SMED30015944

Overview
NameSMED30015944
Smed IDSMED30015944
Length (bp)3034
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of SMED30015944 (SMED30015944) t-SNE clustered cells

Violin plots show distribution of expression levels for SMED30015944 (SMED30015944) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of SMED30015944 (SMED30015944) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for SMED30015944 (SMED30015944) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30015944

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 1

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
X2 cellSMED30015944 SmedASXL_003910SmedAsxl_ww_GCZZ01PMID:26114597
Zhu et al., 2015
FACS sorted cell population asexual adult RNA-sequencing evidence
Note: Hover over icons to view figure legend
Alignments
SMED30015944 aligns in the following genomic locations:
Alignment LocationAlignment Score
v31.000309:34494..37560 +14783
Homology
BLAST of SMED30015944 vs. TrEMBL
Match: A0A077ZLU6 (Poly(A) RNA polymerase, mitochondrial OS=Trichuris trichiura OX=36087 GN=TTRE_0000904401 PE=4 SV=1)

HSP 1 Score: 60.4622 bits (145), Expect = 1.152e-15
Identity = 49/178 (27.53%), Postives = 88/178 (49.44%), Query Frame = 3
Query:  744 TYLSNPINRLSYLCVIIKQIYLYEGVLFDRPNIYFTGFKIVALVLHFLQYK--KLIPSLENIVNSN------QEDQITRPDLGDLLIEFFQYMI-KFN-PNFAIDLSRGCLVAKSQDVFLQCNFHFDPSLNITSNIGKDQWIKFTESNKNILKTLKVDNHAKI-----WGLASFIDSN 1232
            T L   I RL +   +I++     G++   P  + + F+++ LV  F+Q +   L+PS++ +++ +      Q      P+  +LLIEFF++   + N  N A+DLS G L AK++   +      + S NIT N+   +W +  E  +  +K L+  N  +      WGL S +D +
Sbjct:  224 TILQPSIKRLLF---VIRRWAREIGLIRQHPGTWLSNFQLICLVAFFMQCRNPPLLPSIDMVLSQSSALNKWQRSVKCSPEPRELLIEFFRFFTSQVNYENQALDLSTGQLTAKTEFAPIVILNPMEDSHNITRNVESGEWQRCLECMEVAIKLLERSNSCRPDAGTQWGLLSLLDPS 398          

HSP 2 Score: 54.6842 bits (130), Expect = 1.152e-15
Identity = 52/217 (23.96%), Postives = 97/217 (44.70%), Query Frame = 2
Query:  131 GIIDLIHWPYNYISLLKCSSDINFKEILTQLKCNYSDFRMFHETEHFRRVDQSKLNDALTYIKSSVNYVEIDKSPKLLREKLNSGVCLNDHINIFYDFYKLSEHEIDLRNCYESFVNSSVRKLLPHSNVRIFGSTLSRLGKFDSDLDMKIILNERN--YQPCQS----IEILKSIASKLQTDNP---YMVKSFVIPCRFPILHYFDSVLSLNVDISI 754
            GI+  IH       LL+C   +  K +L ++  ++ +     E+   + V  +   D  +  K +  +  +D     L   L     +ND I   Y   ++S+  + LR    S +  +VR+L P S  R FGST++   +   DLD+ + LN     Y+P        + L +I + L++  P   ++VK  ++  R PI+      L ++ D+++
Sbjct:    3 GILQEIH-------LLECKDCVQVKRLLEEVNHHFQNRVFPWESRMIKHVPAAGCRDLHSIPKLTFPFEIVDSIS--LEGTLREVQSVNDQIEQLYQKTRISKEGLRLRFFLTSLIEDAVRRLFPQSICRPFGSTVNGFAQKGCDLDINVQLNPDGLKYRPTNERSYIQQTLCAIGAVLESFFPCAEHVVK--ILNARVPIVKLSSRSLGISCDLTL 208          
BLAST of SMED30015944 vs. TrEMBL
Match: A0A1D1VQ97 (Uncharacterized protein OS=Ramazzottius varieornatus OX=947166 GN=RvY_14128-1 PE=4 SV=1)

