Growth arrest-specific protein 8

Overview
NameGrowth arrest-specific protein 8
Smed IDSMED30015955
Length (bp)1605
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Growth arrest-specific protein 8 (SMED30015955) t-SNE clustered cells

Violin plots show distribution of expression levels for Growth arrest-specific protein 8 (SMED30015955) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Growth arrest-specific protein 8 (SMED30015955) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Growth arrest-specific protein 8 (SMED30015955) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30015955

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 16

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
head regionSMED30015955SMESG000013356.1 dd_Smed_v6_2848_0_1dd_Smed_v6PMID:28171748
Stückemann et al., 2017
whole organism asexual adult RNA-sequencing evidence
pharynxSMED30015955SMESG000013356.1 dd_Smed_v6_2848_0dd_Smed_v6PMID:29674432
Plass et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
epidermisSMED30015955SMESG000013356.1 dd_Smed_v4_2848_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
ciliated epithelial cellSMED30015955SMESG000013356.1 dd_Smed_v4_2848_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
head regionSMED30015955SMESG000013356.1 SmedASXL_011362SmedAsxl_ww_GCZZ01PMID:27034770
Currie et al., 2016
whole organism asexual adult RNA-sequencing evidence
nervous systemSMED30015955SMESG000013356.1 dd_Smed_v4_2848_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
pharynxSMED30015955SMESG000013356.1 dd_Smed_v4_2848_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
protonephridiaSMED30015955SMESG000013356.1 dd_Smed_v4_2848_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
epidermisSMED30015955SMESG000013356.1 dd_Smed_v4_2848_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
cephalic gangliaSMED30015955SMESG000013356.1 dd_Smed_v4_2848_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
neuronSMED30015955SMESG000013356.1 dd_Smed_v4_2848_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult colorimetric in situ hybridization evidence
neoblastSMED30015955SMESG000013356.1 dd_Smed_v4_2848_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
cilated neuronSMED30015955SMESG000013356.1 dd_Smed_v4_2848_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
non-ciliated neuronSMED30015955SMESG000013356.1 dd_Smed_v4_2848_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30015955SMESG000013356.1 Contig49522newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30015955SMESG000013356.1 Contig49522uc_Smed_v2PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Growth arrest-specific protein 8 vs. Ensembl Human
Match: GAS8 (growth arrest specific 8 [Source:HGNC Symbol;Acc:HGNC:4166])

HSP 1 Score: 572.392 bits (1474), Expect = 0.000e+0
Identity = 303/464 (65.30%), Postives = 393/464 (84.70%), Query Frame = 3
Query:  147 TPTVIDGIPSEEMTKEQLEDHVVXXXXXXXXXXXXXNYFQLERDKINTFWEITKRQLEERKAEMRNKDREMEESEEKHQTEIKVYKQKVKHLMYGHSQKVSQLQAETIASLKLAEEEHRGEESELKTDNRTLKCDIKEQQLSNEDKIKDLKLSYENNITDIRMDFERQVKEIEVKFMKKMQVQRDEMDLRRKNEIHEIEERKNTQINTLMKNHEKAFSDIKNYYXXXXXXXXXXXXXXKEQMEEMNRKQERTEKSMSEIMTENKRLVEPLRKAQEENNELKRQLTNYEKDKLALKNTKARLKIKEKDYRDLEWEHEVLEQRFSKVEEERNQLYQKFVKAINEVHQKSGLKNVLLERKLNTLTESLEKKEAQLNEVLSASNLDPNALAIVTRKLEDVLDSKNSAIKDLQYELARVCKAHNDQLRTYEAKLAQFGIPSEELGFKPLESTVGNQSLGYGPAGLVSAP 1538
            TP ++DG+  E+M+KEQ+E+HV R+REEL+REREERNYFQLERDKI+TFWEIT+RQLEE+KAE+RNKDREMEE+EE+HQ EIKVYKQKVKHL+Y H   +++++AE    +KLA++EHR +ES L+ D R LK ++KEQ+L++E  +K+L+L +   IT +R DFERQV+EIE K+ KKM++ RDE+DLRRK E+HE+EERKN QI+TLM+ HE+AF+DIKNYYNDITLNNLALIN+LKEQME+M +K++  E+ M+E+  +NKRL +PL+KA+EE +E+++QL NYE+DK  L  TKARLK++EK+ +DL+WEHEVLEQRF+KV++ER++LY+KF  AI EV QK+G KN++LERKL  L+ ++EKKE Q NEVL+ASNLDP AL +V+RKLEDVL+SKNS IKDLQYELA+VCKAHND LRTYEAKL  FGIP + +GFKPLE+ V  Q+LG GPAGLV  P
Sbjct:   15 TP-IVDGLAPEDMSKEQVEEHVSRIREELDREREERNYFQLERDKIHTFWEITRRQLEEKKAELRNKDREMEEAEERHQVEIKVYKQKVKHLLYEHQNNLTEMKAEGTVVMKLAQKEHRIQESVLRKDMRALKVELKEQELASEVVVKNLRLKHTEEITRMRNDFERQVREIEAKYDKKMKMLRDELDLRRKTELHEVEERKNGQIHTLMQRHEEAFTDIKNYYNDITLNNLALINSLKEQMEDMRKKEDHLEREMAEVSGQNKRLADPLQKAREEMSEMQKQLANYERDKQILLCTKARLKVREKELKDLQWEHEVLEQRFTKVQQERDELYRKFTAAIQEVQQKTGFKNLVLERKLQALSAAVEKKEVQFNEVLAASNLDPAALTLVSRKLEDVLESKNSTIKDLQYELAQVCKAHNDLLRTYEAKLLAFGIPLDNVGFKPLETAVIGQTLGQGPAGLVGTP 477          
BLAST of Growth arrest-specific protein 8 vs. Ensembl Human
Match: GAS8 (growth arrest specific 8 [Source:HGNC Symbol;Acc:HGNC:4166])

HSP 1 Score: 561.607 bits (1446), Expect = 0.000e+0
Identity = 298/452 (65.93%), Postives = 384/452 (84.96%), Query Frame = 3
Query:  183 MTKEQLEDHVVXXXXXXXXXXXXXNYFQLERDKINTFWEITKRQLEERKAEMRNKDREMEESEEKHQTEIKVYKQKVKHLMYGHSQKVSQLQAETIASLKLAEEEHRGEESELKTDNRTLKCDIKEQQLSNEDKIKDLKLSYENNITDIRMDFERQVKEIEVKFMKKMQVQRDEMDLRRKNEIHEIEERKNTQINTLMKNHEKAFSDIKNYYXXXXXXXXXXXXXXKEQMEEMNRKQERTEKSMSEIMTENKRLVEPLRKAQEENNELKRQLTNYEKDKLALKNTKARLKIKEKDYRDLEWEHEVLEQRFSKVEEERNQLYQKFVKAINEVHQKSGLKNVLLERKLNTLTESLEKKEAQLNEVLSASNLDPNALAIVTRKLEDVLDSKNSAIKDLQYELARVCKAHNDQLRTYEAKLAQFGIPSEELGFKPLESTVGNQSLGYGPAGLVSAP 1538
            M+KEQ+E+HV R+REEL+REREERNYFQLERDKI+TFWEIT+RQLEE+KAE+RNKDREMEE+EE+HQ EIKVYKQKVKHL+Y H   +++++AE    +KLA++EHR +ES L+ D R LK ++KEQ+L++E  +K+L+L +   IT +R DFERQV+EIE K+ KKM++ RDE+DLRRK E+HE+EERKN QI+TLM+ HE+AF+DIKNYYNDITLNNLALIN+LKEQME+M +K++  E+ M+E+  +NKRL +PL+KA+EE +E+++QL NYE+DK  L  TKARLK++EK+ +DL+WEHEVLEQRF+KV++ER++LY+KF  AI EV QK+G KN++LERKL  L+ ++EKKE Q NEVL+ASNLDP AL +V+RKLEDVL+SKNS IKDLQYELA+VCKAHND LRTYEAKL  FGIP + +GFKPLE+ V  Q+LG GPAGLV  P
Sbjct:    1 MSKEQVEEHVSRIREELDREREERNYFQLERDKIHTFWEITRRQLEEKKAELRNKDREMEEAEERHQVEIKVYKQKVKHLLYEHQNNLTEMKAEGTVVMKLAQKEHRIQESVLRKDMRALKVELKEQELASEVVVKNLRLKHTEEITRMRNDFERQVREIEAKYDKKMKMLRDELDLRRKTELHEVEERKNGQIHTLMQRHEEAFTDIKNYYNDITLNNLALINSLKEQMEDMRKKEDHLEREMAEVSGQNKRLADPLQKAREEMSEMQKQLANYERDKQILLCTKARLKVREKELKDLQWEHEVLEQRFTKVQQERDELYRKFTAAIQEVQQKTGFKNLVLERKLQALSAAVEKKEVQFNEVLAASNLDPAALTLVSRKLEDVLESKNSTIKDLQYELAQVCKAHNDLLRTYEAKLLAFGIPLDNVGFKPLETAVIGQTLGQGPAGLVGTP 452          
BLAST of Growth arrest-specific protein 8 vs. Ensembl Human
Match: GAS8 (growth arrest specific 8 [Source:HGNC Symbol;Acc:HGNC:4166])

HSP 1 Score: 487.649 bits (1254), Expect = 4.885e-170
Identity = 250/394 (63.45%), Postives = 327/394 (82.99%), Query Frame = 3
Query:  357 MEESEEKHQTEIKVYKQKVKHLMYGHSQKVSQLQAETIASLKLAEEEHRGEESELKTDNRTLKCDIKEQQLSNEDKIKDLKLSYENNITDIRMDFERQVKEIEVKFMKKMQVQRDEMDLRRKNEIHEIEERKNTQINTLMKNHEKAFSDIKNYYXXXXXXXXXXXXXXKEQMEEMNRKQERTEKSMSEIMTENKRLVEPLRKAQEENNELKRQLTNYEKDKLALKNTKARLKIKEKDYRDLEWEHEVLEQRFSKVEEERNQLYQKFVKAINEVHQKSGLKNVLLERKLNTLTESLEKKEAQLNEVLSASNLDPNALAIVTRKLEDVLDSKNSAIKDLQYELARVCKAHNDQLRTYEAKLAQFGIPSEELGFKPLESTVGNQSLGYGPAGLVSAP 1538
            MEE+EE+HQ EIKVYKQKVKHL+Y H   +++++AE    +KLA++EHR +ES L+ D R LK ++KEQ+L++E  +K+L+L +   IT +R DFERQV+EIE K+ KKM++ RDE+DLRRK E+HE+EERKN QI+TLM+ HE+AF+DIKNYYNDITLNNLALIN+LKEQME+M +K++  E+ M+E+  +NKRL +PL+KA+EE +E+++QL NYE+DK  L  TKARLK++EK+ +DL+WEHEVLEQRF+KV++ER++LY+KF  AI EV QK+G KN++LERKL  L+ ++EKKE Q NEVL+ASNLDP AL +V+RKLEDVL+SKNS IKDLQYELA+VCKAHND LRTYEAKL  FGIP + +GFKPLE+ V  Q+LG GPAGLV  P
Sbjct:    1 MEEAEERHQVEIKVYKQKVKHLLYEHQNNLTEMKAEGTVVMKLAQKEHRIQESVLRKDMRALKVELKEQELASEVVVKNLRLKHTEEITRMRNDFERQVREIEAKYDKKMKMLRDELDLRRKTELHEVEERKNGQIHTLMQRHEEAFTDIKNYYNDITLNNLALINSLKEQMEDMRKKEDHLEREMAEVSGQNKRLADPLQKAREEMSEMQKQLANYERDKQILLCTKARLKVREKELKDLQWEHEVLEQRFTKVQQERDELYRKFTAAIQEVQQKTGFKNLVLERKLQALSAAVEKKEVQFNEVLAASNLDPAALTLVSRKLEDVLESKNSTIKDLQYELAQVCKAHNDLLRTYEAKLLAFGIPLDNVGFKPLETAVIGQTLGQGPAGLVGTP 394          
BLAST of Growth arrest-specific protein 8 vs. Ensembl Human
Match: GAS8 (growth arrest specific 8 [Source:HGNC Symbol;Acc:HGNC:4166])

HSP 1 Score: 124.405 bits (311), Expect = 1.249e-33
Identity = 71/94 (75.53%), Postives = 88/94 (93.62%), Query Frame = 3
Query:  183 MTKEQLEDHVVXXXXXXXXXXXXXNYFQLERDKINTFWEITKRQLEERKAEMRNKDREMEESEEKHQTEIKVYKQKVKHLMYGHSQKVSQLQAE 464
            M+KEQ+E+HV R+REEL+REREERNYFQLERDKI+TFWEIT+RQLEE+KAE+RNKDREMEE+EE+HQ EIKVYKQKVKHL+Y H   +++++AE
Sbjct:    1 MSKEQVEEHVSRIREELDREREERNYFQLERDKIHTFWEITRRQLEEKKAELRNKDREMEEAEERHQVEIKVYKQKVKHLLYEHQNNLTEMKAE 94          
BLAST of Growth arrest-specific protein 8 vs. Ensembl Human
Match: GAS8 (growth arrest specific 8 [Source:HGNC Symbol;Acc:HGNC:4166])

HSP 1 Score: 69.707 bits (169), Expect = 1.363e-14
Identity = 34/60 (56.67%), Postives = 47/60 (78.33%), Query Frame = 3
Query:  357 MEESEEKHQTEIKVYKQKVKHLMYGHSQKVSQLQAETIASLKLAEEEHRGEESELKTDNR 536
            MEE+EE+HQ EIKVYKQKVKHL+Y H   +++++AE    +KLA++EHR +ES L+ D R
Sbjct:    1 MEEAEERHQVEIKVYKQKVKHLLYEHQNNLTEMKAEGTVVMKLAQKEHRIQESVLRKDMR 60          
BLAST of Growth arrest-specific protein 8 vs. Ensembl Fly
Match: Gas8 (gene:FBgn0029667 transcript:FBtr0070589)

HSP 1 Score: 298.516 bits (763), Expect = 3.963e-95
Identity = 193/464 (41.59%), Postives = 302/464 (65.09%), Query Frame = 3
Query:  150 PTVIDGIPSEEMTKEQLEDHVVXXXXXXXXXXXXXNYFQLERDKINTFWEITKRQLEERKAEMRNKDREMEESEEKHQTEIKVYKQKVKHLMYGHSQKVSQLQAETIASLKLAEEEHRGEESELKTDNRTLKCDIKEQQLSNEDKIKDLKLSYENNITDIRMDFERQVKEIEVKFMKKMQVQRDEMDLRRKNEIHEIEERKNTQINTLMKNHEKAFSDIKNYYXXXXXXXXXXXXXXKEQMEEMNRKQERTEKSMSEIMTENKRLVEPLRKAQEENNELKRQLTNYEKDKLALKNTKARLKIKEKDYRDLEWEHEVLEQRFSKVEEERNQLYQKFVKAINEVHQKSGLKNVLLERKLNTLTESLEKKEAQLNEVLSASNLDPN---ALAIVTRKLEDVLDSKNSAIKDLQYELARVCKAHNDQLRTYEAKLAQFGIPSEELGFKPLESTVGNQSLGYGPAGLVS 1532
            P +IDG+ +  MT++QLE   +RL+ E++REREERNYFQLERDKI TFWEIT++QL+E + E++ KD+E+E +++    + K   Q++KHL + +  ++ +++AE +  LKLA+E H  +E+EL+ D R L+  ++E+   +E +++ ++  +   + + R+ FER+ K+ E+   +KM  Q+ ++DL    ++ E+EERKN QI  L  +H+ AF+D+KNYYNDITLNNLALI ++KEQ+E + ++ ER+++  ++   EN+RL EPL  A  + NE +R+L  YE+DK  L   K R    EK  + L WE E L  R   +  ER  L ++F   I E+ QK+GLKNVLLERK+  L    EK+   L+E ++     PN    L  +  ++ +++D KN  I DL+YE+ +  KAH+D L TYE KL Q+G+P++ELGFKP+ +    Q    GPAG+++
Sbjct:   15 PVLIDGVDTSAMTRDQLEAFALRLKAEMDREREERNYFQLERDKIRTFWEITRQQLDETRYELQQKDKEIEATQDLADIDTKHVMQQMKHLQFENHNRLGEVRAEAMTQLKLAQEHHVLQENELQRDKRQLRRMLRERMEMSEMQLRQMEAHFNEKLLEQRITFERERKDNEMLHEEKMIEQKAKLDLFYGTQMFEVEERKNQQIKDLQDHHDLAFNDMKNYYNDITLNNLALIGSMKEQLEHLRKQAERSDRIAADTAAENRRLKEPLEHANIQLNEYRRKLEFYERDKQQLSRLKTRNTRLEKKVKGLTWEAETLILRNDSLVAEREGLKERFNDVIVELQQKTGLKNVLLERKIAALMREDEKRSIVLHETIATCA--PNFAEKLTSLDERVGNIIDEKNKIILDLRYEVTKARKAHDDLLETYECKLKQYGVPTDELGFKPIRNRDQQQLYVCGPAGIIT 476          
BLAST of Growth arrest-specific protein 8 vs. Ensembl Fly
Match: Gas8 (gene:FBgn0029667 transcript:FBtr0344969)

