Threonine--tRNA ligase, cytoplasmic

Overview
NameThreonine--tRNA ligase, cytoplasmic
Smed IDSMED30015942
Length (bp)2505
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Threonine--tRNA ligase, cytoplasmic (SMED30015942) t-SNE clustered cells

Violin plots show distribution of expression levels for Threonine--tRNA ligase, cytoplasmic (SMED30015942) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Threonine--tRNA ligase, cytoplasmic (SMED30015942) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Threonine--tRNA ligase, cytoplasmic (SMED30015942) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30015942

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 10

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
nervous systemSMED30015942SMESG000061707.1 dd_Smed_v4_1476_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
epidermisSMED30015942SMESG000061707.1 dd_Smed_v4_1476_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
neoblastSMED30015942SMESG000061707.1 dd_Smed_v4_1476_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
parenchymal cellSMED30015942SMESG000061707.1 dd_Smed_v4_1476_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
muscle cellSMED30015942SMESG000061707.1 dd_Smed_v4_1476_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
non-ciliated neuronSMED30015942SMESG000061707.1 dd_Smed_v4_1476_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
cilated neuronSMED30015942SMESG000061707.1 dd_Smed_v4_1476_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30015942SMESG000061707.1 Contig48880newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30015942SMESG000061707.1 Contig48880uc_Smed_v2PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Category 2 cellSMED30015942SMESG000061707.1 dd_Smed_v6_1476_0dd_Smed_v6PMID:29674432
Plass et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Threonine--tRNA ligase, cytoplasmic vs. Ensembl Human
Match: TARS1 (threonyl-tRNA synthetase 1 [Source:HGNC Symbol;Acc:HGNC:11572])

HSP 1 Score: 892.108 bits (2304), Expect = 0.000e+0
Identity = 433/681 (63.58%), Postives = 528/681 (77.53%), Query Frame = 1
Query:  100 PEFIEKRIKLWDEWKKEYDEFV-EKQER--KEITITLKDGQNVIGKAWETSPYICMKEICQSVADNAVIAKVNGVLWDLDRPLENDSSLELLNFDSKDGEYVFWHSSAHILGEVMELEYAGHLCYGPPIEEGFYYDMFLKDRQVKPEEYKTLDXXXXXXXXXXXXXXRLEVSIDRLLEMFDYNEFKCRILKERVKTDKTTIYRCGDLIDLCQGPHVRNTGKVKALSVIKNSASYWEGDATRESLQRIYGISFPDPKQMKEWKTIQEEAAKRDHRKIGTKQQLFMFHELSPGSCFFLPKGTVIYNKLVDFMKEQYWTRGFTEVISPNLYNSKLWETSGHWEHYKENMFQTEIEKCKFAMKPMNCPGHCLMFGSTIRSYRDLPIRLADFGVLHRNEASGALTGLTRVRRFQQDDAHIFCREDQITKEIESCLDFLDYTYRVFGFDFQLKLSTRPEKFLGEISMWDKAEAQLTDALNNFGKKWELNPADGAFYGPKIDITITDALRRHHQCATIQLDFQLPIRFSLEYMTDSAAQREGDSKITLARPVIIHRAILGSVERMFAILAENYGGKWPFWLSPFQAIVIPFNPSCDEYALSIQKAVHDAGFHVDIDLDTKSIFNKKISKAQEAQYNFMLVVGKKEVENKTVNIRTRDNKVHGERSIEKVIERFRELETSRASDNQFEF 2133
            PE+I  R+++++  K E+D  + EK E+  K I +TL DG+ V  ++W+T+PY     I Q +ADN VIAKVN V+WDLDRPLE D +LELL F+ ++ + V+WHSSAHI+GE ME  Y G LCYGPPIE GFYYDM+L++  V   ++ +L+  CKKI+KEKQ FERLEV  + LL MF YN+FKCRIL E+V T  TT+YRCG LIDLC+GPHVR+TGK+KAL + KNS++YWEG A  E+LQRIYGISFPDPK +KEW+  QEEA  RDHRKIG  Q+L+ FHELSPGSCFFLPKG  IYN L++F++ +Y  RGF EV++PN++NS+LW TSGHW+HY ENMF  E+EK  FA+KPMNCPGHCLMF    RS+R+LP+RLADFGVLHRNE SGALTGLTRVRRFQQDDAHIFC  +QI  EI+ CLDFL   Y VFGF F+L LSTRPEKFLG+I +WD+AE QL ++LN FG+KWELN  DGAFYGPKIDI I DA+ R+HQCATIQLDFQLPIRF+L Y++      +GD K    RPVI+HRAILGSVERM AIL ENYGGKWPFWLSP Q +V+P  P+CDEYA  +++  HDA F  DIDLD     NKKI  AQ AQYNF+LVVG+KE  + TVNIRTRDNKVHGER+I + IER ++L+  R+   + EF
Sbjct:   51 PEYIYTRLEMYNILKAEHDSILAEKAEKDSKPIKVTLPDGKQVDAESWKTTPYQIACGISQGLADNTVIAKVNNVVWDLDRPLEEDCTLELLKFEDEEAQAVYWHSSAHIMGEAMERVYGGCLCYGPPIENGFYYDMYLEEGGVSSNDFSSLEALCKKIIKEKQAFERLEVKKETLLAMFKYNKFKCRILNEKVNTPTTTVYRCGPLIDLCRGPHVRHTGKIKALKIHKNSSTYWEGKADMETLQRIYGISFPDPKMLKEWEKFQEEAKNRDHRKIGRDQELYFFHELSPGSCFFLPKGAYIYNALIEFIRSEYRKRGFQEVVTPNIFNSRLWMTSGHWQHYSENMFSFEVEKELFALKPMNCPGHCLMFDHRPRSWRELPLRLADFGVLHRNELSGALTGLTRVRRFQQDDAHIFCAMEQIEDEIKGCLDFLRTVYSVFGFSFKLNLSTRPEKFLGDIEVWDQAEKQLENSLNEFGEKWELNSGDGAFYGPKIDIQIKDAIGRYHQCATIQLDFQLPIRFNLTYVS-----HDGDDK---KRPVIVHRAILGSVERMIAILTENYGGKWPFWLSPRQVMVVPVGPTCDEYAQKVRQQFHDAKFMADIDLDPGCTLNKKIRNAQLAQYNFILVVGEKEKISGTVNIRTRDNKVHGERTISETIERLQQLKEFRSKQAEEEF 723          
BLAST of Threonine--tRNA ligase, cytoplasmic vs. Ensembl Human
Match: TARS1 (threonyl-tRNA synthetase 1 [Source:HGNC Symbol;Acc:HGNC:11572])

HSP 1 Score: 892.108 bits (2304), Expect = 0.000e+0
Identity = 433/681 (63.58%), Postives = 528/681 (77.53%), Query Frame = 1
Query:  100 PEFIEKRIKLWDEWKKEYDEFV-EKQER--KEITITLKDGQNVIGKAWETSPYICMKEICQSVADNAVIAKVNGVLWDLDRPLENDSSLELLNFDSKDGEYVFWHSSAHILGEVMELEYAGHLCYGPPIEEGFYYDMFLKDRQVKPEEYKTLDXXXXXXXXXXXXXXRLEVSIDRLLEMFDYNEFKCRILKERVKTDKTTIYRCGDLIDLCQGPHVRNTGKVKALSVIKNSASYWEGDATRESLQRIYGISFPDPKQMKEWKTIQEEAAKRDHRKIGTKQQLFMFHELSPGSCFFLPKGTVIYNKLVDFMKEQYWTRGFTEVISPNLYNSKLWETSGHWEHYKENMFQTEIEKCKFAMKPMNCPGHCLMFGSTIRSYRDLPIRLADFGVLHRNEASGALTGLTRVRRFQQDDAHIFCREDQITKEIESCLDFLDYTYRVFGFDFQLKLSTRPEKFLGEISMWDKAEAQLTDALNNFGKKWELNPADGAFYGPKIDITITDALRRHHQCATIQLDFQLPIRFSLEYMTDSAAQREGDSKITLARPVIIHRAILGSVERMFAILAENYGGKWPFWLSPFQAIVIPFNPSCDEYALSIQKAVHDAGFHVDIDLDTKSIFNKKISKAQEAQYNFMLVVGKKEVENKTVNIRTRDNKVHGERSIEKVIERFRELETSRASDNQFEF 2133
            PE+I  R+++++  K E+D  + EK E+  K I +TL DG+ V  ++W+T+PY     I Q +ADN VIAKVN V+WDLDRPLE D +LELL F+ ++ + V+WHSSAHI+GE ME  Y G LCYGPPIE GFYYDM+L++  V   ++ +L+  CKKI+KEKQ FERLEV  + LL MF YN+FKCRIL E+V T  TT+YRCG LIDLC+GPHVR+TGK+KAL + KNS++YWEG A  E+LQRIYGISFPDPK +KEW+  QEEA  RDHRKIG  Q+L+ FHELSPGSCFFLPKG  IYN L++F++ +Y  RGF EV++PN++NS+LW TSGHW+HY ENMF  E+EK  FA+KPMNCPGHCLMF    RS+R+LP+RLADFGVLHRNE SGALTGLTRVRRFQQDDAHIFC  +QI  EI+ CLDFL   Y VFGF F+L LSTRPEKFLG+I +WD+AE QL ++LN FG+KWELN  DGAFYGPKIDI I DA+ R+HQCATIQLDFQLPIRF+L Y++      +GD K    RPVI+HRAILGSVERM AIL ENYGGKWPFWLSP Q +V+P  P+CDEYA  +++  HDA F  DIDLD     NKKI  AQ AQYNF+LVVG+KE  + TVNIRTRDNKVHGER+I + IER ++L+  R+   + EF
Sbjct:   51 PEYIYTRLEMYNILKAEHDSILAEKAEKDSKPIKVTLPDGKQVDAESWKTTPYQIACGISQGLADNTVIAKVNNVVWDLDRPLEEDCTLELLKFEDEEAQAVYWHSSAHIMGEAMERVYGGCLCYGPPIENGFYYDMYLEEGGVSSNDFSSLEALCKKIIKEKQAFERLEVKKETLLAMFKYNKFKCRILNEKVNTPTTTVYRCGPLIDLCRGPHVRHTGKIKALKIHKNSSTYWEGKADMETLQRIYGISFPDPKMLKEWEKFQEEAKNRDHRKIGRDQELYFFHELSPGSCFFLPKGAYIYNALIEFIRSEYRKRGFQEVVTPNIFNSRLWMTSGHWQHYSENMFSFEVEKELFALKPMNCPGHCLMFDHRPRSWRELPLRLADFGVLHRNELSGALTGLTRVRRFQQDDAHIFCAMEQIEDEIKGCLDFLRTVYSVFGFSFKLNLSTRPEKFLGDIEVWDQAEKQLENSLNEFGEKWELNSGDGAFYGPKIDIQIKDAIGRYHQCATIQLDFQLPIRFNLTYVS-----HDGDDK---KRPVIVHRAILGSVERMIAILTENYGGKWPFWLSPRQVMVVPVGPTCDEYAQKVRQQFHDAKFMADIDLDPGCTLNKKIRNAQLAQYNFILVVGEKEKISGTVNIRTRDNKVHGERTISETIERLQQLKEFRSKQAEEEF 723          
BLAST of Threonine--tRNA ligase, cytoplasmic vs. Ensembl Human
Match: TARS3 (threonyl-tRNA synthetase 3 [Source:HGNC Symbol;Acc:HGNC:24728])

HSP 1 Score: 887.871 bits (2293), Expect = 0.000e+0
Identity = 425/684 (62.13%), Postives = 521/684 (76.17%), Query Frame = 1
Query:   97 KPEFIEKRIKLWDEWKKEYDEFVEKQERKE-----ITITLKDGQNVIGKAWETSPYICMKEICQSVADNAVIAKVNGVLWDLDRPLENDSSLELLNFDSKDGEYVFWHSSAHILGEVMELEYAGHLCYGPPIEEGFYYDMFLKDRQVKPEEYKTLDXXXXXXXXXXXXXXRLEVSIDRLLEMFDYNEFKCRILKERVKTDKTTIYRCGDLIDLCQGPHVRNTGKVKALSVIKNSASYWEGDATRESLQRIYGISFPDPKQMKEWKTIQEEAAKRDHRKIGTKQQLFMFHELSPGSCFFLPKGTVIYNKLVDFMKEQYWTRGFTEVISPNLYNSKLWETSGHWEHYKENMFQTEIEKCKFAMKPMNCPGHCLMFGSTIRSYRDLPIRLADFGVLHRNEASGALTGLTRVRRFQQDDAHIFCREDQITKEIESCLDFLDYTYRVFGFDFQLKLSTRPEKFLGEISMWDKAEAQLTDALNNFGKKWELNPADGAFYGPKIDITITDALRRHHQCATIQLDFQLPIRFSLEYMTDSAAQREGDSKITLARPVIIHRAILGSVERMFAILAENYGGKWPFWLSPFQAIVIPFNPSCDEYALSIQKAVHDAGFHVDIDLDTKSIFNKKISKAQEAQYNFMLVVGKKEVENKTVNIRTRDNKVHGERSIEKVIERFRELETSRASDNQFEF 2133
            +P FI++R+KL++  KK++   +    +K      IT+ + DGQ V G+ W+T+PY    EI Q +A++ VIAKVNG LWDLDRPLE DSSLELL FD+++ + V+WHSSAHILGE MEL Y GHLCYGPPIE GFYYDMF++DR V   E   L+  CK I+KEKQ FERLEVS + LLEMF YN+FKCRIL E+V T  TT+YRCG LIDLC+GPHVR+TGK+K + + KNS++YWEG+   E+LQRIYGISFPD K M++W+  QEEA  RDHRKIG +Q+LF FH+LSPGSCFFLP+G  IYN L DF++E+Y  R FTEV+SPN+YNSKLWE SGHW+HY ENMF  EIEK  FA+KPMNCPGHCLMF    RS+R++PIR ADFGVLHRNE SG L+GLTRVRRFQQDDAHIFC  +QI +EI+ CL FL   Y  FGF FQL LSTRPE FLGEI MW++AE QL ++L +FG+ W++NP DGAFYGPKIDI I DA+ R+HQCATIQLDFQLPIRF+L Y++     ++GD K    RPVIIHRAILGSVERM AIL+ENYGGKWPFWLSP Q +VIP  P+C++YAL +     + GF  D+DLD     NKKI  AQ AQYNF+LVVG+KE  +  VN+RTRDNK+HGE  +   I++ + L  +R  + +  F
Sbjct:  127 QPIFIKERLKLFEILKKDHQLLLAIYGKKGDTSNIITVRVADGQTVQGEVWKTTPYQVAAEISQELAESTVIAKVNGELWDLDRPLEGDSSLELLTFDNEEAQAVYWHSSAHILGEAMELYYGGHLCYGPPIENGFYYDMFIEDRAVSSTELSALENICKAIIKEKQPFERLEVSKEILLEMFKYNKFKCRILNEKVNTATTTVYRCGPLIDLCKGPHVRHTGKIKTIKIFKNSSTYWEGNPEMETLQRIYGISFPDNKMMRDWEKFQEEAKNRDHRKIGKEQELFFFHDLSPGSCFFLPRGAFIYNTLTDFIREEYHKRDFTEVLSPNMYNSKLWEASGHWQHYSENMFTFEIEKDTFALKPMNCPGHCLMFAHRPRSWREMPIRFADFGVLHRNELSGTLSGLTRVRRFQQDDAHIFCTVEQIEEEIKGCLQFLQSVYSTFGFSFQLNLSTRPENFLGEIEMWNEAEKQLQNSLMDFGEPWKMNPGDGAFYGPKIDIKIKDAIGRYHQCATIQLDFQLPIRFNLTYVS-----KDGDDK---KRPVIIHRAILGSVERMIAILSENYGGKWPFWLSPRQVMVIPVGPTCEKYALQVSSEFFEEGFMADVDLDHSCTLNKKIRNAQLAQYNFILVVGEKEKIDNAVNVRTRDNKIHGEILVTSAIDKLKNLRKTRTLNAEEAF 802          
BLAST of Threonine--tRNA ligase, cytoplasmic vs. Ensembl Human
Match: TARS1 (threonyl-tRNA synthetase 1 [Source:HGNC Symbol;Acc:HGNC:11572])

HSP 1 Score: 876.7 bits (2264), Expect = 0.000e+0
Identity = 434/714 (60.78%), Postives = 529/714 (74.09%), Query Frame = 1
Query:  100 PEFIEKRIKLWDEWKKEYDEFV-EKQER--KEITITLKDGQNVIGKAWETSPY-----ICMKEIC----------------------------QSVADNAVIAKVNGVLWDLDRPLENDSSLELLNFDSKDGEYVFWHSSAHILGEVMELEYAGHLCYGPPIEEGFYYDMFLKDRQVKPEEYKTLDXXXXXXXXXXXXXXRLEVSIDRLLEMFDYNEFKCRILKERVKTDKTTIYRCGDLIDLCQGPHVRNTGKVKALSVIKNSASYWEGDATRESLQRIYGISFPDPKQMKEWKTIQEEAAKRDHRKIGTKQQLFMFHELSPGSCFFLPKGTVIYNKLVDFMKEQYWTRGFTEVISPNLYNSKLWETSGHWEHYKENMFQTEIEKCKFAMKPMNCPGHCLMFGSTIRSYRDLPIRLADFGVLHRNEASGALTGLTRVRRFQQDDAHIFCREDQITKEIESCLDFLDYTYRVFGFDFQLKLSTRPEKFLGEISMWDKAEAQLTDALNNFGKKWELNPADGAFYGPKIDITITDALRRHHQCATIQLDFQLPIRFSLEYMTDSAAQREGDSKITLARPVIIHRAILGSVERMFAILAENYGGKWPFWLSPFQAIVIPFNPSCDEYALSIQKAVHDAGFHVDIDLDTKSIFNKKISKAQEAQYNFMLVVGKKEVENKTVNIRTRDNKVHGERSIEKVIERFRELETSRASDNQFEF 2133
            PE+I  R+++++  K E+D  + EK E+  K I +TL DG+ V  ++W+T+PY     I     C                            Q +ADN VIAKVN V+WDLDRPLE D +LELL F+ ++ + V+WHSSAHI+GE ME  Y G LCYGPPIE GFYYDM+L++  V   ++ +L+  CKKI+KEKQ FERLEV  + LL MF YN+FKCRIL E+V T  TT+YRCG LIDLC+GPHVR+TGK+KAL + KNS++YWEG A  E+LQRIYGISFPDPK +KEW+  QEEA  RDHRKIG  Q+L+ FHELSPGSCFFLPKG  IYN L++F++ +Y  RGF EV++PN++NS+LW TSGHW+HY ENMF  E+EK  FA+KPMNCPGHCLMF    RS+R+LP+RLADFGVLHRNE SGALTGLTRVRRFQQDDAHIFC  +QI  EI+ CLDFL   Y VFGF F+L LSTRPEKFLG+I +WD+AE QL ++LN FG+KWELN  DGAFYGPKIDI I DA+ R+HQCATIQLDFQLPIRF+L Y++      +GD K    RPVI+HRAILGSVERM AIL ENYGGKWPFWLSP Q +V+P  P+CDEYA  +++  HDA F  DIDLD     NKKI  AQ AQYNF+LVVG+KE  + TVNIRTRDNKVHGER+I + IER ++L+  R+   + EF
Sbjct:   51 PEYIYTRLEMYNILKAEHDSILAEKAEKDSKPIKVTLPDGKQVDAESWKTTPYQIACGISHTASCKNLSSLASLLASVAIPSSGMPWPPLFFLQGLADNTVIAKVNNVVWDLDRPLEEDCTLELLKFEDEEAQAVYWHSSAHIMGEAMERVYGGCLCYGPPIENGFYYDMYLEEGGVSSNDFSSLEALCKKIIKEKQAFERLEVKKETLLAMFKYNKFKCRILNEKVNTPTTTVYRCGPLIDLCRGPHVRHTGKIKALKIHKNSSTYWEGKADMETLQRIYGISFPDPKMLKEWEKFQEEAKNRDHRKIGRDQELYFFHELSPGSCFFLPKGAYIYNALIEFIRSEYRKRGFQEVVTPNIFNSRLWMTSGHWQHYSENMFSFEVEKELFALKPMNCPGHCLMFDHRPRSWRELPLRLADFGVLHRNELSGALTGLTRVRRFQQDDAHIFCAMEQIEDEIKGCLDFLRTVYSVFGFSFKLNLSTRPEKFLGDIEVWDQAEKQLENSLNEFGEKWELNSGDGAFYGPKIDIQIKDAIGRYHQCATIQLDFQLPIRFNLTYVS-----HDGDDK---KRPVIVHRAILGSVERMIAILTENYGGKWPFWLSPRQVMVVPVGPTCDEYAQKVRQQFHDAKFMADIDLDPGCTLNKKIRNAQLAQYNFILVVGEKEKISGTVNIRTRDNKVHGERTISETIERLQQLKEFRSKQAEEEF 756          
BLAST of Threonine--tRNA ligase, cytoplasmic vs. Ensembl Human
Match: TARS3 (threonyl-tRNA synthetase 3 [Source:HGNC Symbol;Acc:HGNC:24728])

HSP 1 Score: 845.499 bits (2183), Expect = 0.000e+0
Identity = 405/635 (63.78%), Postives = 490/635 (77.17%), Query Frame = 1
Query:   97 KPEFIEKRIKLWDEWKKEYDEFVEKQERKE-----ITITLKDGQNVIGKAWETSPYICMKEICQSVADNAVIAKVNGVLWDLDRPLENDSSLELLNFDSKDGEYVFWHSSAHILGEVMELEYAGHLCYGPPIEEGFYYDMFLKDRQVKPEEYKTLDXXXXXXXXXXXXXXRLEVSIDRLLEMFDYNEFKCRILKERVKTDKTTIYRCGDLIDLCQGPHVRNTGKVKALSVIKNSASYWEGDATRESLQRIYGISFPDPKQMKEWKTIQEEAAKRDHRKIGTKQQLFMFHELSPGSCFFLPKGTVIYNKLVDFMKEQYWTRGFTEVISPNLYNSKLWETSGHWEHYKENMFQTEIEKCKFAMKPMNCPGHCLMFGSTIRSYRDLPIRLADFGVLHRNEASGALTGLTRVRRFQQDDAHIFCREDQITKEIESCLDFLDYTYRVFGFDFQLKLSTRPEKFLGEISMWDKAEAQLTDALNNFGKKWELNPADGAFYGPKIDITITDALRRHHQCATIQLDFQLPIRFSLEYMTDSAAQREGDSKITLARPVIIHRAILGSVERMFAILAENYGGKWPFWLSPFQAIVIPFNPSCDEYALSIQKAVHDAGFHVDIDLDTKSIFNKKISKAQEAQYNFML 1986
            +P FI++R+KL++  KK++   +    +K      IT+ + DGQ V G+ W+T+PY    EI Q +A++ VIAKVNG LWDLDRPLE DSSLELL FD+++ + V+WHSSAHILGE MEL Y GHLCYGPPIE GFYYDMF++DR V   E   L+  CK I+KEKQ FERLEVS + LLEMF YN+FKCRIL E+V T  TT+YRCG LIDLC+GPHVR+TGK+K + + KNS++YWEG+   E+LQRIYGISFPD K M++W+  QEEA  RDHRKIG +Q+LF FH+LSPGSCFFLP+G  IYN L DF++E+Y  R FTEV+SPN+YNSKLWE SGHW+HY ENMF  EIEK  FA+KPMNCPGHCLMF    RS+R++PIR ADFGVLHRNE SG L+GLTRVRRFQQDDAHIFC  +QI +EI+ CL FL   Y  FGF FQL LSTRPE FLGEI MW++AE QL ++L +FG+ W++NP DGAFYGPKIDI I DA+ R+HQCATIQLDFQLPIRF+L Y++     ++GD K    RPVIIHRAILGSVERM AIL+ENYGGKWPFWLSP Q +VIP  P+C++YAL +     + GF  D+DLD     NKKI  AQ AQYNF+L
Sbjct:  127 QPIFIKERLKLFEILKKDHQLLLAIYGKKGDTSNIITVRVADGQTVQGEVWKTTPYQVAAEISQELAESTVIAKVNGELWDLDRPLEGDSSLELLTFDNEEAQAVYWHSSAHILGEAMELYYGGHLCYGPPIENGFYYDMFIEDRAVSSTELSALENICKAIIKEKQPFERLEVSKEILLEMFKYNKFKCRILNEKVNTATTTVYRCGPLIDLCKGPHVRHTGKIKTIKIFKNSSTYWEGNPEMETLQRIYGISFPDNKMMRDWEKFQEEAKNRDHRKIGKEQELFFFHDLSPGSCFFLPRGAFIYNTLTDFIREEYHKRDFTEVLSPNMYNSKLWEASGHWQHYSENMFTFEIEKDTFALKPMNCPGHCLMFAHRPRSWREMPIRFADFGVLHRNELSGTLSGLTRVRRFQQDDAHIFCTVEQIEEEIKGCLQFLQSVYSTFGFSFQLNLSTRPENFLGEIEMWNEAEKQLQNSLMDFGEPWKMNPGDGAFYGPKIDIKIKDAIGRYHQCATIQLDFQLPIRFNLTYVS-----KDGDDK---KRPVIIHRAILGSVERMIAILSENYGGKWPFWLSPRQVMVIPVGPTCEKYALQVSSEFFEEGFMADVDLDHSCTLNKKIRNAQLAQYNFIL 753          
BLAST of Threonine--tRNA ligase, cytoplasmic vs. Ensembl Celegans
Match: tars-1 (Threonine--tRNA ligase, cytoplasmic [Source:UniProtKB/Swiss-Prot;Acc:P52709])

HSP 1 Score: 875.159 bits (2260), Expect = 0.000e+0
Identity = 419/680 (61.62%), Postives = 521/680 (76.62%), Query Frame = 1
Query:   88 MITKPEFIEKRIKLWDEWKKEYDEFVEKQERKEITITLKDGQNVIGKAWETSPYICMKEICQSVADNAVIAKVNGVLWDLDRPLENDSSLELLNFDSKDGEYVFWHSSAHILGEVMELEYAGHLCYGPPIEEGFYYDMFLKDRQVKPEEYKTLDXXXXXXXXXXXXXXRLEVSIDRLLEMFDYNEFKCRILKERVKTDKTTIYRCGDLIDLCQGPHVRNTGKVKALSVIKNSASYWEGDATRESLQRIYGISFPDPKQMKEWKTIQEEAAKRDHRKIGTKQQLFMFHELSPGSCFFLPKGTVIYNKLVDFMKEQYWTRGFTEVISPNLYNSKLWETSGHWEHYKENMFQTEIEKCKFAMKPMNCPGHCLMFGSTIRSYRDLPIRLADFGVLHRNEASGALTGLTRVRRFQQDDAHIFCREDQITKEIESCLDFLDYTY-RVFGFDFQLKLSTRPEKFLGEISMWDKAEAQLTDALNNFGKKWELNPADGAFYGPKIDITITDALRRHHQCATIQLDFQLPIRFSLEYMTDSAAQREGDSKITLARPVIIHRAILGSVERMFAILAENYGGKWPFWLSPFQAIVIPFNPSCDEYALSIQKAVHDAGFHVDIDLDTKSIFNKKISKAQEAQYNFMLVVGKKEVENKTVNIRTRDNKVHGERSIEKVIERFRELETSRASDNQ 2124
            M   P FIE+RIKLWD+ K EYD  +  +E + I ITL DG+   GK W T+P+   + I + +A+ AVIAKVNG +WDLDRP E ++ LELL FD  + + VFWHSSAH+LGE ME    GHLCYGPPI+EGFYYDM+ ++R + P+++  +D+  K  VK+KQKFERLE++ + LLEMF YNEFK RI+ E++ T KTT+YRCG LIDLC+GPHVR+TGKVKA+++ KNS+SYWEG A  ESLQR+YGISFPD KQ+KEW+ +QEEAAKRDHRK+G +  LF FH+LSPGS F+ PKG  IYNKLVDF+++QY  RGFTEVI+PN+YN KLWETSGHW+HY E+MF+ E+EK +F +KPMNCPGHCLMFG    +Y +LP R ADFGVLHRNE SGALTGLTRVRRFQQDDAHIFCR+DQI++EI+ CLDFL+Y Y +VFGF F+L LSTRPE FLG I  WDKAEA LT+ALN  G+KW LNP DGAFYGPKIDITI DAL+R+ QCATIQLDFQLP +F L Y          D K    RPV+IHRA+LGSVERM AIL E+YGGKWPFWLSP Q  +I  + S  +YA  ++K + +AGF ++ + +     NK++ KAQ AQ+NF+LV+G KE EN TVN+RTRDN V GE +++K+I +FR       +D +
Sbjct:   49 MAPWPAFIEERIKLWDKLKAEYDAEIAAKESEPIQITLPDGKIHEGKTWRTTPFEIAERISKGLAEAAVIAKVNGAVWDLDRPFEGNAKLELLKFDDDEAKQVFWHSSAHVLGEAMERYCGGHLCYGPPIQEGFYYDMWHENRTICPDDFPKIDQIVKAAVKDKQKFERLEMTKEDLLEMFKYNEFKVRIITEKIHTPKTTVYRCGPLIDLCRGPHVRHTGKVKAMAITKNSSSYWEGKADAESLQRLYGISFPDSKQLKEWQKLQEEAAKRDHRKLGKEHDLFFFHQLSPGSAFWYPKGAHIYNKLVDFIRKQYRRRGFTEVITPNMYNKKLWETSGHWQHYSEDMFKIEVEKEEFGLKPMNCPGHCLMFGHMPHTYNELPFRFADFGVLHRNEMSGALTGLTRVRRFQQDDAHIFCRQDQISEEIKQCLDFLEYAYEKVFGFTFKLNLSTRPEGFLGNIETWDKAEADLTNALNASGRKWVLNPGDGAFYGPKIDITIQDALKRNFQCATIQLDFQLPNQFDLSYF---------DEKGEKQRPVMIHRAVLGSVERMTAILTESYGGKWPFWLSPRQCKIITVHESVRDYANDVKKQIFEAGFEIEYEENCGDTMNKQVRKAQLAQFNFILVIGAKEKENGTVNVRTRDNAVRGEVALDKLISKFRRFADEYVADTE 719          
BLAST of Threonine--tRNA ligase, cytoplasmic vs. Ensembl Celegans
Match: tars-1 (Threonine--tRNA ligase, cytoplasmic [Source:UniProtKB/Swiss-Prot;Acc:P52709])