HSP 1 Score: 51.2174 bits (121), Expect = 8.589e-12
Identity = 39/130 (30.00%), Postives = 59/130 (45.38%), Query Frame = 3
Query:  765 NRLSYLCVIIKQIYLYEGVLFDRPNIYFTGFKIVALVLHFLQYKKLIPSL----ENIVNSNQEDQITRP--DLGDLLIEFFQYMIKFN-PNFAIDLSRGCLVAKSQDVFLQCNFHFDPSLNITSNIGKDQ 1133
             RL  L V +K+      +    P  + + F +  LV+ F+QYKKL+P L     +I    +E Q  RP  DL  LL+EFF++   F     AI +  G    K     L      +  LN++ N+  D+
Sbjct:  352 ERLRALVVTVKRWAAVADLTNPTPGRWISNFTLTILVVFFMQYKKLLPPLNKVKRDISEMKKEMQSIRPETDLQSLLLEFFEFYSSFPYKTQAISVIEGVSYTKPDYSSLYIENPVETELNVSKNLSADE 481          

HSP 2 Score: 50.8322 bits (120), Expect = 8.589e-12
Identity = 36/153 (23.53%), Postives = 72/153 (47.06%), Query Frame = 2
Query:  359 LLREKLNSGVCLNDHINIFYDFYKLSEHEIDLRNCYESFVNSSVRKLLPHSNVRIFGSTLSRLGKFDSDLDMKIILNERNYQPCQSIEILKSIASKLQTDN----------------PYMVKSF-----VIPCRFPILHYFDSVLSLNVDISI 754
            L+ ++L     +++ I +FY   +++E  I LR    + +  ++  + P S V +FGS+++  GK DSD+D+ +  +  + +  QS +     ASKL   N                 Y++  +     ++  R PI+ +   V  ++ D+SI
Sbjct:  180 LINQRLKETENMSEQIQLFYTHSQITETAIRLRYFISTQIEDAISGIFPWSRVYLFGSSVNGFGKQDSDVDLILDYDVGHTEKVQSDKSSLKFASKLTAGNDRVQTQRSLELLADHLQYLLPGYAQVQRILLARVPIVKFVHEVSGVHCDLSI 332          
BLAST of SMED30015944 vs. TrEMBL
Match: A0A0B1PQT5 (RNA polymerase Rpb3/Rpb11 dimerization domain protein OS=Trichuris suis OX=68888 GN=D918_07459 PE=4 SV=1)

HSP 1 Score: 50.447 bits (119), Expect = 3.264e-10
Identity = 50/222 (22.52%), Postives = 97/222 (43.69%), Query Frame = 2
Query:  167 ISLLKCSSDINFKEILTQLKCNYSDFRMFHETEHFRRVDQSKLND-----ALTYIKSSVNYVEIDKSPKLLREKLNSGVCLNDHINIFYDFYKLSEHEIDLRNCYESFVNSSVRKLLPHSNVRIFGSTLSRLGKFDSDLDMKIILNE--------------RNYQPCQS----IEILKSIASKLQTDNP---YMVKSFVIPCRFPILHYFDSVLSLNVDISI 754
            I L +C   +  K +L ++   +       E+   + V  +   D      LT+   +V+Y+ ++ +   LRE  +    +ND I   Y   ++S+  + LR    S +   +R+L P S  R FGST++   +   DLD+ + LN                 Y+P        + L +I + L++  P   ++VK  ++  R PI+   +  L ++ D+++
Sbjct:   38 IHLFECKDAVQVKRLLEEVNHRFQSRVFPWESRVIKHVSAAGCRDIHSIPKLTFPFETVDYISLEGT---LREVES----VNDQIEQLYQKTRISKEGLRLRFFLTSIIEDVIRRLFPQSICRPFGSTVNGFAQKGCDLDVNMQLNPDGLKVSSGSQFYFCAKYRPANERSYIQQTLSTIGAVLESFIPCTEHVVK--ILNARVPIIKLSNRSLGISCDLTL 250          