HSP 1 Score: 298.516 bits (763), Expect = 3.963e-95
Identity = 193/464 (41.59%), Postives = 302/464 (65.09%), Query Frame = 3
Query:  150 PTVIDGIPSEEMTKEQLEDHVVXXXXXXXXXXXXXNYFQLERDKINTFWEITKRQLEERKAEMRNKDREMEESEEKHQTEIKVYKQKVKHLMYGHSQKVSQLQAETIASLKLAEEEHRGEESELKTDNRTLKCDIKEQQLSNEDKIKDLKLSYENNITDIRMDFERQVKEIEVKFMKKMQVQRDEMDLRRKNEIHEIEERKNTQINTLMKNHEKAFSDIKNYYXXXXXXXXXXXXXXKEQMEEMNRKQERTEKSMSEIMTENKRLVEPLRKAQEENNELKRQLTNYEKDKLALKNTKARLKIKEKDYRDLEWEHEVLEQRFSKVEEERNQLYQKFVKAINEVHQKSGLKNVLLERKLNTLTESLEKKEAQLNEVLSASNLDPN---ALAIVTRKLEDVLDSKNSAIKDLQYELARVCKAHNDQLRTYEAKLAQFGIPSEELGFKPLESTVGNQSLGYGPAGLVS 1532
            P +IDG+ +  MT++QLE   +RL+ E++REREERNYFQLERDKI TFWEIT++QL+E + E++ KD+E+E +++    + K   Q++KHL + +  ++ +++AE +  LKLA+E H  +E+EL+ D R L+  ++E+   +E +++ ++  +   + + R+ FER+ K+ E+   +KM  Q+ ++DL    ++ E+EERKN QI  L  +H+ AF+D+KNYYNDITLNNLALI ++KEQ+E + ++ ER+++  ++   EN+RL EPL  A  + NE +R+L  YE+DK  L   K R    EK  + L WE E L  R   +  ER  L ++F   I E+ QK+GLKNVLLERK+  L    EK+   L+E ++     PN    L  +  ++ +++D KN  I DL+YE+ +  KAH+D L TYE KL Q+G+P++ELGFKP+ +    Q    GPAG+++
Sbjct:   15 PVLIDGVDTSAMTRDQLEAFALRLKAEMDREREERNYFQLERDKIRTFWEITRQQLDETRYELQQKDKEIEATQDLADIDTKHVMQQMKHLQFENHNRLGEVRAEAMTQLKLAQEHHVLQENELQRDKRQLRRMLRERMEMSEMQLRQMEAHFNEKLLEQRITFERERKDNEMLHEEKMIEQKAKLDLFYGTQMFEVEERKNQQIKDLQDHHDLAFNDMKNYYNDITLNNLALIGSMKEQLEHLRKQAERSDRIAADTAAENRRLKEPLEHANIQLNEYRRKLEFYERDKQQLSRLKTRNTRLEKKVKGLTWEAETLILRNDSLVAEREGLKERFNDVIVELQQKTGLKNVLLERKIAALMREDEKRSIVLHETIATCA--PNFAEKLTSLDERVGNIIDEKNKIILDLRYEVTKARKAHDDLLETYECKLKQYGVPTDELGFKPIRNRDQQQLYVCGPAGIIT 476          
BLAST of Growth arrest-specific protein 8 vs. Ensembl Fly
Match: Gas8 (gene:FBgn0029667 transcript:FBtr0343540)

HSP 1 Score: 284.648 bits (727), Expect = 3.675e-90
Identity = 189/453 (41.72%), Postives = 295/453 (65.12%), Query Frame = 3
Query:  183 MTKEQLEDHVVXXXXXXXXXXXXXNYFQLERDKINTFWEITKRQLEERKAEMRNKDREMEESEEKHQTEIKVYKQKVKHLMYGHSQKVSQLQAETIASLKLAEEEHRGEESELKTDNRTLKCDIKEQQLSNEDKIKDLKLSYENNITDIRMDFERQVKEIEVKFMKKMQVQRDEMDLRRKNEIHEIEERKNTQINTLMKNHEKAFSDIKNYYXXXXXXXXXXXXXXKEQMEEMNRKQERTEKSMSEIMTENKRLVEPLRKAQEENNELKRQLTNYEKDKLALKNTKARLKIKEKDYRDLEWEHEVLEQRFSKVEEERNQLYQKFVKAINEVHQKSGLKNVLLERKLNTLTESLEKKEAQLNEVLSASNLDPN---ALAIVTRKLEDVLDSKNSAIKDLQYELARVCKAHNDQLRTYEAKLAQFGIPSEELGFKPLESTVGNQSLGYGPAGLVS 1532
            MT++QLE   +RL+ E++REREERNYFQLERDKI TFWEIT++QL+E + E++ KD+E+E +++    + K   Q++KHL + +  ++ +++AE +  LKLA+E H  +E+EL+ D R L+  ++E+   +E +++ ++  +   + + R+ FER+ K+ E+   +KM  Q+ ++DL    ++ E+EERKN QI  L  +H+ AF+D+KNYYNDITLNNLALI ++KEQ+E + ++ ER+++  ++   EN+RL EPL  A  + NE +R+L  YE+DK  L   K R    EK  + L WE E L  R   +  ER  L ++F   I E+ QK+GLKNVLLERK+  L    EK+   L+E ++     PN    L  +  ++ +++D KN  I DL+YE+ +  KAH+D L TYE KL Q+G+P++ELGFKP+ +    Q    GPAG+++
Sbjct:    1 MTRDQLEAFALRLKAEMDREREERNYFQLERDKIRTFWEITRQQLDETRYELQQKDKEIEATQDLADIDTKHVMQQMKHLQFENHNRLGEVRAEAMTQLKLAQEHHVLQENELQRDKRQLRRMLRERMEMSEMQLRQMEAHFNEKLLEQRITFERERKDNEMLHEEKMIEQKAKLDLFYGTQMFEVEERKNQQIKDLQDHHDLAFNDMKNYYNDITLNNLALIGSMKEQLEHLRKQAERSDRIAADTAAENRRLKEPLEHANIQLNEYRRKLEFYERDKQQLSRLKTRNTRLEKKVKGLTWEAETLILRNDSLVAEREGLKERFNDVIVELQQKTGLKNVLLERKIAALMREDEKRSIVLHETIATCA--PNFAEKLTSLDERVGNIIDEKNKIILDLRYEVTKARKAHDDLLETYECKLKQYGVPTDELGFKPIRNRDQQQLYVCGPAGIIT 451          
BLAST of Growth arrest-specific protein 8 vs. Ensembl Zebrafish
Match: gas8 (growth arrest-specific 8 [Source:NCBI gene;Acc:323260])

HSP 1 Score: 491.115 bits (1263), Expect = 2.461e-170
Identity = 286/464 (61.64%), Postives = 370/464 (79.74%), Query Frame = 3
Query:  144 RTPTVIDGIPSEEMTKEQLEDHVVXXXXXXXXXXXXXNYFQLERDKINTFWEITKRQLEERKAEMRNKDREMEESEEKHQTEIKVYKQKVKHLMYGHSQKVSQLQAETIASLKLAEEEHRGEESELKTDNRTLKCDIKEQQLSNEDKIKDLKLSYENNITDIRMDFERQVKEIEVKFMKKMQVQRDEMDLRRKNEIHEIEERKNTQINTLMKNHEKAFSDIKNYYXXXXXXXXXXXXXXKEQMEEMNRKQERTEKSMSEIMTENKRLVEPLRKAQEENNELKRQLTNYEKDKLALKNTKARLKIKEKDYRDLEWEHEVLEQRFSKVEEERNQLYQKFVKAINEVHQKSGLKNVLLERKLNTLTESLEKKEAQLNEVLSASNLDPNALAIVTRKLEDVLDSKNSAIKDLQYELARVCKAHNDQLRTYEAKLAQFGIPSEELGFKPLESTVGNQSLGYGPAGLVSA 1535
            +TPTV+DG+ +EEM+KEQLE+H++RLREEL+REREERNYFQLERDKI+TFWEIT+R LEE K E+RN++RE+EE EE+HQ EIKVYKQKVKHL+Y     +S+L+AE+I S KL ++EH   E E   D R+LK ++K+Q+LS+E+ +K + L ++   TD+R DF RQV+EI  K+ K+MQ  R E +LRRK EIHEIEERKNT IN LMKNHEKAF DI+NY++DI   NL LI +LKE+++EM + +E+  K M+E++ +NK L E  +KA+E+  EL++QL NYEKDK  L  ++ARLK+ +++ ++L+WE EVLEQRFSKV+ ER++LY KF KAI EV QKSG KN+LLE KLNTL ++LEKKEAQL+EVLSASNLDP  L++VT KLE+VL+SKN  IKDLQYE+ARVCKAHND L+T EAKL  FGIP EEL F+PL+S    QS+G GPA  VS+
Sbjct:   12 KTPTVVDGLSTEEMSKEQLEEHIMRLREELDREREERNYFQLERDKIHTFWEITRRHLEENKCELRNRERELEEVEERHQVEIKVYKQKVKHLLYEQQNMLSELKAESIISTKLLQDEHADLEKEQWKDMRSLKLELKQQELSSENVLKRIHLKHDEETTDLRNDFARQVQEIGSKYEKRMQKLRQEEELRRKTEIHEIEERKNTHINMLMKNHEKAFRDIRNYFSDIVYKNLDLITSLKEELKEMKKNEEKRNKEMAEVLEQNKELKESSQKAKEQVAELQKQLANYEKDKSILTRSRARLKMSDREMKELKWELEVLEQRFSKVQLERDELYMKFTKAILEVQQKSGFKNLLLECKLNTLNDTLEKKEAQLSEVLSASNLDPTTLSVVTHKLEEVLESKNHTIKDLQYEVARVCKAHNDLLKTSEAKLRAFGIPVEELCFEPLKS--NGQSVGQGPAMFVSS 473          
BLAST of Growth arrest-specific protein 8 vs. Ensembl Xenopus
Match: gas8 (growth arrest specific 8 [Source:NCBI gene;Acc:100127615])

HSP 1 Score: 592.038 bits (1525), Expect = 0.000e+0
Identity = 329/462 (71.21%), Postives = 392/462 (84.85%), Query Frame = 3
Query:  153 TVIDGIPSEEMTKEQLEDHVVXXXXXXXXXXXXXNYFQLERDKINTFWEITKRQLEERKAEMRNKDREMEESEEKHQTEIKVYKQKVKHLMYGHSQKVSQLQAETIASLKLAEEEHRGEESELKTDNRTLKCDIKEQQLSNEDKIKDLKLSYENNITDIRMDFERQVKEIEVKFMKKMQVQRDEMDLRRKNEIHEIEERKNTQINTLMKNHEKAFSDIKNYYXXXXXXXXXXXXXXKEQMEEMNRKQERTEKSMSEIMTENKRLVEPLRKAQEENNELKRQLTNYEKDKLALKNTKARLKIKEKDYRDLEWEHEVLEQRFSKVEEERNQLYQKFVKAINEVHQKSGLKNVLLERKLNTLTESLEKKEAQLNEVLSASNLDPNALAIVTRKLEDVLDSKNSAIKDLQYELARVCKAHNDQLRTYEAKLAQFGIPSEELGFKPLESTVGNQSLGYGPAGLVSAP 1538
             V+DGI +EEM+KE+LE+H+VRLREEL+REREERNYFQLERDKI+TFWEIT+RQLEE+K E+RNKDREMEE+EE+HQ EIKVYKQKVKHL+Y H   +S+L+AE   S+KLA+ EH  +ES L+ D R LK +IKEQ+L+NE  +K+LK+  +   T +R DFERQV+EIE K+ KKM++ RDE++LRRK EIHEIEERKN QINTLM+NHEKAFSDIKNYYNDITLNNLALIN+LKEQMEEM +K++R EK M+++  +N+RL EPL+KA+EE  EL RQL NYEKDK AL NTKARLK  EK+  DL+WEHEVLEQRF KV+ ER++LY+KF  AI+EV QKSG KN+LLERKL  L ++LEKKEAQLNEVL+ASNLDP ALA+VTRKLEDVLDSKN AIKDLQYELARVCKAHND L TYEAK+  FGIP++ELGFKPLE  V  Q+ G GPAGLVSAP
Sbjct:   22 AVVDGIATEEMSKEELEEHIVRLREELDREREERNYFQLERDKIHTFWEITRRQLEEKKCELRNKDREMEEAEERHQVEIKVYKQKVKHLLYEHQNNISELKAEGSVSMKLAQTEHHTQESLLRKDMRGLKVEIKEQELANEMVVKNLKMKQDEETTRLRNDFERQVREIEAKYEKKMRILRDELELRRKTEIHEIEERKNGQINTLMRNHEKAFSDIKNYYNDITLNNLALINSLKEQMEEMKKKEDRMEKEMADLQLQNRRLTEPLQKAREEVTELNRQLANYEKDKTALANTKARLKATEKELNDLKWEHEVLEQRFQKVQMERDELYKKFTAAIHEVQQKSGFKNLLLERKLQALGDALEKKEAQLNEVLAASNLDPTALAVVTRKLEDVLDSKNGAIKDLQYELARVCKAHNDLLGTYEAKMRAFGIPADELGFKPLECLVPGQNFGQGPAGLVSAP 483          
BLAST of Growth arrest-specific protein 8 vs. Ensembl Xenopus
Match: gas8 (growth arrest specific 8 [Source:NCBI gene;Acc:100127615])