HSP 1 Score: 874.774 bits (2259), Expect = 0.000e+0
Identity = 419/680 (61.62%), Postives = 521/680 (76.62%), Query Frame = 1
Query:   88 MITKPEFIEKRIKLWDEWKKEYDEFVEKQERKEITITLKDGQNVIGKAWETSPYICMKEICQSVADNAVIAKVNGVLWDLDRPLENDSSLELLNFDSKDGEYVFWHSSAHILGEVMELEYAGHLCYGPPIEEGFYYDMFLKDRQVKPEEYKTLDXXXXXXXXXXXXXXRLEVSIDRLLEMFDYNEFKCRILKERVKTDKTTIYRCGDLIDLCQGPHVRNTGKVKALSVIKNSASYWEGDATRESLQRIYGISFPDPKQMKEWKTIQEEAAKRDHRKIGTKQQLFMFHELSPGSCFFLPKGTVIYNKLVDFMKEQYWTRGFTEVISPNLYNSKLWETSGHWEHYKENMFQTEIEKCKFAMKPMNCPGHCLMFGSTIRSYRDLPIRLADFGVLHRNEASGALTGLTRVRRFQQDDAHIFCREDQITKEIESCLDFLDYTY-RVFGFDFQLKLSTRPEKFLGEISMWDKAEAQLTDALNNFGKKWELNPADGAFYGPKIDITITDALRRHHQCATIQLDFQLPIRFSLEYMTDSAAQREGDSKITLARPVIIHRAILGSVERMFAILAENYGGKWPFWLSPFQAIVIPFNPSCDEYALSIQKAVHDAGFHVDIDLDTKSIFNKKISKAQEAQYNFMLVVGKKEVENKTVNIRTRDNKVHGERSIEKVIERFRELETSRASDNQ 2124
            M   P FIE+RIKLWD+ K EYD  +  +E + I ITL DG+   GK W T+P+   + I + +A+ AVIAKVNG +WDLDRP E ++ LELL FD  + + VFWHSSAH+LGE ME    GHLCYGPPI+EGFYYDM+ ++R + P+++  +D+  K  VK+KQKFERLE++ + LLEMF YNEFK RI+ E++ T KTT+YRCG LIDLC+GPHVR+TGKVKA+++ KNS+SYWEG A  ESLQR+YGISFPD KQ+KEW+ +QEEAAKRDHRK+G +  LF FH+LSPGS F+ PKG  IYNKLVDF+++QY  RGFTEVI+PN+YN KLWETSGHW+HY E+MF+ E+EK +F +KPMNCPGHCLMFG    +Y +LP R ADFGVLHRNE SGALTGLTRVRRFQQDDAHIFCR+DQI++EI+ CLDFL+Y Y +VFGF F+L LSTRPE FLG I  WDKAEA LT+ALN  G+KW LNP DGAFYGPKIDITI DAL+R+ QCATIQLDFQLP +F L Y          D K    RPV+IHRA+LGSVERM AIL E+YGGKWPFWLSP Q  +I  + S  +YA  ++K + +AGF ++ + +     NK++ KAQ AQ+NF+LV+G KE EN TVN+RTRDN V GE +++K+I +FR       +D +
Sbjct:    8 MAPWPAFIEERIKLWDKLKAEYDAEIAAKESEPIQITLPDGKIHEGKTWRTTPFEIAERISKGLAEAAVIAKVNGAVWDLDRPFEGNAKLELLKFDDDEAKQVFWHSSAHVLGEAMERYCGGHLCYGPPIQEGFYYDMWHENRTICPDDFPKIDQIVKAAVKDKQKFERLEMTKEDLLEMFKYNEFKVRIITEKIHTPKTTVYRCGPLIDLCRGPHVRHTGKVKAMAITKNSSSYWEGKADAESLQRLYGISFPDSKQLKEWQKLQEEAAKRDHRKLGKEHDLFFFHQLSPGSAFWYPKGAHIYNKLVDFIRKQYRRRGFTEVITPNMYNKKLWETSGHWQHYSEDMFKIEVEKEEFGLKPMNCPGHCLMFGHMPHTYNELPFRFADFGVLHRNEMSGALTGLTRVRRFQQDDAHIFCRQDQISEEIKQCLDFLEYAYEKVFGFTFKLNLSTRPEGFLGNIETWDKAEADLTNALNASGRKWVLNPGDGAFYGPKIDITIQDALKRNFQCATIQLDFQLPNQFDLSYF---------DEKGEKQRPVMIHRAVLGSVERMTAILTESYGGKWPFWLSPRQCKIITVHESVRDYANDVKKQIFEAGFEIEYEENCGDTMNKQVRKAQLAQFNFILVIGAKEKENGTVNVRTRDNAVRGEVALDKLISKFRRFADEYVADTE 678          
BLAST of Threonine--tRNA ligase, cytoplasmic vs. Ensembl Celegans
Match: tars-1 (Threonine--tRNA ligase, cytoplasmic [Source:UniProtKB/Swiss-Prot;Acc:P52709])

HSP 1 Score: 874.774 bits (2259), Expect = 0.000e+0
Identity = 419/680 (61.62%), Postives = 521/680 (76.62%), Query Frame = 1
Query:   88 MITKPEFIEKRIKLWDEWKKEYDEFVEKQERKEITITLKDGQNVIGKAWETSPYICMKEICQSVADNAVIAKVNGVLWDLDRPLENDSSLELLNFDSKDGEYVFWHSSAHILGEVMELEYAGHLCYGPPIEEGFYYDMFLKDRQVKPEEYKTLDXXXXXXXXXXXXXXRLEVSIDRLLEMFDYNEFKCRILKERVKTDKTTIYRCGDLIDLCQGPHVRNTGKVKALSVIKNSASYWEGDATRESLQRIYGISFPDPKQMKEWKTIQEEAAKRDHRKIGTKQQLFMFHELSPGSCFFLPKGTVIYNKLVDFMKEQYWTRGFTEVISPNLYNSKLWETSGHWEHYKENMFQTEIEKCKFAMKPMNCPGHCLMFGSTIRSYRDLPIRLADFGVLHRNEASGALTGLTRVRRFQQDDAHIFCREDQITKEIESCLDFLDYTY-RVFGFDFQLKLSTRPEKFLGEISMWDKAEAQLTDALNNFGKKWELNPADGAFYGPKIDITITDALRRHHQCATIQLDFQLPIRFSLEYMTDSAAQREGDSKITLARPVIIHRAILGSVERMFAILAENYGGKWPFWLSPFQAIVIPFNPSCDEYALSIQKAVHDAGFHVDIDLDTKSIFNKKISKAQEAQYNFMLVVGKKEVENKTVNIRTRDNKVHGERSIEKVIERFRELETSRASDNQ 2124
            M   P FIE+RIKLWD+ K EYD  +  +E + I ITL DG+   GK W T+P+   + I + +A+ AVIAKVNG +WDLDRP E ++ LELL FD  + + VFWHSSAH+LGE ME    GHLCYGPPI+EGFYYDM+ ++R + P+++  +D+  K  VK+KQKFERLE++ + LLEMF YNEFK RI+ E++ T KTT+YRCG LIDLC+GPHVR+TGKVKA+++ KNS+SYWEG A  ESLQR+YGISFPD KQ+KEW+ +QEEAAKRDHRK+G +  LF FH+LSPGS F+ PKG  IYNKLVDF+++QY  RGFTEVI+PN+YN KLWETSGHW+HY E+MF+ E+EK +F +KPMNCPGHCLMFG    +Y +LP R ADFGVLHRNE SGALTGLTRVRRFQQDDAHIFCR+DQI++EI+ CLDFL+Y Y +VFGF F+L LSTRPE FLG I  WDKAEA LT+ALN  G+KW LNP DGAFYGPKIDITI DAL+R+ QCATIQLDFQLP +F L Y          D K    RPV+IHRA+LGSVERM AIL E+YGGKWPFWLSP Q  +I  + S  +YA  ++K + +AGF ++ + +     NK++ KAQ AQ+NF+LV+G KE EN TVN+RTRDN V GE +++K+I +FR       +D +
Sbjct:    8 MAPWPAFIEERIKLWDKLKAEYDAEIAAKESEPIQITLPDGKIHEGKTWRTTPFEIAERISKGLAEAAVIAKVNGAVWDLDRPFEGNAKLELLKFDDDEAKQVFWHSSAHVLGEAMERYCGGHLCYGPPIQEGFYYDMWHENRTICPDDFPKIDQIVKAAVKDKQKFERLEMTKEDLLEMFKYNEFKVRIITEKIHTPKTTVYRCGPLIDLCRGPHVRHTGKVKAMAITKNSSSYWEGKADAESLQRLYGISFPDSKQLKEWQKLQEEAAKRDHRKLGKEHDLFFFHQLSPGSAFWYPKGAHIYNKLVDFIRKQYRRRGFTEVITPNMYNKKLWETSGHWQHYSEDMFKIEVEKEEFGLKPMNCPGHCLMFGHMPHTYNELPFRFADFGVLHRNEMSGALTGLTRVRRFQQDDAHIFCRQDQISEEIKQCLDFLEYAYEKVFGFTFKLNLSTRPEGFLGNIETWDKAEADLTNALNASGRKWVLNPGDGAFYGPKIDITIQDALKRNFQCATIQLDFQLPNQFDLSYF---------DEKGEKQRPVMIHRAVLGSVERMTAILTESYGGKWPFWLSPRQCKIITVHESVRDYANDVKKQIFEAGFEIEYEENCGDTMNKQVRKAQLAQFNFILVIGAKEKENGTVNVRTRDNAVRGEVALDKLISKFRRFADEYVADTE 678          
BLAST of Threonine--tRNA ligase, cytoplasmic vs. Ensembl Celegans
Match: tars-1 (Threonine--tRNA ligase, cytoplasmic [Source:UniProtKB/Swiss-Prot;Acc:P52709])

HSP 1 Score: 874.774 bits (2259), Expect = 0.000e+0
Identity = 419/680 (61.62%), Postives = 521/680 (76.62%), Query Frame = 1
Query:   88 MITKPEFIEKRIKLWDEWKKEYDEFVEKQERKEITITLKDGQNVIGKAWETSPYICMKEICQSVADNAVIAKVNGVLWDLDRPLENDSSLELLNFDSKDGEYVFWHSSAHILGEVMELEYAGHLCYGPPIEEGFYYDMFLKDRQVKPEEYKTLDXXXXXXXXXXXXXXRLEVSIDRLLEMFDYNEFKCRILKERVKTDKTTIYRCGDLIDLCQGPHVRNTGKVKALSVIKNSASYWEGDATRESLQRIYGISFPDPKQMKEWKTIQEEAAKRDHRKIGTKQQLFMFHELSPGSCFFLPKGTVIYNKLVDFMKEQYWTRGFTEVISPNLYNSKLWETSGHWEHYKENMFQTEIEKCKFAMKPMNCPGHCLMFGSTIRSYRDLPIRLADFGVLHRNEASGALTGLTRVRRFQQDDAHIFCREDQITKEIESCLDFLDYTY-RVFGFDFQLKLSTRPEKFLGEISMWDKAEAQLTDALNNFGKKWELNPADGAFYGPKIDITITDALRRHHQCATIQLDFQLPIRFSLEYMTDSAAQREGDSKITLARPVIIHRAILGSVERMFAILAENYGGKWPFWLSPFQAIVIPFNPSCDEYALSIQKAVHDAGFHVDIDLDTKSIFNKKISKAQEAQYNFMLVVGKKEVENKTVNIRTRDNKVHGERSIEKVIERFRELETSRASDNQ 2124
            M   P FIE+RIKLWD+ K EYD  +  +E + I ITL DG+   GK W T+P+   + I + +A+ AVIAKVNG +WDLDRP E ++ LELL FD  + + VFWHSSAH+LGE ME    GHLCYGPPI+EGFYYDM+ ++R + P+++  +D+  K  VK+KQKFERLE++ + LLEMF YNEFK RI+ E++ T KTT+YRCG LIDLC+GPHVR+TGKVKA+++ KNS+SYWEG A  ESLQR+YGISFPD KQ+KEW+ +QEEAAKRDHRK+G +  LF FH+LSPGS F+ PKG  IYNKLVDF+++QY  RGFTEVI+PN+YN KLWETSGHW+HY E+MF+ E+EK +F +KPMNCPGHCLMFG    +Y +LP R ADFGVLHRNE SGALTGLTRVRRFQQDDAHIFCR+DQI++EI+ CLDFL+Y Y +VFGF F+L LSTRPE FLG I  WDKAEA LT+ALN  G+KW LNP DGAFYGPKIDITI DAL+R+ QCATIQLDFQLP +F L Y          D K    RPV+IHRA+LGSVERM AIL E+YGGKWPFWLSP Q  +I  + S  +YA  ++K + +AGF ++ + +     NK++ KAQ AQ+NF+LV+G KE EN TVN+RTRDN V GE +++K+I +FR       +D +
Sbjct:    8 MAPWPAFIEERIKLWDKLKAEYDAEIAAKESEPIQITLPDGKIHEGKTWRTTPFEIAERISKGLAEAAVIAKVNGAVWDLDRPFEGNAKLELLKFDDDEAKQVFWHSSAHVLGEAMERYCGGHLCYGPPIQEGFYYDMWHENRTICPDDFPKIDQIVKAAVKDKQKFERLEMTKEDLLEMFKYNEFKVRIITEKIHTPKTTVYRCGPLIDLCRGPHVRHTGKVKAMAITKNSSSYWEGKADAESLQRLYGISFPDSKQLKEWQKLQEEAAKRDHRKLGKEHDLFFFHQLSPGSAFWYPKGAHIYNKLVDFIRKQYRRRGFTEVITPNMYNKKLWETSGHWQHYSEDMFKIEVEKEEFGLKPMNCPGHCLMFGHMPHTYNELPFRFADFGVLHRNEMSGALTGLTRVRRFQQDDAHIFCRQDQISEEIKQCLDFLEYAYEKVFGFTFKLNLSTRPEGFLGNIETWDKAEADLTNALNASGRKWVLNPGDGAFYGPKIDITIQDALKRNFQCATIQLDFQLPNQFDLSYF---------DEKGEKQRPVMIHRAVLGSVERMTAILTESYGGKWPFWLSPRQCKIITVHESVRDYANDVKKQIFEAGFEIEYEENCGDTMNKQVRKAQLAQFNFILVIGAKEKENGTVNVRTRDNAVRGEVALDKLISKFRRFADEYVADTE 678          
BLAST of Threonine--tRNA ligase, cytoplasmic vs. Ensembl Fly
Match: ThrRS (gene:FBgn0027081 transcript:FBtr0080333)

HSP 1 Score: 877.085 bits (2265), Expect = 0.000e+0
Identity = 413/666 (62.01%), Postives = 511/666 (76.73%), Query Frame = 1
Query:  100 PEFIEKRIKLWDEWKKEYDEFVEKQERKEITITLKDGQNVIGKAWETSPYICMKEICQSVADNAVIAKVNGVLWDLDRPLENDSSLELLNFDSKDGEYVFWHSSAHILGEVMELEYAGHLCYGPPIEEGFYYDMFLKDRQVKPEEYKTLDXXXXXXXXXXXXXXRLEVSIDRLLEMFDYNEFKCRILKERVKTDKTTIYRCGDLIDLCQGPHVRNTGKVKALSVIKNSASYWEGDATRESLQRIYGISFPDPKQMKEWKTIQEEAAKRDHRKIGTKQQLFMFHELSPGSCFFLPKGTVIYNKLVDFMKEQYWTRGFTEVISPNLYNSKLWETSGHWEHYKENMFQTEIEKCKFAMKPMNCPGHCLMFGSTIRSYRDLPIRLADFGVLHRNEASGALTGLTRVRRFQQDDAHIFCREDQITKEIESCLDFLDYTYRVFGFDFQLKLSTRPEKFLGEISMWDKAEAQLTDALNNFGKKWELNPADGAFYGPKIDITITDALRRHHQCATIQLDFQLPIRFSLEYMTDSAAQREGDSKITLARPVIIHRAILGSVERMFAILAENYGGKWPFWLSPFQAIVIPFNPSCDEYALSIQKAVHDAGFHVDIDLDTKSIFNKKISKAQEAQYNFMLVVGKKEVENKTVNIRTRDNKVHGERSIEKVIERFREL 2097
            P++IE+R   W++ K EY+  +  ++R+ I +TL DG+ V   +WET+PY   + I Q +ADN VI+KVNG +WDLDR LE + +L+LL FD  + + VFWHSSAHI+GE ME  Y GHLCYGPPIE GFYYDM L+   +   +Y  ++   K+IVKEKQ FERLE+    LLEMF YNEFK RIL E+V TD+TT+Y+CG LIDLC+GPHVR+TGKVKAL + KNS++YWEG A  E+LQR+YGISFPDPKQ+KEW+ +QEEAAKRDHRKIG +Q+LF FHELSPGSCFF P+G  IYN L+ F+K +Y  RGF EVISPN+YN+KLW TSGHW+HY ENMF  E EK KFA+KPMNCPGHCL+F +  RS+R+LP+R+ADFGVLHRNE SGALTGLTRVRRFQQDDAHIFC  +QI  E++ CL+FL Y Y +FGF FQL LSTRP+ +LGE+  W+ AE  L ++LN FG  W+ NP DGAFYGPKIDITI DAL+R HQCATIQLDFQLPIRF+L Y+ D   ++         RPVIIHRAILGSVERM AIL EN+ GKWPFWLSP Q +V+P  P+ D+YA S++  +HDAGF  + D D     NKKI  AQ AQ+NF+LVVG KE  + TVN+RTRDNKVHGE S+ ++I + +++
Sbjct:   23 PKYIEERNVFWEKCKAEYEAELAAKKREPIKVTLPDGKQVDATSWETTPYEVARGISQGLADNTVISKVNGEVWDLDRVLEGNCTLQLLKFDDPEAQAVFWHSSAHIMGEAMERIYGGHLCYGPPIENGFYYDMHLEGEGISTNDYGAMEGLVKQIVKEKQNFERLEMKKSDLLEMFKYNEFKVRILNEKVTTDRTTVYKCGSLIDLCRGPHVRHTGKVKALKITKNSSTYWEGKADAETLQRVYGISFPDPKQLKEWEKLQEEAAKRDHRKIGREQELFFFHELSPGSCFFQPRGAHIYNTLMGFIKAEYRKRGFQEVISPNIYNAKLWMTSGHWQHYAENMFSFEAEKEKFALKPMNCPGHCLIFDNRNRSWRELPLRMADFGVLHRNELSGALTGLTRVRRFQQDDAHIFCAPEQIKSEMKGCLEFLKYVYTIFGFSFQLVLSTRPDNYLGELEQWNDAEKALAESLNEFGMPWKENPGDGAFYGPKIDITIMDALKRAHQCATIQLDFQLPIRFNLSYIADDGEKK---------RPVIIHRAILGSVERMIAILTENFAGKWPFWLSPRQVMVVPVGPAYDQYAQSVRDQLHDAGFMSEADCDAGDTMNKKIRNAQLAQFNFILVVGDKERSSNTVNVRTRDNKVHGEVSVAELITKLQKI 679          
BLAST of Threonine--tRNA ligase, cytoplasmic vs. Ensembl Fly
Match: ThrRS (gene:FBgn0027081 transcript:FBtr0080331)

HSP 1 Score: 877.085 bits (2265), Expect = 0.000e+0
Identity = 413/666 (62.01%), Postives = 511/666 (76.73%), Query Frame = 1
Query:  100 PEFIEKRIKLWDEWKKEYDEFVEKQERKEITITLKDGQNVIGKAWETSPYICMKEICQSVADNAVIAKVNGVLWDLDRPLENDSSLELLNFDSKDGEYVFWHSSAHILGEVMELEYAGHLCYGPPIEEGFYYDMFLKDRQVKPEEYKTLDXXXXXXXXXXXXXXRLEVSIDRLLEMFDYNEFKCRILKERVKTDKTTIYRCGDLIDLCQGPHVRNTGKVKALSVIKNSASYWEGDATRESLQRIYGISFPDPKQMKEWKTIQEEAAKRDHRKIGTKQQLFMFHELSPGSCFFLPKGTVIYNKLVDFMKEQYWTRGFTEVISPNLYNSKLWETSGHWEHYKENMFQTEIEKCKFAMKPMNCPGHCLMFGSTIRSYRDLPIRLADFGVLHRNEASGALTGLTRVRRFQQDDAHIFCREDQITKEIESCLDFLDYTYRVFGFDFQLKLSTRPEKFLGEISMWDKAEAQLTDALNNFGKKWELNPADGAFYGPKIDITITDALRRHHQCATIQLDFQLPIRFSLEYMTDSAAQREGDSKITLARPVIIHRAILGSVERMFAILAENYGGKWPFWLSPFQAIVIPFNPSCDEYALSIQKAVHDAGFHVDIDLDTKSIFNKKISKAQEAQYNFMLVVGKKEVENKTVNIRTRDNKVHGERSIEKVIERFREL 2097
            P++IE+R   W++ K EY+  +  ++R+ I +TL DG+ V   +WET+PY   + I Q +ADN VI+KVNG +WDLDR LE + +L+LL FD  + + VFWHSSAHI+GE ME  Y GHLCYGPPIE GFYYDM L+   +   +Y  ++   K+IVKEKQ FERLE+    LLEMF YNEFK RIL E+V TD+TT+Y+CG LIDLC+GPHVR+TGKVKAL + KNS++YWEG A  E+LQR+YGISFPDPKQ+KEW+ +QEEAAKRDHRKIG +Q+LF FHELSPGSCFF P+G  IYN L+ F+K +Y  RGF EVISPN+YN+KLW TSGHW+HY ENMF  E EK KFA+KPMNCPGHCL+F +  RS+R+LP+R+ADFGVLHRNE SGALTGLTRVRRFQQDDAHIFC  +QI  E++ CL+FL Y Y +FGF FQL LSTRP+ +LGE+  W+ AE  L ++LN FG  W+ NP DGAFYGPKIDITI DAL+R HQCATIQLDFQLPIRF+L Y+ D   ++         RPVIIHRAILGSVERM AIL EN+ GKWPFWLSP Q +V+P  P+ D+YA S++  +HDAGF  + D D     NKKI  AQ AQ+NF+LVVG KE  + TVN+RTRDNKVHGE S+ ++I + +++
Sbjct:   23 PKYIEERNVFWEKCKAEYEAELAAKKREPIKVTLPDGKQVDATSWETTPYEVARGISQGLADNTVISKVNGEVWDLDRVLEGNCTLQLLKFDDPEAQAVFWHSSAHIMGEAMERIYGGHLCYGPPIENGFYYDMHLEGEGISTNDYGAMEGLVKQIVKEKQNFERLEMKKSDLLEMFKYNEFKVRILNEKVTTDRTTVYKCGSLIDLCRGPHVRHTGKVKALKITKNSSTYWEGKADAETLQRVYGISFPDPKQLKEWEKLQEEAAKRDHRKIGREQELFFFHELSPGSCFFQPRGAHIYNTLMGFIKAEYRKRGFQEVISPNIYNAKLWMTSGHWQHYAENMFSFEAEKEKFALKPMNCPGHCLIFDNRNRSWRELPLRMADFGVLHRNELSGALTGLTRVRRFQQDDAHIFCAPEQIKSEMKGCLEFLKYVYTIFGFSFQLVLSTRPDNYLGELEQWNDAEKALAESLNEFGMPWKENPGDGAFYGPKIDITIMDALKRAHQCATIQLDFQLPIRFNLSYIADDGEKK---------RPVIIHRAILGSVERMIAILTENFAGKWPFWLSPRQVMVVPVGPAYDQYAQSVRDQLHDAGFMSEADCDAGDTMNKKIRNAQLAQFNFILVVGDKERSSNTVNVRTRDNKVHGEVSVAELITKLQKI 679          
BLAST of Threonine--tRNA ligase, cytoplasmic vs. Ensembl Fly
Match: ThrRS (gene:FBgn0027081 transcript:FBtr0080332)

HSP 1 Score: 876.7 bits (2264), Expect = 0.000e+0
Identity = 413/666 (62.01%), Postives = 511/666 (76.73%), Query Frame = 1
Query:  100 PEFIEKRIKLWDEWKKEYDEFVEKQERKEITITLKDGQNVIGKAWETSPYICMKEICQSVADNAVIAKVNGVLWDLDRPLENDSSLELLNFDSKDGEYVFWHSSAHILGEVMELEYAGHLCYGPPIEEGFYYDMFLKDRQVKPEEYKTLDXXXXXXXXXXXXXXRLEVSIDRLLEMFDYNEFKCRILKERVKTDKTTIYRCGDLIDLCQGPHVRNTGKVKALSVIKNSASYWEGDATRESLQRIYGISFPDPKQMKEWKTIQEEAAKRDHRKIGTKQQLFMFHELSPGSCFFLPKGTVIYNKLVDFMKEQYWTRGFTEVISPNLYNSKLWETSGHWEHYKENMFQTEIEKCKFAMKPMNCPGHCLMFGSTIRSYRDLPIRLADFGVLHRNEASGALTGLTRVRRFQQDDAHIFCREDQITKEIESCLDFLDYTYRVFGFDFQLKLSTRPEKFLGEISMWDKAEAQLTDALNNFGKKWELNPADGAFYGPKIDITITDALRRHHQCATIQLDFQLPIRFSLEYMTDSAAQREGDSKITLARPVIIHRAILGSVERMFAILAENYGGKWPFWLSPFQAIVIPFNPSCDEYALSIQKAVHDAGFHVDIDLDTKSIFNKKISKAQEAQYNFMLVVGKKEVENKTVNIRTRDNKVHGERSIEKVIERFREL 2097
            P++IE+R   W++ K EY+  +  ++R+ I +TL DG+ V   +WET+PY   + I Q +ADN VI+KVNG +WDLDR LE + +L+LL FD  + + VFWHSSAHI+GE ME  Y GHLCYGPPIE GFYYDM L+   +   +Y  ++   K+IVKEKQ FERLE+    LLEMF YNEFK RIL E+V TD+TT+Y+CG LIDLC+GPHVR+TGKVKAL + KNS++YWEG A  E+LQR+YGISFPDPKQ+KEW+ +QEEAAKRDHRKIG +Q+LF FHELSPGSCFF P+G  IYN L+ F+K +Y  RGF EVISPN+YN+KLW TSGHW+HY ENMF  E EK KFA+KPMNCPGHCL+F +  RS+R+LP+R+ADFGVLHRNE SGALTGLTRVRRFQQDDAHIFC  +QI  E++ CL+FL Y Y +FGF FQL LSTRP+ +LGE+  W+ AE  L ++LN FG  W+ NP DGAFYGPKIDITI DAL+R HQCATIQLDFQLPIRF+L Y+ D   ++         RPVIIHRAILGSVERM AIL EN+ GKWPFWLSP Q +V+P  P+ D+YA S++  +HDAGF  + D D     NKKI  AQ AQ+NF+LVVG KE  + TVN+RTRDNKVHGE S+ ++I + +++
Sbjct:   80 PKYIEERNVFWEKCKAEYEAELAAKKREPIKVTLPDGKQVDATSWETTPYEVARGISQGLADNTVISKVNGEVWDLDRVLEGNCTLQLLKFDDPEAQAVFWHSSAHIMGEAMERIYGGHLCYGPPIENGFYYDMHLEGEGISTNDYGAMEGLVKQIVKEKQNFERLEMKKSDLLEMFKYNEFKVRILNEKVTTDRTTVYKCGSLIDLCRGPHVRHTGKVKALKITKNSSTYWEGKADAETLQRVYGISFPDPKQLKEWEKLQEEAAKRDHRKIGREQELFFFHELSPGSCFFQPRGAHIYNTLMGFIKAEYRKRGFQEVISPNIYNAKLWMTSGHWQHYAENMFSFEAEKEKFALKPMNCPGHCLIFDNRNRSWRELPLRMADFGVLHRNELSGALTGLTRVRRFQQDDAHIFCAPEQIKSEMKGCLEFLKYVYTIFGFSFQLVLSTRPDNYLGELEQWNDAEKALAESLNEFGMPWKENPGDGAFYGPKIDITIMDALKRAHQCATIQLDFQLPIRFNLSYIADDGEKK---------RPVIIHRAILGSVERMIAILTENFAGKWPFWLSPRQVMVVPVGPAYDQYAQSVRDQLHDAGFMSEADCDAGDTMNKKIRNAQLAQFNFILVVGDKERSSNTVNVRTRDNKVHGEVSVAELITKLQKI 736          
BLAST of Threonine--tRNA ligase, cytoplasmic vs. Ensembl Fly
Match: ThrRS (gene:FBgn0027081 transcript:FBtr0346436)