HSP 2 Score: 45.8246 bits (107), Expect = 3.264e-10
Identity = 40/152 (26.32%), Postives = 70/152 (46.05%), Query Frame = 3
Query:  816 GVLFDRPNIYFTGFKIVALVLHFLQYK--KLIPSLENIVNSN------QEDQITRPDLGDLLIEFFQYMI-KFN-PNFAIDLSRGCLVAKSQDVFLQCNFHFDPSLNITSNIGKDQWIKFTESNKNILKTLKVDNHAKIWGLASFIDSNETL 1241
            G+    P  + + F+++ LV  F+Q +   L+PS++ ++  +      Q      P+  +LLIEFF++   + N  N A+DL  G L  K++   +      + S NIT N+   +W +  E  +  +K L+     K    A      ETL
Sbjct:  287 GLTRQHPGTWLSNFQLICLVAFFMQCRNPPLLPSIDVLLRQSSTLDKWQRSVKCSPEPCELLIEFFRFFTSQVNYENQALDLFAGQLTPKTEFAPIVIWNPMEDSHNITRNVESSEWQRCLECMEVAIKLLERSKGCKPAENADVEHGAETL 438          
BLAST of SMED30015944 vs. TrEMBL
Match: A0A1B6EP16 (Uncharacterized protein (Fragment) OS=Cuerna arida OX=1464854 GN=g.19903 PE=4 SV=1)

HSP 1 Score: 45.8246 bits (107), Expect = 5.221e-7
Identity = 42/199 (21.11%), Postives = 85/199 (42.71%), Query Frame = 2
Query:  224 KCNYSDFRMFHETEHFRRVDQSKLNDALTYIKSSVNYVEIDKSPKLLREKLNSGV----CLNDHINIFYDFYKLSEHEIDLRNCYESFVNSSVRKLLPHSNVRIFGSTLSRLGKFDSDLDMKIILNERNYQPCQSIEIL----KSIASKLQTDN-----PYMVKSFVIPC---------RFPILHYFDSVLSLNVDISI 754
            +C Y+D      T       ++K    +T   S  N   +  SP + R +L+  +     ++D + + Y   +L E  + LR      +  +V  L P + V +FGS+++  G+   DLD+ + L++ + +  +   ++     S+ ++ QT         +V+ F+  C         R PI+ Y      +  D+S+
Sbjct:  131 ECGYNDRSQIIPTYSRMLWFRAKQKKNITSNSSQTNVPLVSSSPPVTRAQLHEWLGQSDSVSDQLTLLYQATRLDELGVRLRYITAHQLELAVSGLFPRARVLLFGSSVNGFGRQGCDLDLVLQLDQGSEEEERKCRLMFHAKPSVNARSQTQRHIDGLADLVQWFLPGCTDVRRILLARVPIVKYRQEFTDMECDLSL 329          

HSP 2 Score: 39.6614 bits (91), Expect = 5.221e-7
Identity = 48/223 (21.52%), Postives = 86/223 (38.57%), Query Frame = 3
Query:  768 RLSYLCVIIKQIYLYEGVLFDRPNIYFTGFKIVALVLHFLQYKKLIPSLENIVN-SNQEDQITRPD---------------------LGDLLIEFFQYMIKFN-PNFAIDLSRGCLVAKSQDVFLQCNFHFDPSLNITSNIGKDQWIKFTESNKNILKTLKVDNHAKIWGLASFIDSNETLWKTSSFNN*CGVILMINNNLYF-------KFY*SANRNEINL 1346
            RL  L   +++     G+    P  + T F +  LV+ +LQ  K++PSL+ +   + + D+    D                     L  LL+ FF+Y   F+     I L  G  + K     L      +  LN++ N+  ++            + L++++    W L S  D NE   +TS +    G++ +  +N +        +FY    RN   L
Sbjct:  350 RLQPLAFTVRRWAAEIGLTNPSPGRWITNFSLTLLVIFYLQRVKVLPSLDTLRKLAGKSDRRVTEDGVNCSFLRDITHLSPSDNTSSLESLLLGFFEYYSAFDFATQGISLGPGAPIKKRDHAALYIANPLETHLNVSQNVSLEE-----------TERLRIESRNAAWELESSSD-NEDRERTSEW----GLLRLFKDNKFAEKAKQFEQFYSPKKRNSSRL 556          
BLAST of SMED30015944 vs. TrEMBL
Match: A0A336LRV6 (CSON010597 protein (Fragment) OS=Culicoides sonorensis OX=179676 GN=CSON010597 PE=4 SV=1)