HSP 1 Score: 591.652 bits (1524), Expect = 0.000e+0
Identity = 329/462 (71.21%), Postives = 392/462 (84.85%), Query Frame = 3
Query:  153 TVIDGIPSEEMTKEQLEDHVVXXXXXXXXXXXXXNYFQLERDKINTFWEITKRQLEERKAEMRNKDREMEESEEKHQTEIKVYKQKVKHLMYGHSQKVSQLQAETIASLKLAEEEHRGEESELKTDNRTLKCDIKEQQLSNEDKIKDLKLSYENNITDIRMDFERQVKEIEVKFMKKMQVQRDEMDLRRKNEIHEIEERKNTQINTLMKNHEKAFSDIKNYYXXXXXXXXXXXXXXKEQMEEMNRKQERTEKSMSEIMTENKRLVEPLRKAQEENNELKRQLTNYEKDKLALKNTKARLKIKEKDYRDLEWEHEVLEQRFSKVEEERNQLYQKFVKAINEVHQKSGLKNVLLERKLNTLTESLEKKEAQLNEVLSASNLDPNALAIVTRKLEDVLDSKNSAIKDLQYELARVCKAHNDQLRTYEAKLAQFGIPSEELGFKPLESTVGNQSLGYGPAGLVSAP 1538
             V+DGI +EEM+KE+LE+H+VRLREEL+REREERNYFQLERDKI+TFWEIT+RQLEE+K E+RNKDREMEE+EE+HQ EIKVYKQKVKHL+Y H   +S+L+AE   S+KLA+ EH  +ES L+ D R LK +IKEQ+L+NE  +K+LK+  +   T +R DFERQV+EIE K+ KKM++ RDE++LRRK EIHEIEERKN QINTLM+NHEKAFSDIKNYYNDITLNNLALIN+LKEQMEEM +K++R EK M+++  +N+RL EPL+KA+EE  EL RQL NYEKDK AL NTKARLK  EK+  DL+WEHEVLEQRF KV+ ER++LY+KF  AI+EV QKSG KN+LLERKL  L ++LEKKEAQLNEVL+ASNLDP ALA+VTRKLEDVLDSKN AIKDLQYELARVCKAHND L TYEAK+  FGIP++ELGFKPLE  V  Q+ G GPAGLVSAP
Sbjct:   22 AVVDGIATEEMSKEELEEHIVRLREELDREREERNYFQLERDKIHTFWEITRRQLEEKKCELRNKDREMEEAEERHQVEIKVYKQKVKHLLYEHQNNISELKAEGSVSMKLAQTEHHTQESLLRKDMRGLKVEIKEQELANEMVVKNLKMKQDEETTRLRNDFERQVREIEAKYEKKMRILRDELELRRKTEIHEIEERKNGQINTLMRNHEKAFSDIKNYYNDITLNNLALINSLKEQMEEMKKKEDRMEKEMADLQLQNRRLTEPLQKAREEVTELNRQLANYEKDKTALANTKARLKATEKELNDLKWEHEVLEQRFQKVQMERDELYKKFTAAIHEVQQKSGFKNLLLERKLQALGDALEKKEAQLNEVLAASNLDPTALAVVTRKLEDVLDSKNGAIKDLQYELARVCKAHNDLLGTYEAKMRAFGIPADELGFKPLECLVPGQNFGQGPAGLVSAP 483          
BLAST of Growth arrest-specific protein 8 vs. Ensembl Xenopus
Match: gas8 (growth arrest specific 8 [Source:NCBI gene;Acc:100127615])

HSP 1 Score: 591.652 bits (1524), Expect = 0.000e+0
Identity = 329/462 (71.21%), Postives = 392/462 (84.85%), Query Frame = 3
Query:  153 TVIDGIPSEEMTKEQLEDHVVXXXXXXXXXXXXXNYFQLERDKINTFWEITKRQLEERKAEMRNKDREMEESEEKHQTEIKVYKQKVKHLMYGHSQKVSQLQAETIASLKLAEEEHRGEESELKTDNRTLKCDIKEQQLSNEDKIKDLKLSYENNITDIRMDFERQVKEIEVKFMKKMQVQRDEMDLRRKNEIHEIEERKNTQINTLMKNHEKAFSDIKNYYXXXXXXXXXXXXXXKEQMEEMNRKQERTEKSMSEIMTENKRLVEPLRKAQEENNELKRQLTNYEKDKLALKNTKARLKIKEKDYRDLEWEHEVLEQRFSKVEEERNQLYQKFVKAINEVHQKSGLKNVLLERKLNTLTESLEKKEAQLNEVLSASNLDPNALAIVTRKLEDVLDSKNSAIKDLQYELARVCKAHNDQLRTYEAKLAQFGIPSEELGFKPLESTVGNQSLGYGPAGLVSAP 1538
             V+DGI +EEM+KE+LE+H+VRLREEL+REREERNYFQLERDKI+TFWEIT+RQLEE+K E+RNKDREMEE+EE+HQ EIKVYKQKVKHL+Y H   +S+L+AE   S+KLA+ EH  +ES L+ D R LK +IKEQ+L+NE  +K+LK+  +   T +R DFERQV+EIE K+ KKM++ RDE++LRRK EIHEIEERKN QINTLM+NHEKAFSDIKNYYNDITLNNLALIN+LKEQMEEM +K++R EK M+++  +N+RL EPL+KA+EE  EL RQL NYEKDK AL NTKARLK  EK+  DL+WEHEVLEQRF KV+ ER++LY+KF  AI+EV QKSG KN+LLERKL  L ++LEKKEAQLNEVL+ASNLDP ALA+VTRKLEDVLDSKN AIKDLQYELARVCKAHND L TYEAK+  FGIP++ELGFKPLE  V  Q+ G GPAGLVSAP
Sbjct:   22 AVVDGIATEEMSKEELEEHIVRLREELDREREERNYFQLERDKIHTFWEITRRQLEEKKCELRNKDREMEEAEERHQVEIKVYKQKVKHLLYEHQNNISELKAEGSVSMKLAQTEHHTQESLLRKDMRGLKVEIKEQELANEMVVKNLKMKQDEETTRLRNDFERQVREIEAKYEKKMRILRDELELRRKTEIHEIEERKNGQINTLMRNHEKAFSDIKNYYNDITLNNLALINSLKEQMEEMKKKEDRMEKEMADLQLQNRRLTEPLQKAREEVTELNRQLANYEKDKTALANTKARLKATEKELNDLKWEHEVLEQRFQKVQMERDELYKKFTAAIHEVQQKSGFKNLLLERKLQALGDALEKKEAQLNEVLAASNLDPTALAVVTRKLEDVLDSKNGAIKDLQYELARVCKAHNDLLGTYEAKMRAFGIPADELGFKPLECLVPGQNFGQGPAGLVSAP 483          
BLAST of Growth arrest-specific protein 8 vs. Ensembl Xenopus
Match: gas8 (growth arrest specific 8 [Source:NCBI gene;Acc:100127615])

HSP 1 Score: 511.916 bits (1317), Expect = 2.685e-178
Identity = 295/415 (71.08%), Postives = 354/415 (85.30%), Query Frame = 3
Query:  153 TVIDGIPSEEMTKEQLEDHVVXXXXXXXXXXXXXNYFQLERDKINTFWEITKRQLEERKAEMRNKDREMEESEEKHQTEIKVYKQKVKHLMYGHSQKVSQLQAETIASLKLAEEEHRGEESELKTDNRTLKCDIKEQQLSNEDKIKDLKLSYENNITDIRMDFERQVKEIEVKFMKKMQVQRDEMDLRRKNEIHEIEERKNTQINTLMKNHEKAFSDIKNYYXXXXXXXXXXXXXXKEQMEEMNRKQERTEKSMSEIMTENKRLVEPLRKAQEENNELKRQLTNYEKDKLALKNTKARLKIKEKDYRDLEWEHEVLEQRFSKVEEERNQLYQKFVKAINEVHQKSGLKNVLLERKLNTLTESLEKKEAQLNEVLSASNLDPNALAIVTRKLEDVLDSKNSAIKDLQYELARVCKA 1397
             V+DGI +EEM+KE+LE+H+VRLREEL+REREERNYFQLERDKI+TFWEIT+RQLEE+K E+RNKDREMEE+EE+HQ EIKVYKQKVKHL+Y H   +S+L+AE   S+KLA+ EH  +ES L+ D R LK +IKEQ+L+NE  +K+LK+  +   T +R DFERQV+EIE K+ KKM++ RDE++LRRK EIHEIEERKN QINTLM+NHEKAFSDIKNYYNDITLNNLALIN+LKEQMEEM +K++R EK M+++  +N+RL EPL+KA+EE  EL RQL NYEKDK AL NTKARLK  EK+  DL+WEHEVLEQRF KV+ ER++LY+KF  AI+EV QKSG KN+LLERKL  L ++LEKKEAQLNEVL+ASNLDP ALA+VTRKLEDVLDSKN AIKDLQYELARVCK 
Sbjct:   22 AVVDGIATEEMSKEELEEHIVRLREELDREREERNYFQLERDKIHTFWEITRRQLEEKKCELRNKDREMEEAEERHQVEIKVYKQKVKHLLYEHQNNISELKAEGSVSMKLAQTEHHTQESLLRKDMRGLKVEIKEQELANEMVVKNLKMKQDEETTRLRNDFERQVREIEAKYEKKMRILRDELELRRKTEIHEIEERKNGQINTLMRNHEKAFSDIKNYYNDITLNNLALINSLKEQMEEMKKKEDRMEKEMADLQLQNRRLTEPLQKAREEVTELNRQLANYEKDKTALANTKARLKATEKELNDLKWEHEVLEQRFQKVQMERDELYKKFTAAIHEVQQKSGFKNLLLERKLQALGDALEKKEAQLNEVLAASNLDPTALAVVTRKLEDVLDSKNGAIKDLQYELARVCKV 436          
BLAST of Growth arrest-specific protein 8 vs. Ensembl Mouse
Match: Gas8 (growth arrest specific 8 [Source:MGI Symbol;Acc:MGI:1202386])

HSP 1 Score: 570.081 bits (1468), Expect = 0.000e+0
Identity = 302/462 (65.37%), Postives = 385/462 (83.33%), Query Frame = 3
Query:  153 TVIDGIPSEEMTKEQLEDHVVXXXXXXXXXXXXXNYFQLERDKINTFWEITKRQLEERKAEMRNKDREMEESEEKHQTEIKVYKQKVKHLMYGHSQKVSQLQAETIASLKLAEEEHRGEESELKTDNRTLKCDIKEQQLSNEDKIKDLKLSYENNITDIRMDFERQVKEIEVKFMKKMQVQRDEMDLRRKNEIHEIEERKNTQINTLMKNHEKAFSDIKNYYXXXXXXXXXXXXXXKEQMEEMNRKQERTEKSMSEIMTENKRLVEPLRKAQEENNELKRQLTNYEKDKLALKNTKARLKIKEKDYRDLEWEHEVLEQRFSKVEEERNQLYQKFVKAINEVHQKSGLKNVLLERKLNTLTESLEKKEAQLNEVLSASNLDPNALAIVTRKLEDVLDSKNSAIKDLQYELARVCKAHNDQLRTYEAKLAQFGIPSEELGFKPLESTVGNQSLGYGPAGLVSAP 1538
             ++DG+  E+MTKEQ+E+HV R+REEL+REREERNYFQLERDKI+TFWEIT+RQLEE+KAE+RNKDREMEE+EE+HQ EIKVYKQKVKHL+Y H   +++++AE    +KLA++EHR +E  L+ D R LK ++KEQ+L+NE  IK+L L     IT +R DFERQV+EIE K+ KKM++ RDE+DLRRK EIHE+EERKN QI+TLM+ HE+AF+DIKNYYNDITLNNLALIN+LKEQME+M +K+E  E+ M+E+  +N+RL +PL+KA++E NE++++L N+E+DK  L  TKARLK+ E++ +DL+WEHEVLEQRF KV++ER +LY+KF  AI EV QK+G KN+LLERKL  L  ++EK+E Q NEVL+ASNLDP AL +V+RKLEDVL+SKN+ IKDLQYELARVCKAHND LRTYEAKL  FGIP + +GFKPLE+ V  Q+LG GPAGLV AP
Sbjct:   16 AIVDGVAPEDMTKEQVEEHVARIREELDREREERNYFQLERDKIHTFWEITRRQLEEKKAELRNKDREMEEAEERHQVEIKVYKQKVKHLLYEHQNNLAEVKAEGTVVMKLAQKEHRTQEGALRKDMRVLKVELKEQELANEVVIKNLCLKQAEEITKMRNDFERQVREIEAKYDKKMKMLRDELDLRRKTEIHEVEERKNGQISTLMQRHEEAFTDIKNYYNDITLNNLALINSLKEQMEDMRKKEEHMEREMAEVTLQNRRLADPLQKAKDEMNEMQKRLGNHERDKQILVCTKARLKVAERELKDLKWEHEVLEQRFIKVQQEREELYRKFADAIQEVQQKTGFKNLLLERKLQALNAAVEKREVQFNEVLAASNLDPTALTLVSRKLEDVLESKNTTIKDLQYELARVCKAHNDLLRTYEAKLLAFGIPLDNVGFKPLETAVIGQTLGQGPAGLVGAP 477          
BLAST of Growth arrest-specific protein 8 vs. Ensembl Mouse
Match: Gas8 (growth arrest specific 8 [Source:MGI Symbol;Acc:MGI:1202386])

HSP 1 Score: 489.96 bits (1260), Expect = 6.017e-170
Identity = 268/415 (64.58%), Postives = 347/415 (83.61%), Query Frame = 3
Query:  153 TVIDGIPSEEMTKEQLEDHVVXXXXXXXXXXXXXNYFQLERDKINTFWEITKRQLEERKAEMRNKDREMEESEEKHQTEIKVYKQKVKHLMYGHSQKVSQLQAETIASLKLAEEEHRGEESELKTDNRTLKCDIKEQQLSNEDKIKDLKLSYENNITDIRMDFERQVKEIEVKFMKKMQVQRDEMDLRRKNEIHEIEERKNTQINTLMKNHEKAFSDIKNYYXXXXXXXXXXXXXXKEQMEEMNRKQERTEKSMSEIMTENKRLVEPLRKAQEENNELKRQLTNYEKDKLALKNTKARLKIKEKDYRDLEWEHEVLEQRFSKVEEERNQLYQKFVKAINEVHQKSGLKNVLLERKLNTLTESLEKKEAQLNEVLSASNLDPNALAIVTRKLEDVLDSKNSAIKDLQYELARVCKA 1397
             ++DG+  E+MTKEQ+E+HV R+REEL+REREERNYFQLERDKI+TFWEIT+RQLEE+KAE+RNKDREMEE+EE+HQ EIKVYKQKVKHL+Y H   +++++AE    +KLA++EHR +E  L+ D R LK ++KEQ+L+NE  IK+L L     IT +R DFERQV+EIE K+ KKM++ RDE+DLRRK EIHE+EERKN QI+TLM+ HE+AF+DIKNYYNDITLNNLALIN+LKEQME+M +K+E  E+ M+E+  +N+RL +PL+KA++E NE++++L N+E+DK  L  TKARLK+ E++ +DL+WEHEVLEQRF KV++ER +LY+KF  AI EV QK+G KN+LLERKL  L  ++EK+E Q NEVL+ASNLDP AL +V+RKLEDVL+SKN+ IKDLQYELARVCK 
Sbjct:   16 AIVDGVAPEDMTKEQVEEHVARIREELDREREERNYFQLERDKIHTFWEITRRQLEEKKAELRNKDREMEEAEERHQVEIKVYKQKVKHLLYEHQNNLAEVKAEGTVVMKLAQKEHRTQEGALRKDMRVLKVELKEQELANEVVIKNLCLKQAEEITKMRNDFERQVREIEAKYDKKMKMLRDELDLRRKTEIHEVEERKNGQISTLMQRHEEAFTDIKNYYNDITLNNLALINSLKEQMEDMRKKEEHMEREMAEVTLQNRRLADPLQKAKDEMNEMQKRLGNHERDKQILVCTKARLKVAERELKDLKWEHEVLEQRFIKVQQEREELYRKFADAIQEVQQKTGFKNLLLERKLQALNAAVEKREVQFNEVLAASNLDPTALTLVSRKLEDVLESKNTTIKDLQYELARVCKV 430          
BLAST of Growth arrest-specific protein 8 vs. UniProt/SwissProt
Match: sp|O95995|DRC4_HUMAN (Dynein regulatory complex subunit 4 OS=Homo sapiens OX=9606 GN=GAS8 PE=1 SV=1)