HSP 1 Score: 876.7 bits (2264), Expect = 0.000e+0
Identity = 413/666 (62.01%), Postives = 511/666 (76.73%), Query Frame = 1
Query:  100 PEFIEKRIKLWDEWKKEYDEFVEKQERKEITITLKDGQNVIGKAWETSPYICMKEICQSVADNAVIAKVNGVLWDLDRPLENDSSLELLNFDSKDGEYVFWHSSAHILGEVMELEYAGHLCYGPPIEEGFYYDMFLKDRQVKPEEYKTLDXXXXXXXXXXXXXXRLEVSIDRLLEMFDYNEFKCRILKERVKTDKTTIYRCGDLIDLCQGPHVRNTGKVKALSVIKNSASYWEGDATRESLQRIYGISFPDPKQMKEWKTIQEEAAKRDHRKIGTKQQLFMFHELSPGSCFFLPKGTVIYNKLVDFMKEQYWTRGFTEVISPNLYNSKLWETSGHWEHYKENMFQTEIEKCKFAMKPMNCPGHCLMFGSTIRSYRDLPIRLADFGVLHRNEASGALTGLTRVRRFQQDDAHIFCREDQITKEIESCLDFLDYTYRVFGFDFQLKLSTRPEKFLGEISMWDKAEAQLTDALNNFGKKWELNPADGAFYGPKIDITITDALRRHHQCATIQLDFQLPIRFSLEYMTDSAAQREGDSKITLARPVIIHRAILGSVERMFAILAENYGGKWPFWLSPFQAIVIPFNPSCDEYALSIQKAVHDAGFHVDIDLDTKSIFNKKISKAQEAQYNFMLVVGKKEVENKTVNIRTRDNKVHGERSIEKVIERFREL 2097
            P++IE+R   W++ K EY+  +  ++R+ I +TL DG+ V   +WET+PY   + I Q +ADN VI+KVNG +WDLDR LE + +L+LL FD  + + VFWHSSAHI+GE ME  Y GHLCYGPPIE GFYYDM L+   +   +Y  ++   K+IVKEKQ FERLE+    LLEMF YNEFK RIL E+V TD+TT+Y+CG LIDLC+GPHVR+TGKVKAL + KNS++YWEG A  E+LQR+YGISFPDPKQ+KEW+ +QEEAAKRDHRKIG +Q+LF FHELSPGSCFF P+G  IYN L+ F+K +Y  RGF EVISPN+YN+KLW TSGHW+HY ENMF  E EK KFA+KPMNCPGHCL+F +  RS+R+LP+R+ADFGVLHRNE SGALTGLTRVRRFQQDDAHIFC  +QI  E++ CL+FL Y Y +FGF FQL LSTRP+ +LGE+  W+ AE  L ++LN FG  W+ NP DGAFYGPKIDITI DAL+R HQCATIQLDFQLPIRF+L Y+ D   ++         RPVIIHRAILGSVERM AIL EN+ GKWPFWLSP Q +V+P  P+ D+YA S++  +HDAGF  + D D     NKKI  AQ AQ+NF+LVVG KE  + TVN+RTRDNKVHGE S+ ++I + +++
Sbjct:   80 PKYIEERNVFWEKCKAEYEAELAAKKREPIKVTLPDGKQVDATSWETTPYEVARGISQGLADNTVISKVNGEVWDLDRVLEGNCTLQLLKFDDPEAQAVFWHSSAHIMGEAMERIYGGHLCYGPPIENGFYYDMHLEGEGISTNDYGAMEGLVKQIVKEKQNFERLEMKKSDLLEMFKYNEFKVRILNEKVTTDRTTVYKCGSLIDLCRGPHVRHTGKVKALKITKNSSTYWEGKADAETLQRVYGISFPDPKQLKEWEKLQEEAAKRDHRKIGREQELFFFHELSPGSCFFQPRGAHIYNTLMGFIKAEYRKRGFQEVISPNIYNAKLWMTSGHWQHYAENMFSFEAEKEKFALKPMNCPGHCLIFDNRNRSWRELPLRMADFGVLHRNELSGALTGLTRVRRFQQDDAHIFCAPEQIKSEMKGCLEFLKYVYTIFGFSFQLVLSTRPDNYLGELEQWNDAEKALAESLNEFGMPWKENPGDGAFYGPKIDITIMDALKRAHQCATIQLDFQLPIRFNLSYIADDGEKK---------RPVIIHRAILGSVERMIAILTENFAGKWPFWLSPRQVMVVPVGPAYDQYAQSVRDQLHDAGFMSEADCDAGDTMNKKIRNAQLAQFNFILVVGDKERSSNTVNVRTRDNKVHGEVSVAELITKLQKI 736          
BLAST of Threonine--tRNA ligase, cytoplasmic vs. Ensembl Fly
Match: mRpL39 (gene:FBgn0036462 transcript:FBtr0075672)

HSP 1 Score: 86.2705 bits (212), Expect = 9.101e-18
Identity = 75/292 (25.68%), Postives = 138/292 (47.26%), Query Frame = 1
Query:   58 TVWVIL-GFQRMITKPEF------IEKRIKLWDEWKKEYDEFVEKQERKEIT-ITLKDGQNVIGKAWETSPYICMKEICQSVADNAVIAKVNG-VLWDLDRPLENDSSLELLNFDSKDGEYV---FWHSSAHILGEVM------ELEYAGHLCYGPPIEEG-FYYDMFLKDRQVKP--EEYKTLDXXXXXXXXXXXXXXRLEVSIDRLLEMFDYNEFKCRILK--ERVKTDKTTIYRCGDLIDLCQGPHVRNTGKVKALSVIKNSASYWEGDATRESLQRIYGISFPDPKQM 864
            T W  L   Q+  TK  F      + KR  L+++ ++   + V + ++ E+  + L +   ++     ++P+ C + + +     + +A ++G V WD+ RPL+   +L+LLNF   +   V   FW + + +LG  +      E     H   GP I+ G F +D+ L+ +  +P  EE + L  +  K+  +  + ERL+V  D   EMF  +++K   L    +    + T+YR GD ID+ +GP V +T  +    +        EG +   +  RI G++ P   Q+
Sbjct:   10 TSWCALRQLQQYRTKANFSGSSASLAKRNDLFNQEQRRQRDAVGRIDKIEVRYLGLPEDVTLVMNGNISTPFNCAQHLSEGHCKRSALALIDGSVPWDMHRPLQESCTLQLLNFHVSEPHVVNKAFWRTCSFMLGAALNRAFKPEANLQLHSFPGPNIKSGSFVHDIVLQTQNWEPGKEEMRALSAEMVKLAAQDLRIERLDVQQDLAQEMFKDSKYKSEQLPSISQQTNGRVTLYRLGDHIDISRGPMVASTSFLGKCVISAAHKVAEEGPSG--AFYRIQGVALPSGFQL 299          
BLAST of Threonine--tRNA ligase, cytoplasmic vs. Ensembl Zebrafish
Match: tars1 (threonyl-tRNA synthetase 1 [Source:ZFIN;Acc:ZDB-GENE-041010-218])

HSP 1 Score: 895.575 bits (2313), Expect = 0.000e+0
Identity = 431/689 (62.55%), Postives = 527/689 (76.49%), Query Frame = 1
Query:   76 GFQRMITKPEFIEKRIKLWDEWKKEYDEFVEKQ---ERKEITITLKDGQNVIGKAWETSPYICMKEICQSVADNAVIAKVNGVLWDLDRPLENDSSLELLNFDSKDGEYVFWHSSAHILGEVMELEYAGHLCYGPPIEEGFYYDMFLKDRQVKPEEYKTLDXXXXXXXXXXXXXXRLEVSIDRLLEMFDYNEFKCRILKERVKTDKTTIYRCGDLIDLCQGPHVRNTGKVKALSVIKNSASYWEGDATRESLQRIYGISFPDPKQMKEWKTIQEEAAKRDHRKIGTKQQLFMFHELSPGSCFFLPKGTVIYNKLVDFMKEQYWTRGFTEVISPNLYNSKLWETSGHWEHYKENMFQTEIEKCKFAMKPMNCPGHCLMFGSTIRSYRDLPIRLADFGVLHRNEASGALTGLTRVRRFQQDDAHIFCREDQITKEIESCLDFLDYTYRVFGFDFQLKLSTRPEKFLGEISMWDKAEAQLTDALNNFGKKWELNPADGAFYGPKIDITITDALRRHHQCATIQLDFQLPIRFSLEYMTDSAAQREGDSKITLARPVIIHRAILGSVERMFAILAENYGGKWPFWLSPFQAIVIPFNPSCDEYALSIQKAVHDAGFHVDIDLDTKSIFNKKISKAQEAQYNFMLVVGKKEVENKTVNIRTRDNKVHGERSIEKVIERFRELETSRASDNQFEF 2133
            G   +   P++I++R+ ++++ K+E+D  + ++   E K I ITL DG+ V G++W+T+PY     I Q +ADN VI+KVN  +WDLDRPLE D SL  L FD ++ + V+WHSSAHI+GE ME  Y G LCYGPPIE GFYYDM+L +  V   ++  L+  CKKI+KEKQ FERLEV  + LLEMF YN+FKCRIL E+V T  TT+YRCG LIDLC+GPHVR+TGK+KA+ + KNS++YWEG A  ESLQRIYGISFPDPK +KEW+  QEEA  RDHRK+G +Q LF FH+LSPGSCFFLPKG  IYN L++F++ +Y  RGF EV++PN+YNSKLW+TSGHW+HY ENMF  E+EK  FA+KPMNCPGHCLMF    RS+R+LP+RLADFGVLHRNE SGALTGLTRVRRFQQDDAHIFC  DQI  EI+ CLDFL   Y VFGF F+L LSTRPEKFLGE  +WD+AE QL ++LN+FG+KW LNP DGAFYGPKIDI I DA+ R+HQCATIQLDFQLPIRF+L +++      +GD K    RPVIIHRAILGSVERM AIL ENYGGKWP WLSP Q +V+P  P+CDEYA  +QK  H  G   D+DLD     NKKI  AQ AQYNF+LVVG+KE  + TVN+RTRDNKVHGERS+   +ER ++L+ SR  + + EF
Sbjct:   38 GKTELSPPPQYIDERLSIYNKLKEEHDALLAEKAAKESKPIKITLPDGKVVDGESWKTTPYQVACGISQGLADNTVISKVNNGVWDLDRPLEEDCSLVFLKFDDEEAQAVYWHSSAHIMGEAMERVYGGCLCYGPPIENGFYYDMYLDNEGVSSNDFPCLENLCKKIIKEKQPFERLEVKKETLLEMFKYNKFKCRILNEKVTTPTTTVYRCGPLIDLCRGPHVRHTGKIKAMKIHKNSSTYWEGKADMESLQRIYGISFPDPKMLKEWEKFQEEAKNRDHRKLGREQDLFFFHDLSPGSCFFLPKGAYIYNTLIEFIRSEYRKRGFQEVVTPNIYNSKLWQTSGHWQHYSENMFSFEVEKEIFALKPMNCPGHCLMFDHRPRSWRELPLRLADFGVLHRNELSGALTGLTRVRRFQQDDAHIFCSMDQIESEIKGCLDFLRTVYDVFGFTFKLNLSTRPEKFLGEPEVWDQAEKQLENSLNDFGEKWVLNPGDGAFYGPKIDIQIKDAIGRYHQCATIQLDFQLPIRFNLTFVS-----HDGDDK---KRPVIIHRAILGSVERMIAILTENYGGKWPLWLSPRQVMVVPIGPTCDEYAQRVQKEFHKVGLMTDVDLDPGCTLNKKIRNAQLAQYNFILVVGEKEKSSDTVNVRTRDNKVHGERSLTDCMERLKQLKASRTRNAEEEF 718          
BLAST of Threonine--tRNA ligase, cytoplasmic vs. Ensembl Zebrafish
Match: tars1 (threonyl-tRNA synthetase 1 [Source:ZFIN;Acc:ZDB-GENE-041010-218])

HSP 1 Score: 844.729 bits (2181), Expect = 0.000e+0
Identity = 418/692 (60.40%), Postives = 512/692 (73.99%), Query Frame = 1
Query:   76 GFQRMITKPEFIEKRIKLWDEWKKEYDEFVEKQ---ERKEITITLKDGQNVIGKAWETSPYICMKEICQSVADNAVIAKVNGVLWDLDRPLENDSSLELLNFDSKDGEYVFWHSSAHILGEVMELEYAGHLCYGPPIEEGFYYDMFLKDRQVKPEEYKTLDXXXXXXXXXXXXXXRLEVSIDRLLEMFDYNEFKCRILKERVKTDKTTIYRCGDLIDLCQGPHVRNTGKVKALSVIKNSASYWEGDATRESLQRIYGISFPDPKQMKEWKTIQEEAAKRDHRKIGTKQQLFMFHELSPGSCFFLPKGTVIYNKLVDFMKEQYWTRGFTEVISPNLYNSKLWETSGHWEHYKENMFQTEIEKCKFAMKPMNCPGHCLMFGSTIRSYRDLPIRLADFGVLHRNEASGALTGLTRVRRFQQDDAHIFCREDQITKEIESCLDFLDYTYRVFGFDFQLKLSTRPEKFLGEISMWDKAEAQLTDALN---NFGKKWELNPADGAFYGPKIDITITDALRRHHQCATIQLDFQLPIRFSLEYMTDSAAQREGDSKITLARPVIIHRAILGSVERMFAILAENYGGKWPFWLSPFQAIVIPFNPSCDEYALSIQKAVHDAGFHVDIDLDTKSIFNKKISKAQEAQYNFMLVVGKKEVENKTVNIRTRDNKVHGERSIEKVIERFRELETSRASDNQFEF 2133
            G   +   P++I++R+ ++++ K+E+D  + ++   E K I ITL DG+ V G++W+T+PY     I Q +ADN VI+KVN  +WDLDRPLE D SL  L FD ++ + V+WHSSAHI+GE ME  Y G LCYGPPIE GFYYDM+L +  V   ++  L+  CKKI+KEKQ FERLEV  + LLEMF YN+FKCRIL E+V T  TT+YRCG LIDLC+GPHVR+TGK+KA+ + KNS++YWEG A  ESLQRIYGISFPDPK +KEW+  QEEA  RDHRK+G +Q LF FH+LSPGSCFFLPKG  IYN L++F++ +Y  RGF EV++PN+YNSKLW+TSGHW+HY ENMF  E+EK  FA+KPMNCPGHCLMF    RS+R+LP+RLADFGVLHRNE SGALTGLTRVRRFQQDDAHIFC  DQI  EI+ CLDFL   Y VFGF F+L LSTRPEKFLGE  +WD+AE      ++   NFG       AD  F    IDI I DA+ R+HQCATIQLDFQLPIRF+L +++      +GD K    RPVIIHRAILGSVERM AIL ENYGGKWP WLSP Q +V+P  P+CDEYA  +QK  H  G   D+DLD     NKKI  AQ AQYNF+LVVG+KE  + TVN+RTRDNKVHGERS+   +ER ++L+ SR  + + EF
Sbjct:   20 GKTELSPPPQYIDERLSIYNKLKEEHDALLAEKAAKESKPIKITLPDGKVVDGESWKTTPYQVACGISQGLADNTVISKVNNGVWDLDRPLEEDCSLVFLKFDDEEAQAVYWHSSAHIMGEAMERVYGGCLCYGPPIENGFYYDMYLDNEGVSSNDFPCLENLCKKIIKEKQPFERLEVKKETLLEMFKYNKFKCRILNEKVTTPTTTVYRCGPLIDLCRGPHVRHTGKIKAMKIHKNSSTYWEGKADMESLQRIYGISFPDPKMLKEWEKFQEEAKNRDHRKLGREQDLFFFHDLSPGSCFFLPKGAYIYNTLIEFIRSEYRKRGFQEVVTPNIYNSKLWQTSGHWQHYSENMFSFEVEKEIFALKPMNCPGHCLMFDHRPRSWRELPLRLADFGVLHRNELSGALTGLTRVRRFQQDDAHIFCSMDQIESEIKGCLDFLRTVYDVFGFTFKLNLSTRPEKFLGEPEVWDQAEKVKFTTVSITLNFG-------ADSTF----IDIQIKDAIGRYHQCATIQLDFQLPIRFNLTFVS-----HDGDDK---KRPVIIHRAILGSVERMIAILTENYGGKWPLWLSPRQVMVVPIGPTCDEYAQRVQKEFHKVGLMTDVDLDPGCTLNKKIRNAQLAQYNFILVVGEKEKSSDTVNVRTRDNKVHGERSLTDCMERLKQLKASRTRNAEEEF 692          
BLAST of Threonine--tRNA ligase, cytoplasmic vs. Ensembl Zebrafish
Match: tars1 (threonyl-tRNA synthetase 1 [Source:ZFIN;Acc:ZDB-GENE-041010-218])

HSP 1 Score: 834.328 bits (2154), Expect = 0.000e+0
Identity = 410/689 (59.51%), Postives = 504/689 (73.15%), Query Frame = 1
Query:   76 GFQRMITKPEFIEKRIKLWDEWKKEYDEFVEKQ---ERKEITITLKDGQNVIGKAWETSPYICMKEICQSVADNAVIAKVNGVLWDLDRPLENDSSLELLNFDSKDGEYVFWHSSAHILGEVMELEYAGHLCYGPPIEEGFYYDMFLKDRQVKPEEYKTLDXXXXXXXXXXXXXXRLEVSIDRLLEMFDYNEFKCRILKERVKTDKTTIYRCGDLIDLCQGPHVRNTGKVKALSVIKNSASYWEGDATRESLQRIYGISFPDPKQMKEWKTIQEEAAKRDHRKIGTKQQLFMFHELSPGSCFFLPKGTVIYNKLVDFMKEQYWTRGFTEVISPNLYNSKLWETSGHWEHYKENMFQTEIEKCKFAMKPMNCPGHCLMFGSTIRSYRDLPIRLADFGVLHRNEASGALTGLTRVRRFQQDDAHIFCREDQITKEIESCLDFLDYTYRVFGFDFQLKLSTRPEKFLGEISMWDKAEAQLTDALNNFGKKWELNPADGAFYGPKIDITITDALRRHHQCATIQLDFQLPIRFSLEYMTDSAAQREGDSKITLARPVIIHRAILGSVERMFAILAENYGGKWPFWLSPFQAIVIPFNPSCDEYALSIQKAVHDAGFHVDIDLDTKSIFNKKISKAQEAQYNFMLVVGKKEVENKTVNIRTRDNKVHGERSIEKVIERFRELETSRASDNQFEF 2133
            G   +   P++I++R+ ++++ K+E+D  + ++   E K I ITL DG+ V G++W+T+PY     I Q +ADN VI+KVN  +WDLDRPLE D SL  L FD ++ + V+WHSSAHI+GE ME  Y G LCYGPPIE GFYYDM+L +  V   ++  L+  CKKI+KEKQ FERLEV  + LLEMF YN+FKCRIL E+V T  TT+YRCG LIDLC+GPHVRNTGK+KA+ + KNS++YWEG A  ESLQRIYGISFPDPK +KEW+  QEEA  RDHRK+G +Q LF FH+LSPGSCFFLPKG  IYN L++F++ +Y  RGF EV++PN+YNSKLW+TSGHW+HY ENMF  E+EK  FA+KPMNCPGHCLMF    RS+R+LP+RLADFGVLHRNE SGALTGLTRVRRFQQDDAHIFC  DQI  EI+ CLDFL   Y VFGF F+L LSTRPEKFLGE  ++ +   +L +                      IDI I DA+ R+HQCATIQLDFQLPIRF+L +++      +GD K    RPVIIHRAILGSVERM AIL ENYGGKWP WLSP Q +V+P  P+CDEYA  +QK  H  G   D+DLD     NKKI  AQ AQYNF+LVVG+KE  + TVN+RTRDNKVHGERS+   +ER ++L+ SR  + + EF
Sbjct:   20 GKTELSPPPQYIDERLSIYNKLKEEHDALLAEKAAKESKPIKITLPDGKVVDGESWKTTPYQVACGISQGLADNTVISKVNNGVWDLDRPLEEDCSLVFLKFDDEEAQAVYWHSSAHIMGEAMERVYGGCLCYGPPIENGFYYDMYLDNEGVSSNDFPCLENLCKKIIKEKQPFERLEVKKETLLEMFKYNKFKCRILNEKVTTPTTTVYRCGPLIDLCRGPHVRNTGKIKAMKIHKNSSTYWEGKADMESLQRIYGISFPDPKMLKEWEKFQEEAKNRDHRKLGREQDLFFFHDLSPGSCFFLPKGAYIYNTLIEFIRSEYRKRGFQEVVTPNIYNSKLWQTSGHWQHYSENMFSFEVEKEIFALKPMNCPGHCLMFDHRPRSWRELPLRLADFGVLHRNELSGALTGLTRVRRFQQDDAHIFCSMDQIESEIKGCLDFLRTVYDVFGFTFKLNLSTRPEKFLGEPEVYKQMNKELPEHF--------------------IDIQIKDAIGRYHQCATIQLDFQLPIRFNLTFVS-----HDGDDK---KRPVIIHRAILGSVERMIAILTENYGGKWPLWLSPRQVMVVPIGPTCDEYAQRVQKEFHKVGLMTDVDLDPGCTLNKKIRNAQLAQYNFILVVGEKEKSSDTVNVRTRDNKVHGERSLTDCMERLKQLKASRTRNAEEEF 680          
BLAST of Threonine--tRNA ligase, cytoplasmic vs. Ensembl Zebrafish
Match: tars1 (threonyl-tRNA synthetase 1 [Source:ZFIN;Acc:ZDB-GENE-041010-218])

HSP 1 Score: 790.415 bits (2040), Expect = 0.000e+0
Identity = 392/645 (60.78%), Postives = 477/645 (73.95%), Query Frame = 1
Query:   76 GFQRMITKPEFIEKRIKLWDEWKKEYDEFVEKQ---ERKEITITLKDGQNVIGKAWETSPYICMKEICQSVADNAVIAKVNGVLWDLDRPLENDSSLELLNFDSKDGEYVFWHSSAHILGEVMELEYAGHLCYGPPIEEGFYYDMFLKDRQVKPEEYKTLDXXXXXXXXXXXXXXRLEVSIDRLLEMFDYNEFKCRILKERVKTDKTTIYRCGDLIDLCQGPHVRNTGKVKALSVIKNSASYWEGDATRESLQRIYGISFPDPKQMKEWKTIQEEAAKRDHRKIGTKQQLFMFHELSPGSCFFLPKGTVIYNKLVDFMKEQYWTRGFTEVISPNLYNSKLWETSGHWEHYKENMFQTEIEKCKFAMKPMNCPGHCLMFGSTIRSYRDLPIRLADFGVLHRNEASGALTGLTRVRRFQQDDAHIFCREDQITKEIESCLDFLDYTYRVFGFDFQLKLSTRPEKFLGEISMWDKAEAQLTDALN---NFGKKWELNPADGAFYGPKIDITITDALRRHHQCATIQLDFQLPIRFSLEYMTDSAAQREGDSKITLARPVIIHRAILGSVERMFAILAENYGGKWPFWLSPFQAIVIPFNPSCDEYALSIQKAVHDAGFHVDIDLDTKSIFNKKISKAQEAQYNFMLVV 1992
            G   +   P++I++R+ ++++ K+E+D  + ++   E K I ITL DG+ V G++W+T+PY     I Q +ADN VI+KVN  +WDLDRPLE D SL  L FD ++ + V+WHSSAHI+GE ME  Y G LCYGPPIE GFYYDM+L +  V   ++  L+  CKKI+KEKQ FERLEV  + LLEMF YN+FKCRIL E+V T  TT+YRCG LIDLC+GPHVR+TGK+KA+ + KNS++YWEG A  ESLQRIYGISFPDPK +KEW+  QEEA  RDHRK+G +Q LF FH+LSPGSCFFLPKG  IYN L++F++ +Y  RGF EV++PN+YNSKLW+TSGHW+HY ENMF  E+EK  FA+KPMNCPGHCLMF    RS+R+LP+RLADFGVLHRNE SGALTGLTRVRRFQQDDAHIFC  DQI  EI+ CLDFL   Y VFGF F+L LSTRPEKFLGE  +WD+AE      ++   NFG       AD  F    IDI I DA+ R+HQCATIQLDFQLPIRF+L +++      +GD K    RPVIIHRAILGSVERM AIL ENYGGKWP WLSP Q +V+P  P+CDEYA  +QK  H  G   D+DLD     NKKI  AQ AQYNF+LV+
Sbjct:   20 GKTELSPPPQYIDERLSIYNKLKEEHDALLAEKAAKESKPIKITLPDGKVVDGESWKTTPYQVACGISQGLADNTVISKVNNGVWDLDRPLEEDCSLVFLKFDDEEAQAVYWHSSAHIMGEAMERVYGGCLCYGPPIENGFYYDMYLDNEGVSSNDFPCLENLCKKIIKEKQPFERLEVKKETLLEMFKYNKFKCRILNEKVTTPTTTVYRCGPLIDLCRGPHVRHTGKIKAMKIHKNSSTYWEGKADMESLQRIYGISFPDPKMLKEWEKFQEEAKNRDHRKLGREQDLFFFHDLSPGSCFFLPKGAYIYNTLIEFIRSEYRKRGFQEVVTPNIYNSKLWQTSGHWQHYSENMFSFEVEKEIFALKPMNCPGHCLMFDHRPRSWRELPLRLADFGVLHRNELSGALTGLTRVRRFQQDDAHIFCSMDQIESEIKGCLDFLRTVYDVFGFTFKLNLSTRPEKFLGEPEVWDQAEKVKFTTVSITLNFG-------ADSTF----IDIQIKDAIGRYHQCATIQLDFQLPIRFNLTFVS-----HDGDDK---KRPVIIHRAILGSVERMIAILTENYGGKWPLWLSPRQVMVVPIGPTCDEYAQRVQKEFHKVGLMTDVDLDPGCTLNKKIRNAQLAQYNFILVL 645          
BLAST of Threonine--tRNA ligase, cytoplasmic vs. Ensembl Zebrafish
Match: tars1 (threonyl-tRNA synthetase 1 [Source:ZFIN;Acc:ZDB-GENE-041010-218])

HSP 1 Score: 780.015 bits (2013), Expect = 0.000e+0
Identity = 384/642 (59.81%), Postives = 469/642 (73.05%), Query Frame = 1
Query:   76 GFQRMITKPEFIEKRIKLWDEWKKEYDEFVEKQ---ERKEITITLKDGQNVIGKAWETSPYICMKEICQSVADNAVIAKVNGVLWDLDRPLENDSSLELLNFDSKDGEYVFWHSSAHILGEVMELEYAGHLCYGPPIEEGFYYDMFLKDRQVKPEEYKTLDXXXXXXXXXXXXXXRLEVSIDRLLEMFDYNEFKCRILKERVKTDKTTIYRCGDLIDLCQGPHVRNTGKVKALSVIKNSASYWEGDATRESLQRIYGISFPDPKQMKEWKTIQEEAAKRDHRKIGTKQQLFMFHELSPGSCFFLPKGTVIYNKLVDFMKEQYWTRGFTEVISPNLYNSKLWETSGHWEHYKENMFQTEIEKCKFAMKPMNCPGHCLMFGSTIRSYRDLPIRLADFGVLHRNEASGALTGLTRVRRFQQDDAHIFCREDQITKEIESCLDFLDYTYRVFGFDFQLKLSTRPEKFLGEISMWDKAEAQLTDALNNFGKKWELNPADGAFYGPKIDITITDALRRHHQCATIQLDFQLPIRFSLEYMTDSAAQREGDSKITLARPVIIHRAILGSVERMFAILAENYGGKWPFWLSPFQAIVIPFNPSCDEYALSIQKAVHDAGFHVDIDLDTKSIFNKKISKAQEAQYNFMLVV 1992
            G   +   P++I++R+ ++++ K+E+D  + ++   E K I ITL DG+ V G++W+T+PY     I Q +ADN VI+KVN  +WDLDRPLE D SL  L FD ++ + V+WHSSAHI+GE ME  Y G LCYGPPIE GFYYDM+L +  V   ++  L+  CKKI+KEKQ FERLEV  + LLEMF YN+FKCRIL E+V T  TT+YRCG LIDLC+GPHVRNTGK+KA+ + KNS++YWEG A  ESLQRIYGISFPDPK +KEW+  QEEA  RDHRK+G +Q LF FH+LSPGSCFFLPKG  IYN L++F++ +Y  RGF EV++PN+YNSKLW+TSGHW+HY ENMF  E+EK  FA+KPMNCPGHCLMF    RS+R+LP+RLADFGVLHRNE SGALTGLTRVRRFQQDDAHIFC  DQI  EI+ CLDFL   Y VFGF F+L LSTRPEKFLGE  ++ +   +L +                      IDI I DA+ R+HQCATIQLDFQLPIRF+L +++      +GD K    RPVIIHRAILGSVERM AIL ENYGGKWP WLSP Q +V+P  P+CDEYA  +QK  H  G   D+DLD     NKKI  AQ AQYNF+LV+
Sbjct:   20 GKTELSPPPQYIDERLSIYNKLKEEHDALLAEKAAKESKPIKITLPDGKVVDGESWKTTPYQVACGISQGLADNTVISKVNNGVWDLDRPLEEDCSLVFLKFDDEEAQAVYWHSSAHIMGEAMERVYGGCLCYGPPIENGFYYDMYLDNEGVSSNDFPCLENLCKKIIKEKQPFERLEVKKETLLEMFKYNKFKCRILNEKVTTPTTTVYRCGPLIDLCRGPHVRNTGKIKAMKIHKNSSTYWEGKADMESLQRIYGISFPDPKMLKEWEKFQEEAKNRDHRKLGREQDLFFFHDLSPGSCFFLPKGAYIYNTLIEFIRSEYRKRGFQEVVTPNIYNSKLWQTSGHWQHYSENMFSFEVEKEIFALKPMNCPGHCLMFDHRPRSWRELPLRLADFGVLHRNELSGALTGLTRVRRFQQDDAHIFCSMDQIESEIKGCLDFLRTVYDVFGFTFKLNLSTRPEKFLGEPEVYKQMNKELPEHF--------------------IDIQIKDAIGRYHQCATIQLDFQLPIRFNLTFVS-----HDGDDK---KRPVIIHRAILGSVERMIAILTENYGGKWPLWLSPRQVMVVPIGPTCDEYAQRVQKEFHKVGLMTDVDLDPGCTLNKKIRNAQLAQYNFILVL 633          
BLAST of Threonine--tRNA ligase, cytoplasmic vs. Ensembl Xenopus
Match: tars (threonyl-tRNA synthetase 1 [Source:NCBI gene;Acc:407892])