HSP 1 Score: 45.8246 bits (107), Expect = 1.027e-6
Identity = 40/150 (26.67%), Postives = 66/150 (44.00%), Query Frame = 2
Query:  362 LREKLNSGVCLNDHINIFYDFYKLSEHEIDLRNCYESFVNSSVRKLLPHSNVRIFGSTLSRLGKFDSDLDMKIILNER-----------------NYQPCQSIEILKSIASKLQTDNPYM--VKSFVIPCRFPILHYFDSVLSLNVDISI 754
            + E L S   L D +NI +   KLS+  I LR        +S+  + P++    FGS+++  GK   DLD+ + L +                  N    Q+   ++S+   LQ   P +  V+  ++  R PI+ Y    L L VD+S+
Sbjct:  113 IAEWLTSAESLKDQMNIVFQSTKLSDLGIRLRFLAAQQAQNSIVGMFPNAYAHPFGSSVNGFGKEGCDLDLILRLEKEEVETKESRLVFHTKANLNNGRTQAQRYMESVGDILQLFLPGVNNVRR-ILQARVPIIKYNHEYLDLEVDLSM 261          

HSP 2 Score: 38.5058 bits (88), Expect = 1.027e-6
Identity = 40/188 (21.28%), Postives = 77/188 (40.96%), Query Frame = 3
Query:  765 NRLSYLCVIIKQIYLYEGVLFDRPNIYFTGFKIVALVLHFLQYKK--LIPSLENIVNSNQEDQITRPDLG-----------------------DLLIEFFQYMIKFN-PNFAIDLSRGCLVAKSQDVFLQCNFHFDPSLNITSNIGKDQWIKFTESNKNILKTLKVD-----NHAKIWGLASFIDSNE 1235
            NR+  L   I++     G+    P  + + F +  LVL+FLQ  K  ++PS+ + +   ++  +   + G                       +LL EFF++   F+  N  I L+    + K     +      +P LN++ N+  ++  +F    +N    L+ D     N  + WGL +   +N+
Sbjct:  281 NRVRPLVFCIRRWAKSTGLTNPSPGRWISNFSLTLLVLYFLQALKQPILPSINHFIKKARKQDMRVTEDGINCTFLRDLNLLDFKVKNTSSIDELLREFFEFYSSFDFNNRGISLNEAKSILKPDHSAMYIVNPLEPLLNVSKNLSLEETERFRIEVRNAAWILESDLQSSKNAGEPWGLVNLFKTNQ 468          
BLAST of SMED30015944 vs. Planmine SMEST
Match: SMESG000075926.1 (SMESG000075926.1)

HSP 1 Score: 350.903 bits (899), Expect = 0.000e+0
Identity = 172/177 (97.18%), Postives = 174/177 (98.31%), Query Frame = 2
Query:  248 MFHETEHFRRVDQSKLNDALTYIKSSVNYVEIDKSPKLLREKLNSGVCLNDHINIFYDFYKLSEHEIDLRNCYESFVNSSVRKLLPHSNVRIFGSTLSRLGKFDSDLDMKIILNERNYQPCQSIEILKSIASKLQTDNPYMVKSFVIPCRFPILHYFDSVLSLNVDISIKPDKSLEL 778
            MFHETEHFRRVDQSKLNDALTYIKSSVNYVEIDKSPK LREKLNSGVCLNDHINIFYDFYKLSEHEIDLRNCYESFVNSSVRKLLPHSNVRIFGSTLSRLGKFDSDLDMKIILNERNYQPCQSI+ILKSI SKLQTDNPYMVKSFVIPCRFPILHYFD VLSLNVDISIKPDKSLE+
Sbjct:    1 MFHETEHFRRVDQSKLNDALTYIKSSVNYVEIDKSPKFLREKLNSGVCLNDHINIFYDFYKLSEHEIDLRNCYESFVNSSVRKLLPHSNVRIFGSTLSRLGKFDSDLDMKIILNERNYQPCQSIQILKSIESKLQTDNPYMVKSFVIPCRFPILHYFDGVLSLNVDISIKPDKSLEV 177          