HSP 1 Score: 572.392 bits (1474), Expect = 0.000e+0
Identity = 303/464 (65.30%), Postives = 393/464 (84.70%), Query Frame = 3
Query:  147 TPTVIDGIPSEEMTKEQLEDHVVXXXXXXXXXXXXXNYFQLERDKINTFWEITKRQLEERKAEMRNKDREMEESEEKHQTEIKVYKQKVKHLMYGHSQKVSQLQAETIASLKLAEEEHRGEESELKTDNRTLKCDIKEQQLSNEDKIKDLKLSYENNITDIRMDFERQVKEIEVKFMKKMQVQRDEMDLRRKNEIHEIEERKNTQINTLMKNHEKAFSDIKNYYXXXXXXXXXXXXXXKEQMEEMNRKQERTEKSMSEIMTENKRLVEPLRKAQEENNELKRQLTNYEKDKLALKNTKARLKIKEKDYRDLEWEHEVLEQRFSKVEEERNQLYQKFVKAINEVHQKSGLKNVLLERKLNTLTESLEKKEAQLNEVLSASNLDPNALAIVTRKLEDVLDSKNSAIKDLQYELARVCKAHNDQLRTYEAKLAQFGIPSEELGFKPLESTVGNQSLGYGPAGLVSAP 1538
            TP ++DG+  E+M+KEQ+E+HV R+REEL+REREERNYFQLERDKI+TFWEIT+RQLEE+KAE+RNKDREMEE+EE+HQ EIKVYKQKVKHL+Y H   +++++AE    +KLA++EHR +ES L+ D R LK ++KEQ+L++E  +K+L+L +   IT +R DFERQV+EIE K+ KKM++ RDE+DLRRK E+HE+EERKN QI+TLM+ HE+AF+DIKNYYNDITLNNLALIN+LKEQME+M +K++  E+ M+E+  +NKRL +PL+KA+EE +E+++QL NYE+DK  L  TKARLK++EK+ +DL+WEHEVLEQRF+KV++ER++LY+KF  AI EV QK+G KN++LERKL  L+ ++EKKE Q NEVL+ASNLDP AL +V+RKLEDVL+SKNS IKDLQYELA+VCKAHND LRTYEAKL  FGIP + +GFKPLE+ V  Q+LG GPAGLV  P
Sbjct:   15 TP-IVDGLAPEDMSKEQVEEHVSRIREELDREREERNYFQLERDKIHTFWEITRRQLEEKKAELRNKDREMEEAEERHQVEIKVYKQKVKHLLYEHQNNLTEMKAEGTVVMKLAQKEHRIQESVLRKDMRALKVELKEQELASEVVVKNLRLKHTEEITRMRNDFERQVREIEAKYDKKMKMLRDELDLRRKTELHEVEERKNGQIHTLMQRHEEAFTDIKNYYNDITLNNLALINSLKEQMEDMRKKEDHLEREMAEVSGQNKRLADPLQKAREEMSEMQKQLANYERDKQILLCTKARLKVREKELKDLQWEHEVLEQRFTKVQQERDELYRKFTAAIQEVQQKTGFKNLVLERKLQALSAAVEKKEVQFNEVLAASNLDPAALTLVSRKLEDVLESKNSTIKDLQYELAQVCKAHNDLLRTYEAKLLAFGIPLDNVGFKPLETAVIGQTLGQGPAGLVGTP 477          
BLAST of Growth arrest-specific protein 8 vs. UniProt/SwissProt
Match: sp|Q60779|DRC4_MOUSE (Dynein regulatory complex subunit 4 OS=Mus musculus OX=10090 GN=Gas8 PE=1 SV=2)

HSP 1 Score: 570.081 bits (1468), Expect = 0.000e+0
Identity = 302/462 (65.37%), Postives = 385/462 (83.33%), Query Frame = 3
Query:  153 TVIDGIPSEEMTKEQLEDHVVXXXXXXXXXXXXXNYFQLERDKINTFWEITKRQLEERKAEMRNKDREMEESEEKHQTEIKVYKQKVKHLMYGHSQKVSQLQAETIASLKLAEEEHRGEESELKTDNRTLKCDIKEQQLSNEDKIKDLKLSYENNITDIRMDFERQVKEIEVKFMKKMQVQRDEMDLRRKNEIHEIEERKNTQINTLMKNHEKAFSDIKNYYXXXXXXXXXXXXXXKEQMEEMNRKQERTEKSMSEIMTENKRLVEPLRKAQEENNELKRQLTNYEKDKLALKNTKARLKIKEKDYRDLEWEHEVLEQRFSKVEEERNQLYQKFVKAINEVHQKSGLKNVLLERKLNTLTESLEKKEAQLNEVLSASNLDPNALAIVTRKLEDVLDSKNSAIKDLQYELARVCKAHNDQLRTYEAKLAQFGIPSEELGFKPLESTVGNQSLGYGPAGLVSAP 1538
             ++DG+  E+MTKEQ+E+HV R+REEL+REREERNYFQLERDKI+TFWEIT+RQLEE+KAE+RNKDREMEE+EE+HQ EIKVYKQKVKHL+Y H   +++++AE    +KLA++EHR +E  L+ D R LK ++KEQ+L+NE  IK+L L     IT +R DFERQV+EIE K+ KKM++ RDE+DLRRK EIHE+EERKN QI+TLM+ HE+AF+DIKNYYNDITLNNLALIN+LKEQME+M +K+E  E+ M+E+  +N+RL +PL+KA++E NE++++L N+E+DK  L  TKARLK+ E++ +DL+WEHEVLEQRF KV++ER +LY+KF  AI EV QK+G KN+LLERKL  L  ++EK+E Q NEVL+ASNLDP AL +V+RKLEDVL+SKN+ IKDLQYELARVCKAHND LRTYEAKL  FGIP + +GFKPLE+ V  Q+LG GPAGLV AP
Sbjct:   16 AIVDGVAPEDMTKEQVEEHVARIREELDREREERNYFQLERDKIHTFWEITRRQLEEKKAELRNKDREMEEAEERHQVEIKVYKQKVKHLLYEHQNNLAEVKAEGTVVMKLAQKEHRTQEGALRKDMRVLKVELKEQELANEVVIKNLCLKQAEEITKMRNDFERQVREIEAKYDKKMKMLRDELDLRRKTEIHEVEERKNGQISTLMQRHEEAFTDIKNYYNDITLNNLALINSLKEQMEDMRKKEEHMEREMAEVTLQNRRLADPLQKAKDEMNEMQKRLGNHERDKQILVCTKARLKVAERELKDLKWEHEVLEQRFIKVQQEREELYRKFADAIQEVQQKTGFKNLLLERKLQALNAAVEKREVQFNEVLAASNLDPTALTLVSRKLEDVLESKNTTIKDLQYELARVCKAHNDLLRTYEAKLLAFGIPLDNVGFKPLETAVIGQTLGQGPAGLVGAP 477          
BLAST of Growth arrest-specific protein 8 vs. UniProt/SwissProt
Match: sp|Q499U4|DRC4_RAT (Dynein regulatory complex subunit 4 OS=Rattus norvegicus OX=10116 GN=Gas8 PE=2 SV=1)

HSP 1 Score: 569.311 bits (1466), Expect = 0.000e+0
Identity = 301/462 (65.15%), Postives = 385/462 (83.33%), Query Frame = 3
Query:  153 TVIDGIPSEEMTKEQLEDHVVXXXXXXXXXXXXXNYFQLERDKINTFWEITKRQLEERKAEMRNKDREMEESEEKHQTEIKVYKQKVKHLMYGHSQKVSQLQAETIASLKLAEEEHRGEESELKTDNRTLKCDIKEQQLSNEDKIKDLKLSYENNITDIRMDFERQVKEIEVKFMKKMQVQRDEMDLRRKNEIHEIEERKNTQINTLMKNHEKAFSDIKNYYXXXXXXXXXXXXXXKEQMEEMNRKQERTEKSMSEIMTENKRLVEPLRKAQEENNELKRQLTNYEKDKLALKNTKARLKIKEKDYRDLEWEHEVLEQRFSKVEEERNQLYQKFVKAINEVHQKSGLKNVLLERKLNTLTESLEKKEAQLNEVLSASNLDPNALAIVTRKLEDVLDSKNSAIKDLQYELARVCKAHNDQLRTYEAKLAQFGIPSEELGFKPLESTVGNQSLGYGPAGLVSAP 1538
             V+DG+  E+M+KEQ+E+HV R+REEL+REREERNYFQLERDKI+TFWEIT+RQLEE+KAE+RNKDREMEE+EE+HQ EIKVYKQKVKHL+Y H   +++++ E    +KLA++EHR +E  L+ D R LK ++KEQ+L+NE  IK+L+L     IT +R DFERQV+EIE K+ KKM++ RDE+DLRRK EIHE+EERKN QI+TLM+ HE+AF+DIKNYYNDITLNNLALIN+LKEQME+M +K+E  E+ M+E+  +NKRL EPL++A+EE +E++++L N+E+DK  L  TKARLK+ EK+ +DL+WEHE+LEQRF KV++ER +LY+KF  AI EV QK+G KN++LERKL  L  ++EK+E Q NEVL+ASNLDP AL +V+RKLEDVL+SKN+ IKDLQYELARVCKAHND LRTYEAKL  FGIP + +GFKPLE+ V  Q+LG GPAGLV AP
Sbjct:   16 AVVDGVAPEDMSKEQVEEHVARIREELDREREERNYFQLERDKIHTFWEITRRQLEEKKAELRNKDREMEEAEERHQVEIKVYKQKVKHLLYEHQNNLAEVKTEGTVVMKLAQKEHRAQEGALRKDMRVLKVELKEQELANEVVIKNLRLKQAEEITKMRNDFERQVREIEAKYDKKMKMLRDELDLRRKTEIHEVEERKNGQISTLMQRHEEAFTDIKNYYNDITLNNLALINSLKEQMEDMRKKEEYLEREMAEVSLQNKRLAEPLQRAKEEMSEMQKRLGNHERDKQILACTKARLKVTEKELKDLKWEHEILEQRFIKVQQEREELYRKFTAAIQEVQQKTGFKNLVLERKLQALNAAVEKREVQFNEVLAASNLDPTALTLVSRKLEDVLESKNTTIKDLQYELARVCKAHNDLLRTYEAKLLAFGIPLDNVGFKPLETAVIGQTLGQGPAGLVGAP 477          
BLAST of Growth arrest-specific protein 8 vs. UniProt/SwissProt
Match: sp|A5D7M3|DRC4_BOVIN (Dynein regulatory complex subunit 4 OS=Bos taurus OX=9913 GN=GAS8 PE=2 SV=1)

HSP 1 Score: 565.459 bits (1456), Expect = 0.000e+0
Identity = 298/464 (64.22%), Postives = 385/464 (82.97%), Query Frame = 3
Query:  147 TPTVIDGIPSEEMTKEQLEDHVVXXXXXXXXXXXXXNYFQLERDKINTFWEITKRQLEERKAEMRNKDREMEESEEKHQTEIKVYKQKVKHLMYGHSQKVSQLQAETIASLKLAEEEHRGEESELKTDNRTLKCDIKEQQLSNEDKIKDLKLSYENNITDIRMDFERQVKEIEVKFMKKMQVQRDEMDLRRKNEIHEIEERKNTQINTLMKNHEKAFSDIKNYYXXXXXXXXXXXXXXKEQMEEMNRKQERTEKSMSEIMTENKRLVEPLRKAQEENNELKRQLTNYEKDKLALKNTKARLKIKEKDYRDLEWEHEVLEQRFSKVEEERNQLYQKFVKAINEVHQKSGLKNVLLERKLNTLTESLEKKEAQLNEVLSASNLDPNALAIVTRKLEDVLDSKNSAIKDLQYELARVCKAHNDQLRTYEAKLAQFGIPSEELGFKPLESTVGNQSLGYGPAGLVSAP 1538
            TP ++DG+  E+M+KEQ+E+H+ R+REEL+REREERNYFQLERDKI+TFWEIT+RQLEE+KAE+RNKDREMEE+EE+HQ EIKVYKQKVKHL+Y H   +++++AE    +KLA++EHR +E  L+ D R LK ++KEQ+L+NE  +K+L+L +   IT +R DFERQV+EIE K+ KKM++ RDE+DLRRK EIHE+EERKN QI TLM+ HE+AF+DIKNYYNDITLNNLALIN+LKEQME+M +K+E  EK M+E+  +N+RL +PL+KA+EE ++++++L +YE+DK  L  TKARLK+ EK+ + L WEHEVLEQRF KV++ER+ LY KF  AI EV QK+G +N++LERK+  L  ++EKKE Q NEVL+ASNLDP AL +V+RKLEDVL+SKNSAIKDLQYELARVCKAHND LRTYEAKL  FG+P + +GFKPL++ V  Q+LG GPAGLV  P
Sbjct:   15 TP-IVDGLAPEDMSKEQVEEHIGRIREELDREREERNYFQLERDKIHTFWEITRRQLEEKKAELRNKDREMEEAEERHQVEIKVYKQKVKHLLYEHQSSLTEMKAEGTVVMKLAQKEHRAQEGTLRRDMRALKVELKEQELANEVMVKNLRLKHTEEITKMRNDFERQVREIEAKYDKKMKMLRDELDLRRKTEIHEVEERKNGQITTLMQRHEEAFTDIKNYYNDITLNNLALINSLKEQMEDMGKKEEHLEKEMTEVAMQNRRLADPLQKAREEMSDMQKKLGSYERDKQILVCTKARLKVTEKELKSLRWEHEVLEQRFIKVQQERDDLYHKFTSAILEVQQKAGFRNLVLERKVQALVAAVEKKEVQFNEVLAASNLDPAALTLVSRKLEDVLESKNSAIKDLQYELARVCKAHNDLLRTYEAKLLAFGVPLDNVGFKPLDTAVIGQTLGQGPAGLVGTP 477          
BLAST of Growth arrest-specific protein 8 vs. UniProt/SwissProt
Match: sp|F1QNW4|DRC4_DANRE (Dynein regulatory complex subunit 4 OS=Danio rerio OX=7955 GN=gas8 PE=2 SV=1)