HSP 1 Score: 903.664 bits (2334), Expect = 0.000e+0
Identity = 430/681 (63.14%), Postives = 535/681 (78.56%), Query Frame = 1
Query:  100 PEFIEKRIKLWDEWKKEYDEFVE---KQERKEITITLKDGQNVIGKAWETSPYICMKEICQSVADNAVIAKVNGVLWDLDRPLENDSSLELLNFDSKDGEYVFWHSSAHILGEVMELEYAGHLCYGPPIEEGFYYDMFLKDRQVKPEEYKTLDXXXXXXXXXXXXXXRLEVSIDRLLEMFDYNEFKCRILKERVKTDKTTIYRCGDLIDLCQGPHVRNTGKVKALSVIKNSASYWEGDATRESLQRIYGISFPDPKQMKEWKTIQEEAAKRDHRKIGTKQQLFMFHELSPGSCFFLPKGTVIYNKLVDFMKEQYWTRGFTEVISPNLYNSKLWETSGHWEHYKENMFQTEIEKCKFAMKPMNCPGHCLMFGSTIRSYRDLPIRLADFGVLHRNEASGALTGLTRVRRFQQDDAHIFCREDQITKEIESCLDFLDYTYRVFGFDFQLKLSTRPEKFLGEISMWDKAEAQLTDALNNFGKKWELNPADGAFYGPKIDITITDALRRHHQCATIQLDFQLPIRFSLEYMTDSAAQREGDSKITLARPVIIHRAILGSVERMFAILAENYGGKWPFWLSPFQAIVIPFNPSCDEYALSIQKAVHDAGFHVDIDLDTKSIFNKKISKAQEAQYNFMLVVGKKEVENKTVNIRTRDNKVHGERSIEKVIERFRELETSRASDNQFEF 2133
            PE+I +R++++++ K E+D  +     +E K I +TL DG+ V  ++W+++PY     I Q +ADN V+AKVNG +WDLDRPLE D +L LL FD ++ + V+WHSSAHI+GE ME  Y G LCYGPPIE GFYYDM+L+D  V   ++ +L+  CKKI+KEKQ+FERLEV+ + LLEMF YN+FKCRIL E+V T  TT+YRCG LIDLC+GPHVR+TGK+KAL V KNS++YWEG A  E+LQR+YGISFPDPK +KEW+  QEEA  RDHRKIG +Q+LF FHELSPGSCFFLPKG  IYN+L+ F++++Y  RGF EV++PN+YNSKLW+TSGHW+HY ENMF  E+EK  FA+KPMNCPGHCLMF    RS+R+LP+R+ADFGVLHRNE SGALTGLTRVRRFQQDDAHIFC  +QI +EI+SCLDFL   Y VFGF F+L LSTRPEKFLG+I +W++AE QL ++LN FG+KW LNP DGAFYGPKIDI I DA+ R+HQCATIQLDFQLPIRF+L Y++      +GD K    RPVIIHRAILGSVERM AIL EN+GGKWP WLSP Q +V+P  P+CDEYA  +++  H AG   D+DLD     NKKI  AQ AQYNF+LV+G+KE  + TVNIRTRDNKVHGER+I + IER  +L+ SR+ +++ EF
Sbjct:   49 PEYINQRLEMYNKLKAEHDTLLADKAAKESKAIKVTLPDGKQVDAESWKSTPYQIACGISQGLADNTVVAKVNGSVWDLDRPLEEDCTLALLKFDDEEAQAVYWHSSAHIMGEAMERVYGGCLCYGPPIENGFYYDMYLEDGGVSSNDFTSLENLCKKIMKEKQQFERLEVTKETLLEMFKYNKFKCRILNEKVDTPTTTVYRCGPLIDLCRGPHVRHTGKIKALKVHKNSSTYWEGKADMETLQRVYGISFPDPKMLKEWEKFQEEAKNRDHRKIGREQELFFFHELSPGSCFFLPKGAYIYNQLIAFIRQEYRKRGFQEVVTPNVYNSKLWQTSGHWQHYSENMFSFEVEKEIFALKPMNCPGHCLMFDHRPRSWRELPLRMADFGVLHRNELSGALTGLTRVRRFQQDDAHIFCAMEQIEEEIKSCLDFLRAVYNVFGFTFKLNLSTRPEKFLGDIEVWNQAEKQLENSLNEFGEKWVLNPGDGAFYGPKIDIQIKDAIGRYHQCATIQLDFQLPIRFNLTYVS-----HDGDDK---KRPVIIHRAILGSVERMIAILTENFGGKWPLWLSPQQVMVVPVGPTCDEYAQQVREQFHRAGLMTDVDLDPGCTLNKKIRNAQLAQYNFILVIGEKEKASGTVNIRTRDNKVHGERTIAETIERLLQLKDSRSKNSEEEF 721          
BLAST of Threonine--tRNA ligase, cytoplasmic vs. Ensembl Xenopus
Match: tars (threonyl-tRNA synthetase 1 [Source:NCBI gene;Acc:407892])

HSP 1 Score: 902.123 bits (2330), Expect = 0.000e+0
Identity = 430/681 (63.14%), Postives = 535/681 (78.56%), Query Frame = 1
Query:  100 PEFIEKRIKLWDEWKKEYDEFVE---KQERKEITITLKDGQNVIGKAWETSPYICMKEICQSVADNAVIAKVNGVLWDLDRPLENDSSLELLNFDSKDGEYVFWHSSAHILGEVMELEYAGHLCYGPPIEEGFYYDMFLKDRQVKPEEYKTLDXXXXXXXXXXXXXXRLEVSIDRLLEMFDYNEFKCRILKERVKTDKTTIYRCGDLIDLCQGPHVRNTGKVKALSVIKNSASYWEGDATRESLQRIYGISFPDPKQMKEWKTIQEEAAKRDHRKIGTKQQLFMFHELSPGSCFFLPKGTVIYNKLVDFMKEQYWTRGFTEVISPNLYNSKLWETSGHWEHYKENMFQTEIEKCKFAMKPMNCPGHCLMFGSTIRSYRDLPIRLADFGVLHRNEASGALTGLTRVRRFQQDDAHIFCREDQITKEIESCLDFLDYTYRVFGFDFQLKLSTRPEKFLGEISMWDKAEAQLTDALNNFGKKWELNPADGAFYGPKIDITITDALRRHHQCATIQLDFQLPIRFSLEYMTDSAAQREGDSKITLARPVIIHRAILGSVERMFAILAENYGGKWPFWLSPFQAIVIPFNPSCDEYALSIQKAVHDAGFHVDIDLDTKSIFNKKISKAQEAQYNFMLVVGKKEVENKTVNIRTRDNKVHGERSIEKVIERFRELETSRASDNQFEF 2133
            PE+I +R++++++ K E+D  +     +E K I +TL DG+ V  ++W+++PY     I Q +ADN V+AKVNG +WDLDRPLE D +L LL FD ++ + V+WHSSAHI+GE ME  Y G LCYGPPIE GFYYDM+L+D  V   ++ +L+  CKKI+KEKQ+FERLEV+ + LLEMF YN+FKCRIL E+V T  TT+YRCG LIDLC+GPHVR+TGK+KAL V KNS++YWEG A  E+LQR+YGISFPDPK +KEW+  QEEA  RDHRKIG +Q+LF FHELSPGSCFFLPKG  IYN+L+ F++++Y  RGF EV++PN+YNSKLW+TSGHW+HY ENMF  E+EK  FA+KPMNCPGHCLMF    RS+R+LP+R+ADFGVLHRNE SGALTGLTRVRRFQQDDAHIFC  +QI +EI+SCLDFL   Y VFGF F+L LSTRPEKFLG+I +W++AE QL ++LN FG+KW LNP DGAFYGPKIDI I DA+ R+HQCATIQLDFQLPIRF+L Y++      +GD K    RPVIIHRAILGSVERM AIL EN+GGKWP WLSP Q +V+P  P+CDEYA  +++  H AG   D+DLD     NKKI  AQ AQYNF+LV+G+KE  + TVNIRTRDNKVHGER+I + IER  +L+ SR+ +++ EF
Sbjct:   14 PEYINQRLEMYNKLKAEHDTLLADKAAKESKAIKVTLPDGKQVDAESWKSTPYQIACGISQGLADNTVVAKVNGSVWDLDRPLEEDCTLALLKFDDEEAQAVYWHSSAHIMGEAMERVYGGCLCYGPPIENGFYYDMYLEDGGVSSNDFTSLENLCKKIMKEKQQFERLEVTKETLLEMFKYNKFKCRILNEKVDTPTTTVYRCGPLIDLCRGPHVRHTGKIKALKVHKNSSTYWEGKADMETLQRVYGISFPDPKMLKEWEKFQEEAKNRDHRKIGREQELFFFHELSPGSCFFLPKGAYIYNQLIAFIRQEYRKRGFQEVVTPNVYNSKLWQTSGHWQHYSENMFSFEVEKEIFALKPMNCPGHCLMFDHRPRSWRELPLRMADFGVLHRNELSGALTGLTRVRRFQQDDAHIFCAMEQIEEEIKSCLDFLRAVYNVFGFTFKLNLSTRPEKFLGDIEVWNQAEKQLENSLNEFGEKWVLNPGDGAFYGPKIDIQIKDAIGRYHQCATIQLDFQLPIRFNLTYVS-----HDGDDK---KRPVIIHRAILGSVERMIAILTENFGGKWPLWLSPQQVMVVPVGPTCDEYAQQVREQFHRAGLMTDVDLDPGCTLNKKIRNAQLAQYNFILVIGEKEKASGTVNIRTRDNKVHGERTIAETIERLLQLKDSRSKNSEEEF 686          
BLAST of Threonine--tRNA ligase, cytoplasmic vs. Ensembl Xenopus
Match: tars (threonyl-tRNA synthetase 1 [Source:NCBI gene;Acc:407892])

HSP 1 Score: 899.812 bits (2324), Expect = 0.000e+0
Identity = 430/681 (63.14%), Postives = 535/681 (78.56%), Query Frame = 1
Query:  100 PEFIEKRIKLWDEWKKEYDEFVE---KQERKEITITLKDGQNVIGKAWETSPYICMKEICQSVADNAVIAKVNGVLWDLDRPLENDSSLELLNFDSKDGEYVFWHSSAHILGEVMELEYAGHLCYGPPIEEGFYYDMFLKDRQVKPEEYKTLDXXXXXXXXXXXXXXRLEVSIDRLLEMFDYNEFKCRILKERVKTDKTTIYRCGDLIDLCQGPHVRNTGKVKALSVIKNSASYWEGDATRESLQRIYGISFPDPKQMKEWKTIQEEAAKRDHRKIGTKQQLFMFHELSPGSCFFLPKGTVIYNKLVDFMKEQYWTRGFTEVISPNLYNSKLWETSGHWEHYKENMFQTEIEKCKFAMKPMNCPGHCLMFGSTIRSYRDLPIRLADFGVLHRNEASGALTGLTRVRRFQQDDAHIFCREDQITKEIESCLDFLDYTYRVFGFDFQLKLSTRPEKFLGEISMWDKAEAQLTDALNNFGKKWELNPADGAFYGPKIDITITDALRRHHQCATIQLDFQLPIRFSLEYMTDSAAQREGDSKITLARPVIIHRAILGSVERMFAILAENYGGKWPFWLSPFQAIVIPFNPSCDEYALSIQKAVHDAGFHVDIDLDTKSIFNKKISKAQEAQYNFMLVVGKKEVENKTVNIRTRDNKVHGERSIEKVIERFRELETSRASDNQFEF 2133
            PE+I +R++++++ K E+D  +     +E K I +TL DG+ V  ++W+++PY     I Q +ADN V+AKVNG +WDLDRPLE D +L LL FD ++ + V+WHSSAHI+GE ME  Y G LCYGPPIE GFYYDM+L+D  V   ++ +L+  CKKI+KEKQ+FERLEV+ + LLEMF YN+FKCRIL E+V T  TT+YRCG LIDLC+GPHVR+TGK+KAL V KNS++YWEG A  E+LQR+YGISFPDPK +KEW+  QEEA  RDHRKIG +Q+LF FHELSPGSCFFLPKG  IYN+L+ F++++Y  RGF EV++PN+YNSKLW+TSGHW+HY ENMF  E+EK  FA+KPMNCPGHCLMF    RS+R+LP+R+ADFGVLHRNE SGALTGLTRVRRFQQDDAHIFC  +QI +EI+SCLDFL   Y VFGF F+L LSTRPEKFLG+I +W++AE QL ++LN FG+KW LNP DGAFYGPKIDI I DA+ R+HQCATIQLDFQLPIRF+L Y++      +GD K    RPVIIHRAILGSVERM AIL EN+GGKWP WLSP Q +V+P  P+CDEYA  +++  H AG   D+DLD     NKKI  AQ AQYNF+LV+G+KE  + TVNIRTRDNKVHGER+I + IER  +L+ SR+ +++ EF
Sbjct:   43 PEYINQRLEMYNKLKAEHDTLLADKAAKESKAIKVTLPDGKQVDAESWKSTPYQIACGISQGLADNTVVAKVNGSVWDLDRPLEEDCTLALLKFDDEEAQAVYWHSSAHIMGEAMERVYGGCLCYGPPIENGFYYDMYLEDGGVSSNDFTSLENLCKKIMKEKQQFERLEVTKETLLEMFKYNKFKCRILNEKVDTPTTTVYRCGPLIDLCRGPHVRHTGKIKALKVHKNSSTYWEGKADMETLQRVYGISFPDPKMLKEWEKFQEEAKNRDHRKIGREQELFFFHELSPGSCFFLPKGAYIYNQLIAFIRQEYRKRGFQEVVTPNVYNSKLWQTSGHWQHYSENMFSFEVEKEIFALKPMNCPGHCLMFDHRPRSWRELPLRMADFGVLHRNELSGALTGLTRVRRFQQDDAHIFCAMEQIEEEIKSCLDFLRAVYNVFGFTFKLNLSTRPEKFLGDIEVWNQAEKQLENSLNEFGEKWVLNPGDGAFYGPKIDIQIKDAIGRYHQCATIQLDFQLPIRFNLTYVS-----HDGDDK---KRPVIIHRAILGSVERMIAILTENFGGKWPLWLSPQQVMVVPVGPTCDEYAQQVREQFHRAGLMTDVDLDPGCTLNKKIRNAQLAQYNFILVIGEKEKASGTVNIRTRDNKVHGERTIAETIERLLQLKDSRSKNSEEEF 715          
BLAST of Threonine--tRNA ligase, cytoplasmic vs. Ensembl Xenopus
Match: tars (threonyl-tRNA synthetase 1 [Source:NCBI gene;Acc:407892])

HSP 1 Score: 898.271 bits (2320), Expect = 0.000e+0
Identity = 431/681 (63.29%), Postives = 534/681 (78.41%), Query Frame = 1
Query:  100 PEFIEKRIKLWDEWKKEYDEFVE---KQERKEITITLKDGQNVIGKAWETSPYICMKEICQSVADNAVIAKVNGVLWDLDRPLENDSSLELLNFDSKDGEYVFWHSSAHILGEVMELEYAGHLCYGPPIEEGFYYDMFLKDRQVKPEEYKTLDXXXXXXXXXXXXXXRLEVSIDRLLEMFDYNEFKCRILKERVKTDKTTIYRCGDLIDLCQGPHVRNTGKVKALSVIKNSASYWEGDATRESLQRIYGISFPDPKQMKEWKTIQEEAAKRDHRKIGTKQQLFMFHELSPGSCFFLPKGTVIYNKLVDFMKEQYWTRGFTEVISPNLYNSKLWETSGHWEHYKENMFQTEIEKCKFAMKPMNCPGHCLMFGSTIRSYRDLPIRLADFGVLHRNEASGALTGLTRVRRFQQDDAHIFCREDQITKEIESCLDFLDYTYRVFGFDFQLKLSTRPEKFLGEISMWDKAEAQLTDALNNFGKKWELNPADGAFYGPKIDITITDALRRHHQCATIQLDFQLPIRFSLEYMTDSAAQREGDSKITLARPVIIHRAILGSVERMFAILAENYGGKWPFWLSPFQAIVIPFNPSCDEYALSIQKAVHDAGFHVDIDLDTKSIFNKKISKAQEAQYNFMLVVGKKEVENKTVNIRTRDNKVHGERSIEKVIERFRELETSRASDNQFEF 2133
            PE+I +R++++++ K E+D  +     +E K I +TL DG+ V  ++W+++PY     I Q +ADN V+AKVNG +WDLDRPLE D +L LL FD ++ + V+WHSSAHI+GE ME  Y G LCYGPPIE GFYYDM+L+D  V   ++ +L+  CKKI+KEKQ+FERLEV+ + LLEMF YN+FKCRIL E+V T  TT+YRCG LIDLC+GPHVR+TGK+KAL V KNS++YWEG A  E+LQR+YGISFPDPK +KEW+  QEEA  RDHRKIG +Q+LF FHELSPGSCFFLPKG  IYN+L+ F++++Y  RGF EV++PN+YNSKLW+TSGHW+HY ENMF  E+EK  FA+KPMNCPGHCLMF    RS+R+LP+R+ADFGVLHRNE SGALTGLTRVRRFQQDDAHIFC  +QI +EI+SCLDFL   Y VFGF F+L LSTRPEKFLG+I +W++AE QL ++LN FG+KW LNP DGAFYGPKIDI I DA+ R+HQCATIQLDFQLPIRF+L Y++      +GD K    RPVIIHRAILGSVERM AIL EN+GGKWP WLSP Q +V+P  P+CDEYA  + K  H AG   D+DLD     NKKI  AQ AQYNF+LV+G+KE  + TVNIRTRDNKVHGER+I + IER  +L+ SR+ +++ EF
Sbjct:   14 PEYINQRLEMYNKLKAEHDTLLADKAAKESKAIKVTLPDGKQVDAESWKSTPYQIACGISQGLADNTVVAKVNGSVWDLDRPLEEDCTLALLKFDDEEAQAVYWHSSAHIMGEAMERVYGGCLCYGPPIENGFYYDMYLEDGGVSSNDFTSLENLCKKIMKEKQQFERLEVTKETLLEMFKYNKFKCRILNEKVDTPTTTVYRCGPLIDLCRGPHVRHTGKIKALKVHKNSSTYWEGKADMETLQRVYGISFPDPKMLKEWEKFQEEAKNRDHRKIGREQELFFFHELSPGSCFFLPKGAYIYNQLIAFIRQEYRKRGFQEVVTPNVYNSKLWQTSGHWQHYSENMFSFEVEKEIFALKPMNCPGHCLMFDHRPRSWRELPLRMADFGVLHRNELSGALTGLTRVRRFQQDDAHIFCAMEQIEEEIKSCLDFLRAVYNVFGFTFKLNLSTRPEKFLGDIEVWNQAEKQLENSLNEFGEKWVLNPGDGAFYGPKIDIQIKDAIGRYHQCATIQLDFQLPIRFNLTYVS-----HDGDDK---KRPVIIHRAILGSVERMIAILTENFGGKWPLWLSPQQVMVVPVGPTCDEYAQQV-KQFHRAGLMTDVDLDPGCTLNKKIRNAQLAQYNFILVIGEKEKASGTVNIRTRDNKVHGERTIAETIERLLQLKDSRSKNSEEEF 685          
BLAST of Threonine--tRNA ligase, cytoplasmic vs. Ensembl Xenopus
Match: tars3 (threonyl-tRNA synthetase 3 [Source:NCBI gene;Acc:100124774])

HSP 1 Score: 890.182 bits (2299), Expect = 0.000e+0
Identity = 433/681 (63.58%), Postives = 516/681 (75.77%), Query Frame = 1
Query:  100 PEFIEKRIKLWDEWKKEYDEFVEKQ---ERKEITITLKDGQNVIGKAWETSPYICMKEICQSVADNAVIAKVNGVLWDLDRPLENDSSLELLNFDSKDGEYVFWHSSAHILGEVMELEYAGHLCYGPPIEEGFYYDMFLKDRQVKPEEYKTLDXXXXXXXXXXXXXXRLEVSIDRLLEMFDYNEFKCRILKERVKTDKTTIYRCGDLIDLCQGPHVRNTGKVKALSVIKNSASYWEGDATRESLQRIYGISFPDPKQMKEWKTIQEEAAKRDHRKIGTKQQLFMFHELSPGSCFFLPKGTVIYNKLVDFMKEQYWTRGFTEVISPNLYNSKLWETSGHWEHYKENMFQTEIEKCKFAMKPMNCPGHCLMFGSTIRSYRDLPIRLADFGVLHRNEASGALTGLTRVRRFQQDDAHIFCREDQITKEIESCLDFLDYTYRVFGFDFQLKLSTRPEKFLGEISMWDKAEAQLTDALNNFGKKWELNPADGAFYGPKIDITITDALRRHHQCATIQLDFQLPIRFSLEYMTDSAAQREGDSKITLARPVIIHRAILGSVERMFAILAENYGGKWPFWLSPFQAIVIPFNPSCDEYALSIQKAVHDAGFHVDIDLDTKSIFNKKISKAQEAQYNFMLVVGKKEVENKTVNIRTRDNKVHGERSIEKVIERFRELETSRASDNQFEF 2133
            P FI+ R+ L++  K E+D  +  +   + K I ITL DG+ V G++W+T+PY     I + +ADN VIAKVN  LWDLDRPLE DS++ELL FDS++ + V+WHSSAHILGE ME  Y G LCYGPPIE GFYYDM+L  R V   E+ +L+  CK I+KEKQ FERLEVS D LLEMF YN+FKCRIL E+V T  TT+YRCG LIDLC+GPHVR+TGK+K L + KNS++YWEG A  E+LQRIYGISFPD K MKEW+  QEEA  RDHRKIG  Q+LF FH+LSPGSCFFLP+G  IYN L DF+K +Y  R FTEV SPN+YNSKLWE SGHW+HY ENMF  E+EK  FA+KPMNCPGHCLMFG   RS+R+LP+R ADFGVLHRNE SG L+GLTRVRRFQQDDAHIFC  DQI +E+  CL FL   Y+VFGF FQL LSTRPE +LGEI +W++AE QL  +LN FG+ W+LNP DGAFYGPKIDI I DA+ R+HQCATIQLDFQLPIRF+L Y++     ++GD K    RPVIIHRAILGSVERM AIL ENYGGKWPFWLSP Q +VIP  PSCDEYA  + K V +AGF  ++DLD     NKKI  AQ AQ NF+LVVG+KE  +  VN+RTRDNKVHGE  +   IE+ + L+  R+ + + EF
Sbjct:  142 PGFIKDRLALYETLKNEHDALLAARAAHQSKPIKITLADGKQVDGESWKTTPYQVAIGISKGLADNVVIAKVNNELWDLDRPLEQDSNVELLKFDSEEAQAVYWHSSAHILGETMENFYGGCLCYGPPIENGFYYDMYLDGRGVSSNEFPSLENMCKAIIKEKQPFERLEVSKDLLLEMFKYNKFKCRILNEKVDTPTTTVYRCGPLIDLCRGPHVRHTGKIKTLKIYKNSSTYWEGRADMETLQRIYGISFPDSKLMKEWEQFQEEAKNRDHRKIGRDQELFFFHDLSPGSCFFLPRGAHIYNTLTDFIKGEYQIRNFTEVASPNIYNSKLWEMSGHWQHYSENMFSFEVEKETFALKPMNCPGHCLMFGHRPRSWRELPLRFADFGVLHRNELSGTLSGLTRVRRFQQDDAHIFCTMDQIQEEMNGCLQFLQSVYKVFGFTFQLHLSTRPENYLGEIEIWNEAEKQLESSLNQFGEPWKLNPGDGAFYGPKIDIKIKDAIGRYHQCATIQLDFQLPIRFNLTYVS-----KDGDDK---KRPVIIHRAILGSVERMIAILCENYGGKWPFWLSPRQVMVIPVGPSCDEYAQQVCKDVFEAGFMAEVDLDHSCTLNKKIRNAQLAQCNFILVVGEKEKTDSAVNVRTRDNKVHGEILLTSAIEKLKTLKKLRSKNAEEEF 814          
BLAST of Threonine--tRNA ligase, cytoplasmic vs. Ensembl Mouse
Match: Tarsl2 (threonyl-tRNA synthetase-like 2 [Source:MGI Symbol;Acc:MGI:2444486])

HSP 1 Score: 898.271 bits (2320), Expect = 0.000e+0
Identity = 428/687 (62.30%), Postives = 527/687 (76.71%), Query Frame = 1
Query:   85 RMITKPEFIEKRIKLWDEWKKEYDEFVEKQERKE----ITITLKDGQNVIGKAWETSPYICMKEICQSVADNAVIAKVNGVLWDLDRPLENDSSLELLNFDSKDGEYVFWHSSAHILGEVMELEYAGHLCYGPPIEEGFYYDMFLKDRQVKPEEYKTLDXXXXXXXXXXXXXXRLEVSIDRLLEMFDYNEFKCRILKERVKTDKTTIYRCGDLIDLCQGPHVRNTGKVKALSVIKNSASYWEGDATRESLQRIYGISFPDPKQMKEWKTIQEEAAKRDHRKIGTKQQLFMFHELSPGSCFFLPKGTVIYNKLVDFMKEQYWTRGFTEVISPNLYNSKLWETSGHWEHYKENMFQTEIEKCKFAMKPMNCPGHCLMFGSTIRSYRDLPIRLADFGVLHRNEASGALTGLTRVRRFQQDDAHIFCREDQITKEIESCLDFLDYTYRVFGFDFQLKLSTRPEKFLGEISMWDKAEAQLTDALNNFGKKWELNPADGAFYGPKIDITITDALRRHHQCATIQLDFQLPIRFSLEYMTDSAAQREGDSKITLARPVIIHRAILGSVERMFAILAENYGGKWPFWLSPFQAIVIPFNPSCDEYALSIQKAVHDAGFHVDIDLDTKSIFNKKISKAQEAQYNFMLVVGKKEVENKTVNIRTRDNKVHGERSIEKVIERFRELETSRASDNQFEF 2133
            R + +P FI++R++L++  K ++      QE+K     I++ +  G+ V G+ W+T+PY     I + +A++ VIAKVNGVLWDLDRPLE DS++ELL FD+++ + V+WHSSAHILGE MEL Y GHLCYGPPIE GFYYDMF++DR V   E   L+  CK I+KEKQ FERLEVS D LLEMF YN+FKCRILKE+V T  TT+YRCG LIDLC+GPHVR+TGK+KA+ + KNS++YWEG+   E+LQRIYGISFPD K MK+W+  QEEA  RDHRKIG +Q+LF FH+LSPGSCFFLP+G  IYN L+DF++E+Y  R FTEV+SPN+YNSKLWETSGHW+HY  NMF  ++EK  FA+KPMNCPGHCLMF    RS+R++P+R ADFGVLHRNE SG L+GLTRVRRFQQDDAHIFC  +QI +EI+ CL FL   Y  FGF FQL LSTRPE FLGEI +WD+AE QL ++L  FGK W++NP DGAFYGPKIDI I DA+ R+HQCATIQLDFQLPIRF+L Y++     ++GD K    RPVIIHRAILGSVERM AIL+ENYGGKWP WLSP Q +VIP  P+C+ YAL + K   + GF  D+DLD     NKKI  AQ AQYNF+LVVG+KE  N  VN+RTRDNK+HGE SI  VIE+ + L+ SR  + + +F
Sbjct:  112 REVKQPNFIKERLQLFETLKTDHQLLPATQEKKNTNNVISVRVAGGKTVQGERWKTTPYQVAAGISKELAEHTVIAKVNGVLWDLDRPLEGDSTVELLMFDNEEAQAVYWHSSAHILGEAMELYYGGHLCYGPPIENGFYYDMFIEDRVVSSTELSALENICKTIIKEKQPFERLEVSKDTLLEMFKYNKFKCRILKEKVDTPTTTVYRCGPLIDLCKGPHVRHTGKIKAIKIFKNSSTYWEGNPEMETLQRIYGISFPDSKMMKDWEKFQEEAKSRDHRKIGKEQELFFFHDLSPGSCFFLPRGAFIYNALMDFIREEYHKRNFTEVLSPNMYNSKLWETSGHWQHYSNNMFTFDVEKDTFALKPMNCPGHCLMFAHRPRSWREMPVRFADFGVLHRNELSGTLSGLTRVRRFQQDDAHIFCMVEQIEEEIKGCLHFLQSVYSTFGFSFQLNLSTRPEHFLGEIEIWDEAERQLQNSLVEFGKPWKINPGDGAFYGPKIDIKIKDAIGRYHQCATIQLDFQLPIRFNLTYVS-----KDGDDK---NRPVIIHRAILGSVERMIAILSENYGGKWPLWLSPRQVMVIPVGPACENYALQVSKECFEEGFMADVDLDDSCTLNKKIRNAQLAQYNFILVVGEKEKINNAVNVRTRDNKIHGEISIASVIEKLKNLKKSRTLNAEEDF 790          
BLAST of Threonine--tRNA ligase, cytoplasmic vs. Ensembl Mouse
Match: Tars (threonyl-tRNA synthetase [Source:MGI Symbol;Acc:MGI:106314])