HSP 2 Score: 337.806 bits (865), Expect = 0.000e+0
Identity = 164/164 (100.00%), Postives = 164/164 (100.00%), Query Frame = 3
Query:  774 SYLCVIIKQIYLYEGVLFDRPNIYFTGFKIVALVLHFLQYKKLIPSLENIVNSNQEDQITRPDLGDLLIEFFQYMIKFNPNFAIDLSRGCLVAKSQDVFLQCNFHFDPSLNITSNIGKDQWIKFTESNKNILKTLKVDNHAKIWGLASFIDSNETLWKTSSFNN 1265
            SYLCVIIKQIYLYEGVLFDRPNIYFTGFKIVALVLHFLQYKKLIPSLENIVNSNQEDQITRPDLGDLLIEFFQYMIKFNPNFAIDLSRGCLVAKSQDVFLQCNFHFDPSLNITSNIGKDQWIKFTESNKNILKTLKVDNHAKIWGLASFIDSNETLWKTSSFNN
Sbjct:  192 SYLCVIIKQIYLYEGVLFDRPNIYFTGFKIVALVLHFLQYKKLIPSLENIVNSNQEDQITRPDLGDLLIEFFQYMIKFNPNFAIDLSRGCLVAKSQDVFLQCNFHFDPSLNITSNIGKDQWIKFTESNKNILKTLKVDNHAKIWGLASFIDSNETLWKTSSFNN 355          
BLAST of SMED30015944 vs. Planmine SMEST
Match: SMESG000035609.1 (SMESG000035609.1)

HSP 1 Score: 117.087 bits (292), Expect = 3.206e-50
Identity = 66/153 (43.14%), Postives = 97/153 (63.40%), Query Frame = 3
Query:  780 LCVIIKQIYLYEGVLFDRPNIYFTGFKIVALVLHFLQYKKLIPSLENIVNSNQEDQI-TRPDLGDLLIEFFQYMIKFNPN-FAIDLSRGCLVAKSQDVFLQCNFHFDPSLNITSNIGKDQWIKFTESNKNILKTLKV--DNHAKIWGLASFID 1226
            LC+ IKQIY  + ++ + PN YFTGFKIV+L++HFLQ +KLIP +++I  S  E  I +  DLG LL++FF+Y I F+P+ + IDL  G L+ KS++ FL C+F    + N+T  +  +QW  F  +N  IL  L V  + +   WGL  F +
Sbjct:  207 LCMAIKQIYFNQNIIKNSPNFYFTGFKIVSLIIHFLQSEKLIPPIKSI--SETEIAIKSHKDLGVLLMDFFRYYIDFDPHKYQIDLDEGKLLPKSRNAFLLCSFSSHMTRNVTKGVKSNQWEIFNHTNIKILADLSVTIEENPHHWGLWKFCN 357          

HSP 2 Score: 102.834 bits (255), Expect = 3.206e-50
Identity = 59/161 (36.65%), Postives = 98/161 (60.87%), Query Frame = 2
Query:  293 LNDALTYIKSSVNYVEIDKSPKLLREKLNSGVCLNDHINIFYDFYKLSEHEIDLRNCYESFVNSSVRKLLPHSNVRIFGSTLSRLGKFDSDLDMKIILNERNYQPCQSIEILKSIASKLQTDNPYMVKSF-VIPCRFPILHYFDSVLSLNVDISIKPDKSL 772
            +N+  + +KS  NYVEI+KS     +     + L++ I  FY+FY++SE+++ LRNCY   ++ +++   P+  ++I GST++ LGK++SDLDMKI+  +   +       L  IA  L  +    +KS  +    +PI +YFD++L +NVDISI PD S+
Sbjct:   30 VNNRSSIVKSIENYVEINKSLPAFVKYRKDALSLSEQIMYFYNFYRMSEYDMKLRNCYADIIDETLKIYCPNFCIKIVGSTVNGLGKYNSDLDMKIMHFDLGRETAH--RYLGKIAYGLSHNPKLKLKSLKIFNGTYPICNYFDNILDVNVDISILPDSSI 188          
BLAST of SMED30015944 vs. Planmine SMEST
Match: SMESG000034768.1 (SMESG000034768.1)

HSP 1 Score: 56.6102 bits (135), Expect = 1.607e-9
Identity = 25/57 (43.86%), Postives = 39/57 (68.42%), Query Frame = 2
Query: 2588 VMKLTRTKCIVKVPIHGSDGDFSAVEKRK*TAEVVGNDPRWNITTW*YCRVAYRYHK 2758
            ++++  TK I+ VPI+GSDG F  V K +   EV GNDPRW+ TTW   +++ ++H+
Sbjct:   14 ILEVNTTKLIITVPIYGSDGKFIGVTKGEGITEVEGNDPRWDTTTW---QISTQHHR 67          
BLAST of SMED30015944 vs. Planmine SMEST
Match: SMESG000066834.1 (SMESG000066834.1)