HSP 1 Score: 491.115 bits (1263), Expect = 1.858e-169
Identity = 286/464 (61.64%), Postives = 370/464 (79.74%), Query Frame = 3
Query:  144 RTPTVIDGIPSEEMTKEQLEDHVVXXXXXXXXXXXXXNYFQLERDKINTFWEITKRQLEERKAEMRNKDREMEESEEKHQTEIKVYKQKVKHLMYGHSQKVSQLQAETIASLKLAEEEHRGEESELKTDNRTLKCDIKEQQLSNEDKIKDLKLSYENNITDIRMDFERQVKEIEVKFMKKMQVQRDEMDLRRKNEIHEIEERKNTQINTLMKNHEKAFSDIKNYYXXXXXXXXXXXXXXKEQMEEMNRKQERTEKSMSEIMTENKRLVEPLRKAQEENNELKRQLTNYEKDKLALKNTKARLKIKEKDYRDLEWEHEVLEQRFSKVEEERNQLYQKFVKAINEVHQKSGLKNVLLERKLNTLTESLEKKEAQLNEVLSASNLDPNALAIVTRKLEDVLDSKNSAIKDLQYELARVCKAHNDQLRTYEAKLAQFGIPSEELGFKPLESTVGNQSLGYGPAGLVSA 1535
            +TPTV+DG+ +EEM+KEQLE+H++RLREEL+REREERNYFQLERDKI+TFWEIT+R LEE K E+RN++RE+EE EE+HQ EIKVYKQKVKHL+Y     +S+L+AE+I S KL ++EH   E E   D R+LK ++K+Q+LS+E+ +K + L ++   TD+R DF RQV+EI  K+ K+MQ  R E +LRRK EIHEIEERKNT IN LMKNHEKAF DI+NY++DI   NL LI +LKE+++EM + +E+  K M+E++ +NK L E  +KA+E+  EL++QL NYEKDK  L  ++ARLK+ +++ ++L+WE EVLEQRFSKV+ ER++LY KF KAI EV QKSG KN+LLE KLNTL ++LEKKEAQL+EVLSASNLDP  L++VT KLE+VL+SKN  IKDLQYE+ARVCKAHND L+T EAKL  FGIP EEL F+PL+S    QS+G GPA  VS+
Sbjct:   12 KTPTVVDGLSTEEMSKEQLEEHIMRLREELDREREERNYFQLERDKIHTFWEITRRHLEENKCELRNRERELEEVEERHQVEIKVYKQKVKHLLYEQQNMLSELKAESIISTKLLQDEHADLEKEQWKDMRSLKLELKQQELSSENVLKRIHLKHDEETTDLRNDFARQVQEIGSKYEKRMQKLRQEEELRRKTEIHEIEERKNTHINMLMKNHEKAFRDIRNYFSDIVYKNLDLITSLKEELKEMKKNEEKRNKEMAEVLEQNKELKESSQKAKEQVAELQKQLANYEKDKSILTRSRARLKMSDREMKELKWELEVLEQRFSKVQLERDELYMKFTKAILEVQQKSGFKNLLLECKLNTLNDTLEKKEAQLSEVLSASNLDPTTLSVVTHKLEEVLESKNHTIKDLQYEVARVCKAHNDLLKTSEAKLRAFGIPVEELCFEPLKS--NGQSVGQGPAMFVSS 473          
BLAST of Growth arrest-specific protein 8 vs. TrEMBL
Match: A0A267FZB3 (GAS domain-containing protein OS=Macrostomum lignano OX=282301 GN=BOX15_Mlig031513g2 PE=4 SV=1)

HSP 1 Score: 648.277 bits (1671), Expect = 0.000e+0
Identity = 346/465 (74.41%), Postives = 406/465 (87.31%), Query Frame = 3
Query:  147 TPTVIDGIPSEEMTKEQLEDHVVXXXXXXXXXXXXXNYFQLERDKINTFWEITKRQLEERKAEMRNKDREMEESEEKHQTEIKVYKQKVKHLMYGHSQKVSQLQAETIASLKLAEEEHRGEESELKTDNRTLKCDIKEQQLSNEDKIKDLKLSYENNITDIRMDFERQVKEIEVKFMKKMQVQRDEMDLRRKNEIHEIEERKNTQINTLMKNHEKAFSDIKNYYXXXXXXXXXXXXXXKEQMEEMNRKQERTEKSMSEIMTENKRLVEPLRKAQEENNELKRQLTNYEKDKLALKNTKARLKIKEKDYRDLEWEHEVLEQRFSKVEEERNQLYQKFVKAINEVHQKSGLKNVLLERKLNTLTESLEKKEAQLNEVLSASNLDPNALAIVTRKLEDVLDSKNSAIKDLQYELARVCKAHNDQLRTYEAKLAQFGIPSEELGFKPLESTVGNQSLGYGPAGLVSAPP 1541
            TPTVIDGI + EMTKE LE+HV R+R+EL+REREERNYFQLERDKINTFWEITKRQLEE+KAE+RNKDREME++EE+HQ EIKVYKQKVKHL+Y H   +S+L+AE    LKLA++EHR EESELK D R LK D+KE +L+N+  +K+LK  YE ++T++R DFERQ +EIE K+ KKM+  RDEMDLRRK EIHE+EERKN QINTLMKNHEKAFSDIKNYYNDITLNNLALINTLKE+++EM  K++R EK M+E+M EN+RL EPLR+AQ+EN ELKR L NYEKDK +LKN KAR+K+ E + + LEWEHEVL+QRF K++EER++LY+KF KAI+EV QKSGLKN+LLERKL TL ++LEKK+AQLNEVLSASNLDP AL +VTRKLEDVLDSKNSAIKDLQYELARVCKAHND L+TYEAKL Q+GIP EELGFKPLESTVG Q LG+GPAGLVSAPP
Sbjct:   23 TPTVIDGISTAEMTKEDLEEHVNRIRDELQREREERNYFQLERDKINTFWEITKRQLEEKKAELRNKDREMEDAEERHQLEIKVYKQKVKHLLYEHQNNISELKAENTVQLKLAQDEHRDEESELKKDKRRLKVDLKEHELANQQSVKELKRHYEAHLTEVRNDFERQAQEIEQKYEKKMRQLRDEMDLRRKTEIHEVEERKNDQINTLMKNHEKAFSDIKNYYNDITLNNLALINTLKEKIDEMKAKEDRLEKQMAEVMAENRRLSEPLRQAQDENAELKRTLANYEKDKQSLKNAKARIKMMEAERKKLEWEHEVLDQRFEKLQEERDELYRKFEKAIHEVQQKSGLKNILLERKLGTLADTLEKKDAQLNEVLSASNLDPTALTVVTRKLEDVLDSKNSAIKDLQYELARVCKAHNDLLKTYEAKLRQYGIPVEELGFKPLESTVGGQQLGHGPAGLVSAPP 487          
BLAST of Growth arrest-specific protein 8 vs. TrEMBL
Match: R7UQI7 (GAS domain-containing protein OS=Capitella teleta OX=283909 GN=CAPTEDRAFT_162685 PE=4 SV=1)

HSP 1 Score: 645.966 bits (1665), Expect = 0.000e+0
Identity = 356/486 (73.25%), Postives = 425/486 (87.45%), Query Frame = 3
Query:   81 MPPXXXXXXXXXXXXXXXXXXRTPTVIDGIPSEEMTKEQLEDHVVXXXXXXXXXXXXXNYFQLERDKINTFWEITKRQLEERKAEMRNKDREMEESEEKHQTEIKVYKQKVKHLMYGHSQKVSQLQAETIASLKLAEEEHRGEESELKTDNRTLKCDIKEQQLSNEDKIKDLKLSYENNITDIRMDFERQVKEIEVKFMKKMQVQRDEMDLRRKNEIHEIEERKNTQINTLMKNHEKAFSDIKNYYXXXXXXXXXXXXXXKEQMEEMNRKQERTEKSMSEIMTENKRLVEPLRKAQEENNELKRQLTNYEKDKLALKNTKARLKIKEKDYRDLEWEHEVLEQRFSKVEEERNQLYQKFVKAINEVHQKSGLKNVLLERKLNTLTESLEKKEAQLNEVLSASNLDPNALAIVTRKLEDVLDSKNSAIKDLQYELARVCKAHNDQLRTYEAKLAQFGIPSEELGFKPLESTVGNQSLGYGPAGLVSAP 1538
            MPPK K G KGKKGKKK A  +TPTVIDG+ +EEM+KEQLE+H+VRLREEL+REREERNYFQLERDK+NTFWEITKRQL+E+KAE+RNKDREME++EE+HQ EIKVYKQKVKHL+Y H   +S+L+AE+  +LKLA+++HR  E +L+ D R LK  +KEQ+LS+ED IK+LK S +  I+++R+DFERQ KEIE K+ KKM+  RDEMDLRRK EIHEIEERKN QINTLMKNHEKAFSDIKNYYNDITLNNLALINTLKEQ+EEM +K+ER EK M+EIM ENKRLVEPL++A++E +EL+RQL NY+KDK +L + KARL++ +++Y+ L WEHEVLEQRF K++ ER++LY +F+KAI EV QKS  KN+LLE+KL+ L ++LEKKEAQLNEVLSASNLDP AL +VTRKLEDVLDSKNSAIKDLQYELARVCKAHND LRTYEAKL QFG+P+EELGFKPLESTVG QSLG GPAGLVSAP
Sbjct:    1 MPPKAKAGKKGKKGKKKSAKAKTPTVIDGVSTEEMSKEQLEEHIVRLREELDREREERNYFQLERDKVNTFWEITKRQLDEKKAELRNKDREMEDAEERHQIEIKVYKQKVKHLLYEHQNNISELKAESTVALKLAQDDHRSNELDLRKDKRGLKVGLKEQELSHEDVIKNLKKSNDEEISNLRVDFERQAKEIEQKYEKKMRTLRDEMDLRRKTEIHEIEERKNGQINTLMKNHEKAFSDIKNYYNDITLNNLALINTLKEQVEEMKKKEERLEKQMAEIMAENKRLVEPLQRARDEVDELRRQLANYDKDKQSLASAKARLRVMDQEYKALGWEHEVLEQRFEKIQAERDELYTRFIKAIQEVQQKSNFKNLLLEKKLSALADTLEKKEAQLNEVLSASNLDPTALTVVTRKLEDVLDSKNSAIKDLQYELARVCKAHNDLLRTYEAKLTQFGVPTEELGFKPLESTVGGQSLGTGPAGLVSAP 486          
BLAST of Growth arrest-specific protein 8 vs. TrEMBL
Match: A0A267G0N4 (GAS domain-containing protein (Fragment) OS=Macrostomum lignano OX=282301 GN=BOX15_Mlig031513g3 PE=4 SV=1)

HSP 1 Score: 645.58 bits (1664), Expect = 0.000e+0
Identity = 346/465 (74.41%), Postives = 406/465 (87.31%), Query Frame = 3
Query:  147 TPTVIDGIPSEEMTKEQLEDHVVXXXXXXXXXXXXXNYFQLERDKINTFWEITKRQLEERKAEMRNKDREMEESEEKHQTEIKVYKQKVKHLMYGHSQKVSQLQAETIASLKLAEEEHRGEESELKTDNRTLKCDIKEQQLSNEDKIKDLKLSYENNITDIRMDFERQVKEIEVKFMKKMQVQRDEMDLRRKNEIHEIEERKNTQINTLMKNHEKAFSDIKNYYXXXXXXXXXXXXXXKEQMEEMNRKQERTEKSMSEIMTENKRLVEPLRKAQEENNELKRQLTNYEKDKLALKNTKARLKIKEKDYRDLEWEHEVLEQRFSKVEEERNQLYQKFVKAINEVHQKSGLKNVLLERKLNTLTESLEKKEAQLNEVLSASNLDPNALAIVTRKLEDVLDSKNSAIKDLQYELARVCKAHNDQLRTYEAKLAQFGIPSEELGFKPLESTVGNQSLGYGPAGLVSAPP 1541
            TPTVIDGI + EMTKE LE+HV R+R+EL+REREERNYFQLERDKINTFWEITKRQLEE+KAE+RNKDREME++EE+HQ EIKVYKQKVKHL+Y H   +S+L+AE    LKLA++EHR EESELK D R LK D+KE +L+N+  +K+LK  YE ++T++R DFERQ +EIE K+ KKM+  RDEMDLRRK EIHE+EERKN QINTLMKNHEKAFSDIKNYYNDITLNNLALINTLKE+++EM  K++R EK M+E+M EN+RL EPLR+AQ+EN ELKR L NYEKDK +LKN KAR+K+ E + + LEWEHEVL+QRF K++EER++LY+KF KAI+EV QKSGLKN+LLERKL TL ++LEKK+AQLNEVLSASNLDP AL +VTRKLEDVLDSKNSAIKDLQYELARVCKAHND L+TYEAKL Q+GIP EELGFKPLESTVG Q LG+GPAGLVSAPP
Sbjct:   56 TPTVIDGISTAEMTKEDLEEHVNRIRDELQREREERNYFQLERDKINTFWEITKRQLEEKKAELRNKDREMEDAEERHQLEIKVYKQKVKHLLYEHQNNISELKAENTVQLKLAQDEHRDEESELKKDKRRLKVDLKEHELANQQSVKELKRHYEAHLTEVRNDFERQAQEIEQKYEKKMRQLRDEMDLRRKTEIHEVEERKNDQINTLMKNHEKAFSDIKNYYNDITLNNLALINTLKEKIDEMKAKEDRLEKQMAEVMAENRRLSEPLRQAQDENAELKRTLANYEKDKQSLKNAKARIKMMEAERKKLEWEHEVLDQRFEKLQEERDELYRKFEKAIHEVQQKSGLKNILLERKLGTLADTLEKKDAQLNEVLSASNLDPTALTVVTRKLEDVLDSKNSAIKDLQYELARVCKAHNDLLKTYEAKLRQYGIPVEELGFKPLESTVGGQQLGHGPAGLVSAPP 520          
BLAST of Growth arrest-specific protein 8 vs. TrEMBL
Match: V4C0V6 (GAS domain-containing protein OS=Lottia gigantea OX=225164 GN=LOTGIDRAFT_215253 PE=4 SV=1)

HSP 1 Score: 644.425 bits (1661), Expect = 0.000e+0
Identity = 346/465 (74.41%), Postives = 405/465 (87.10%), Query Frame = 3
Query:  144 RTPTVIDGIPSEEMTKEQLEDHVVXXXXXXXXXXXXXNYFQLERDKINTFWEITKRQLEERKAEMRNKDREMEESEEKHQTEIKVYKQKVKHLMYGHSQKVSQLQAETIASLKLAEEEHRGEESELKTDNRTLKCDIKEQQLSNEDKIKDLKLSYENNITDIRMDFERQVKEIEVKFMKKMQVQRDEMDLRRKNEIHEIEERKNTQINTLMKNHEKAFSDIKNYYXXXXXXXXXXXXXXKEQMEEMNRKQERTEKSMSEIMTENKRLVEPLRKAQEENNELKRQLTNYEKDKLALKNTKARLKIKEKDYRDLEWEHEVLEQRFSKVEEERNQLYQKFVKAINEVHQKSGLKNVLLERKLNTLTESLEKKEAQLNEVLSASNLDPNALAIVTRKLEDVLDSKNSAIKDLQYELARVCKAHNDQLRTYEAKLAQFGIPSEELGFKPLESTVGNQSLGYGPAGLVSAP 1538
            +TPTVIDG+P+EEM+KEQLE+H+ RLREELEREREERNYFQLERDK+NTFWEITKRQLEE+KAE+RNKDREME++EE+HQ EIKVYKQKVKHL+Y H   VS+L+AE   SLKLA++EH G E+ L+ D R LK  +KEQ+L++ED IK+LK S +  +T +R DFERQ KEIE K+ KKM+  RDE+DLRRK EIHEIEERKN QINTLMKNHEKAFSDIKNYYNDITLNNLALINTLKEQ+EEM +K+ER EK M+E++ ENKRL EPL+KA+EE  +L++QL NYEKDK  L+ TKARLK+ E+++R L+WEHEVLEQRF K + ER+ LY+KFVKAI+EV QKS  KN+LLE+KL  L ++LEKKEAQLNEVLSASNLDP AL +VTRKLEDVLDSKNSAIKDLQYELARVCKAHND LRTYE+KL QFGIP+EELGFKPLESTVG Q+LG GPAGLVSAP
Sbjct:   21 KTPTVIDGVPTEEMSKEQLEEHIARLREELEREREERNYFQLERDKVNTFWEITKRQLEEKKAELRNKDREMEDAEERHQIEIKVYKQKVKHLLYEHQNNVSELKAEGGVSLKLAQDEHEGNETNLRKDKRALKVHLKEQELAHEDVIKNLKKSNDEEVTKLRADFERQAKEIEAKYEKKMRTLRDELDLRRKTEIHEIEERKNGQINTLMKNHEKAFSDIKNYYNDITLNNLALINTLKEQVEEMKKKEERMEKQMAEVIAENKRLTEPLQKAREEVEDLRKQLANYEKDKETLRMTKARLKVTEEEFRALKWEHEVLEQRFQKTQAERDDLYRKFVKAIHEVQQKSNFKNLLLEKKLGALADTLEKKEAQLNEVLSASNLDPTALTVVTRKLEDVLDSKNSAIKDLQYELARVCKAHNDLLRTYESKLNQFGIPTEELGFKPLESTVGGQALGQGPAGLVSAP 485          
BLAST of Growth arrest-specific protein 8 vs. TrEMBL
Match: A0A1S3I2D0 (growth arrest-specific protein 8 OS=Lingula unguis OX=7574 GN=LOC106160367 PE=4 SV=1)