HSP 1 Score: 895.575 bits (2313), Expect = 0.000e+0
Identity = 426/681 (62.56%), Postives = 529/681 (77.68%), Query Frame = 1
Query:  100 PEFIEKRIKLWDEWKKEYDEFVEKQ---ERKEITITLKDGQNVIGKAWETSPYICMKEICQSVADNAVIAKVNGVLWDLDRPLENDSSLELLNFDSKDGEYVFWHSSAHILGEVMELEYAGHLCYGPPIEEGFYYDMFLKDRQVKPEEYKTLDXXXXXXXXXXXXXXRLEVSIDRLLEMFDYNEFKCRILKERVKTDKTTIYRCGDLIDLCQGPHVRNTGKVKALSVIKNSASYWEGDATRESLQRIYGISFPDPKQMKEWKTIQEEAAKRDHRKIGTKQQLFMFHELSPGSCFFLPKGTVIYNKLVDFMKEQYWTRGFTEVISPNLYNSKLWETSGHWEHYKENMFQTEIEKCKFAMKPMNCPGHCLMFGSTIRSYRDLPIRLADFGVLHRNEASGALTGLTRVRRFQQDDAHIFCREDQITKEIESCLDFLDYTYRVFGFDFQLKLSTRPEKFLGEISMWDKAEAQLTDALNNFGKKWELNPADGAFYGPKIDITITDALRRHHQCATIQLDFQLPIRFSLEYMTDSAAQREGDSKITLARPVIIHRAILGSVERMFAILAENYGGKWPFWLSPFQAIVIPFNPSCDEYALSIQKAVHDAGFHVDIDLDTKSIFNKKISKAQEAQYNFMLVVGKKEVENKTVNIRTRDNKVHGERSIEKVIERFRELETSRASDNQFEF 2133
            PE+I  R+ ++++ K E+D  + ++   + K I +TL DG+ V  ++W+T+PY     I Q +ADN V+AKVN V+WDLDRPLE D +LELL F+ ++ + V+WHSSAHI+GE ME  Y G LCYGPPIE GFYYDM+L++  V   ++ +L+  CKKI+KEKQ FERLEV  + LLEMF YN+FKCRIL E+V T  TT+YRCG LIDLC+GPHVR+TGK+K L + KNS++YWEG A  E+LQRIYGISFPDPK +KEW+  QEEA  RDHRKIG  Q+L+ FHELSPGSCFFLPKG  IYN L++F++ +Y  RGF EV++PN++NS+LW TSGHW+HY ENMF  E+EK +FA+KPMNCPGHCLMF    RS+R+LP+RLADFGVLHRNE SGALTGLTRVRRFQQDDAHIFC  +QI  EI+ CLDFL   Y VFGF F+L LSTRPEKFLG+I +W++AE QL ++LN FG+KWELNP DGAFYGPKIDI I DA+ R+HQCATIQLDFQLPIRF+L Y++      +GD K    RPVI+HRAILGSVERM AIL ENYGGKWPFWLSP Q +V+P  P+CDEYA  +++  HDA F  D DLD     NKKI  AQ AQYNF+LVVG+KE  + TVNIRTRDNKVHGER++E+ + R ++L+ +R+   + EF
Sbjct:   50 PEYINTRLDMYNKLKAEHDSILAEKAAKDSKPIKVTLPDGKQVDAESWKTTPYQIACGISQGLADNTVVAKVNKVVWDLDRPLETDCTLELLKFEDEEAQAVYWHSSAHIMGEAMERVYGGCLCYGPPIENGFYYDMYLEEGGVSSNDFSSLETLCKKIIKEKQTFERLEVKKETLLEMFKYNKFKCRILNEKVNTPTTTVYRCGPLIDLCRGPHVRHTGKIKTLKIHKNSSTYWEGKADMETLQRIYGISFPDPKLLKEWEKFQEEAKNRDHRKIGRDQELYFFHELSPGSCFFLPKGAYIYNTLMEFIRSEYRKRGFQEVVTPNIFNSRLWMTSGHWQHYSENMFSFEVEKEQFALKPMNCPGHCLMFDHRPRSWRELPLRLADFGVLHRNELSGALTGLTRVRRFQQDDAHIFCAMEQIEDEIKGCLDFLRTVYSVFGFSFKLNLSTRPEKFLGDIEIWNQAEKQLENSLNEFGEKWELNPGDGAFYGPKIDIQIKDAIGRYHQCATIQLDFQLPIRFNLTYVS-----HDGDDK---KRPVIVHRAILGSVERMIAILTENYGGKWPFWLSPRQVMVVPVGPTCDEYAQKVRQQFHDAKFMADTDLDPGCTLNKKIRNAQLAQYNFILVVGEKEKASGTVNIRTRDNKVHGERTVEETVRRLQQLKQTRSKQAEEEF 722          
BLAST of Threonine--tRNA ligase, cytoplasmic vs. Ensembl Mouse
Match: Tars2 (threonyl-tRNA synthetase 2, mitochondrial (putative) [Source:MGI Symbol;Acc:MGI:1919057])

HSP 1 Score: 707.983 bits (1826), Expect = 0.000e+0
Identity = 341/701 (48.64%), Postives = 456/701 (65.05%), Query Frame = 1
Query:   94 TKPEFIEKRIKLWDE-WKKEYDEFVEKQERKE--ITITLKDGQNVIGKAWETSPYICMKEICQSVADNAVIAKVNGVLWDLDRPLENDSSLELLNFDSKDGEYVFWHSSAHILGEVMELEYAGHLCYGPPIEEGFYYDMFL-KDRQVKPEEYKTLDXXXXXXXXXXXXXXRLEVSIDRLLEMFDYNEFKCRILKERVKTDKTTIYRCGDLIDLCQGPHVRNTGKVKALSVIKNSASYWEGDATRESLQRIYGISFPDPKQMKEWKTIQEEAAKRDHRKIGTKQQLFMFHELSPGSCFFLPKGTVIYNKLVDFMKEQYWTRGFTEVISPNLYNSKLWETSGHWEHYKENMFQ-----------------TEIEKCKFAMKPMNCPGHCLMFGSTIRSYRDLPIRLADFGVLHRNEASGALTGLTRVRRFQQDDAHIFCREDQITKEIESCLDFLDYTYRVFGFDFQLKLSTRPEKFLGEISMWDKAEAQLTDALNNFGKKWELNPADGAFYGPKIDITITDALRRHHQCATIQLDFQLPIRFSLEYMTDSAAQREGDSKITLARPVIIHRAILGSVERMFAILAENYGGKWPFWLSPFQAIVIPFNPSCDEYALSIQKAVHDAGFHVDIDLDTKSIFNKKISKAQEAQYNFMLVVGKKEVENKTVNIRTRDNKVHGERSIEKVIERFRELETSRASDNQFEF 2133
            T P ++ +R  L++E W     +     ++K   I I+L +GQ V   AW T+PY    +I  ++AD AV A+VNG L+DLDRPLE D  L  L FDS +G+ VFWHSSAH+LG   E +    LC GP  E GFY+D FL K+R V+  E   L+  C++++   Q F RLE S D+L ++F  N FK  +++E+V     T+Y CG  +DLC+GPH+R+TG++ AL ++ NS++ W      E+LQR+ GISFP  + ++ W+  +E A  RDHR+IG +Q+LF FHELSPGSCFFLP+GT +YN LV F++ +Y  RGF+EV +P L+++KLWE SGHWEHY+ +MF                      K   A+KPMNCP HCLMF    RS+R+LP+RLADFG LHR EASG+L GLTR+ RFQQDDAHIFC   Q+  EI+ CLDFL   Y V GF F L LSTRP  FLGE  +WD+AE  L  AL  FG+ W+LNP DGAFYGPKID+ + DAL R HQC TIQLDFQLP+RF L+Y   +          T   PV+IHRA+LGSVER+  +LAE+ GGKWP WLSP Q +VIP     +EYA  +Q+ +  AG   D+D D+    ++++ +AQ A YNF  VVG++E   +TVN+RTRDN+  GER + + ++R  EL+ +R  + +  F
Sbjct:   32 TPPHWLAERFGLFEELWTAHVKKLASMTQKKARAIKISLPEGQKVDAVAWNTTPYQLAHQISVTLADTAVAAEVNGELYDLDRPLETDCHLRFLTFDSPEGKAVFWHSSAHVLGAAAEQQLGAVLCRGPSTESGFYHDFFLGKERTVRSAELPILERICQELIAAAQPFRRLEASRDQLRQLFKDNHFKLHLIEEKVTGPTATVYGCGMSVDLCRGPHLRHTGQIGALKLLTNSSALWRSLGAPETLQRVSGISFPKVELLRNWEARREAAELRDHRRIGKEQELFFFHELSPGSCFFLPRGTRVYNALVAFIRAEYARRGFSEVKTPTLFSTKLWEQSGHWEHYRADMFSLKPPGTDGVDNSQSGHPARCPKDTLALKPMNCPAHCLMFAHRPRSWRELPVRLADFGALHRAEASGSLGGLTRLWRFQQDDAHIFCAPHQLEAEIQGCLDFLRCVYSVLGFSFHLALSTRPPGFLGEPRLWDQAEQVLQQALEKFGEPWDLNPGDGAFYGPKIDVHLHDALGRPHQCGTIQLDFQLPLRFDLQYKGPAG---------TPECPVLIHRAVLGSVERLLGVLAESCGGKWPLWLSPLQVVVIPVRTEQEEYARQVQQCLQAAGLVSDLDADSGLTLSRRVRRAQLAHYNFQFVVGQREQSQRTVNVRTRDNRQLGERDLAESVQRLLELQNARVPNAEEVF 723          
BLAST of Threonine--tRNA ligase, cytoplasmic vs. Ensembl Mouse
Match: Tars2 (threonyl-tRNA synthetase 2, mitochondrial (putative) [Source:MGI Symbol;Acc:MGI:1919057])

HSP 1 Score: 657.136 bits (1694), Expect = 0.000e+0
Identity = 324/701 (46.22%), Postives = 438/701 (62.48%), Query Frame = 1
Query:   94 TKPEFIEKRIKLWDE-WKKEYDEFVEKQERKE--ITITLKDGQNVIGKAWETSPYICMKEICQSVADNAVIAKVNGVLWDLDRPLENDSSLELLNFDSKDGEYVFWHSSAHILGEVMELEYAGHLCYGPPIEEGFYYDMFL-KDRQVKPEEYKTLDXXXXXXXXXXXXXXRLEVSIDRLLEMFDYNEFKCRILKERVKTDKTTIYRCGDLIDLCQGPHVRNTGKVKALSVIKNSASYWEGDATRESLQRIYGISFPDPKQMKEWKTIQEEAAKRDHRKIGTKQQLFMFHELSPGSCFFLPKGTVIYNKLVDFMKEQYWTRGFTEVISPNLYNSKLWETSGHWEHYKENMFQ-----------------TEIEKCKFAMKPMNCPGHCLMFGSTIRSYRDLPIRLADFGVLHRNEASGALTGLTRVRRFQQDDAHIFCREDQITKEIESCLDFLDYTYRVFGFDFQLKLSTRPEKFLGEISMWDKAEAQLTDALNNFGKKWELNPADGAFYGPKIDITITDALRRHHQCATIQLDFQLPIRFSLEYMTDSAAQREGDSKITLARPVIIHRAILGSVERMFAILAENYGGKWPFWLSPFQAIVIPFNPSCDEYALSIQKAVHDAGFHVDIDLDTKSIFNKKISKAQEAQYNFMLVVGKKEVENKTVNIRTRDNKVHGERSIEKVIERFRELETSRASDNQFEF 2133
            T P ++ +R  L++E W     +     ++K   I I+L +GQ V   AW T+PY    +I  ++AD AV A+VNG L+DLDRPLE D  L  L FDS +G+ VFWHSSAH+LG   E +    LC GP  E GFY+D FL K+R V+  E   L+  C++++   Q F RLE S D+L ++F  N FK  +++E+V     T+Y CG  +DLC+GPH+R+TG++ AL ++ NS++ W      E+LQR+ GISFP  + ++ W+  +E A  RDHR+IG +Q+LF FHELSPGSCFFLP+GT +YN LV F++ +Y  RGF+EV +P L+++KLWE SGHWEHY+ +MF                      K   A+KPMNCP HCLMF    RS+R+LP+RLADFG LHR EASG+L GLTR+ RFQQDDAHIFC   Q+  EI+ CLDFL   Y V GF F L LSTRP  FLGE  +WD+AE                          +ID+ + DAL R HQC TIQLDFQLP+RF L+Y   +          T   PV+IHRA+LGSVER+  +LAE+ GGKWP WLSP Q +VIP     +EYA  +Q+ +  AG   D+D D+    ++++ +AQ A YNF  VVG++E   +TVN+RTRDN+  GER + + ++R  EL+ +R  + +  F
Sbjct:   32 TPPHWLAERFGLFEELWTAHVKKLASMTQKKARAIKISLPEGQKVDAVAWNTTPYQLAHQISVTLADTAVAAEVNGELYDLDRPLETDCHLRFLTFDSPEGKAVFWHSSAHVLGAAAEQQLGAVLCRGPSTESGFYHDFFLGKERTVRSAELPILERICQELIAAAQPFRRLEASRDQLRQLFKDNHFKLHLIEEKVTGPTATVYGCGMSVDLCRGPHLRHTGQIGALKLLTNSSALWRSLGAPETLQRVSGISFPKVELLRNWEARREAAELRDHRRIGKEQELFFFHELSPGSCFFLPRGTRVYNALVAFIRAEYARRGFSEVKTPTLFSTKLWEQSGHWEHYRADMFSLKPPGTDGVDNSQSGHPARCPKDTLALKPMNCPAHCLMFAHRPRSWRELPVRLADFGALHRAEASGSLGGLTRLWRFQQDDAHIFCAPHQLEAEIQGCLDFLRCVYSVLGFSFHLALSTRPPGFLGEPRLWDQAE--------------------------QIDVHLHDALGRPHQCGTIQLDFQLPLRFDLQYKGPAG---------TPECPVLIHRAVLGSVERLLGVLAESCGGKWPLWLSPLQVVVIPVRTEQEEYARQVQQCLQAAGLVSDLDADSGLTLSRRVRRAQLAHYNFQFVVGQREQSQRTVNVRTRDNRQLGERDLAESVQRLLELQNARVPNAEEVF 697          
BLAST of Threonine--tRNA ligase, cytoplasmic vs. Ensembl Mouse
Match: Tars2 (threonyl-tRNA synthetase 2, mitochondrial (putative) [Source:MGI Symbol;Acc:MGI:1919057])

HSP 1 Score: 570.081 bits (1468), Expect = 0.000e+0
Identity = 262/516 (50.78%), Postives = 346/516 (67.05%), Query Frame = 1
Query:  637 NEFKCRILKERVKTDKTTIYRCGDLIDLCQGPHVRNTGKVKALSVIKNSASYWEGDATRESLQRIYGISFPDPKQMKEWKTIQEEAAKRDHRKIGTKQQLFMFHELSPGSCFFLPKGTVIYNKLVDFMKEQYWTRGFTEVISPNLYNSKLWETSGHWEHYKENMFQ-----------------TEIEKCKFAMKPMNCPGHCLMFGSTIRSYRDLPIRLADFGVLHRNEASGALTGLTRVRRFQQDDAHIFCREDQITKEIESCLDFLDYTYRVFGFDFQLKLSTRPEKFLGEISMWDKAEAQLTDALNNFGKKWELNPADGAFYGPKIDITITDALRRHHQCATIQLDFQLPIRFSLEYMTDSAAQREGDSKITLARPVIIHRAILGSVERMFAILAENYGGKWPFWLSPFQAIVIPFNPSCDEYALSIQKAVHDAGFHVDIDLDTKSIFNKKISKAQEAQYNFMLVVGKKEVENKTVNIRTRDNKVHGERSIEKVIERFRELETSRASDNQFEF 2133
            N FK  +++E+V     T+Y CG  +DLC+GPH+R+TG++ AL ++ NS++ W      E+LQR+ GISFP  + ++ W+  +E A  RDHR+IG +Q+LF FHELSPGSCFFLP+GT +YN LV F++ +Y  RGF+EV +P L+++KLWE SGHWEHY+ +MF                      K   A+KPMNCP HCLMF    RS+R+LP+RLADFG LHR EASG+L GLTR+ RFQQDDAHIFC   Q+  EI+ CLDFL   Y V GF F L LSTRP  FLGE  +WD+AE  L  AL  FG+ W+LNP DGAFYGPKID+ + DAL R HQC TIQLDFQLP+RF L+Y   +          T   PV+IHRA+LGSVER+  +LAE+ GGKWP WLSP Q +VIP     +EYA  +Q+ +  AG   D+D D+    ++++ +AQ A YNF  VVG++E   +TVN+RTRDN+  GER + + ++R  EL+ +R  + +  F
Sbjct:  136 NHFKLHLIEEKVTGPTATVYGCGMSVDLCRGPHLRHTGQIGALKLLTNSSALWRSLGAPETLQRVSGISFPKVELLRNWEARREAAELRDHRRIGKEQELFFFHELSPGSCFFLPRGTRVYNALVAFIRAEYARRGFSEVKTPTLFSTKLWEQSGHWEHYRADMFSLKPPGTDGVDNSQSGHPARCPKDTLALKPMNCPAHCLMFAHRPRSWRELPVRLADFGALHRAEASGSLGGLTRLWRFQQDDAHIFCAPHQLEAEIQGCLDFLRCVYSVLGFSFHLALSTRPPGFLGEPRLWDQAEQVLQQALEKFGEPWDLNPGDGAFYGPKIDVHLHDALGRPHQCGTIQLDFQLPLRFDLQYKGPAG---------TPECPVLIHRAVLGSVERLLGVLAESCGGKWPLWLSPLQVVVIPVRTEQEEYARQVQQCLQAAGLVSDLDADSGLTLSRRVRRAQLAHYNFQFVVGQREQSQRTVNVRTRDNRQLGERDLAESVQRLLELQNARVPNAEEVF 642          

HSP 2 Score: 81.2629 bits (199), Expect = 2.648e-15
Identity = 42/102 (41.18%), Postives = 60/102 (58.82%), Query Frame = 1
Query:   94 TKPEFIEKRIKLWDE-WKKEYDEFVEKQERKE--ITITLKDGQNVIGKAWETSPYICMKEICQSVADNAVIAKVNGVLWDLDRPLENDSSLELLNFDSKDGE 390
            T P ++ +R  L++E W     +     ++K   I I+L +GQ V   AW T+PY    +I  ++AD AV A+VNG L+DLDRPLE D  L  L FDS +G+
Sbjct:   32 TPPHWLAERFGLFEELWTAHVKKLASMTQKKARAIKISLPEGQKVDAVAWNTTPYQLAHQISVTLADTAVAAEVNGELYDLDRPLETDCHLRFLTFDSPEGK 133          
BLAST of Threonine--tRNA ligase, cytoplasmic vs. UniProt/SwissProt
Match: sp|Q8BLY2|SYTC2_MOUSE (Threonine--tRNA ligase 2, cytoplasmic OS=Mus musculus OX=10090 GN=Tars3 PE=1 SV=1)

HSP 1 Score: 898.271 bits (2320), Expect = 0.000e+0
Identity = 428/687 (62.30%), Postives = 527/687 (76.71%), Query Frame = 1
Query:   85 RMITKPEFIEKRIKLWDEWKKEYDEFVEKQERKE----ITITLKDGQNVIGKAWETSPYICMKEICQSVADNAVIAKVNGVLWDLDRPLENDSSLELLNFDSKDGEYVFWHSSAHILGEVMELEYAGHLCYGPPIEEGFYYDMFLKDRQVKPEEYKTLDXXXXXXXXXXXXXXRLEVSIDRLLEMFDYNEFKCRILKERVKTDKTTIYRCGDLIDLCQGPHVRNTGKVKALSVIKNSASYWEGDATRESLQRIYGISFPDPKQMKEWKTIQEEAAKRDHRKIGTKQQLFMFHELSPGSCFFLPKGTVIYNKLVDFMKEQYWTRGFTEVISPNLYNSKLWETSGHWEHYKENMFQTEIEKCKFAMKPMNCPGHCLMFGSTIRSYRDLPIRLADFGVLHRNEASGALTGLTRVRRFQQDDAHIFCREDQITKEIESCLDFLDYTYRVFGFDFQLKLSTRPEKFLGEISMWDKAEAQLTDALNNFGKKWELNPADGAFYGPKIDITITDALRRHHQCATIQLDFQLPIRFSLEYMTDSAAQREGDSKITLARPVIIHRAILGSVERMFAILAENYGGKWPFWLSPFQAIVIPFNPSCDEYALSIQKAVHDAGFHVDIDLDTKSIFNKKISKAQEAQYNFMLVVGKKEVENKTVNIRTRDNKVHGERSIEKVIERFRELETSRASDNQFEF 2133
            R + +P FI++R++L++  K ++      QE+K     I++ +  G+ V G+ W+T+PY     I + +A++ VIAKVNGVLWDLDRPLE DS++ELL FD+++ + V+WHSSAHILGE MEL Y GHLCYGPPIE GFYYDMF++DR V   E   L+  CK I+KEKQ FERLEVS D LLEMF YN+FKCRILKE+V T  TT+YRCG LIDLC+GPHVR+TGK+KA+ + KNS++YWEG+   E+LQRIYGISFPD K MK+W+  QEEA  RDHRKIG +Q+LF FH+LSPGSCFFLP+G  IYN L+DF++E+Y  R FTEV+SPN+YNSKLWETSGHW+HY  NMF  ++EK  FA+KPMNCPGHCLMF    RS+R++P+R ADFGVLHRNE SG L+GLTRVRRFQQDDAHIFC  +QI +EI+ CL FL   Y  FGF FQL LSTRPE FLGEI +WD+AE QL ++L  FGK W++NP DGAFYGPKIDI I DA+ R+HQCATIQLDFQLPIRF+L Y++     ++GD K    RPVIIHRAILGSVERM AIL+ENYGGKWP WLSP Q +VIP  P+C+ YAL + K   + GF  D+DLD     NKKI  AQ AQYNF+LVVG+KE  N  VN+RTRDNK+HGE SI  VIE+ + L+ SR  + + +F
Sbjct:  112 REVKQPNFIKERLQLFETLKTDHQLLPATQEKKNTNNVISVRVAGGKTVQGERWKTTPYQVAAGISKELAEHTVIAKVNGVLWDLDRPLEGDSTVELLMFDNEEAQAVYWHSSAHILGEAMELYYGGHLCYGPPIENGFYYDMFIEDRVVSSTELSALENICKTIIKEKQPFERLEVSKDTLLEMFKYNKFKCRILKEKVDTPTTTVYRCGPLIDLCKGPHVRHTGKIKAIKIFKNSSTYWEGNPEMETLQRIYGISFPDSKMMKDWEKFQEEAKSRDHRKIGKEQELFFFHDLSPGSCFFLPRGAFIYNALMDFIREEYHKRNFTEVLSPNMYNSKLWETSGHWQHYSNNMFTFDVEKDTFALKPMNCPGHCLMFAHRPRSWREMPVRFADFGVLHRNELSGTLSGLTRVRRFQQDDAHIFCMVEQIEEEIKGCLHFLQSVYSTFGFSFQLNLSTRPEHFLGEIEIWDEAERQLQNSLVEFGKPWKINPGDGAFYGPKIDIKIKDAIGRYHQCATIQLDFQLPIRFNLTYVS-----KDGDDK---NRPVIIHRAILGSVERMIAILSENYGGKWPLWLSPRQVMVIPVGPACENYALQVSKECFEEGFMADVDLDDSCTLNKKIRNAQLAQYNFILVVGEKEKINNAVNVRTRDNKIHGEISIASVIEKLKNLKKSRTLNAEEDF 790          
BLAST of Threonine--tRNA ligase, cytoplasmic vs. UniProt/SwissProt
Match: sp|Q3ZBV8|SYTC_BOVIN (Threonine--tRNA ligase 1, cytoplasmic OS=Bos taurus OX=9913 GN=TARS1 PE=2 SV=1)

HSP 1 Score: 897.501 bits (2318), Expect = 0.000e+0
Identity = 431/681 (63.29%), Postives = 532/681 (78.12%), Query Frame = 1
Query:  100 PEFIEKRIKLWDEWKKEYDEFV-EKQER--KEITITLKDGQNVIGKAWETSPYICMKEICQSVADNAVIAKVNGVLWDLDRPLENDSSLELLNFDSKDGEYVFWHSSAHILGEVMELEYAGHLCYGPPIEEGFYYDMFLKDRQVKPEEYKTLDXXXXXXXXXXXXXXRLEVSIDRLLEMFDYNEFKCRILKERVKTDKTTIYRCGDLIDLCQGPHVRNTGKVKALSVIKNSASYWEGDATRESLQRIYGISFPDPKQMKEWKTIQEEAAKRDHRKIGTKQQLFMFHELSPGSCFFLPKGTVIYNKLVDFMKEQYWTRGFTEVISPNLYNSKLWETSGHWEHYKENMFQTEIEKCKFAMKPMNCPGHCLMFGSTIRSYRDLPIRLADFGVLHRNEASGALTGLTRVRRFQQDDAHIFCREDQITKEIESCLDFLDYTYRVFGFDFQLKLSTRPEKFLGEISMWDKAEAQLTDALNNFGKKWELNPADGAFYGPKIDITITDALRRHHQCATIQLDFQLPIRFSLEYMTDSAAQREGDSKITLARPVIIHRAILGSVERMFAILAENYGGKWPFWLSPFQAIVIPFNPSCDEYALSIQKAVHDAGFHVDIDLDTKSIFNKKISKAQEAQYNFMLVVGKKEVENKTVNIRTRDNKVHGERSIEKVIERFRELETSRASDNQFEF 2133
            PE+I  R++++++ K E+D  + EK E+  K I +TL DG+ V  ++W+T+PY     I Q +ADN VIAKVN  +WDLDRPLE D +LELL F+ ++ + V+WHSSAHI+GE ME  Y G LCYGPPIE GFYYDM+L++  V   ++ +L+  CKKI+KEKQ FERLEV  + LLEMF YN+FKCRIL E+V T  TT+YRCG LIDLC+GPHVR+TGK+K L + KNS++YWEG +  E+LQRIYGISFPDPK +KEW+  QEEA  RDHRKIG  Q+L+ FHELSPGSCFFLPKG  IYN L++F++ +Y  RGF EV++PN+YNS+LW TSGHWEHY ENMF  E+EK  FA+KPMNCPGHCLMF    RS+R+LP+R+ADFGVLHRNE SGALTGLTRVRRFQQDDAHIFC  +QI  EI+ CLDFL   Y +FGF F+L LSTRPEKFLG+I +W++AE QL ++LN+FG+KWELNP DGAFYGPKIDI I DA+ R+HQCATIQLDFQLPIRF+L +++      +GD K    +PVIIHRAILGSVERM AIL ENYGGKWPFWLSP Q +V+P  P+CDEYA  +++  H+A F VDIDLD     NKKI  AQ AQYNF+LVVG+KE  + TVNIRTRDNKVHGER+I + IER ++L+ SR+   + EF
Sbjct:   51 PEYINTRLEMYNKLKAEHDSILAEKAEKDSKPIKVTLPDGKQVDAESWKTTPYQIACGISQGLADNTVIAKVNKAVWDLDRPLEEDCTLELLKFEDEEAQAVYWHSSAHIMGEAMERVYGGCLCYGPPIENGFYYDMYLEEGGVSSNDFSSLETLCKKIIKEKQAFERLEVKKETLLEMFKYNKFKCRILNEKVNTPTTTVYRCGPLIDLCRGPHVRHTGKIKTLKIHKNSSTYWEGKSDMETLQRIYGISFPDPKMLKEWEKFQEEAKNRDHRKIGRDQELYFFHELSPGSCFFLPKGAYIYNTLIEFIRSEYRKRGFQEVVTPNIYNSRLWVTSGHWEHYSENMFSFEVEKELFALKPMNCPGHCLMFDHRPRSWRELPLRVADFGVLHRNELSGALTGLTRVRRFQQDDAHIFCAMEQIEDEIKGCLDFLRTVYSIFGFSFKLNLSTRPEKFLGDIEVWNQAEKQLENSLNDFGEKWELNPGDGAFYGPKIDIQIKDAIGRYHQCATIQLDFQLPIRFNLTFVS-----HDGDDK---KKPVIIHRAILGSVERMIAILTENYGGKWPFWLSPRQVMVVPVGPTCDEYAQKVRQQFHNAKFMVDIDLDPGCTLNKKIRNAQLAQYNFILVVGEKEKTSGTVNIRTRDNKVHGERTISETIERLQQLKHSRSKQAEEEF 723          
BLAST of Threonine--tRNA ligase, cytoplasmic vs. UniProt/SwissProt
Match: sp|Q9D0R2|SYTC_MOUSE (Threonine--tRNA ligase 1, cytoplasmic OS=Mus musculus OX=10090 GN=Tars1 PE=1 SV=2)