HSP 1 Score: 46.2098 bits (108), Expect = 7.492e-9
Identity = 26/51 (50.98%), Postives = 36/51 (70.59%), Query Frame = 2
Query: 2471 KFRQDMAQYHKKVITQSQQAKSIIR*CRWXXXXXXRLDQVMKLTRTKCIVK 2623
            KFRQD+A YH K + QSQ+A+++IR CR MEE   R +Q  KLT+   ++K
Sbjct:   40 KFRQDVAYYHDKALEQSQRAEAMIRLCRRMEETWTRPEQAKKLTQHNNLLK 90          

HSP 2 Score: 34.2686 bits (77), Expect = 7.492e-9
Identity = 17/35 (48.57%), Postives = 25/35 (71.43%), Query Frame = 3
Query: 2610 NVLLKSQYMEVMAIFQQLKRGNEQLKLSETIRDGI 2714
            N LLKSQY E+    +++K+ ++QLKL ET R+ I
Sbjct:   86 NNLLKSQYSEMAIELEKIKKEDQQLKLKETFRNEI 120          
BLAST of SMED30015944 vs. Planmine SMEST
Match: SMESG000034009.1 (SMESG000034009.1)

HSP 1 Score: 43.5134 bits (101), Expect = 1.408e-8
Identity = 27/65 (41.54%), Postives = 38/65 (58.46%), Query Frame = 3
Query: 2610 NVLLKSQYMEVMAIFQQLKRGNEQLKLSETIRDGILQHGS------TAESHIDTTSQQPNHSHES 2786
            N LLKSQ  E+ A  ++LKR N+QLK  ETIR+ I  H S      T  + +  +S +PN S+ +
Sbjct:  109 NELLKSQLAEMEAKIEKLKRKNQQLKFKETIRNEIRNHSSMTTIVETNLTWLIPSSSRPNTSNNT 173          

HSP 2 Score: 30.4166 bits (67), Expect = 1.408e-8
Identity = 13/27 (48.15%), Postives = 18/27 (66.67%), Query Frame = 2
Query: 2471 KFRQDMAQYHKKVITQSQQAKSIIR*C 2551
            KF +D+  YH K + Q+ QA+ IIR C
Sbjct:   63 KFLRDVPYYHDKALEQNHQAEFIIRRC 89          