HSP 1 Score: 643.269 bits (1658), Expect = 0.000e+0
Identity = 341/464 (73.49%), Postives = 409/464 (88.15%), Query Frame = 3
Query:  147 TPTVIDGIPSEEMTKEQLEDHVVXXXXXXXXXXXXXNYFQLERDKINTFWEITKRQLEERKAEMRNKDREMEESEEKHQTEIKVYKQKVKHLMYGHSQKVSQLQAETIASLKLAEEEHRGEESELKTDNRTLKCDIKEQQLSNEDKIKDLKLSYENNITDIRMDFERQVKEIEVKFMKKMQVQRDEMDLRRKNEIHEIEERKNTQINTLMKNHEKAFSDIKNYYXXXXXXXXXXXXXXKEQMEEMNRKQERTEKSMSEIMTENKRLVEPLRKAQEENNELKRQLTNYEKDKLALKNTKARLKIKEKDYRDLEWEHEVLEQRFSKVEEERNQLYQKFVKAINEVHQKSGLKNVLLERKLNTLTESLEKKEAQLNEVLSASNLDPNALAIVTRKLEDVLDSKNSAIKDLQYELARVCKAHNDQLRTYEAKLAQFGIPSEELGFKPLESTVGNQSLGYGPAGLVSAP 1538
            TPTVIDGI +EEM+KEQLE+H+VRLREEL+REREERNYFQLERDK+NTFWEITKRQLEE+KAE+RNKDREME++EE+HQ EIKVYKQKVKHL+Y H   +S+L+AE+   L+LA++++R  E +L+ D R LK ++KEQ+LS+ED IK+LK  ++ ++T++R DFERQ +EIE K+ KKM+  RDE+DLRRK EIHEIEERKN QINTLMKNHEKAFSDIKNYYNDITLNNLALINTLKEQ+EEM +K+ER EK M+E+M ENKRL EPL+KA+EE  EL++QL NY+KDK +L N KARLK+ E++Y+ L+WEHEVLEQRF K++ ER++LY+KFVKAI+EV QKS  KN+LLE+KL  L ++LEKKEAQLNEVLSASNLDP AL +VTRKLEDVLDSKNSAIKDLQYELARVCKAHND LRTYE+KL QFGIP+EELGFKPLESTVG Q+LG GPAGLVSAP
Sbjct:   19 TPTVIDGISTEEMSKEQLEEHIVRLREELDREREERNYFQLERDKVNTFWEITKRQLEEKKAELRNKDREMEDAEERHQLEIKVYKQKVKHLLYEHQNNISELKAESAVQLRLAQDDNRASEKDLRKDKRGLKVELKEQELSHEDIIKNLKKDHDESVTNLRQDFERQAREIEAKYEKKMKTLRDELDLRRKTEIHEIEERKNGQINTLMKNHEKAFSDIKNYYNDITLNNLALINTLKEQVEEMKKKEERMEKQMAEVMAENKRLTEPLQKAREEVEELRKQLANYDKDKQSLANAKARLKVMEEEYKSLQWEHEVLEQRFGKLQGERDELYRKFVKAIHEVQQKSNFKNLLLEKKLGALADTLEKKEAQLNEVLSASNLDPTALTVVTRKLEDVLDSKNSAIKDLQYELARVCKAHNDLLRTYESKLNQFGIPTEELGFKPLESTVGGQTLGQGPAGLVSAP 482          
BLAST of Growth arrest-specific protein 8 vs. Ensembl Cavefish
Match: gas8 (growth arrest specific 8 [Source:NCBI gene;Acc:103033045])

HSP 1 Score: 583.563 bits (1503), Expect = 0.000e+0
Identity = 315/464 (67.89%), Postives = 385/464 (82.97%), Query Frame = 3
Query:  147 TPTVIDGIPSEEMTKEQLEDHVVXXXXXXXXXXXXXNYFQLERDKINTFWEITKRQLEERKAEMRNKDREMEESEEKHQTEIKVYKQKVKHLMYGHSQKVSQLQAETIASLKLAEEEHRGEESELKTDNRTLKCDIKEQQLSNEDKIKDLKLSYENNITDIRMDFERQVKEIEVKFMKKMQVQRDEMDLRRKNEIHEIEERKNTQINTLMKNHEKAFSDIKNYYXXXXXXXXXXXXXXKEQMEEMNRKQERTEKSMSEIMTENKRLVEPLRKAQEENNELKRQLTNYEKDKLALKNTKARLKIKEKDYRDLEWEHEVLEQRFSKVEEERNQLYQKFVKAINEVHQKSGLKNVLLERKLNTLTESLEKKEAQLNEVLSASNLDPNALAIVTRKLEDVLDSKNSAIKDLQYELARVCKAHNDQLRTYEAKLAQFGIPSEELGFKPLESTVGNQSLGYGPAGLVSAP 1538
            +PTV+DG+ +EEM+KEQLEDH+VRLREEL+REREERNYFQLERDKI+TFWEITKRQLEE+KA++RN+DREMEE+EE+HQ EIKVYKQKVKHL+Y     +++L+ E + + KL ++EH   E++L+   R LK DIKEQ+LS+E+ IK LKL ++  IT IR DFERQV+EIE K+ KKM   R E DLRRK EI EIEERKN  INTL++NHEKAFSDIK YYNDIT NNLALI+TLKE   EM  K++R EK M++++ ENK+L EPL+KA EE  EL++QL NY KDK +L   + R+K+ EK+ +DL+WEHEVLEQRFSKV++ER++LYQKF KAI EV QKSG KN+LLERKL  LT+SLEKKEAQLNEVL+ASNLDP AL +VTRK+E+V+DSKN AIKDLQYELARVCKAHND LR+ E+KL  FGIP EELGFKP+E ++  Q+LG GPAGLVSAP
Sbjct:   16 SPTVVDGLSTEEMSKEQLEDHIVRLREELDREREERNYFQLERDKIHTFWEITKRQLEEKKADLRNRDREMEEAEERHQVEIKVYKQKVKHLLYEQQNSIAELKTEGVVTTKLLQKEHADLENDLRKGIRNLKVDIKEQELSSENLIKSLKLKHDEEITKIRNDFERQVREIEAKYEKKMLALRQEQDLRRKTEIEEIEERKNCHINTLIQNHEKAFSDIKTYYNDITSNNLALISTLKENEREMKNKEKRLEKEMAKVLRENKQLTEPLQKATEEATELRKQLANYNKDKNSLAGARVRIKVAEKEIKDLKWEHEVLEQRFSKVQQERDELYQKFTKAIQEVQQKSGFKNLLLERKLAALTDSLEKKEAQLNEVLAASNLDPTALNVVTRKIEEVMDSKNIAIKDLQYELARVCKAHNDLLRSCESKLKVFGIPVEELGFKPMEISIAGQTLGQGPAGLVSAP 479          
BLAST of Growth arrest-specific protein 8 vs. Ensembl Cavefish
Match: ENSAMXT00000032361.1 (pep primary_assembly:Astyanax_mexicanus-2.0:7:8367749:8375463:-1 gene:ENSAMXG00000038170.1 transcript:ENSAMXT00000032361.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 237.654 bits (605), Expect = 5.160e-72
Identity = 152/357 (42.58%), Postives = 243/357 (68.07%), Query Frame = 3
Query:  153 TVIDGIP--SEEMTKEQLEDHVVXXXXXXXXXXXXXNYFQLERDKINTFWEITKRQLEERKAEMRNKDREMEESEEKHQTEIKVYKQKVKHLMYGHSQKVSQLQAETIASLKLAEEEHRGEESELKTDNRTLKCDIKEQQLSNEDKIKDLKLSYENNITDIRMDFERQVKEIEVKFMKKMQVQRDEMDLRRKNEIHEIEERKNTQINTLMKNHEKAFSDIKNYYXXXXXXXXXXXXXXKEQMEEMNRKQERTEKSMSEIMTENKRLVEPLRKAQEENNELKRQLTNYEKDKLALKNTKARLKIKEKDYRDLEWEHEVLEQRFSKVEEERNQLYQKFVKAINEVHQKSGLKNVLLERK 1217
            TV D  P  S E++KE+LE  +V LR+EL+RE+++  YFQLERDKI++FWEI+K QL + K E+  K  E+E++EE H  EI+ YKQKVKHL+Y H   +++L+ E   S KL ++E+   + +L+ D + LK  +KE++LS +  I++LKL++   +TDIR  FE+ ++++E K+  KM+    + D+RR  EI  +E+RKN+QI  L+++ EK  +DIK YY DI  ++LA I  LKE   +M    ++ +  +++++ E K+L EPLR   EE + L++Q+T++  DK  L+  +ARLK+ EK+  D ++E  +LE++ S V++ER+ LYQ F KAI EV QK G+K+++ ++K
Sbjct:   17 TVKDIKPAASTEVSKEELEAQIVSLRKELDREKKQCTYFQLERDKIHSFWEISKEQLYDVKRELSKKCEEIEQAEESHNLEIRAYKQKVKHLLYEHQLSITELREEGEVSNKLLQKEYEALKGDLQKDVKNLKVKLKEEELSYKSLIRNLKLNHSKEMTDIRTYFEQLLQDMEAKYKTKMEALSQQADIRRTTEIEMMEKRKNSQIRELIQDQEKTQTDIKAYYKDIVSSSLARIKALKEGERDMKEMVQKLKSEVAKVLREKKQLTEPLRIVSEEASVLRKQVTDHSADKHLLEKVRARLKVAEKEICDRKFEISLLEEKISTVQQERDGLYQGFQKAIQEVKQKKGIKSIVKKKK 373          
BLAST of Growth arrest-specific protein 8 vs. Ensembl Cavefish
Match: ENSAMXT00000056091.1 (pep primary_assembly:Astyanax_mexicanus-2.0:7:8376002:8379590:-1 gene:ENSAMXG00000036331.1 transcript:ENSAMXT00000056091.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 118.242 bits (295), Expect = 2.375e-29
Identity = 83/193 (43.01%), Postives = 125/193 (64.77%), Query Frame = 3
Query:  150 PTVIDGIPSEEMTKEQLEDHVVXXXXXXXXXXXXXNYFQLERDKINTFWEITKRQLEERKAEMRNKDREMEESEEKHQTEIKVYKQKVKHLMYGHSQKVSQLQAETIASLKLAEEEHRGEESELKTDNRTLKCDIKEQQLSNEDKIKDLKLSYENNITDIRMDFERQVKEIEVKFMKKMQVQRDEMDLRRKNE 728
            P V++G  S +M K+ LE  +V LREEL+RER++ NYF+LERDKI+ FWEI+K +L++ K E+ NK +++EE              KVKHL+Y     +++L+AE   S KL  ++H   ES+L+ D + LK  +KE +LSN++ IK +KL +   +TDIR  FE+ ++++E K+  KM   R E D+RRK E
Sbjct:   19 PAVVNG-ASTKMLKKLLEAQIVSLREELDRERKKCNYFRLERDKIHGFWEISKERLDDFKCELSNKYKKIEE--------------KVKHLLYEQQLSITELRAEGEVSNKLLLKKHEDLESDLRKDVQNLKVKLKETELSNKNLIKSVKLKHNEEMTDIRTYFEQLLQDMEAKYENKMVALRQEEDIRRKRE 196          
BLAST of Growth arrest-specific protein 8 vs. Ensembl Cavefish
Match: ENSAMXT00000035259.1 (pep primary_assembly:Astyanax_mexicanus-2.0:7:8375471:8378368:-1 gene:ENSAMXG00000036331.1 transcript:ENSAMXT00000035259.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 99.3673 bits (246), Expect = 8.754e-23
Identity = 59/144 (40.97%), Postives = 92/144 (63.89%), Query Frame = 3
Query:  255 NYFQLERDKINTFWEITKRQLEERKAEMRNKDREMEESEEKHQTEIKVYKQKVKHLMYGHSQKVSQLQAETIASLKLAEEEHRGEESELKTDNRTLKCDIKEQQLSNEDKIKDLKLSYENNITDIRMDFERQVKEIEVKFMKKM 686
            NYF+LERDKI+ FWEI+K +L++ K E+ NK +++EE              KVKHL+Y     +++L+AE   S KL  ++H   ES+L+ D + LK  +KE +LSN++ IK +KL +   +TDIR  FE+ ++++E K+  KM
Sbjct:   28 NYFRLERDKIHGFWEISKERLDDFKCELSNKYKKIEE--------------KVKHLLYEQQLSITELRAEGEVSNKLLLKKHEDLESDLRKDVQNLKVKLKETELSNKNLIKSVKLKHNEEMTDIRTYFEQLLQDMEAKYENKM 157          
BLAST of Growth arrest-specific protein 8 vs. Ensembl Sea Lamprey
Match: gas8 (growth arrest-specific 8 [Source:NCBI gene;Acc:323260])

HSP 1 Score: 393.66 bits (1010), Expect = 1.538e-135
Identity = 211/294 (71.77%), Postives = 254/294 (86.39%), Query Frame = 3
Query:  657 EIEVKFMKKMQVQRDEMDLRRKNEIHEIEERKNTQINTLMKNHEKAFSDIKNYYXXXXXXXXXXXXXXKEQMEEMNRKQERTEKSMSEIMTENKRLVEPLRKAQEENNELKRQLTNYEKDKLALKNTKARLKIKEKDYRDLEWEHEVLEQRFSKVEEERNQLYQKFVKAINEVHQKSGLKNVLLERKLNTLTESLEKKEAQLNEVLSASNLDPNALAIVTRKLEDVLDSKNSAIKDLQYELARVCKAHNDQLRTYEAKLAQFGIPSEELGFKPLESTVGNQSLGYGPAGLVSAP 1538
            E+E K+ KKM+  RDE+DLRRK EIHE+EERKN QIN LM+NHEKAFSDIKNYYNDITLNNLALIN+LKEQ+E+M +K+ER EK M+E   +NKRL EPL++A+EE  EL RQL NY KDK  L + KARLK+ +++ ++L+WEHEV+ QRF+KVE ER++LY+KFV A++EV QKSG K++LLERKL  LT+++EKKEAQLNEVLSAS+LDP AL+IVTRKLEDVLDSKN+AIKDLQYELARVCKAHND LRTYE+KL  FGIP EELGFKPLE++V  Q+LG GPAGLVSAP
Sbjct:    1 EMEAKYEKKMRALRDELDLRRKTEIHEVEERKNGQINALMRNHEKAFSDIKNYYNDITLNNLALINSLKEQVEDMKKKEERLEKEMAETAQQNKRLTEPLQRAREEVAELNRQLANYTKDKTLLASAKARLKVMDQEMQELKWEHEVMIQRFAKVESERDELYRKFVTAVHEVQQKSGFKSLLLERKLVALTDAMEKKEAQLNEVLSASSLDPTALSIVTRKLEDVLDSKNNAIKDLQYELARVCKAHNDLLRTYESKLEAFGIPREELGFKPLETSVAGQTLGRGPAGLVSAP 294          
BLAST of Growth arrest-specific protein 8 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000009647.1 (pep scaffold:Pmarinus_7.0:GL477881:512079:514388:1 gene:ENSPMAG00000008718.1 transcript:ENSPMAT00000009647.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 120.168 bits (300), Expect = 4.261e-33
Identity = 68/84 (80.95%), Postives = 82/84 (97.62%), Query Frame = 3
Query:  147 TPTVIDGIPSEEMTKEQLEDHVVXXXXXXXXXXXXXNYFQLERDKINTFWEITKRQLEERKAEMRNKDREMEESEEKHQTEIKV 398
            TPTV+DGI +EEM+KEQLE+H+VRLREEL+REREERNYFQLERDKI+TFWEIT+RQL+ER+AE+RNKDREME++EE+HQ EIKV
Sbjct:   13 TPTVVDGISTEEMSKEQLEEHIVRLREELDREREERNYFQLERDKIHTFWEITRRQLDERRAELRNKDREMEDAEERHQVEIKV 96          
BLAST of Growth arrest-specific protein 8 vs. Ensembl Nematostella
Match: EDO41610 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S3W7])