HSP 1 Score: 895.575 bits (2313), Expect = 0.000e+0
Identity = 426/681 (62.56%), Postives = 529/681 (77.68%), Query Frame = 1
Query:  100 PEFIEKRIKLWDEWKKEYDEFVEKQ---ERKEITITLKDGQNVIGKAWETSPYICMKEICQSVADNAVIAKVNGVLWDLDRPLENDSSLELLNFDSKDGEYVFWHSSAHILGEVMELEYAGHLCYGPPIEEGFYYDMFLKDRQVKPEEYKTLDXXXXXXXXXXXXXXRLEVSIDRLLEMFDYNEFKCRILKERVKTDKTTIYRCGDLIDLCQGPHVRNTGKVKALSVIKNSASYWEGDATRESLQRIYGISFPDPKQMKEWKTIQEEAAKRDHRKIGTKQQLFMFHELSPGSCFFLPKGTVIYNKLVDFMKEQYWTRGFTEVISPNLYNSKLWETSGHWEHYKENMFQTEIEKCKFAMKPMNCPGHCLMFGSTIRSYRDLPIRLADFGVLHRNEASGALTGLTRVRRFQQDDAHIFCREDQITKEIESCLDFLDYTYRVFGFDFQLKLSTRPEKFLGEISMWDKAEAQLTDALNNFGKKWELNPADGAFYGPKIDITITDALRRHHQCATIQLDFQLPIRFSLEYMTDSAAQREGDSKITLARPVIIHRAILGSVERMFAILAENYGGKWPFWLSPFQAIVIPFNPSCDEYALSIQKAVHDAGFHVDIDLDTKSIFNKKISKAQEAQYNFMLVVGKKEVENKTVNIRTRDNKVHGERSIEKVIERFRELETSRASDNQFEF 2133
            PE+I  R+ ++++ K E+D  + ++   + K I +TL DG+ V  ++W+T+PY     I Q +ADN V+AKVN V+WDLDRPLE D +LELL F+ ++ + V+WHSSAHI+GE ME  Y G LCYGPPIE GFYYDM+L++  V   ++ +L+  CKKI+KEKQ FERLEV  + LLEMF YN+FKCRIL E+V T  TT+YRCG LIDLC+GPHVR+TGK+K L + KNS++YWEG A  E+LQRIYGISFPDPK +KEW+  QEEA  RDHRKIG  Q+L+ FHELSPGSCFFLPKG  IYN L++F++ +Y  RGF EV++PN++NS+LW TSGHW+HY ENMF  E+EK +FA+KPMNCPGHCLMF    RS+R+LP+RLADFGVLHRNE SGALTGLTRVRRFQQDDAHIFC  +QI  EI+ CLDFL   Y VFGF F+L LSTRPEKFLG+I +W++AE QL ++LN FG+KWELNP DGAFYGPKIDI I DA+ R+HQCATIQLDFQLPIRF+L Y++      +GD K    RPVI+HRAILGSVERM AIL ENYGGKWPFWLSP Q +V+P  P+CDEYA  +++  HDA F  D DLD     NKKI  AQ AQYNF+LVVG+KE  + TVNIRTRDNKVHGER++E+ + R ++L+ +R+   + EF
Sbjct:   50 PEYINTRLDMYNKLKAEHDSILAEKAAKDSKPIKVTLPDGKQVDAESWKTTPYQIACGISQGLADNTVVAKVNKVVWDLDRPLETDCTLELLKFEDEEAQAVYWHSSAHIMGEAMERVYGGCLCYGPPIENGFYYDMYLEEGGVSSNDFSSLETLCKKIIKEKQTFERLEVKKETLLEMFKYNKFKCRILNEKVNTPTTTVYRCGPLIDLCRGPHVRHTGKIKTLKIHKNSSTYWEGKADMETLQRIYGISFPDPKLLKEWEKFQEEAKNRDHRKIGRDQELYFFHELSPGSCFFLPKGAYIYNTLMEFIRSEYRKRGFQEVVTPNIFNSRLWMTSGHWQHYSENMFSFEVEKEQFALKPMNCPGHCLMFDHRPRSWRELPLRLADFGVLHRNELSGALTGLTRVRRFQQDDAHIFCAMEQIEDEIKGCLDFLRTVYSVFGFSFKLNLSTRPEKFLGDIEIWNQAEKQLENSLNEFGEKWELNPGDGAFYGPKIDIQIKDAIGRYHQCATIQLDFQLPIRFNLTYVS-----HDGDDK---KRPVIVHRAILGSVERMIAILTENYGGKWPFWLSPRQVMVVPVGPTCDEYAQKVRQQFHDAKFMADTDLDPGCTLNKKIRNAQLAQYNFILVVGEKEKASGTVNIRTRDNKVHGERTVEETVRRLQQLKQTRSKQAEEEF 722          
BLAST of Threonine--tRNA ligase, cytoplasmic vs. UniProt/SwissProt
Match: sp|Q5XHY5|SYTC_RAT (Threonine--tRNA ligase 1, cytoplasmic OS=Rattus norvegicus OX=10116 GN=Tars1 PE=1 SV=1)

HSP 1 Score: 895.19 bits (2312), Expect = 0.000e+0
Identity = 428/681 (62.85%), Postives = 529/681 (77.68%), Query Frame = 1
Query:  100 PEFIEKRIKLWDEWKKEYDEFVEKQ---ERKEITITLKDGQNVIGKAWETSPYICMKEICQSVADNAVIAKVNGVLWDLDRPLENDSSLELLNFDSKDGEYVFWHSSAHILGEVMELEYAGHLCYGPPIEEGFYYDMFLKDRQVKPEEYKTLDXXXXXXXXXXXXXXRLEVSIDRLLEMFDYNEFKCRILKERVKTDKTTIYRCGDLIDLCQGPHVRNTGKVKALSVIKNSASYWEGDATRESLQRIYGISFPDPKQMKEWKTIQEEAAKRDHRKIGTKQQLFMFHELSPGSCFFLPKGTVIYNKLVDFMKEQYWTRGFTEVISPNLYNSKLWETSGHWEHYKENMFQTEIEKCKFAMKPMNCPGHCLMFGSTIRSYRDLPIRLADFGVLHRNEASGALTGLTRVRRFQQDDAHIFCREDQITKEIESCLDFLDYTYRVFGFDFQLKLSTRPEKFLGEISMWDKAEAQLTDALNNFGKKWELNPADGAFYGPKIDITITDALRRHHQCATIQLDFQLPIRFSLEYMTDSAAQREGDSKITLARPVIIHRAILGSVERMFAILAENYGGKWPFWLSPFQAIVIPFNPSCDEYALSIQKAVHDAGFHVDIDLDTKSIFNKKISKAQEAQYNFMLVVGKKEVENKTVNIRTRDNKVHGERSIEKVIERFRELETSRASDNQFEF 2133
            PE+I  R+ ++ + K E+D  + ++   + K I +TL DG+ V  ++W+T+PY     I Q +ADN V+AKVN V+WDLDRPLE D +LELL F+ ++ + V+WHSSAHI+GE ME  Y G LCYGPPIE GFYYDM+L++  V   ++ +L+  CKKI+KEKQ FERLEV  + LLEMF YN+FKCRIL E+V T  TT+YRCG LIDLC+GPHVR+TGK+K L + KNS++YWEG A  E+LQRIYGISFPDPK +KEW+  QEEA  RDHRKIG  Q+L+ FHELSPGSCFFLPKG  IYN L++F++ +Y  RGF EV++PN++NS+LW TSGHW+HY ENMF  E+EK +FA+KPMNCPGHCLMF    RS+R+LP+RLADFGVLHRNE SGALTGLTRVRRFQQDDAHIFC  +QI  EI+ CLDFL   Y VFGF F+L LSTRPEKFLG+I +W++AE QL ++LN FG+KWELNP DGAFYGPKIDI I DA+ R+HQCATIQLDFQLPIRF+L Y++      +GD K    RPVI+HRAILGSVERM AIL ENYGGKWPFWLSP Q +V+P  P+CDEYA  +++  HDA F VDIDLD     NKKI  AQ AQYNF+LVVG+KE  + TVNIRTRDNKVHGER++ + +ER ++L+  R+   + EF
Sbjct:   23 PEYINTRLDMYHKLKAEHDSILAEKAAKDSKPIKVTLPDGKQVDAESWKTTPYQIACGISQGLADNTVVAKVNKVVWDLDRPLETDCTLELLKFEDEEAQAVYWHSSAHIMGEAMERVYGGCLCYGPPIENGFYYDMYLEEGGVSSNDFSSLETLCKKIIKEKQTFERLEVKKETLLEMFKYNKFKCRILNEKVNTPTTTVYRCGPLIDLCRGPHVRHTGKIKTLKIHKNSSTYWEGKADMETLQRIYGISFPDPKLLKEWEKFQEEAKNRDHRKIGRDQELYFFHELSPGSCFFLPKGAYIYNTLMEFIRSEYRKRGFQEVVTPNIFNSRLWMTSGHWQHYSENMFSFEVEKEQFALKPMNCPGHCLMFDHRPRSWRELPLRLADFGVLHRNELSGALTGLTRVRRFQQDDAHIFCAMEQIEDEIKGCLDFLRTVYSVFGFSFKLNLSTRPEKFLGDIEIWNQAEKQLENSLNEFGEKWELNPGDGAFYGPKIDIQIKDAIGRYHQCATIQLDFQLPIRFNLTYVS-----HDGDDK---KRPVIVHRAILGSVERMIAILTENYGGKWPFWLSPRQVMVVPVGPTCDEYAQKVRQEFHDAKFMVDIDLDPGCTLNKKIRNAQLAQYNFILVVGEKEKASGTVNIRTRDNKVHGERTVGETVERLQQLKQLRSKQAEEEF 695          
BLAST of Threonine--tRNA ligase, cytoplasmic vs. UniProt/SwissProt
Match: sp|P26639|SYTC_HUMAN (Threonine--tRNA ligase 1, cytoplasmic OS=Homo sapiens OX=9606 GN=TARS1 PE=1 SV=3)

HSP 1 Score: 892.108 bits (2304), Expect = 0.000e+0
Identity = 433/681 (63.58%), Postives = 528/681 (77.53%), Query Frame = 1
Query:  100 PEFIEKRIKLWDEWKKEYDEFV-EKQER--KEITITLKDGQNVIGKAWETSPYICMKEICQSVADNAVIAKVNGVLWDLDRPLENDSSLELLNFDSKDGEYVFWHSSAHILGEVMELEYAGHLCYGPPIEEGFYYDMFLKDRQVKPEEYKTLDXXXXXXXXXXXXXXRLEVSIDRLLEMFDYNEFKCRILKERVKTDKTTIYRCGDLIDLCQGPHVRNTGKVKALSVIKNSASYWEGDATRESLQRIYGISFPDPKQMKEWKTIQEEAAKRDHRKIGTKQQLFMFHELSPGSCFFLPKGTVIYNKLVDFMKEQYWTRGFTEVISPNLYNSKLWETSGHWEHYKENMFQTEIEKCKFAMKPMNCPGHCLMFGSTIRSYRDLPIRLADFGVLHRNEASGALTGLTRVRRFQQDDAHIFCREDQITKEIESCLDFLDYTYRVFGFDFQLKLSTRPEKFLGEISMWDKAEAQLTDALNNFGKKWELNPADGAFYGPKIDITITDALRRHHQCATIQLDFQLPIRFSLEYMTDSAAQREGDSKITLARPVIIHRAILGSVERMFAILAENYGGKWPFWLSPFQAIVIPFNPSCDEYALSIQKAVHDAGFHVDIDLDTKSIFNKKISKAQEAQYNFMLVVGKKEVENKTVNIRTRDNKVHGERSIEKVIERFRELETSRASDNQFEF 2133
            PE+I  R+++++  K E+D  + EK E+  K I +TL DG+ V  ++W+T+PY     I Q +ADN VIAKVN V+WDLDRPLE D +LELL F+ ++ + V+WHSSAHI+GE ME  Y G LCYGPPIE GFYYDM+L++  V   ++ +L+  CKKI+KEKQ FERLEV  + LL MF YN+FKCRIL E+V T  TT+YRCG LIDLC+GPHVR+TGK+KAL + KNS++YWEG A  E+LQRIYGISFPDPK +KEW+  QEEA  RDHRKIG  Q+L+ FHELSPGSCFFLPKG  IYN L++F++ +Y  RGF EV++PN++NS+LW TSGHW+HY ENMF  E+EK  FA+KPMNCPGHCLMF    RS+R+LP+RLADFGVLHRNE SGALTGLTRVRRFQQDDAHIFC  +QI  EI+ CLDFL   Y VFGF F+L LSTRPEKFLG+I +WD+AE QL ++LN FG+KWELN  DGAFYGPKIDI I DA+ R+HQCATIQLDFQLPIRF+L Y++      +GD K    RPVI+HRAILGSVERM AIL ENYGGKWPFWLSP Q +V+P  P+CDEYA  +++  HDA F  DIDLD     NKKI  AQ AQYNF+LVVG+KE  + TVNIRTRDNKVHGER+I + IER ++L+  R+   + EF
Sbjct:   51 PEYIYTRLEMYNILKAEHDSILAEKAEKDSKPIKVTLPDGKQVDAESWKTTPYQIACGISQGLADNTVIAKVNNVVWDLDRPLEEDCTLELLKFEDEEAQAVYWHSSAHIMGEAMERVYGGCLCYGPPIENGFYYDMYLEEGGVSSNDFSSLEALCKKIIKEKQAFERLEVKKETLLAMFKYNKFKCRILNEKVNTPTTTVYRCGPLIDLCRGPHVRHTGKIKALKIHKNSSTYWEGKADMETLQRIYGISFPDPKMLKEWEKFQEEAKNRDHRKIGRDQELYFFHELSPGSCFFLPKGAYIYNALIEFIRSEYRKRGFQEVVTPNIFNSRLWMTSGHWQHYSENMFSFEVEKELFALKPMNCPGHCLMFDHRPRSWRELPLRLADFGVLHRNELSGALTGLTRVRRFQQDDAHIFCAMEQIEDEIKGCLDFLRTVYSVFGFSFKLNLSTRPEKFLGDIEVWDQAEKQLENSLNEFGEKWELNSGDGAFYGPKIDIQIKDAIGRYHQCATIQLDFQLPIRFNLTYVS-----HDGDDK---KRPVIVHRAILGSVERMIAILTENYGGKWPFWLSPRQVMVVPVGPTCDEYAQKVRQQFHDAKFMADIDLDPGCTLNKKIRNAQLAQYNFILVVGEKEKISGTVNIRTRDNKVHGERTISETIERLQQLKEFRSKQAEEEF 723          
BLAST of Threonine--tRNA ligase, cytoplasmic vs. TrEMBL
Match: V4CSN3 (AA_TRNA_LIGASE_II domain-containing protein OS=Lottia gigantea OX=225164 GN=LOTGIDRAFT_103202 PE=3 SV=1)

HSP 1 Score: 937.562 bits (2422), Expect = 0.000e+0
Identity = 451/683 (66.03%), Postives = 529/683 (77.45%), Query Frame = 1
Query:   88 MITKPEFIEKRIKLWDEWKKEYDEFVEKQERKEITITLKDGQNVIGKAWETSPYICMKEICQSVADNAVIAKVNGVLWDLDRPLENDSSLELLNFDSKDGEYVFWHSSAHILGEVMELEYAGHLCYGPPIEEGFYYDMFLKDRQVKPEEYKTLDXXXXXXXXXXXXXXRLEVSIDRLLEMFDYNEFKCRILKERVKTDKTTIYRCGDLIDLCQGPHVRNTGKVKALSVIKNSASYWEGDATRESLQRIYGISFPDPKQMKEWKTIQEEAAKRDHRKIGTKQQLFMFHELSPGSCFFLPKGTVIYNKLVDFMKEQYWTRGFTEVISPNLYNSKLWETSGHWEHYKENMFQTEIEKCKFAMKPMNCPGHCLMFGSTIRSYRDLPIRLADFGVLHRNEASGALTGLTRVRRFQQDDAHIFCREDQITKEIESCLDFLDYTYRVFGFDFQLKLSTRPEKFLGEISMWDKAEAQLTDALNNFGKKWELNPADGAFYGPKIDITITDALRRHHQCATIQLDFQLPIRFSLEYMTDSAAQREGDSKITLARPVIIHRAILGSVERMFAILAENYGGKWPFWLSPFQAIVIPFNPSCDEYALSIQ-KAVHDAGFHVDIDLDTKSIFNKKISKAQEAQYNFMLVVGKKEVENKTVNIRTRDNKVHGERSIEKVIERFRELETSRASDNQFEF 2133
            M   PEFIEKR KLWD  KKEYD++V  Q  + I +TL DG+ V  ++W T+PY   K I Q +ADN VIAKVNG LWDLDRPLE D+SLELL FD  DG+YVFWHSSAH+LGE MEL Y GHLCYGPPIE GFYYDMF+ D+ V   +Y  L+   K I KEKQ FERLE+  + LLEMF+YN+FK RIL E+V T  TT+Y+CG LIDLC+GPH+R+TGKVK+ +V K S++YWEG A  ESLQRIYGISFPD KQMKEWK  QEEAAKRDHRKIG +Q LF FHELSPGSCFFLP+G  IYN LV F++E+YW RGF EV+SPN+YNSKLWE SGHW+HY ENMF  E+EK  FA+KPMNCPGHCLMF  T RS+RDLP+R ADFGVLHRNE SGALTGLTRVRRFQQDDAHIFCR  QI +EI  CLDFL+  Y VFGF F+LKLSTRPEK+LGEI MWDKAE  L + LNNFG KWELNP DGAFYGPKIDITI DALRR HQCATIQLDFQLP+RF+L Y+ +S  +          +PVIIHRAILGSVERM AIL E+YGGKWPFWLSP Q IVIP     ++Y + ++ K + +AGF  D D+D     NKK+  AQ AQYNF+ VVG+KE+  +T N+RTRD+KVHGE SI ++I RF++ ++S+  + +  F
Sbjct:    1 MTPPPEFIEKRQKLWDRLKKEYDDWVAAQPAQSIKVTLPDGKVVEAESWRTTPYEVAKGISQGLADNTVIAKVNGELWDLDRPLEKDASLELLKFDDTDGQYVFWHSSAHMLGEAMELHYGGHLCYGPPIESGFYYDMFVGDKNVSSFDYPKLETIVKNITKEKQPFERLEMKKEHLLEMFEYNKFKQRILNEKVTTPTTTVYKCGPLIDLCRGPHIRHTGKVKSFAVTKGSSTYWEGKADAESLQRIYGISFPDGKQMKEWKHFQEEAAKRDHRKIGKEQDLFFFHELSPGSCFFLPRGAHIYNLLVTFIREEYWKRGFKEVVSPNIYNSKLWEVSGHWQHYSENMFSFEVEKETFALKPMNCPGHCLMFDHTTRSWRDLPLRFADFGVLHRNELSGALTGLTRVRRFQQDDAHIFCRFSQIKEEIAGCLDFLNGVYNVFGFTFKLKLSTRPEKYLGEIEMWDKAEKALEECLNNFGSKWELNPGDGAFYGPKIDITILDALRRQHQCATIQLDFQLPLRFNLGYINESGEKE---------KPVIIHRAILGSVERMIAILCESYGGKWPFWLSPRQGIVIPVASPFNDYTVKVRPKQIQEAGFLCDYDIDDADTMNKKVRNAQIAQYNFIFVVGEKELNAETANVRTRDSKVHGEHSITEIINRFKKFQSSKCPNAEETF 674          
BLAST of Threonine--tRNA ligase, cytoplasmic vs. TrEMBL
Match: A0A2C9JJK6 (AA_TRNA_LIGASE_II domain-containing protein OS=Biomphalaria glabrata OX=6526 GN=106075152 PE=3 SV=1)

HSP 1 Score: 930.628 bits (2404), Expect = 0.000e+0
Identity = 447/675 (66.22%), Postives = 527/675 (78.07%), Query Frame = 1
Query:  100 PEFIEKRIKLWDEWKKEYDEFVEKQERKEITITLKDGQNVIGKAWETSPYICMKEICQSVADNAVIAKVNGVLWDLDRPLENDSSLELLNFDSKDGEYVFWHSSAHILGEVMELEYAGHLCYGPPIEEGFYYDMFLKDRQVKPEEYKTLDXXXXXXXXXXXXXXRLEVSIDRLLEMFDYNEFKCRILKERVKTDKTTIYRCGDLIDLCQGPHVRNTGKVKALSVIKNSASYWEGDATRESLQRIYGISFPDPKQMKEWKTIQEEAAKRDHRKIGTKQQLFMFHELSPGSCFFLPKGTVIYNKLVDFMKEQYWTRGFTEVISPNLYNSKLWETSGHWEHYKENMFQTEIEKCKFAMKPMNCPGHCLMFGSTIRSYRDLPIRLADFGVLHRNEASGALTGLTRVRRFQQDDAHIFCREDQITKEIESCLDFLDYTYRVFGFDFQLKLSTRPEKFLGEISMWDKAEAQLTDALNNFGKKWELNPADGAFYGPKIDITITDALRRHHQCATIQLDFQLPIRFSLEYMTDSAAQREGDSKITLARPVIIHRAILGSVERMFAILAENYGGKWPFWLSPFQAIVIPFNPSCDEYALSIQKAVHDAGFHVDIDLDTKSIFNKKISKAQEAQYNFMLVVGKKEVENKTVNIRTRDNKVHGERSIEKVIERFRELETSRASDNQ 2124
            P FIE+R KLWD+ KKE DE+V  Q+  +I ITL DG    G AW T+PY     I Q +ADN V+AKVNG LWDLDRP E DSSL LL FD  DG+YVFWHSSAHILGE ME  Y GHLCYGPPIEEGFYYDM+  +  V   E   L+   K I KEKQ FERLE++ + LL+MF+YNEFK RI+ E++ T  TT+YRCG LIDLC+GPHVR+TGKVKA++V KNS++YWEG+A  ESLQRIYGISFP+PKQ+KEWK  QEEAAKRDHR+IG +Q+LF FHELSPGSCFFLP+G  IYN L+DF+K +YW RGFTEV+SPN+YNSKLWE SGHW+HY ENMF  + EK K+A+KPMNCPGHCLMF   +RS+R+LP+RLADFGVLHRNE SGAL+GLTRVRRFQQDDAHIFCR DQI +EI SCL+FL   Y++F F F LKLSTRP+KFLGE  +WD+AE QL + LN FG KWELNP DGAFYGPKIDITI DAL+R HQCATIQLDFQLP RF+L YM D   +          RPVI+HRAILGSVERM AIL E++GGKWPFWLSP Q+IVI   P+ D+YA  + K +  AGF  + DLD  +  NKKI  AQ +QYNF+ VVG+KE+ NKTVN+RTRDNK+HGE SIE VI RF++ + S+A D +
Sbjct:   46 PSFIEQRQKLWDKLKKERDEWVAAQDPVQIKITLPDGAVKEGNAWRTTPYEVAVSISQGLADNTVVAKVNGELWDLDRPFEKDSSLALLKFDDPDGQYVFWHSSAHILGEAMERHYGGHLCYGPPIEEGFYYDMWTPE-PVSSNELPDLETLAKNITKEKQLFERLEMTKEDLLKMFEYNEFKQRIINEKIDTPTTTVYRCGPLIDLCRGPHVRHTGKVKAIAVTKNSSTYWEGNAEAESLQRIYGISFPEPKQLKEWKHFQEEAAKRDHRRIGKEQELFFFHELSPGSCFFLPRGAHIYNTLIDFIKTEYWQRGFTEVVSPNIYNSKLWEISGHWQHYAENMFSFDCEKEKYALKPMNCPGHCLMFDHRVRSWRELPLRLADFGVLHRNEVSGALSGLTRVRRFQQDDAHIFCRRDQIKEEIMSCLEFLSNVYKIFNFTFNLKLSTRPDKFLGEKEVWDEAEKQLEETLNEFGHKWELNPGDGAFYGPKIDITIHDALKRSHQCATIQLDFQLPERFNLSYMNDKQEKE---------RPVIVHRAILGSVERMIAILCESFGGKWPFWLSPRQSIVITVAPTFDDYAQEVMKQIRSAGFICEHDLDQGTTMNKKIRNAQLSQYNFIFVVGEKELANKTVNVRTRDNKIHGEHSIEHVISRFQDFKKSKALDAE 710          
BLAST of Threonine--tRNA ligase, cytoplasmic vs. TrEMBL
Match: A0A2C9JJI5 (AA_TRNA_LIGASE_II domain-containing protein OS=Biomphalaria glabrata OX=6526 GN=106075152 PE=3 SV=1)

HSP 1 Score: 930.243 bits (2403), Expect = 0.000e+0
Identity = 447/675 (66.22%), Postives = 527/675 (78.07%), Query Frame = 1
Query:  100 PEFIEKRIKLWDEWKKEYDEFVEKQERKEITITLKDGQNVIGKAWETSPYICMKEICQSVADNAVIAKVNGVLWDLDRPLENDSSLELLNFDSKDGEYVFWHSSAHILGEVMELEYAGHLCYGPPIEEGFYYDMFLKDRQVKPEEYKTLDXXXXXXXXXXXXXXRLEVSIDRLLEMFDYNEFKCRILKERVKTDKTTIYRCGDLIDLCQGPHVRNTGKVKALSVIKNSASYWEGDATRESLQRIYGISFPDPKQMKEWKTIQEEAAKRDHRKIGTKQQLFMFHELSPGSCFFLPKGTVIYNKLVDFMKEQYWTRGFTEVISPNLYNSKLWETSGHWEHYKENMFQTEIEKCKFAMKPMNCPGHCLMFGSTIRSYRDLPIRLADFGVLHRNEASGALTGLTRVRRFQQDDAHIFCREDQITKEIESCLDFLDYTYRVFGFDFQLKLSTRPEKFLGEISMWDKAEAQLTDALNNFGKKWELNPADGAFYGPKIDITITDALRRHHQCATIQLDFQLPIRFSLEYMTDSAAQREGDSKITLARPVIIHRAILGSVERMFAILAENYGGKWPFWLSPFQAIVIPFNPSCDEYALSIQKAVHDAGFHVDIDLDTKSIFNKKISKAQEAQYNFMLVVGKKEVENKTVNIRTRDNKVHGERSIEKVIERFRELETSRASDNQ 2124
            P FIE+R KLWD+ KKE DE+V  Q+  +I ITL DG    G AW T+PY     I Q +ADN V+AKVNG LWDLDRP E DSSL LL FD  DG+YVFWHSSAHILGE ME  Y GHLCYGPPIEEGFYYDM+  +  V   E   L+   K I KEKQ FERLE++ + LL+MF+YNEFK RI+ E++ T  TT+YRCG LIDLC+GPHVR+TGKVKA++V KNS++YWEG+A  ESLQRIYGISFP+PKQ+KEWK  QEEAAKRDHR+IG +Q+LF FHELSPGSCFFLP+G  IYN L+DF+K +YW RGFTEV+SPN+YNSKLWE SGHW+HY ENMF  + EK K+A+KPMNCPGHCLMF   +RS+R+LP+RLADFGVLHRNE SGAL+GLTRVRRFQQDDAHIFCR DQI +EI SCL+FL   Y++F F F LKLSTRP+KFLGE  +WD+AE QL + LN FG KWELNP DGAFYGPKIDITI DAL+R HQCATIQLDFQLP RF+L YM D   +          RPVI+HRAILGSVERM AIL E++GGKWPFWLSP Q+IVI   P+ D+YA  + K +  AGF  + DLD  +  NKKI  AQ +QYNF+ VVG+KE+ NKTVN+RTRDNK+HGE SIE VI RF++ + S+A D +
Sbjct:   31 PSFIEQRQKLWDKLKKERDEWVAAQDPVQIKITLPDGAVKEGNAWRTTPYEVAVSISQGLADNTVVAKVNGELWDLDRPFEKDSSLALLKFDDPDGQYVFWHSSAHILGEAMERHYGGHLCYGPPIEEGFYYDMWTPE-PVSSNELPDLETLAKNITKEKQLFERLEMTKEDLLKMFEYNEFKQRIINEKIDTPTTTVYRCGPLIDLCRGPHVRHTGKVKAIAVTKNSSTYWEGNAEAESLQRIYGISFPEPKQLKEWKHFQEEAAKRDHRRIGKEQELFFFHELSPGSCFFLPRGAHIYNTLIDFIKTEYWQRGFTEVVSPNIYNSKLWEISGHWQHYAENMFSFDCEKEKYALKPMNCPGHCLMFDHRVRSWRELPLRLADFGVLHRNEVSGALSGLTRVRRFQQDDAHIFCRRDQIKEEIMSCLEFLSNVYKIFNFTFNLKLSTRPDKFLGEKEVWDEAEKQLEETLNEFGHKWELNPGDGAFYGPKIDITIHDALKRSHQCATIQLDFQLPERFNLSYMNDKQEKE---------RPVIVHRAILGSVERMIAILCESFGGKWPFWLSPRQSIVITVAPTFDDYAQEVMKQIRSAGFICEHDLDQGTTMNKKIRNAQLSQYNFIFVVGEKELANKTVNVRTRDNKIHGEHSIEHVISRFQDFKKSKALDAE 695          
BLAST of Threonine--tRNA ligase, cytoplasmic vs. TrEMBL
Match: A0A2C9JJI7 (AA_TRNA_LIGASE_II domain-containing protein OS=Biomphalaria glabrata OX=6526 GN=106075152 PE=3 SV=1)