HSP 3 Score: 24.6386 bits (52), Expect = 1.408e-8
Identity = 15/31 (48.39%), Postives = 20/31 (64.52%), Query Frame = 1
Query: 2815 KTKPSKPRSGKPERGRK*RLKPVRLLVQIRK 2907
            K K +KPR  K +  R+ RLK  RL+ QI+K
Sbjct:  178 KPKHNKPRLSKAKWERRRRLKSARLMGQIKK 208          
The following BLAST results are available for this feature:
BLAST of SMED30015944 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30015944 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30015944 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30015944 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30015944 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30015944 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30015944 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30015944 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A077ZLU61.152e-1527.53Poly(A) RNA polymerase, mitochondrial OS=Trichuris... [more]
A0A1D1VQ978.589e-1230.00Uncharacterized protein OS=Ramazzottius varieornat... [more]
A0A0B1PQT53.264e-1022.52RNA polymerase Rpb3/Rpb11 dimerization domain prot... [more]
A0A1B6EP165.221e-721.11Uncharacterized protein (Fragment) OS=Cuerna arida... [more]
A0A336LRV61.027e-626.67CSON010597 protein (Fragment) OS=Culicoides sonore... [more]
back to top
BLAST of SMED30015944 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30015944 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30015944 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30015944 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30015944 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30015944 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000075926.10.000e+097.18SMESG000075926.1[more]
SMESG000035609.13.206e-5043.14SMESG000035609.1[more]
SMESG000034768.11.607e-943.86SMESG000034768.1[more]
SMESG000066834.17.492e-950.98SMESG000066834.1[more]
SMESG000034009.11.408e-841.54SMESG000034009.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30015944 ID=SMED30015944|Name=SMED30015944|organism=Schmidtea mediterranea sexual|type=transcript|length=3034bp
GTCTTATCGAAATCTATTTAAAAATTATATGAAAATGAAATTAAATAATC
AGCGATCAATCCAAAATACCATTATATTTTATAATGGCTTTCTGTCATTG
CCTGATATTATTCACAAATTCAAAACATCTGGTATTATTGACCTAATCCA
CTGGCCCTATAATTATATTTCATTGTTAAAATGTTCGTCGGATATTAATT
TTAAAGAAATCTTAACTCAGCTTAAATGTAACTACTCAGATTTCAGAATG
TTTCATGAAACAGAACATTTTCGTCGAGTTGATCAATCCAAACTAAATGA
TGCACTAACTTATATAAAGTCATCTGTAAATTATGTTGAAATCGATAAGT
CACCAAAGCTTTTACGGGAAAAGCTTAACAGTGGCGTTTGTCTAAATGAT
CATATCAACATTTTTTATGATTTTTATAAACTTTCGGAACACGAAATTGA
TTTACGAAATTGTTATGAAAGCTTTGTCAACAGCAGCGTCCGTAAATTAT
TACCACATTCAAATGTGCGAATATTTGGTTCAACGTTAAGTAGATTGGGT
AAATTTGATAGCGATTTAGACATGAAAATTATTTTAAATGAAAGAAATTA
TCAACCATGTCAAAGTATTGAAATTTTGAAATCGATTGCATCAAAACTTC
AAACTGATAATCCCTATATGGTTAAGTCATTTGTTATTCCTTGTAGGTTT
CCGATTCTCCATTATTTCGATAGTGTATTGAGTTTAAATGTCGACATATC
TATCAAACCCGATAAATCGCTTGAGTTATCTATGTGTGATCATTAAGCAA
ATCTATCTGTACGAAGGCGTATTATTCGATAGGCCAAATATTTATTTCAC
TGGTTTCAAAATCGTCGCATTAGTTTTGCATTTTTTACAATATAAGAAAT
TAATTCCTTCATTAGAAAATATTGTTAATTCCAACCAAGAAGATCAAATA
ACCAGACCCGATTTGGGGGATTTGTTGATCGAGTTTTTCCAGTACATGAT
TAAATTCAATCCCAATTTTGCGATAGATCTTAGTCGAGGTTGCCTCGTTG
CCAAATCACAAGACGTTTTCCTCCAGTGTAATTTTCATTTCGATCCTTCT
TTAAACATTACATCAAATATCGGTAAAGATCAATGGATTAAATTTACAGA
AAGTAACAAAAATATATTAAAAACCCTTAAGGTTGATAATCACGCTAAAA
TTTGGGGGCTTGCATCATTTATTGATTCAAATGAAACCTTGTGGAAAACG
AGCTCATTCAATAATTAATGCGGAGTTATTTTAATGATCAATAATAATCT
ATATTTTAAATTTTATTAATCAGCCAATAGGAACGAGATTAATCTCAACG
AATTCTGAAGGTTTGTTTTGAGGTTTGTAGACATCGAGTATTAAGGAGAA
ATTTTGTTAGTATTGAATTGAGATTGGTTGAATTTTGTTATATTGTGCTG
ATCGATTTTAAAGAGTATAATGGAAATTAATTTGTTTCTAGGTACCCCAT
GTGTTACTTACACTAAAATCAGATTTAAAATTTTGAGTCTCGCACACAAT
AACGGCTTGACATTTTTTTCAACTCTTTCAAAGCGAAAGCTACTCTGTAT
TGTTATGGATTTCCAAAATACTTGTTTTCTATATCGGCCGATGTCATAGC
AATGTTACTGTAGGAATCGATAGATGACATCACTAGTATTGCATTAAAAG
TGTGGTACTGCGCTAATTACCACAAGGCTGATAAAAAGAATTTTGGATCA
GTTAAAAAACGCCAAATTTAAAAACTGACAATAACTTAAAAATTACACTA
AGAAAAAAATTAATTTAAATGTCATTTTTAAAATACTTAAATTTTTGATA
ACTGTTTAATTAAATTCAAACAGTATATTTTTATGATTCCATTTTCAAAC
AAATTTATGTAAGGAACTTAGGTCTCAAATTAGTCTTACTGCCTTGTCTT
TTTTTATCTACAGCTTTAACTTATTACACATGTTTCCGTTCATTAAAAAC
TCCTATAGTAGAAAAATTTGATTTTACCTCTCACAATGAGACGGTATGTT
GAATGAAGAAATTTCTTTCTTAAACTAAATTGGAATTTCTTGTTTCAATT
CACTCCTTTATTATCTGAGTTTTATAGGGTTCTATCATTAATATGGTCGA
ATGTGAGAGTTTTACATGAATTTTTAACACGGGGTTTCAATACAAATGTT
TGGATATTGTAATTGTTTGAAGCCAAATTGAAGATTTAGGAAATAATGTA
GGCAAAGACCCTGCTAATTTGTTTTTATAGTCGTCGATTTCAAATCGAAA
TCAAATTACTATCCATTGATTTGATAATCTGATTACATTTTTATTAATCA
CTTATAATTCGTCTGAAGCTAGACTCAATAGTCTGTAGTCATCGTTGTCA
TTGTAAATTTGATTCCCAAAATTGATGCCTTAGCTTAAATTGATTATAAA
CTAATTAAATTTTTGATATAAAATTTCGCCAAGATATGGCTCAGTACCAC
AAGAAGGTTATAACTCAGTCGCAACAAGCTAAATCTATAATCCGCTGATG
CAGATGGATGGAGGAAGAATGAATGAGGCTTGACCAAGTCATGAAATTAA
CGCGAACGAAATGTATTGTTAAAGTCCCAATACATGGAAGTGATGGCGAT
TTTTCAGCAGTTGAAAAGAGGAAATGAACAGCTGAAGTTGTCGGAAACGA
TCCGAGATGGAATATTACAACATGGTAGTACTGCAGAGTCGCATATAGAT
ACCACAAGTCAGCAACCAAATCATTCCCATGAAAGTCGACACAAAATCTT
CCACTATGAAACACAAAACCAAACCTAGTAAGCCTCGTTCAGGAAAACCA
GAGCGAGGAAGAAAATGAAGATTAAAACCTGTTAGACTATTGGTACAAAT
AAGAAAAACTAATCTTATTTGATCATCTGTTAATTTTATTGTTATTATGA
ATTATATAAATCTGTAAGTGAGTGATTTTTTTAAAATCCAATATTGTTTC
CATTAGTGTTAAATACAAGGACAATGAGCAAGCT
back to top