HSP 1 Score: 633.639 bits (1633), Expect = 0.000e+0
Identity = 347/486 (71.40%), Postives = 418/486 (86.01%), Query Frame = 3
Query:   81 MPPXXXXXXXXXXXXXXXXXXRTPTVIDGIPSEEMTKEQLEDHVVXXXXXXXXXXXXXNYFQLERDKINTFWEITKRQLEERKAEMRNKDREMEESEEKHQTEIKVYKQKVKHLMYGHSQKVSQLQAETIASLKLAEEEHRGEESELKTDNRTLKCDIKEQQLSNEDKIKDLKLSYENNITDIRMDFERQVKEIEVKFMKKMQVQRDEMDLRRKNEIHEIEERKNTQINTLMKNHEKAFSDIKNYYXXXXXXXXXXXXXXKEQMEEMNRKQERTEKSMSEIMTENKRLVEPLRKAQEENNELKRQLTNYEKDKLALKNTKARLKIKEKDYRDLEWEHEVLEQRFSKVEEERNQLYQKFVKAINEVHQKSGLKNVLLERKLNTLTESLEKKEAQLNEVLSASNLDPNALAIVTRKLEDVLDSKNSAIKDLQYELARVCKAHNDQLRTYEAKLAQFGIPSEELGFKPLESTVGNQSLGYGPAGLVSAP 1538
            MPPKKK G K  KGKKK A  +TPT++DGI +EEMTKEQLE+H+VRLREEL+REREERNYFQLERDK+NTFWEITKRQ EE+KAE+RNKDREMEE+EE+HQ EIKVYKQKVKHL+Y H   +++L+AE+  +L LA++EHR  E +L+ D R+LK ++KEQ+LS+ED +K+LK +++ ++T +R DFERQVKEIE K+ KKM+  R+E++LRRK EIHEIEERKN QINTLMKNHEKAFSDIKNYYNDITLNNLALIN+LKEQ+EEM +K+ER EK M+EIM ENKRL EPL+KA+EE  EL++QL NYEKDK +L + KARLK++E +   L WEHEVL+QRF++ + ER++LY KFVKAI+EV QKS  KN+LLE+KL  L ++LEKKEAQLNEVLSASNLDP AL +VTRKLEDVLDSKNSAIKDLQYELARVCKAHND +RTYEAKL  FG+P+EELGFKPLES VG Q LG GPAGLV+AP
Sbjct:    1 MPPKKKSGKKKGKGKKKSAKSKTPTIVDGISTEEMTKEQLEEHIVRLREELDREREERNYFQLERDKVNTFWEITKRQFEEKKAELRNKDREMEEAEERHQVEIKVYKQKVKHLLYEHQNNIAELKAESSVALSLAQDEHRTSEQDLRKDKRSLKVELKEQELSHEDVVKNLKRNHDEHVTRLRQDFERQVKEIEAKYDKKMKALREELELRRKTEIHEIEERKNGQINTLMKNHEKAFSDIKNYYNDITLNNLALINSLKEQVEEMKKKEERMEKQMNEIMAENKRLTEPLQKAREEVEELRKQLANYEKDKASLASAKARLKVQEDELHSLHWEHEVLQQRFAQTQSERDELYGKFVKAIHEVQQKSNFKNLLLEKKLTALADTLEKKEAQLNEVLSASNLDPTALTVVTRKLEDVLDSKNSAIKDLQYELARVCKAHNDLIRTYEAKLTSFGVPTEELGFKPLESNVGGQQLGKGPAGLVAAP 486          
BLAST of Growth arrest-specific protein 8 vs. Ensembl Medaka
Match: ENSORLT00000032278.1 (growth arrest-specific protein 8 [Source:NCBI gene;Acc:101168854])

HSP 1 Score: 161.77 bits (408), Expect = 5.264e-44
Identity = 149/426 (34.98%), Postives = 240/426 (56.34%), Query Frame = 3
Query:  153 TVIDGIPSEEMTKEQLEDHVVXXXXXXXXXXXXXNYFQLERDKINTFWEITKRQLEERKAEMRNKDREMEESEEKHQTEIKVYKQKVKHLMYGHSQKVSQLQAETIASLKLAEEEHRGEESELKTDNRTLKCDIKEQQLSNEDKIKDLKLSYENNITDIRMDFERQVKEIEVKFMKKMQVQRDEMDLRRKNEIHEIEERKNTQINTLMKNHEKAFSDIKNYYXXXXXXXXXXXXXXKEQMEEMNRKQERTEKSMSEIMTENKRLVEPLRKAQEENNELKRQLTNYEKDK-LALKNTKARLKIKE-KDYRDLEWEHEVLEQRFSKVEEERNQLYQKFVKAINEVHQKSGLKNVLLERKLNTLTESLEKKEAQLNEVLSASNLDPNALAIVTRKLEDVLDSKNSAIKDLQYELARVCKAHNDQLRTYE 1424
            T+I+G   EE TKEQ+E+++  L+EEL+RE EERNYFQLERD+++TF +IT ++LEE  AE +  ++ +EE EE H  EIKVYKQK+KHL+  H   +S+L+ E + S+K  ++E    E E     +    DI  Q+L+N+D  +  +L  ++ +T  R ++E+QV E   K+ + +++ ++E++    + +   E  ++T I    +   + F+ I                      +E+N   E+  + ++EI  +NK L E   K  +  +  K Q TN +K     LKN K  +KI E K   DL+ E+E LEQ+F+ ++ E+ +LY      I    +K GL++  L RKL  LT+SL + + QL  VLS  N+D N L+ +  K E+ LD + SAI+++ Y+   + KA +  L T E
Sbjct:   19 TLINGRTKEETTKEQIEEYIAHLQEELDREMEERNYFQLERDQVHTFGKITAKKLEEVLAEEKILEKGLEEDEEHHLIEIKVYKQKIKHLLCEHQSTISELKEEGLVSIKKLQKELDQLEMEFHKKIKAGMVDI--QELNNDD-FERQRLLLQDEVTKTRSNWEQQVTETAAKYEECLKLFQEELENTETSLVMNCELERDTHIVAFQEEMREVFNSI----------------------QEVNILMEQNREIINEI--QNKILQE---KEIQVYDIPKVQKTNIKKKADFHLKN-KQSIKIPETKTVEDLKLENEALEQKFNGLQLEKAKLYNSVTPNIERTREKVGLRSAQLRRKLQDLTDSLARSQTQLFTVLSDPNMDHNVLSEIANKSEENLDRRKSAIRNIAYKKNEILKARSHLLLTGE 413          
BLAST of Growth arrest-specific protein 8 vs. Ensembl Medaka
Match: ENSORLT00000030131.1 (growth arrest-specific protein 8 [Source:NCBI gene;Acc:101160959])

HSP 1 Score: 72.7886 bits (177), Expect = 1.687e-13
Identity = 100/361 (27.70%), Postives = 173/361 (47.92%), Query Frame = 3
Query:  258 YFQLERDKINTFWEITKRQLEERKAEMRNKDREMEESEEKHQTEIKVYKQKVKHLMYGHSQKVSQ---LQAETIASLKLAEEEHRGEESELKTDNRTLKCDIKEQQLSNEDKIKDLKLSYENNITDIRMDFERQVKEIEVKFMKKMQVQRDEMDLRRKNEIHEIEERKNTQINTLMKNHEKAFSDIKNYYXXXXXXXXXXXXXXKEQMEEMNRKQERTEKSMSEIMTENKRLVEPLRKAQEENN-------ELKRQL-----------TNYEK-----DKLALKNTKARLKIKEKDYRDLEWEHEVLEQRFSKVEEERNQLYQKFVKAINEVHQKSGLKNVLLERKLNTLTESLEKKEAQL 1262
              QL+RD +  +    + +LEE +A++RN  +E +E+EE+HQ EI VYKQK+K ++  H Q  S    LQ + + S        RG E  L+ +  TL   ++        K+K    S E+              ++EV+F  KM+   +E D RR   +   ++   + + +LM+ H +A                              R +E    +  E + E ++L++ L  AQE+N        EL+R+L            N +      D +  ++  + LK  +++ RDL+ E+++L Q F KV++ER+QL ++  +++ ++ ++S LK  LL+RKL  L+  LE+KEAQL
Sbjct:    5 LLQLQRDHMLGWRGTVEEKLEEAEAKLRNICKEKQEAEERHQVEISVYKQKLKQIL-SHQQNTSPHNPLQNQNLQS--------RGVEKRLQ-EALTLVSRLQSGWCLQRSKLKACS-SPESPGHAPSAPLPPPPADVEVRFDLKMKSLMEEQDRRRAAALRRQKKEAWSHMASLMEEHSRAL-----------------------------RGEEELRSAAQEELQEAQQLIKELSAAQEKNQGVQEAQQELQRRLQEEVAVSSVCALNIKHSLDVVDGVFPQDLHSMLKEAQEELRDLKEENKLLLQGFCKVQQERDQLLRRQEQSMADLQRRSTLKKELLDRKLLALSRFLERKEAQL 325          
BLAST of Growth arrest-specific protein 8 vs. Planmine SMEST
Match: SMESG000013356.1 (SMESG000013356.1)

HSP 1 Score: 902.123 bits (2330), Expect = 0.000e+0
Identity = 511/512 (99.80%), Postives = 511/512 (99.80%), Query Frame = 3
Query:    6 MIDIYITISFFYSLLFKLLETINITMPPXXXXXXXXXXXXXXXXXXRTPTVIDGIPSEEMTKEQLEDHVVXXXXXXXXXXXXXNYFQLERDKINTFWEITKRQLEERKAEMRNKDREMEESEEKHQTEIKVYKQKVKHLMYGHSQKVSQLQAETIASLKLAEEEHRGEESELKTDNRTLKCDIKEQQLSNEDKIKDLKLSYENNITDIRMDFERQVKEIEVKFMKKMQVQRDEMDLRRKNEIHEIEERKNTQINTLMKNHEKAFSDIKNYYXXXXXXXXXXXXXXKEQMEEMNRKQERTEKSMSEIMTENKRLVEPLRKAQEENNELKRQLTNYEKDKLALKNTKARLKIKEKDYRDLEWEHEVLEQRFSKVEEERNQLYQKFVKAINEVHQKSGLKNVLLERKLNTLTESLEKKEAQLNEVLSASNLDPNALAIVTRKLEDVLDSKNSAIKDLQYELARVCKAHNDQLRTYEAKLAQFGIPSEELGFKPLESTVGNQSLGYGPAGLVSAPP 1541
            MIDIYITISFFYSLL KLLETINITMPPKKKKGGKGKKGKKKGAGKRTPTVIDGIPSEEMTKEQLEDHVVRLREELEREREERNYFQLERDKINTFWEITKRQLEERKAEMRNKDREMEESEEKHQTEIKVYKQKVKHLMYGHSQKVSQLQAETIASLKLAEEEHRGEESELKTDNRTLKCDIKEQQLSNEDKIKDLKLSYENNITDIRMDFERQVKEIEVKFMKKMQVQRDEMDLRRKNEIHEIEERKNTQINTLMKNHEKAFSDIKNYYNDITLNNLALINTLKEQMEEMNRKQERTEKSMSEIMTENKRLVEPLRKAQEENNELKRQLTNYEKDKLALKNTKARLKIKEKDYRDLEWEHEVLEQRFSKVEEERNQLYQKFVKAINEVHQKSGLKNVLLERKLNTLTESLEKKEAQLNEVLSASNLDPNALAIVTRKLEDVLDSKNSAIKDLQYELARVCKAHNDQLRTYEAKLAQFGIPSEELGFKPLESTVGNQSLGYGPAGLVSAPP
Sbjct:    1 MIDIYITISFFYSLLSKLLETINITMPPKKKKGGKGKKGKKKGAGKRTPTVIDGIPSEEMTKEQLEDHVVRLREELEREREERNYFQLERDKINTFWEITKRQLEERKAEMRNKDREMEESEEKHQTEIKVYKQKVKHLMYGHSQKVSQLQAETIASLKLAEEEHRGEESELKTDNRTLKCDIKEQQLSNEDKIKDLKLSYENNITDIRMDFERQVKEIEVKFMKKMQVQRDEMDLRRKNEIHEIEERKNTQINTLMKNHEKAFSDIKNYYNDITLNNLALINTLKEQMEEMNRKQERTEKSMSEIMTENKRLVEPLRKAQEENNELKRQLTNYEKDKLALKNTKARLKIKEKDYRDLEWEHEVLEQRFSKVEEERNQLYQKFVKAINEVHQKSGLKNVLLERKLNTLTESLEKKEAQLNEVLSASNLDPNALAIVTRKLEDVLDSKNSAIKDLQYELARVCKAHNDQLRTYEAKLAQFGIPSEELGFKPLESTVGNQSLGYGPAGLVSAPP 512          
BLAST of Growth arrest-specific protein 8 vs. Planmine SMEST
Match: SMESG000013356.1 (SMESG000013356.1)

HSP 1 Score: 855.129 bits (2208), Expect = 0.000e+0
Identity = 487/487 (100.00%), Postives = 487/487 (100.00%), Query Frame = 3
Query:   81 MPPXXXXXXXXXXXXXXXXXXRTPTVIDGIPSEEMTKEQLEDHVVXXXXXXXXXXXXXNYFQLERDKINTFWEITKRQLEERKAEMRNKDREMEESEEKHQTEIKVYKQKVKHLMYGHSQKVSQLQAETIASLKLAEEEHRGEESELKTDNRTLKCDIKEQQLSNEDKIKDLKLSYENNITDIRMDFERQVKEIEVKFMKKMQVQRDEMDLRRKNEIHEIEERKNTQINTLMKNHEKAFSDIKNYYXXXXXXXXXXXXXXKEQMEEMNRKQERTEKSMSEIMTENKRLVEPLRKAQEENNELKRQLTNYEKDKLALKNTKARLKIKEKDYRDLEWEHEVLEQRFSKVEEERNQLYQKFVKAINEVHQKSGLKNVLLERKLNTLTESLEKKEAQLNEVLSASNLDPNALAIVTRKLEDVLDSKNSAIKDLQYELARVCKAHNDQLRTYEAKLAQFGIPSEELGFKPLESTVGNQSLGYGPAGLVSAPP 1541
            MPPKKKKGGKGKKGKKKGAGKRTPTVIDGIPSEEMTKEQLEDHVVRLREELEREREERNYFQLERDKINTFWEITKRQLEERKAEMRNKDREMEESEEKHQTEIKVYKQKVKHLMYGHSQKVSQLQAETIASLKLAEEEHRGEESELKTDNRTLKCDIKEQQLSNEDKIKDLKLSYENNITDIRMDFERQVKEIEVKFMKKMQVQRDEMDLRRKNEIHEIEERKNTQINTLMKNHEKAFSDIKNYYNDITLNNLALINTLKEQMEEMNRKQERTEKSMSEIMTENKRLVEPLRKAQEENNELKRQLTNYEKDKLALKNTKARLKIKEKDYRDLEWEHEVLEQRFSKVEEERNQLYQKFVKAINEVHQKSGLKNVLLERKLNTLTESLEKKEAQLNEVLSASNLDPNALAIVTRKLEDVLDSKNSAIKDLQYELARVCKAHNDQLRTYEAKLAQFGIPSEELGFKPLESTVGNQSLGYGPAGLVSAPP
Sbjct:    1 MPPKKKKGGKGKKGKKKGAGKRTPTVIDGIPSEEMTKEQLEDHVVRLREELEREREERNYFQLERDKINTFWEITKRQLEERKAEMRNKDREMEESEEKHQTEIKVYKQKVKHLMYGHSQKVSQLQAETIASLKLAEEEHRGEESELKTDNRTLKCDIKEQQLSNEDKIKDLKLSYENNITDIRMDFERQVKEIEVKFMKKMQVQRDEMDLRRKNEIHEIEERKNTQINTLMKNHEKAFSDIKNYYNDITLNNLALINTLKEQMEEMNRKQERTEKSMSEIMTENKRLVEPLRKAQEENNELKRQLTNYEKDKLALKNTKARLKIKEKDYRDLEWEHEVLEQRFSKVEEERNQLYQKFVKAINEVHQKSGLKNVLLERKLNTLTESLEKKEAQLNEVLSASNLDPNALAIVTRKLEDVLDSKNSAIKDLQYELARVCKAHNDQLRTYEAKLAQFGIPSEELGFKPLESTVGNQSLGYGPAGLVSAPP 487          
BLAST of Growth arrest-specific protein 8 vs. Planmine SMEST
Match: SMESG000031912.1 (SMESG000031912.1)