HSP 1 Score: 929.087 bits (2400), Expect = 0.000e+0
Identity = 447/673 (66.42%), Postives = 526/673 (78.16%), Query Frame = 1
Query:  100 PEFIEKRIKLWDEWKKEYDEFVEKQERKEITITLKDGQNVIGKAWETSPYICMKEICQSVADNAVIAKVNGVLWDLDRPLENDSSLELLNFDSKDGEYVFWHSSAHILGEVMELEYAGHLCYGPPIEEGFYYDMFLKDRQVKPEEYKTLDXXXXXXXXXXXXXXRLEVSIDRLLEMFDYNEFKCRILKERVKTDKTTIYRCGDLIDLCQGPHVRNTGKVKALSVIKNSASYWEGDATRESLQRIYGISFPDPKQMKEWKTIQEEAAKRDHRKIGTKQQLFMFHELSPGSCFFLPKGTVIYNKLVDFMKEQYWTRGFTEVISPNLYNSKLWETSGHWEHYKENMFQTEIEKCKFAMKPMNCPGHCLMFGSTIRSYRDLPIRLADFGVLHRNEASGALTGLTRVRRFQQDDAHIFCREDQITKEIESCLDFLDYTYRVFGFDFQLKLSTRPEKFLGEISMWDKAEAQLTDALNNFGKKWELNPADGAFYGPKIDITITDALRRHHQCATIQLDFQLPIRFSLEYMTDSAAQREGDSKITLARPVIIHRAILGSVERMFAILAENYGGKWPFWLSPFQAIVIPFNPSCDEYALSIQKAVHDAGFHVDIDLDTKSIFNKKISKAQEAQYNFMLVVGKKEVENKTVNIRTRDNKVHGERSIEKVIERFRELETSRASD 2118
            P FIE+R KLWD+ KKE DE+V  Q+  +I ITL DG    G AW T+PY     I Q +ADN V+AKVNG LWDLDRP E DSSL LL FD  DG+YVFWHSSAHILGE ME  Y GHLCYGPPIEEGFYYDM+  +  V   E   L+   K I KEKQ FERLE++ + LL+MF+YNEFK RI+ E++ T  TT+YRCG LIDLC+GPHVR+TGKVKA++V KNS++YWEG+A  ESLQRIYGISFP+PKQ+KEWK  QEEAAKRDHR+IG +Q+LF FHELSPGSCFFLP+G  IYN L+DF+K +YW RGFTEV+SPN+YNSKLWE SGHW+HY ENMF  + EK K+A+KPMNCPGHCLMF   +RS+R+LP+RLADFGVLHRNE SGAL+GLTRVRRFQQDDAHIFCR DQI +EI SCL+FL   Y++F F F LKLSTRP+KFLGE  +WD+AE QL + LN FG KWELNP DGAFYGPKIDITI DAL+R HQCATIQLDFQLP RF+L YM D   +          RPVI+HRAILGSVERM AIL E++GGKWPFWLSP Q+IVI   P+ D+YA  + K +  AGF  + DLD  +  NKKI  AQ +QYNF+ VVG+KE+ NKTVN+RTRDNK+HGE SIE VI RF++ + S+A D
Sbjct:   40 PSFIEQRQKLWDKLKKERDEWVAAQDPVQIKITLPDGAVKEGNAWRTTPYEVAVSISQGLADNTVVAKVNGELWDLDRPFEKDSSLALLKFDDPDGQYVFWHSSAHILGEAMERHYGGHLCYGPPIEEGFYYDMWTPE-PVSSNELPDLETLAKNITKEKQLFERLEMTKEDLLKMFEYNEFKQRIINEKIDTPTTTVYRCGPLIDLCRGPHVRHTGKVKAIAVTKNSSTYWEGNAEAESLQRIYGISFPEPKQLKEWKHFQEEAAKRDHRRIGKEQELFFFHELSPGSCFFLPRGAHIYNTLIDFIKTEYWQRGFTEVVSPNIYNSKLWEISGHWQHYAENMFSFDCEKEKYALKPMNCPGHCLMFDHRVRSWRELPLRLADFGVLHRNEVSGALSGLTRVRRFQQDDAHIFCRRDQIKEEIMSCLEFLSNVYKIFNFTFNLKLSTRPDKFLGEKEVWDEAEKQLEETLNEFGHKWELNPGDGAFYGPKIDITIHDALKRSHQCATIQLDFQLPERFNLSYMNDKQEKE---------RPVIVHRAILGSVERMIAILCESFGGKWPFWLSPRQSIVITVAPTFDDYAQEVMKQIRSAGFICEHDLDQGTTMNKKIRNAQLSQYNFIFVVGEKELANKTVNVRTRDNKIHGEHSIEHVISRFQDFKKSKALD 702          
BLAST of Threonine--tRNA ligase, cytoplasmic vs. TrEMBL
Match: A0A4E0REG1 (Threonyl tRNA synthetase C OS=Fasciola hepatica OX=6192 GN=D915_003797 PE=3 SV=1)

HSP 1 Score: 927.932 bits (2397), Expect = 0.000e+0
Identity = 447/697 (64.13%), Postives = 537/697 (77.04%), Query Frame = 1
Query:  100 PEFIEKRIKLWDEWKKEYDEFVEKQERKEITITLKDGQNVIGKAWETSPYICMKEICQSVADNAVIAKVNGVLWDLDRPLENDSSLELLNFDSKDGEYVFWHSSAHILGEVMELEYAGHLCYGPPIEEGFYYDMFLKDRQVK---PEEYKTLDXXXXXXXXXXXXXXRLEVSIDRLLEMFDYNEFKCRILKERVKTDKTTIYRCGDLIDLCQGPHVRNTGKVKALSVIKNSASYWEGDATRESLQRIYGISFPDPKQMKEWKTIQEEAAKRDHRKIGTKQQLFMFHELSPGSCFFLPKGTVIYNKLVDFMKEQYWTRGFTEVISPNLYNSKLWETSGHWEHYKENMFQTEIEKCKFAMKPMNCPGHCLMFGSTIRSYRDLPIRLADFGVLHRNEASGALTGLTRVRRFQQDDAHIFCREDQITKEIESCLDFLDYTYRVFGFDFQLKLSTRPEKFLGEISMWDKAEAQLTDALNNFGKKWELNPADGAFYGPKIDITITDALRRHHQCATIQLDFQLPIRFSLEYM----TDSAAQREGDSKIT------------LARPVIIHRAILGSVERMFAILAENYGGKWPFWLSPFQAIVIPFNPSCDEYALSIQKAVHDAGFHVDIDLDTKSIFNKKISKAQEAQYNFMLVVGKKEVENKTVNIRTRDNKVHGERSIEKVIERFRELETSRASDNQFEF 2133
            PEFIE R KLW + +KEY+EFV  Q R  I ITL DG  V GKAWET+P    K I +++AD AVIA+VNG LWDL RP E ++SLE+LNFD KDG+YVFWHSSAH+LGE MEL Y GHLCYGPPI+EGFYYDM+L  +  K   P+++  LD+ C++I KE Q FERLE++   LLEMF YN+FKCRI++E+V T KTT+YRCG LIDLC+GPHVR+TG +K++ V K+S++YWEG A  E+LQR+YGISFPDPK++KEWK  QEEAAKRDHRK+G +Q+LF FHELSPGSCFFLP G  IYN LV F++ +YW RGF EVI+PNLYNS LWE SGHW+HY +NMF+ ++EK +F +KPMNCPGHCLMF   IRS+RDLP+R ADFGVLHRNE SGALTGLTRVRRFQQDDAHIFCREDQI  EI++CL FL Y Y VFGF F+L LSTRPEKFLGEI +WD+AE QL ++L+  G KWELNP DGAFYGPKIDITI DAL R HQCATIQLDFQ+P RFSL Y     T   A  + ++++T            L RPVIIHRAILGSVER+ AIL E+YGGKWPFWLSP QA+V+P   + DEYA  ++  +H AGF V +D D     NKKI   Q AQYNF+LVVG KE  + TVN+RTRDNKVHGE ++E V+ERFR    S+  + + E+
Sbjct:   45 PEFIEHRNKLWAKLRKEYEEFVASQPRAPIQITLPDGTIVDGKAWETTPMEIAKSINKNLADCAVIARVNGELWDLLRPFEGNASLEVLNFDHKDGQYVFWHSSAHVLGEAMELAYGGHLCYGPPIDEGFYYDMWLPQKDHKGLGPDDHAALDQLCRRICKENQPFERLEMTKKDLLEMFAYNQFKCRIIQEKVTTPKTTVYRCGPLIDLCRGPHVRHTGCIKSMLVTKSSSAYWEGRADAETLQRVYGISFPDPKRLKEWKHWQEEAAKRDHRKLGVEQKLFFFHELSPGSCFFLPAGAHIYNTLVAFIRAEYWRRGFQEVITPNLYNSALWEISGHWQHYSDNMFKIDVEKQQFGLKPMNCPGHCLMFAKEIRSHRDLPLRFADFGVLHRNEFSGALTGLTRVRRFQQDDAHIFCREDQIKDEIKNCLGFLRYVYGVFGFSFELYLSTRPEKFLGEIELWDRAEQQLKESLDEMGLKWELNPGDGAFYGPKIDITIMDALHRRHQCATIQLDFQMPCRFSLVYACEGDTSKPAGDDANNEVTEHVATLQHPEPNLRRPVIIHRAILGSVERIIAILTESYGGKWPFWLSPRQALVVPVTSANDEYATKVRDQLHGAGFMVSVDTDPGRTLNKKIRTGQLAQYNFILVVGDKESSSGTVNVRTRDNKVHGEHTVEHVLERFRAFAASKTLEAEQEY 741          
BLAST of Threonine--tRNA ligase, cytoplasmic vs. Ensembl Cavefish
Match: tars1 (threonyl-tRNA synthetase 1 [Source:NCBI gene;Acc:103026572])

HSP 1 Score: 902.123 bits (2330), Expect = 0.000e+0
Identity = 434/689 (62.99%), Postives = 529/689 (76.78%), Query Frame = 1
Query:   76 GFQRMITKPEFIEKRIKLWDEWKKEYDEFVEKQERKE---ITITLKDGQNVIGKAWETSPYICMKEICQSVADNAVIAKVNGVLWDLDRPLENDSSLELLNFDSKDGEYVFWHSSAHILGEVMELEYAGHLCYGPPIEEGFYYDMFLKDRQVKPEEYKTLDXXXXXXXXXXXXXXRLEVSIDRLLEMFDYNEFKCRILKERVKTDKTTIYRCGDLIDLCQGPHVRNTGKVKALSVIKNSASYWEGDATRESLQRIYGISFPDPKQMKEWKTIQEEAAKRDHRKIGTKQQLFMFHELSPGSCFFLPKGTVIYNKLVDFMKEQYWTRGFTEVISPNLYNSKLWETSGHWEHYKENMFQTEIEKCKFAMKPMNCPGHCLMFGSTIRSYRDLPIRLADFGVLHRNEASGALTGLTRVRRFQQDDAHIFCREDQITKEIESCLDFLDYTYRVFGFDFQLKLSTRPEKFLGEISMWDKAEAQLTDALNNFGKKWELNPADGAFYGPKIDITITDALRRHHQCATIQLDFQLPIRFSLEYMTDSAAQREGDSKITLARPVIIHRAILGSVERMFAILAENYGGKWPFWLSPFQAIVIPFNPSCDEYALSIQKAVHDAGFHVDIDLDTKSIFNKKISKAQEAQYNFMLVVGKKEVENKTVNIRTRDNKVHGERSIEKVIERFRELETSRASDNQFEF 2133
            G   +   P++IE+R+ L+++ K E+D  + ++  K+   I ITL DG+ V G++W+T+PY     I Q +ADN VIAKVN  +WDLDRPLE D SL+LL FD ++ + V+WHSSAHI+GE ME  Y G LCYGPPIE GFYYDMFL++  V   ++  L+  CKKI+KEKQ FERLE+  + LLEMF YN+FKCRIL E+V T  TT+YRCG LIDLC+GPHVR+TGK+KAL + KNS++YWEG A  ESLQR+YGISFPDPK +KEW+  QEEA  RDHRK+G +Q LF FH+LSPGSCFFLPKG  +YN LV+F++ +Y  RGF EV++PN+YNSKLW+TSGHW+HY ENMF  E+EK  FA+KPMNCPGHCLMF    RS+R+LP+RLADFGVLHRNE SGALTGLTRVRRFQQDDAHIFC  DQI  EI+ CLDFL   Y VFGF F+L LSTRPEKFLGE  +WD+AE QL ++LN FG+KW LNP DGAFYGPKIDI I DA+ R+HQCATIQLDFQLPIRF+L Y++      +GD K    RPVIIHRAILGSVERM AIL ENYGGKWP WLSP Q +V+P  P+C+EYA  +Q   H+AG   D+DLD     NKKI  AQ AQYNF+LVVG+KE  + TVN+RTRDNKVHGERS+   +ER R+L+ +R  + + EF
Sbjct:   45 GKTELSPPPQYIEERLDLYNKLKAEHDALMSERAEKDSKPIKITLPDGKVVDGESWKTTPYQVACGISQGLADNTVIAKVNNAVWDLDRPLEEDCSLQLLKFDDEEAQAVYWHSSAHIMGEAMERVYGGCLCYGPPIENGFYYDMFLENEGVSSNDFPCLENLCKKIIKEKQPFERLEIKKETLLEMFKYNKFKCRILNEKVTTPTTTVYRCGPLIDLCRGPHVRHTGKIKALKIHKNSSTYWEGKADMESLQRLYGISFPDPKMLKEWEKFQEEAKNRDHRKLGREQDLFFFHDLSPGSCFFLPKGAYLYNTLVEFIRSEYRKRGFQEVVTPNIYNSKLWQTSGHWQHYSENMFSFEVEKEIFALKPMNCPGHCLMFDHRPRSWRELPLRLADFGVLHRNELSGALTGLTRVRRFQQDDAHIFCTMDQIESEIKGCLDFLRTVYDVFGFTFKLNLSTRPEKFLGEPEVWDQAEKQLENSLNEFGEKWVLNPGDGAFYGPKIDIQIKDAIGRYHQCATIQLDFQLPIRFNLSYVS-----HDGDDK---KRPVIIHRAILGSVERMIAILTENYGGKWPLWLSPRQVMVVPVGPTCEEYAQRVQNEFHNAGLMTDVDLDPGCTLNKKIRNAQLAQYNFILVVGEKEKSSDTVNVRTRDNKVHGERSLTDCMERLRQLKAARTRNAEEEF 725          
BLAST of Threonine--tRNA ligase, cytoplasmic vs. Ensembl Cavefish
Match: tars3 (threonyl-tRNA synthetase 3 [Source:ZFIN;Acc:ZDB-GENE-081104-490])

HSP 1 Score: 887.1 bits (2291), Expect = 0.000e+0
Identity = 428/681 (62.85%), Postives = 521/681 (76.51%), Query Frame = 1
Query:  100 PEFIEKRIKLWDEWKKEYDEFVEKQ--ERKEITITLKDGQNVIGKAWETSPYICMKEICQSVADNAVIAKVNGVLWDLDRPLENDSSLELLNFDSKDGEYVFWHSSAHILGEVMELEYAGHLCYGPPIEEGFYYDMFLKDRQ-VKPEEYKTLDXXXXXXXXXXXXXXRLEVSIDRLLEMFDYNEFKCRILKERVKTDKTTIYRCGDLIDLCQGPHVRNTGKVKALSVIKNSASYWEGDATRESLQRIYGISFPDPKQMKEWKTIQEEAAKRDHRKIGTKQQLFMFHELSPGSCFFLPKGTVIYNKLVDFMKEQYWTRGFTEVISPNLYNSKLWETSGHWEHYKENMFQTEIEKCKFAMKPMNCPGHCLMFGSTIRSYRDLPIRLADFGVLHRNEASGALTGLTRVRRFQQDDAHIFCREDQITKEIESCLDFLDYTYRVFGFDFQLKLSTRPEKFLGEISMWDKAEAQLTDALNNFGKKWELNPADGAFYGPKIDITITDALRRHHQCATIQLDFQLPIRFSLEYMTDSAAQREGDSKITLARPVIIHRAILGSVERMFAILAENYGGKWPFWLSPFQAIVIPFNPSCDEYALSIQKAVHDAGFHVDIDLDTKSIFNKKISKAQEAQYNFMLVVGKKEVENKTVNIRTRDNKVHGERSIEKVIERFRELETSRASDNQFEF 2133
            P +I +R++L++  KKE D  + KQ    + I++ L DGQ V  ++W T+PY     I Q +ADN VIA+V+G LWDLDRPL+ D SLELL FD +D + V+WHSSAHILGE ME  Y G LCYGPPIE GFYYDMFL +++ V   E+  L+  CK I+K+KQ FERLE+S + LLEMF YN+FKCRIL E+V+T  TT+YRCG LIDLC+GPHVR+TGK+KAL + KNSA+YWEG +  E+LQRIYGISFPD K +KEW+  QEEA  RDHRKIG  Q+LF FH+LSPGSCFFLP+G  IYN L +F++E+YW RGF EV SPN+YNSKLWETSGHW+HY ENMF   +E+  FA+KPMNCPGHCLMFG   RS+R+LP+RLADFGVLHRNE SG LTGLTRVRRFQQDDAHIFC  +QI  E++ CLDFL   Y VFGF FQL LSTRPEKFLG+I++W++AE QL ++LN FG+ W+LNP DGAFYGPKIDI I DA+ R+HQCATIQLDFQLPIRF L Y+      ++GD K   ARPVIIHRAILGSVERM AIL ENY GKWP WLSP Q +++P NPS +EYA  + K   +AGF  D DLD+  + NKKI  AQ AQYNF+LVVG+KE    +VN+RTRDNKVHGE ++ +V+ R   L+ SR  + +  F
Sbjct:  184 PSYISERLELYNRLKKESDAILAKQAANSQPISVVLPDGQKVEAQSWITTPYQLACGISQGLADNCVIARVDGGLWDLDRPLQKDCSLELLRFDHEDAQAVYWHSSAHILGEAMERFYGGCLCYGPPIENGFYYDMFLDEQKGVSSTEFGDLETLCKSIMKDKQPFERLEISKETLLEMFKYNKFKCRILNEKVETPTTTVYRCGPLIDLCRGPHVRHTGKIKALKIYKNSATYWEGRSDMETLQRIYGISFPDSKMLKEWERFQEEAKNRDHRKIGKDQELFFFHDLSPGSCFFLPRGAYIYNTLTEFIREEYWRRGFQEVASPNIYNSKLWETSGHWQHYSENMFSFPVEQDVFALKPMNCPGHCLMFGHRPRSWRELPLRLADFGVLHRNELSGTLTGLTRVRRFQQDDAHIFCTMEQIESEMKGCLDFLRCVYDVFGFSFQLHLSTRPEKFLGDIAVWNQAEKQLENSLNEFGEPWKLNPGDGAFYGPKIDINIKDAIGRYHQCATIQLDFQLPIRFDLTYVG-----KDGDDK---ARPVIIHRAILGSVERMIAILTENYAGKWPLWLSPRQVMLVPVNPSLEEYASKVCKQFVEAGFMADADLDSSCLLNKKIRNAQLAQYNFILVVGEKEKMTNSVNVRTRDNKVHGELTVAEVLARLTLLKQSRCRNAEEVF 856          
BLAST of Threonine--tRNA ligase, cytoplasmic vs. Ensembl Cavefish
Match: ENSAMXT00000012886.2 (threonine--tRNA ligase, cytoplasmic-like [Source:NCBI gene;Acc:103023620])

HSP 1 Score: 639.802 bits (1649), Expect = 0.000e+0
Identity = 311/673 (46.21%), Postives = 438/673 (65.08%), Query Frame = 1
Query:  115 KRIKLWDEWKKEYDEFVEKQERKEITITLKDGQNVIGKAWETSPYICMKEICQSV-ADNAVIAKVNGVLWDLDRPLENDSSLELLNFDSKDGEYVFWHSSAHILGEVMELEYAGHLCYGPPIEEGFYYDMFLKDRQVKPEEYKTLDXXXXXXXXXXXXXXRLEVSIDRLLEMFDYNEFKCRILKERVKTDKT-TIYRCGDLIDLCQGPHVRNTGKVKALSVIKNSASYWEGDATRESLQRIYGISFPDPKQMKEWKTIQEEAAKRDHRKIGTKQQLFMFHELSPGSCFFLPKGTVIYNKLVDFMKEQYWTRGFTEVISPNLYNSKLWETSGHWEHYKENMFQTEIEKCKFAMKPMNCPGHCLMFGSTIRSYRDLPIRLADFGVLHRNEASGALTGLTRVRRFQQDDAHIFCREDQITKEIESCLDFLDYTYRVFGFDFQLKLSTRPEKFLGEISMWDKAEAQLTDALNNFGKKWELNPADGAFYGPKIDITITDALRRHHQCATIQLDFQLPIRFSLEYMTDSAAQREGDSKITLARPVIIHRAILGSVERMFAILAENYGGKWPFWLSPFQAIVIPFNPSCDEYALSIQKAVHDAGFHVDIDLDTKSIFNKKISKAQEAQYNFMLVVGKKEVENKTVNIRTRDNKVHGERSIEKVIERFRELETSRASDNQF 2127
            +R++L+   +++       +  + +++ L DG+ V   A  T+P     +I Q      AV+ +VNG LW+L RPLE D  L LL+FDS +G  V W + A +LG VME  +  H+C     +   Y D  L +  +  EE   ++E+CK++   K    RLE+++  L E+F  +  + ++ +E+++   T ++YRCG  + +C GP + +TG + +  +++ S     G      + R+ G+SFP  K+ ++W   QEEA +RDHR+IG  Q+LF F+++SPGSCFFLPKG  IYN L DF+K +Y +RGF+EV++P L+++ LWE SGHWEHY ENMF  + E   FA+KPMNCP HC+M+   +RS+R+LP+R ADFG LHRNE SGAL GLTRVRRF QDDAHIFC  +Q+ +EI +CLDF+   Y VFGF F   LSTRP  +LGE ++WD AE QL  +L  FG++WELNP DGAFYGPK+DI I DA+ R HQCATIQLDFQLPIRF+L+Y+              + RPV++HRA+LGS+ERM AILAEN+GGKWP WLSP Q +V+P      +Y   +   +  AGF  D+D D  +  NK+I  AQ AQYN++ VVG+KE E+ TV++RTR  K  G+RS+E V+    EL   R++ ++F
Sbjct:   36 ERLRLFSALREKQSGQKAAEPGQNLSVRLADGKTVKAVAGITTPL----QIAQRTRIKGAVVGRVNGELWELARPLEADCELHLLSFDSLEGRQVVWRTGACVLGAVMETHFTAHVCREGVSDTALYCDYRLDNSALSLEE---VEERCKEMAGLKLPITRLELNVHELGELFQ-DALRLQLAEEQIQGKNTISVYRCGQSVGVCSGPLLPHTGFIHSFKMLQVSPVTLSGGTEALGVMRMIGVSFPGEKEKEQWVQEQEEARRRDHRRIGKDQELFFFNDVSPGSCFFLPKGAHIYNTLTDFIKSEYKSRGFSEVVTPTLFSTTLWERSGHWEHYSENMFTVKCEPHTFALKPMNCPAHCVMYEQRVRSWRELPLRWADFGALHRNEHSGALGGLTRVRRFCQDDAHIFCTPEQLEEEITACLDFVRSVYCVFGFTFHCLLSTRPSSYLGETALWDSAEQQLERSLEQFGERWELNPGDGAFYGPKVDIQIRDAIGRQHQCATIQLDFQLPIRFNLQYVGSDGG---------MHRPVMVHRAVLGSLERMIAILAENFGGKWPLWLSPAQVMVLPVGGDSKQYGREVVHRLKKAGFMADVDDDHGATLNKRIRSAQLAQYNYIFVVGEKERESGTVSVRTRGGKQLGQRSLEDVMTSLEELRERRSNRDEF 691          
BLAST of Threonine--tRNA ligase, cytoplasmic vs. Ensembl Cavefish
Match: mrpl39 (mitochondrial ribosomal protein L39 [Source:NCBI gene;Acc:103046218])

HSP 1 Score: 69.707 bits (169), Expect = 2.594e-12
Identity = 70/273 (25.64%), Postives = 118/273 (43.22%), Query Frame = 1
Query:   91 ITKPEFIEKRIKLWDEWKKEYDEFVEKQERKEITITLKDGQN---VIGKAWETSPYICMKEICQSVADNAVIAKVNGVLWDLDRPLENDSSLELLNFDSKDGEY---VFWHSSAHILGEVMEL----EYAGHLCYGP--PIEEGFYYDMFLKDRQVKP-----EEYKTLDXXXXXXXXXXXXXXRLEVSIDRLLEMFDYNEFKCRILKERVK---TDKTTIYRCGDLIDLCQGPHVRNTGKVKALSVIKNSASYWEGDATRESLQRIYGISFP 849
            ++  E    R  L+ + ++       + E+ E+T+     Q    V+ K   T PY C + +      +A +A V+G  W L RPL    SL LL F   + +     +W S A +LG+V+E     EY   L   P  P+  G +   F+ D Q+       E  ++      +++ +   +E LEV+    LE+F ++  K   ++E+         ++YRCG  + L  GP V  TG      V   +A +  G+      +R  G+S P
Sbjct:   30 VSAAEVRSWRSTLFSKEQERQRSLYPRIEKIEVTMQGAGVQGTLLVMNKGLST-PYSCSRHLTDWHVSSAALALVDGEPWHLHRPLTRSCSLTLLTFKDANPQLPNQAYWRSCAALLGQVLEGAFKEEYNVELLRIPEVPVTAGAFCCDFVLDPQLDAWIPTEESLRSFTRDANQLIHQNLPWEPLEVAPPVALEIFSHSRCKQEEVEEKAAQSPNGTVSLYRCGHHVVLAGGPLVGRTGLCSQYEV---TALHTVGEGPWGLQRRAQGLSLP 298          
BLAST of Threonine--tRNA ligase, cytoplasmic vs. Ensembl Cavefish
Match: mrpl39 (mitochondrial ribosomal protein L39 [Source:NCBI gene;Acc:103046218])

HSP 1 Score: 69.707 bits (169), Expect = 3.105e-12
Identity = 70/273 (25.64%), Postives = 118/273 (43.22%), Query Frame = 1
Query:   91 ITKPEFIEKRIKLWDEWKKEYDEFVEKQERKEITITLKDGQN---VIGKAWETSPYICMKEICQSVADNAVIAKVNGVLWDLDRPLENDSSLELLNFDSKDGEY---VFWHSSAHILGEVMEL----EYAGHLCYGP--PIEEGFYYDMFLKDRQVKP-----EEYKTLDXXXXXXXXXXXXXXRLEVSIDRLLEMFDYNEFKCRILKERVK---TDKTTIYRCGDLIDLCQGPHVRNTGKVKALSVIKNSASYWEGDATRESLQRIYGISFP 849
            ++  E    R  L+ + ++       + E+ E+T+     Q    V+ K   T PY C + +      +A +A V+G  W L RPL    SL LL F   + +     +W S A +LG+V+E     EY   L   P  P+  G +   F+ D Q+       E  ++      +++ +   +E LEV+    LE+F ++  K   ++E+         ++YRCG  + L  GP V  TG      V   +A +  G+      +R  G+S P
Sbjct:   23 VSAAEVRSWRSTLFSKEQERQRSLYPRIEKIEVTMQGAGVQGTLLVMNKGLST-PYSCSRHLTDWHVSSAALALVDGEPWHLHRPLTRSCSLTLLTFKDANPQLPNQAYWRSCAALLGQVLEGAFKEEYNVELLRIPEVPVTAGAFCCDFVLDPQLDAWIPTEESLRSFTRDANQLIHQNLPWEPLEVAPPVALEIFSHSRCKQEEVEEKAAQSPNGTVSLYRCGHHVVLAGGPLVGRTGLCSQYEV---TALHTVGEGPWGLQRRAQGLSLP 291          
BLAST of Threonine--tRNA ligase, cytoplasmic vs. Ensembl Sea Lamprey
Match: tars1 (threonyl-tRNA synthetase 1 [Source:ZFIN;Acc:ZDB-GENE-041010-218])