protein sequence of SMED30015944-orf-1

>SMED30015944-orf-1 ID=SMED30015944-orf-1|Name=SMED30015944-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=265bp
SYRNLFKNYMKMKLNNQRSIQNTIIFYNGFLSLPDIIHKFKTSGIIDLIH
WPYNYISLLKCSSDINFKEILTQLKCNYSDFRMFHETEHFRRVDQSKLND
ALTYIKSSVNYVEIDKSPKLLREKLNSGVCLNDHINIFYDFYKLSEHEID
LRNCYESFVNSSVRKLLPHSNVRIFGSTLSRLGKFDSDLDMKIILNERNY
QPCQSIEILKSIASKLQTDNPYMVKSFVIPCRFPILHYFDSVLSLNVDIS
IKPDKSLELSMCDH*
back to top

protein sequence of SMED30015944-orf-2

>SMED30015944-orf-2 ID=SMED30015944-orf-2|Name=SMED30015944-orf-2|organism=Schmidtea mediterranea sexual|type=polypeptide|length=177bp
MSTYLSNPINRLSYLCVIIKQIYLYEGVLFDRPNIYFTGFKIVALVLHFL
QYKKLIPSLENIVNSNQEDQITRPDLGDLLIEFFQYMIKFNPNFAIDLSR
GCLVAKSQDVFLQCNFHFDPSLNITSNIGKDQWIKFTESNKNILKTLKVD
NHAKIWGLASFIDSNETLWKTSSFNN*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0002111X2 cell
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
NoneNo IPR availableGENE3DG3DSA:3.30.460.10coord: 136..248
e-value: 1.4E-14
score: 56.1
NoneNo IPR availableGENE3DG3DSA:1.10.1410.10coord: 116..135
e-value: 1.4E-14
score: 56.1
NoneNo IPR availableSUPERFAMILYSSF81301Nucleotidyltransferasecoord: 121..243