HSP 1 Score: 318.546 bits (815), Expect = 5.973e-103
Identity = 201/471 (42.68%), Postives = 309/471 (65.61%), Query Frame = 3
Query:  150 PTVIDGIPSEEMTKEQLEDHVVXXXXXXXXXXXXXNYFQLERDKINTFWEITKRQLEERKAEMRNKDREMEESEEKHQTEIKVYKQKVKHLMYGHSQKVSQLQAETIASLKLAEEEHRGEESELKTDNRTLKCDIKEQQLSNEDKIKDLKLSYENNITDIRMDFERQVKEIEVKFMKKMQVQRDEMDLRRKNEIHEIEERKNTQINTLMKNHEKAFSDIKNYYXXXXXXXXXXXXXXKEQMEEMNRKQERTEKSMSEIMTENKRLVEPLRKAQEENNELKRQLTNYEKDKLALKNTKARLKIKE-------KDYRDLEWEHEVLEQRFSKVEEERNQLYQKFVKAINEVHQKSGLKNVLLERKLNTLTESLEKKEAQLNEVLSASNLDPNALAIVTRKLEDVLDSKNSAIKDLQYELARVCKAHNDQLRTYEAKLAQFGIPSEELGFKPLESTVG-NQSLGYGPAGLVSAP 1538
            P +IDG+ + +M++E+LE ++V +R EL++ER ERN+FQLERDK+  FWEIT RQLEE K  +RNKD E+E+SEEKHQ E+KVY+QKVKHLMY H    +  +AE  A++ L E   + ++ +L+  N  LK  ++ +QL +E+ IK LK  YE+ +T +R DF ++ KE++  +  KM+ QR+E++LRRK++IHEIEERKN QI TL+++H++AF  +KN+YN+ITLNN+ +I TLKE +E + +K   TE  +     E       L+K  E  N+L+  L    K +  L N +   +I         K+ ++L  E+E++  RF  +E ER+ +  K  K + E+ QK GL+N++LERK+ +L + LEKKE QL  ++++S++D  A+ +V   +E+VL +KN  I++L+YE+AR+ K+H +    +E  LA+     E +GF+ ++     N  LG GPAGLVS P
Sbjct:   20 PIIIDGVVTNDMSREELETYIVTIRRELDKERHERNFFQLERDKVVNFWEITLRQLEEAKISLRNKDTELEDSEEKHQLELKVYRQKVKHLMYEHENVEANTKAEKSAAVMLTENYFKLDKIDLRQHNMNLKNQLRTKQLESEESIKILKRDYESQLTKLREDFIQKSKELDSIYQDKMRTQREELNLRRKSDIHEIEERKNNQIRTLIEHHDEAFRAMKNFYNEITLNNINIIKTLKENIESLRKKLLSTENKLEYTSQE-------LKKKTELVNKLEYTLVALTKTQALLDNERMAHRIANGHVNRLTKENKELNLENELISTRFDNLERERSTVRDKCEKILLEIQQKCGLQNLILERKIFSLKDELEKKEMQLYHIIASSDMDAKAIKVVKHHVEEVLKNKNDTIRNLEYEMARIVKSHTEMKGAFENYLAEMNQYVENVGFEMVKCKATENMHLGKGPAGLVSVP 483          
The following BLAST results are available for this feature:
BLAST of Growth arrest-specific protein 8 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
GAS80.000e+065.30growth arrest specific 8 [Source:HGNC Symbol;Acc:H... [more]
GAS80.000e+065.93growth arrest specific 8 [Source:HGNC Symbol;Acc:H... [more]
GAS84.885e-17063.45growth arrest specific 8 [Source:HGNC Symbol;Acc:H... [more]
GAS81.249e-3375.53growth arrest specific 8 [Source:HGNC Symbol;Acc:H... [more]
GAS81.363e-1456.67growth arrest specific 8 [Source:HGNC Symbol;Acc:H... [more]
back to top
BLAST of Growth arrest-specific protein 8 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Growth arrest-specific protein 8 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 3
Match NameE-valueIdentityDescription
Gas83.963e-9541.59gene:FBgn0029667 transcript:FBtr0070589[more]
Gas83.963e-9541.59gene:FBgn0029667 transcript:FBtr0344969[more]
Gas83.675e-9041.72gene:FBgn0029667 transcript:FBtr0343540[more]
back to top
BLAST of Growth arrest-specific protein 8 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 1
Match NameE-valueIdentityDescription
gas82.461e-17061.64growth arrest-specific 8 [Source:NCBI gene;Acc:323... [more]
back to top
BLAST of Growth arrest-specific protein 8 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 4
Match NameE-valueIdentityDescription
gas80.000e+071.21growth arrest specific 8 [Source:NCBI gene;Acc:100... [more]
gas80.000e+071.21growth arrest specific 8 [Source:NCBI gene;Acc:100... [more]
gas80.000e+071.21growth arrest specific 8 [Source:NCBI gene;Acc:100... [more]
gas82.685e-17871.08growth arrest specific 8 [Source:NCBI gene;Acc:100... [more]
back to top
BLAST of Growth arrest-specific protein 8 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 2
Match NameE-valueIdentityDescription
Gas80.000e+065.37growth arrest specific 8 [Source:MGI Symbol;Acc:MG... [more]
Gas86.017e-17064.58growth arrest specific 8 [Source:MGI Symbol;Acc:MG... [more]
back to top
BLAST of Growth arrest-specific protein 8 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|O95995|DRC4_HUMAN0.000e+065.30Dynein regulatory complex subunit 4 OS=Homo sapien... [more]
sp|Q60779|DRC4_MOUSE0.000e+065.37Dynein regulatory complex subunit 4 OS=Mus musculu... [more]
sp|Q499U4|DRC4_RAT0.000e+065.15Dynein regulatory complex subunit 4 OS=Rattus norv... [more]
sp|A5D7M3|DRC4_BOVIN0.000e+064.22Dynein regulatory complex subunit 4 OS=Bos taurus ... [more]
sp|F1QNW4|DRC4_DANRE1.858e-16961.64Dynein regulatory complex subunit 4 OS=Danio rerio... [more]
back to top
BLAST of Growth arrest-specific protein 8 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A267FZB30.000e+074.41GAS domain-containing protein OS=Macrostomum ligna... [more]
R7UQI70.000e+073.25GAS domain-containing protein OS=Capitella teleta ... [more]
A0A267G0N40.000e+074.41GAS domain-containing protein (Fragment) OS=Macros... [more]
V4C0V60.000e+074.41GAS domain-containing protein OS=Lottia gigantea O... [more]
A0A1S3I2D00.000e+073.49growth arrest-specific protein 8 OS=Lingula unguis... [more]
back to top
BLAST of Growth arrest-specific protein 8 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 4
Match NameE-valueIdentityDescription
gas80.000e+067.89growth arrest specific 8 [Source:NCBI gene;Acc:103... [more]
ENSAMXT00000032361.15.160e-7242.58pep primary_assembly:Astyanax_mexicanus-2.0:7:8367... [more]
ENSAMXT00000056091.12.375e-2943.01pep primary_assembly:Astyanax_mexicanus-2.0:7:8376... [more]
ENSAMXT00000035259.18.754e-2340.97pep primary_assembly:Astyanax_mexicanus-2.0:7:8375... [more]
back to top
BLAST of Growth arrest-specific protein 8 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 2
Match NameE-valueIdentityDescription
gas81.538e-13571.77growth arrest-specific 8 [Source:NCBI gene;Acc:323... [more]
ENSPMAT00000009647.14.261e-3380.95pep scaffold:Pmarinus_7.0:GL477881:512079:514388:1... [more]
back to top
BLAST of Growth arrest-specific protein 8 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Growth arrest-specific protein 8 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 1
Match NameE-valueIdentityDescription
EDO416100.000e+071.40Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Growth arrest-specific protein 8 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 2
Match NameE-valueIdentityDescription
ENSORLT00000032278.15.264e-4434.98growth arrest-specific protein 8 [Source:NCBI gene... [more]
ENSORLT00000030131.11.687e-1327.70growth arrest-specific protein 8 [Source:NCBI gene... [more]
back to top
BLAST of Growth arrest-specific protein 8 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 3
Match NameE-valueIdentityDescription
SMESG000013356.10.000e+099.80SMESG000013356.1[more]
SMESG000013356.10.000e+0100.00SMESG000013356.1[more]
SMESG000031912.15.973e-10342.68SMESG000031912.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30015955 ID=SMED30015955|Name=Growth arrest-specific protein 8|organism=Schmidtea mediterranea sexual|type=transcript|length=1605bp
TCTAAATGATTGACATTTATATCACTATTAGTTTCTTTTATTCATTACTT
TTTAAATTACTAGAAACAATAAACATTACTATGCCCCCTAAAAAGAAAAA
GGGAGGAAAGGGTAAAAAGGGTAAAAAGAAGGGAGCAGGTAAGCGAACCC
CCACAGTCATAGATGGTATTCCATCCGAAGAAATGACCAAAGAACAATTG
GAAGATCATGTTGTTCGGCTTCGTGAAGAACTGGAGAGAGAGCGAGAAGA
AAGAAATTATTTTCAATTGGAAAGAGATAAAATCAACACATTTTGGGAAA
TTACAAAACGACAATTGGAAGAAAGAAAAGCTGAGATGCGCAATAAAGAC
AGAGAAATGGAGGAATCTGAAGAAAAACATCAAACTGAGATCAAAGTATA
TAAACAGAAAGTAAAGCATCTCATGTACGGACACAGCCAAAAGGTGTCAC
AACTACAAGCTGAAACAATAGCATCATTAAAGTTGGCTGAAGAAGAGCAT
CGCGGTGAAGAGAGCGAACTGAAAACTGACAATCGAACCCTGAAATGCGA
CATCAAGGAGCAGCAATTATCGAATGAGGATAAAATTAAAGATTTGAAAT
TGAGCTATGAAAACAATATCACTGATATCAGGATGGATTTCGAGCGACAA
GTCAAGGAGATCGAGGTGAAATTCATGAAGAAAATGCAAGTACAAAGAGA
CGAGATGGATTTAAGGAGGAAAAATGAAATCCATGAAATTGAAGAGCGGA
AAAACACTCAAATCAACACCCTGATGAAAAACCACGAGAAAGCTTTCTCT
GACATCAAAAACTACTACAACGACATCACTCTCAATAATTTGGCTTTGAT
TAACACTTTGAAAGAACAAATGGAAGAGATGAACCGAAAACAGGAACGAA
CGGAAAAGTCAATGTCTGAAATTATGACAGAAAACAAACGACTCGTTGAG
CCGTTAAGAAAAGCCCAAGAAGAAAATAATGAATTGAAGCGGCAATTGAC
GAATTATGAAAAAGATAAATTGGCCTTGAAAAATACAAAAGCTCGTTTGA
AGATTAAAGAAAAAGACTATAGAGATCTTGAATGGGAACACGAAGTGCTT
GAACAGAGATTTTCGAAGGTTGAGGAAGAAAGAAACCAATTGTATCAGAA
ATTCGTTAAAGCTATTAATGAAGTTCATCAAAAATCTGGATTGAAAAATG
TGTTATTAGAAAGGAAACTCAATACTTTGACAGAGTCATTAGAAAAGAAA
GAAGCTCAACTTAATGAAGTATTGTCTGCTAGTAATCTTGATCCGAATGC
ATTGGCGATCGTCACTAGGAAATTAGAGGACGTTCTCGATTCCAAAAATA
GTGCCATTAAAGACTTACAATACGAACTCGCGAGGGTTTGCAAAGCACAT
AATGATCAATTGAGAACATATGAAGCTAAACTAGCACAATTCGGTATACC
CTCAGAAGAATTAGGATTTAAACCACTTGAAAGCACCGTTGGCAATCAGT
CTCTTGGTTACGGTCCTGCTGGACTTGTATCTGCTCCGCCATAGAAAAAT
GATTACAATACTTTATGTTGTGAAGATTCTTTATAAATTTTCTTATTGTT
GTGAA
back to top

protein sequence of SMED30015955-orf-1

>SMED30015955-orf-1 ID=SMED30015955-orf-1|Name=SMED30015955-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=513bp
MIDIYITISFFYSLLFKLLETINITMPPKKKKGGKGKKGKKKGAGKRTPT
VIDGIPSEEMTKEQLEDHVVRLREELEREREERNYFQLERDKINTFWEIT
KRQLEERKAEMRNKDREMEESEEKHQTEIKVYKQKVKHLMYGHSQKVSQL
QAETIASLKLAEEEHRGEESELKTDNRTLKCDIKEQQLSNEDKIKDLKLS
YENNITDIRMDFERQVKEIEVKFMKKMQVQRDEMDLRRKNEIHEIEERKN
TQINTLMKNHEKAFSDIKNYYNDITLNNLALINTLKEQMEEMNRKQERTE
KSMSEIMTENKRLVEPLRKAQEENNELKRQLTNYEKDKLALKNTKARLKI
KEKDYRDLEWEHEVLEQRFSKVEEERNQLYQKFVKAINEVHQKSGLKNVL
LERKLNTLTESLEKKEAQLNEVLSASNLDPNALAIVTRKLEDVLDSKNSA
IKDLQYELARVCKAHNDQLRTYEAKLAQFGIPSEELGFKPLESTVGNQSL
GYGPAGLVSAPP*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: molecular function
TermDefinition
GO:0008017microtubule binding
GO:0017137Rab GTPase binding
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000016pharynx
PLANA:0000020protonephridia
PLANA:0000034epidermis
PLANA:0000099neuron
PLANA:0000106ciliated epithelial cell
PLANA:0000418head
PLANA:0002032epidermal cell
Vocabulary: INTERPRO
TermDefinition
IPR039308GAS8
IPR025593GAS8_dom
Vocabulary: cellular component
TermDefinition
GO:0031514motile cilium
Vocabulary: biological process
TermDefinition
GO:0048870cell motility
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
NoneNo IPR availableCOILSCoilCoilcoord: 55..91
NoneNo IPR availableCOILSCoilCoilcoord: 94..124
NoneNo IPR availableCOILSCoilCoilcoord: 398..425
NoneNo IPR availableCOILSCoilCoilcoord: 278..382
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 30..45
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 28..60
NoneNo IPR availablePANTHERPTHR31543:SF0DYNEIN REGULATORY COMPLEX SUBUNIT 4coord: 26..491
IPR025593Growth arrest-specific protein 8 domainPFAMPF13851GAScoord: 255..454
e-value: 2.6E-82
score: 275.0
IPR039308Growth arrest-specific protein 8PANTHERPTHR31543FAMILY NOT NAMEDcoord: 26..491