HSP 1 Score: 880.167 bits (2273), Expect = 0.000e+0
Identity = 424/681 (62.26%), Postives = 516/681 (75.77%), Query Frame = 1
Query:  100 PEFIEKRIKLWDEWKKEYDEFV---EKQERKEITITLKDGQNVIGKAWETSPYICMKEICQSVADNAVIAKVNGVLWDLDRPLENDSSLELLNFDSKDGEYVFWHSSAHILGEVMELEYAGHLCYGPPIEEGFYYDMFLKDRQVKPEEYKTLDXXXXXXXXXXXXXXRLEVSIDRLLEMFDYNEFKCRILKERVKTDKTTIYRCGDLIDLCQGPHVRNTGKVKALSVIKNSASYWEGDATRESLQRIYGISFPDPKQMKEWKTIQEEAAKRDHRKIGTKQQLFMFHELSPGSCFFLPKGTVIYNKLVDFMKEQYWTRGFTEVISPNLYNSKLWETSGHWEHYKENMFQTEIEKCKFAMKPMNCPGHCLMFGSTIRSYRDLPIRLADFGVLHRNEASGALTGLTRVRRFQQDDAHIFCREDQITKEIESCLDFLDYTYRVFGFDFQLKLSTRPEKFLGEISMWDKAEAQLTDALNNFGKKWELNPADGAFYGPKIDITITDALRRHHQCATIQLDFQLPIRFSLEYMTDSAAQREGDSKITLARPVIIHRAILGSVERMFAILAENYGGKWPFWLSPFQAIVIPFNPSCDEYALSIQKAVHDAGFHVDIDLDTKSIFNKKISKAQEAQYNFMLVVGKKEVENKTVNIRTRDNKVHGERSIEKVIERFRELETSRASDNQFEF 2133
            P +I++RI L+D+ K  +D  +      + K IT+TL DG+ V  ++W+T+PY     I + +ADN VIA+VNG LWDLDRPLE+D++L+LL FD ++ + V+WHSSAHILGE ME  Y G LCYGPPIE GFYYDMFL D  V   ++ +L+  CK I+KEKQ FERLE+  D LLEMF YN+FK RIL E+V T  TT+YRCG LIDLCQGPHVR+TGK+KAL + KNS++YWEG A  ESLQR+YGISFPD K +KEW+ +QEEA  RDHRKIG  Q+LF FH+LSPGSCFFLPKG  IYN LVDF+K +Y  RGFTEV+SPN+YNSKLW+TSGHW++Y ENMF  E+EK  FA+KPMNCPGHCLMF    RS+R+LPIR ADFGVLHRNE SGALTGLTRVRRFQQDDAHIFC  +QI  EI  CLDFL   Y VFGF+F+L LSTRP+ ++G++  W++AE QL ++LN FG+ W+LNP DGAFYGPKIDI I D + R+HQCATIQLDFQLPIRF L ++T      EGD +    RPVIIHRAILGSVERM AIL ENYGGKWP WLSP Q +V+P  P+C+++A  + +  HD GF V+ +LD     NKKI  AQ AQYNF+LVVG+KE  + TVN+RTRDNKVHGERS+E  I R   L   R    + +F
Sbjct:  144 PVYIQERIGLYDKLKAAHDALLLERATNQSKPITVTLPDGKTVEAESWKTTPYQLAAGISKGLADNVVIARVNGNLWDLDRPLESDTTLQLLKFDDEEAQAVYWHSSAHILGEAMERVYGGCLCYGPPIENGFYYDMFLDDGGVSSNDFPSLEGLCKNIMKEKQPFERLEIQKDVLLEMFKYNKFKVRILNEKVNTPTTTVYRCGPLIDLCQGPHVRHTGKIKALKIHKNSSTYWEGKADMESLQRVYGISFPDTKMLKEWERMQEEAKNRDHRKIGKDQELFFFHDLSPGSCFFLPKGAFIYNTLVDFIKSEYQKRGFTEVVSPNIYNSKLWKTSGHWDNYSENMFAFEVEKEMFALKPMNCPGHCLMFDHRPRSWRELPIRFADFGVLHRNELSGALTGLTRVRRFQQDDAHIFCTMEQIESEIAGCLDFLRCVYEVFGFNFKLFLSTRPKNYMGDVEEWNQAEKQLENSLNKFGEPWKLNPGDGAFYGPKIDIQIKDGIGRYHQCATIQLDFQLPIRFDLNFVTG-----EGDER---KRPVIIHRAILGSVERMIAILTENYGGKWPLWLSPQQVMVVPVGPTCNDFAQKVWQRFHDVGFMVNTELDPGLTLNKKIRNAQLAQYNFILVVGEKEKLSDTVNVRTRDNKVHGERSVEDTIARLATLRDMRCKTAEEDF 816          
BLAST of Threonine--tRNA ligase, cytoplasmic vs. Ensembl Yeast
Match: THS1 (Threonyl-tRNA synthetase; essential cytoplasmic protein; human homolog TARS can complement yeast null mutant [Source:SGD;Acc:S000001340])

HSP 1 Score: 754.592 bits (1947), Expect = 0.000e+0
Identity = 373/694 (53.75%), Postives = 496/694 (71.47%), Query Frame = 1
Query:   97 KPEFIEKRIKLWDEWKKEYDEFVEKQERKEITITLKDGQNVIGKAWETSPYICMKEICQSVADNAVIAKVNGVLWDLDRPLENDSS----LELLNFDSKDGEYVFWHSSAHILGEVMELEYAGHLCYGPPIEEGFYYDMFLKD----------RQVKPEEYKTLDXXXXXXXXXXXXXXRLEVSIDRLLEMFDYNEFKCRILKERVK-TDKTTIYRCGDLIDLCQGPHVRNTGKVKALSVIKNSASYWEGDATRESLQRIYGISFPDPKQMKEWKTIQEEAAKRDHRKIGTKQQLFMFHELSPGSCFFLPKGTVIYNKLVDFMKEQYWTRGFTEVISPNLYNSKLWETSGHWEHYKENMFQTEIEKCKFAMKPMNCPGHCLMFGSTIRSYRDLPIRLADFGVLHRNEASGALTGLTRVRRFQQDDAHIFCREDQITKEIESCLDFLDYTYRVFGFDFQLKLSTRPEKFLGEISMWDKAEAQLTDALNNFGKKWELNPADGAFYGPKIDITITDALRRHHQCATIQLDFQLPIRFSLEYMTDSAAQREGDSKITLARPVIIHRAILGSVERMFAILAENYGGKWPFWLSPFQAIVIPFNPSCDEYALSIQKAVHDAGFHVDIDLDTKSIFNKKISKAQEAQYNFMLVVGKKEVENKTVNIRTRD----NKVHGERSIEKVIERFRELETSRASDN 2121
            +P FIE+RI+++D  +KEY++ V    R  + I LKDG      +WET+P    K I +S+AD   I+KVNG LWDLDRP E +++    LELL+F+S +G+ VFWHSSAH+LGE  E     H+C GPP ++GF+Y+M ++D          R V   ++  L+   K ++K+KQKFERL +S + LL+MF Y+++K  +++ +V     TT+YRCG LIDLC GPH+ +TG++KA  ++KNS+ Y+ GDAT +SLQR+YGISFPD K M        EA+ RDHRKIG +Q+LF+F+E+SPGSCF+LP GT IYN LVD ++ +Y  RG+ EVI+PN+YNSKLWETSGHW +YKENMF  E+EK  F +KPMNCPGHCLMF S  RSYR+LP R+ADFGV+HRNE SGAL+GLTRVRRFQQDDAHIFC  DQI  EIE+  +FL Y Y VFGF+F+++LSTRPEK++G+I  WD AE++L  AL  +G  WE+N  DGAFYGPKIDI I+DALRR HQCATIQLDFQLP RF LE+ +     ++ DS+ +  RPV+IHRAILGSVERM AIL E++ GKWPFWLSP Q +V+P       YA  ++  +HDAGF+ D+DL T +   KK+   Q  +YNF+ +VG++E+  K+VNIR RD       +   S+E+V+++ R L+  +  DN
Sbjct:   45 EPTFIEERIEMFDRLQKEYNDKVASMPRVPLKIVLKDGAVKEATSWETTPMDIAKGISKSLADRLCISKVNGQLWDLDRPFEGEANEEIKLELLDFESDEGKKVFWHSSAHVLGESCECHLGAHICLGPPTDDGFFYEMAVRDSMKDISESPERTVSQADFPGLEGVAKNVIKQKQKFERLVMSKEDLLKMFHYSKYKTYLVQTKVPDGGATTVYRCGKLIDLCVGPHIPHTGRIKAFKLLKNSSCYFLGDATNDSLQRVYGISFPDKKLMDAHLKFLAEASMRDHRKIGKEQELFLFNEMSPGSCFWLPHGTRIYNTLVDLLRTEYRKRGYEEVITPNMYNSKLWETSGHWANYKENMFTFEVEKETFGLKPMNCPGHCLMFKSRERSYRELPWRVADFGVIHRNEFSGALSGLTRVRRFQQDDAHIFCTHDQIESEIENIFNFLQYIYGVFGFEFKMELSTRPEKYVGKIETWDAAESKLESALKKWGGNWEINAGDGAFYGPKIDIMISDALRRWHQCATIQLDFQLPNRFELEFKS-----KDQDSE-SYERPVMIHRAILGSVERMTAILTEHFAGKWPFWLSPRQVLVVPVGVKYQGYAEDVRNKLHDAGFYADVDL-TGNTLQKKVRNGQMLKYNFIFIVGEQEMNEKSVNIRNRDVMEQQGKNATVSVEEVLKQLRNLKDEKRGDN 731          
BLAST of Threonine--tRNA ligase, cytoplasmic vs. Ensembl Yeast
Match: MST1 (Mitochondrial threonyl-tRNA synthetase; aminoacylates both the canonical threonine tRNA tT(UGU)Q1 and the unusual threonine tRNA tT(UAG)Q2 in vitro; lacks a typical editing domain, but has pre-transfer editing activity stimulated by the unusual tRNA-Thr [Source:SGD;Acc:S000001677])

HSP 1 Score: 378.252 bits (970), Expect = 1.593e-123
Identity = 190/429 (44.29%), Postives = 274/429 (63.87%), Query Frame = 1
Query:  916 IGTKQQLFMFHELSPGSCFFLPKGTVIYNKLVDFMK-EQYWTRGFTEVISPNLYNSKLWETSGHWEHYKENMFQTEI---EKCKFAMKPMNCPGHCLMFGSTIRSYRDLPIRLADFGVLHRNEASGALTGLTRVRRFQQDDAHIFCREDQITKEIESCLDFLDYTY-RVFGF---------DFQLKLSTRPEKFLGEISMWDKAEAQLTDALNNFGKKWELNPADGAFYGPKIDITITDALRRHHQCATIQLDFQLPIRFSLEYMTDSAAQREGDSKITLARPVIIHRAILGSVERMFAILAENYGGKWPFWLSPFQAIVIPFNPSCDE---YALSIQK--------------AVHDAGFHVDIDLDTKSIFNKKISKAQEAQYNFMLVVGKKEVENKTVNIRTRDNKVHGER-SIEKVIERFRELETS 2106
            +  +Q LFM   LSPGS FFLP G  I+NKL++FMK +Q +  GF EV++P +Y   LWE SGHWE+Y ++MF+ E    EK ++ +KPMNCPGHCL+FG   RSY +LP+R +DF  LHRNEASGAL+GLTR+R+F QDD HIFC   Q+  EI + L  +D  Y ++F F         ++ +  STRP+ F+G++ +W+ AE  L + L   GK W+LNP DGAFYGPK+DI +TD LR+ HQ ATIQLDFQLP RF L++          D   +  RP++IHRA  GS+ER  A+L ++  G+WPFWL+P+QA++IP N    +      ++QK               ++D  F+VD+D+  + +   +I  A    Y+++++VG +EV+ +  NIR RDN+   E+ ++ ++ E+F ELE +
Sbjct:   42 VSQRQDLFMTDPLSPGSMFFLPNGAKIFNKLIEFMKLQQKFKFGFNEVVTPLIYKKTLWEKSGHWENYADDMFKVETTDEEKEEYGLKPMNCPGHCLIFGKKDRSYNELPLRFSDFSPLHRNEASGALSGLTRLRKFHQDDGHIFCTPSQVKSEIFNSLKLIDIVYNKIFPFVKGGSGAESNYFINFSTRPDHFIGDLKVWNHAEQVLKEILEESGKPWKLNPGDGAFYGPKLDIMVTDHLRKTHQVATIQLDFQLPERFDLKF---------KDQDNSYKRPIMIHRATFGSIERFMALLIDSNEGRWPFWLNPYQAVIIPVNTKNVQQLDMCTALQKKLRNELEADDMEPVPLNDWHFNVDLDIRNEPV-GYRIKSAILKNYSYLIIVGDEEVQLQKYNIRERDNRKSFEKLTMSQIWEKFIELEKN 460          
BLAST of Threonine--tRNA ligase, cytoplasmic vs. Ensembl Nematostella
Match: EDO31193 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SYN6])

HSP 1 Score: 796.579 bits (2056), Expect = 0.000e+0
Identity = 381/567 (67.20%), Postives = 449/567 (79.19%), Query Frame = 1
Query:  433 MELEYAGHLCYGPPIEEGFYYDMFLKDRQVKPEEYKTLDXXXXXXXXXXXXXXRLEVSIDRLLEMFDYNEFKCRILKERVKTDKTTIYRCGDLIDLCQGPHVRNTGKVKALSVIKNSASYWEGDATRESLQRIYGISFPDPKQMKEWKTIQEEAAKRDHRKIGTKQQLFMFHELSPGSCFFLPKGTVIYNKLVDFMKEQYWTRGFTEVISPNLYNSKLWETSGHWEHYKENMFQTEIEKCKFAMKPMNCPGHCLMFGSTIRSYRDLPIRLADFGVLHRNEASGALTGLTRVRRFQQDDAHIFCREDQITKEIESCLDFLDYTYRVFGFDFQLKLSTRPEKFLGEISMWDKAEAQLTDALNNFGKKWELNPADGAFYGPKIDITITDALRRHHQCATIQLDFQLPIRFSLEYMTDSAAQREGDSKITLARPVIIHRAILGSVERMFAILAENYGGKWPFWLSPFQAIVIPFNPSCDEYALSIQKAVHDAGFHVDIDLDTKSIFNKKISKAQEAQYNFMLVVGKKEVENKTVNIRTRDNKVHGERSIEKVIERFRELETSRASDNQFEF 2133
            ME  Y G LCYGPPIEEG+YYDM L+ RQV   ++ +LD   KKI KEKQ FERLE+  + LLEMF YNEFKCRIL  +VKT  TT+YRCG LIDLC+GPHVR+TGK+K+++V KNSA+YWEG+   ESLQRIYGISFP+ KQMKEWK  QEEAAKRDHRKIG  Q+LF FHELSPGSCFFLPKG VIYN L++F+KEQYW RGF EV+SPN+Y++KLWETSGHW+HY E+MF  E+EK  +A+KPMNCPGHCLMF    RS+R+LP+R+ADFGVLHRNE SG L+GLTRVRRFQQDDAHIFC  DQI +EI SCLDFL + Y VFGF F+L LSTRPEK+LG+I +W++AE +L  ALN FG+ W LNP DGAFYGPKIDI I DALRR+HQCATIQLDFQLP RF+L Y+T      EGD +    RPVI+HRAILGSVERM AIL E++GGKWPFWLSP QAIVIP  P  DEYA  +   +  AG+HVD DLD  +  NKK+  AQ AQYNF+ VVG+KE    TVN+RTRDNKVHGE S+E V+ +F  L + R  +++ EF
Sbjct:    1 MERHYGGCLCYGPPIEEGYYYDMHLEGRQVSSNDFSSLDNLTKKITKEKQPFERLEMKKEDLLEMFKYNEFKCRILNNKVKTPTTTVYRCGPLIDLCRGPHVRHTGKIKSIAVTKNSATYWEGNCEAESLQRIYGISFPNDKQMKEWKKFQEEAAKRDHRKIGRDQELFFFHELSPGSCFFLPKGAVIYNTLINFIKEQYWKRGFQEVVSPNIYSTKLWETSGHWQHYSEHMFSFEVEKESYALKPMNCPGHCLMFDHRPRSWRELPLRMADFGVLHRNELSGTLSGLTRVRRFQQDDAHIFCTADQIGQEIISCLDFLKHVYGVFGFTFKLNLSTRPEKYLGKIELWNQAEKELEAALNGFGQAWVLNPGDGAFYGPKIDIQIQDALRRYHQCATIQLDFQLPERFNLTYVTG-----EGDER---KRPVIVHRAILGSVERMIAILTESFGGKWPFWLSPRQAIVIPIGPKYDEYAQKVMSDILAAGYHVDADLDHGTTLNKKVRNAQLAQYNFIFVVGEKEATTGTVNVRTRDNKVHGEFSVEAVLNKFATLTSERVRNSEEEF 559          
BLAST of Threonine--tRNA ligase, cytoplasmic vs. Ensembl Nematostella
Match: EDO27279 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7T9P4])

HSP 1 Score: 242.662 bits (618), Expect = 1.705e-75
Identity = 117/172 (68.02%), Postives = 135/172 (78.49%), Query Frame = 1
Query: 1351 QITKEIESCLDFLDYTYRVFGFDFQLKLSTRPEKFLGEISMWDKAEAQLTDALNNFGKKWELNPADGAFYGPKIDITITDALRRHHQCATIQLDFQLPIRFSLEYMTDSAAQREGDSKITLARPVIIHRAILGSVERMFAILAENYGGKWPFWLSPFQAIVIPFNPSCDEYA 1866
            +I +EI SCLDFL + Y VFGF F+L LSTRPEK+LG+I +W++AE +L  ALN FG+ W LNP DGAFYGPKIDI I DALRR+HQCATIQLDFQLP RF+L Y+T      EGD +    RPVI+HRAILGSVERM AIL E++GGKWPFWLSP QAIVIP  P  DEYA
Sbjct:    3 KIGQEIISCLDFLKHVYGVFGFTFKLNLSTRPEKYLGKIELWNQAEKELEAALNGFGQPWVLNPGDGAFYGPKIDIQIQDALRRYHQCATIQLDFQLPERFNLTYVTG-----EGDER---KRPVIVHRAILGSVERMIAILTESFGGKWPFWLSPRQAIVIPIGPKYDEYA 166          
BLAST of Threonine--tRNA ligase, cytoplasmic vs. Ensembl Nematostella
Match: EDO31194 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SYN7])

HSP 1 Score: 76.6406 bits (187), Expect = 2.272e-17
Identity = 38/71 (53.52%), Postives = 48/71 (67.61%), Query Frame = 1
Query:  187 ITITLKDGQNVIGKAWETSPYICMKEICQSVADNAVIAKVNGVLWDLDRPLENDSSLELLNFDSKDGEYVF 399
            I ITL DG+ + G +W+T+PY     I Q +ADN VIAKVNG +WDLDR LE D SL+LL FD  +G  + 
Sbjct:    2 IKITLPDGKEIEGLSWKTTPYEIACSISQGLADNTVIAKVNGEVWDLDRVLEGDCSLQLLKFDDDEGVLLL 72          
BLAST of Threonine--tRNA ligase, cytoplasmic vs. Ensembl Medaka
Match: tars3 (threonine--tRNA ligase, cytoplasmic [Source:NCBI gene;Acc:101167193])

HSP 1 Score: 894.419 bits (2310), Expect = 0.000e+0
Identity = 428/681 (62.85%), Postives = 523/681 (76.80%), Query Frame = 1
Query:  100 PEFIEKRIKLWDEWKKEYDEFVEK--QERKEITITLKDGQNVIGKAWETSPYICMKEICQSVADNAVIAKVNGVLWDLDRPLENDSSLELLNFDSKDGEYVFWHSSAHILGEVMELEYAGHLCYGPPIEEGFYYDMFLKDRQ-VKPEEYKTLDXXXXXXXXXXXXXXRLEVSIDRLLEMFDYNEFKCRILKERVKTDKTTIYRCGDLIDLCQGPHVRNTGKVKALSVIKNSASYWEGDATRESLQRIYGISFPDPKQMKEWKTIQEEAAKRDHRKIGTKQQLFMFHELSPGSCFFLPKGTVIYNKLVDFMKEQYWTRGFTEVISPNLYNSKLWETSGHWEHYKENMFQTEIEKCKFAMKPMNCPGHCLMFGSTIRSYRDLPIRLADFGVLHRNEASGALTGLTRVRRFQQDDAHIFCREDQITKEIESCLDFLDYTYRVFGFDFQLKLSTRPEKFLGEISMWDKAEAQLTDALNNFGKKWELNPADGAFYGPKIDITITDALRRHHQCATIQLDFQLPIRFSLEYMTDSAAQREGDSKITLARPVIIHRAILGSVERMFAILAENYGGKWPFWLSPFQAIVIPFNPSCDEYALSIQKAVHDAGFHVDIDLDTKSIFNKKISKAQEAQYNFMLVVGKKEVENKTVNIRTRDNKVHGERSIEKVIERFRELETSRASDNQFEF 2133
            P +I +R+ L++  KKE D  + K  Q  K+IT+ L DGQ V  K+W T+PY    EI Q +ADNAVI++VNG LWDLDRPL+ D SLELL FD++D + V+WHSSAH+LGE ME  Y G LCYGPPIE GFYYDMFL D++ +   E+  L+  CK ++KEKQ FERLE+S + LL+MF YN+FKCRIL E+V T  TT+YRCG LIDLC+GPHVR+TGK+KA+ + KNS++YWEG +  E+LQRIYGISFPD K +KEW+  QEEA  RDHRKIG  Q+LF FH+LSPGSCFFLP+G  IYN L +F++++YW RGF EV SPN+YNSKLWETSGHW+HY ENMF   +E+  FA+KPMNCPGHCLMF    RS+R+LP+RLADFGVLHRNE SG LTGLTRVRRFQQDDAHIFC  DQI  E++ CLDFL   Y VFGF FQL LSTRPEK+LG+I +W++AE QL ++LN FG+ W+LNP DGAFYGPKIDI I DA+ R+HQCATIQLDFQLPIRF+L ++      ++GD K   ARPVIIHRAILGSVERM AIL ENY GKWP WLSP Q +++P NPSC+EYA  + K   +AGF  + DLD+  + NKKI  AQ AQYNF+LVVG+KE     VN+RTRDNKVHGE S+ +V+ R   L+ SR  + + EF
Sbjct:  105 PGYISERLALYESLKKESDALLAKRSQNSKDITVELPDGQKVAAKSWVTTPYQVACEISQGLADNAVISRVNGELWDLDRPLQQDCSLELLRFDNEDAQAVYWHSSAHVLGEAMERFYGGCLCYGPPIENGFYYDMFLGDQKAISSSEFGDLEVLCKSVMKEKQPFERLELSKETLLKMFKYNKFKCRILNEKVSTPTTTVYRCGPLIDLCRGPHVRHTGKIKAMKIYKNSSTYWEGRSDMETLQRIYGISFPDSKMLKEWERFQEEAKTRDHRKIGKDQELFFFHDLSPGSCFFLPRGAYIYNTLTEFIRDEYWRRGFQEVASPNVYNSKLWETSGHWQHYSENMFSFPVEEDVFALKPMNCPGHCLMFSHRPRSWRELPLRLADFGVLHRNELSGTLTGLTRVRRFQQDDAHIFCTMDQIESEMKGCLDFLRGVYNVFGFSFQLHLSTRPEKYLGDIEVWNQAEKQLENSLNEFGEPWKLNPGDGAFYGPKIDIKIKDAIGRYHQCATIQLDFQLPIRFNLTFVG-----KDGDDK---ARPVIIHRAILGSVERMIAILTENYAGKWPLWLSPCQVMLVPVNPSCEEYAKKVCKQFTEAGFMAEADLDSSCLLNKKIRNAQLAQYNFILVVGEKEKMTNRVNVRTRDNKVHGELSVSEVMARLSLLKQSRCRNAEEEF 777          
BLAST of Threonine--tRNA ligase, cytoplasmic vs. Ensembl Medaka
Match: tars3 (threonine--tRNA ligase, cytoplasmic [Source:NCBI gene;Acc:101167193])

HSP 1 Score: 893.649 bits (2308), Expect = 0.000e+0
Identity = 428/681 (62.85%), Postives = 523/681 (76.80%), Query Frame = 1
Query:  100 PEFIEKRIKLWDEWKKEYDEFVEK--QERKEITITLKDGQNVIGKAWETSPYICMKEICQSVADNAVIAKVNGVLWDLDRPLENDSSLELLNFDSKDGEYVFWHSSAHILGEVMELEYAGHLCYGPPIEEGFYYDMFLKDRQ-VKPEEYKTLDXXXXXXXXXXXXXXRLEVSIDRLLEMFDYNEFKCRILKERVKTDKTTIYRCGDLIDLCQGPHVRNTGKVKALSVIKNSASYWEGDATRESLQRIYGISFPDPKQMKEWKTIQEEAAKRDHRKIGTKQQLFMFHELSPGSCFFLPKGTVIYNKLVDFMKEQYWTRGFTEVISPNLYNSKLWETSGHWEHYKENMFQTEIEKCKFAMKPMNCPGHCLMFGSTIRSYRDLPIRLADFGVLHRNEASGALTGLTRVRRFQQDDAHIFCREDQITKEIESCLDFLDYTYRVFGFDFQLKLSTRPEKFLGEISMWDKAEAQLTDALNNFGKKWELNPADGAFYGPKIDITITDALRRHHQCATIQLDFQLPIRFSLEYMTDSAAQREGDSKITLARPVIIHRAILGSVERMFAILAENYGGKWPFWLSPFQAIVIPFNPSCDEYALSIQKAVHDAGFHVDIDLDTKSIFNKKISKAQEAQYNFMLVVGKKEVENKTVNIRTRDNKVHGERSIEKVIERFRELETSRASDNQFEF 2133
            P +I +R+ L++  KKE D  + K  Q  K+IT+ L DGQ V  K+W T+PY    EI Q +ADNAVI++VNG LWDLDRPL+ D SLELL FD++D + V+WHSSAH+LGE ME  Y G LCYGPPIE GFYYDMFL D++ +   E+  L+  CK ++KEKQ FERLE+S + LL+MF YN+FKCRIL E+V T  TT+YRCG LIDLC+GPHVR+TGK+KA+ + KNS++YWEG +  E+LQRIYGISFPD K +KEW+  QEEA  RDHRKIG  Q+LF FH+LSPGSCFFLP+G  IYN L +F++++YW RGF EV SPN+YNSKLWETSGHW+HY ENMF   +E+  FA+KPMNCPGHCLMF    RS+R+LP+RLADFGVLHRNE SG LTGLTRVRRFQQDDAHIFC  DQI  E++ CLDFL   Y VFGF FQL LSTRPEK+LG+I +W++AE QL ++LN FG+ W+LNP DGAFYGPKIDI I DA+ R+HQCATIQLDFQLPIRF+L ++      ++GD K   ARPVIIHRAILGSVERM AIL ENY GKWP WLSP Q +++P NPSC+EYA  + K   +AGF  + DLD+  + NKKI  AQ AQYNF+LVVG+KE     VN+RTRDNKVHGE S+ +V+ R   L+ SR  + + EF
Sbjct:  140 PGYISERLALYESLKKESDALLAKRSQNSKDITVELPDGQKVAAKSWVTTPYQVACEISQGLADNAVISRVNGELWDLDRPLQQDCSLELLRFDNEDAQAVYWHSSAHVLGEAMERFYGGCLCYGPPIENGFYYDMFLGDQKAISSSEFGDLEVLCKSVMKEKQPFERLELSKETLLKMFKYNKFKCRILNEKVSTPTTTVYRCGPLIDLCRGPHVRHTGKIKAMKIYKNSSTYWEGRSDMETLQRIYGISFPDSKMLKEWERFQEEAKTRDHRKIGKDQELFFFHDLSPGSCFFLPRGAYIYNTLTEFIRDEYWRRGFQEVASPNVYNSKLWETSGHWQHYSENMFSFPVEEDVFALKPMNCPGHCLMFSHRPRSWRELPLRLADFGVLHRNELSGTLTGLTRVRRFQQDDAHIFCTMDQIESEMKGCLDFLRGVYNVFGFSFQLHLSTRPEKYLGDIEVWNQAEKQLENSLNEFGEPWKLNPGDGAFYGPKIDIKIKDAIGRYHQCATIQLDFQLPIRFNLTFVG-----KDGDDK---ARPVIIHRAILGSVERMIAILTENYAGKWPLWLSPCQVMLVPVNPSCEEYAKKVCKQFTEAGFMAEADLDSSCLLNKKIRNAQLAQYNFILVVGEKEKMTNRVNVRTRDNKVHGELSVSEVMARLSLLKQSRCRNAEEEF 812          
BLAST of Threonine--tRNA ligase, cytoplasmic vs. Ensembl Medaka
Match: tars1 (threonine--tRNA ligase, cytoplasmic [Source:NCBI gene;Acc:101171337])

HSP 1 Score: 890.952 bits (2301), Expect = 0.000e+0
Identity = 430/690 (62.32%), Postives = 528/690 (76.52%), Query Frame = 1
Query:   76 GFQRMITKPEFIEKRIKLWDEWKKEYDEFVEKQERKE---ITITLKDGQNVIGKAWETSPYICMKEICQSVADNAVIAKVNGVLWDLDRPLENDSSLELLNFDSKDGEYVFWHSSAHILGEVMELEYAGHLCYGPPIEEGFYYDMFLKDRQ-VKPEEYKTLDXXXXXXXXXXXXXXRLEVSIDRLLEMFDYNEFKCRILKERVKTDKTTIYRCGDLIDLCQGPHVRNTGKVKALSVIKNSASYWEGDATRESLQRIYGISFPDPKQMKEWKTIQEEAAKRDHRKIGTKQQLFMFHELSPGSCFFLPKGTVIYNKLVDFMKEQYWTRGFTEVISPNLYNSKLWETSGHWEHYKENMFQTEIEKCKFAMKPMNCPGHCLMFGSTIRSYRDLPIRLADFGVLHRNEASGALTGLTRVRRFQQDDAHIFCREDQITKEIESCLDFLDYTYRVFGFDFQLKLSTRPEKFLGEISMWDKAEAQLTDALNNFGKKWELNPADGAFYGPKIDITITDALRRHHQCATIQLDFQLPIRFSLEYMTDSAAQREGDSKITLARPVIIHRAILGSVERMFAILAENYGGKWPFWLSPFQAIVIPFNPSCDEYALSIQKAVHDAGFHVDIDLDTKSIFNKKISKAQEAQYNFMLVVGKKEVENKTVNIRTRDNKVHGERSIEKVIERFRELETSRASDNQFEF 2133
            G   +   P++I++R+ L+ + K E+D    ++  KE   I +TL DG+ +  ++W+T+PY     I Q +ADN VIAKVN  +WDLDRPLE+D SL+LL FD ++ + V+WHSSAHILGE ME  Y G LCYGPPIE GFYYDMFL + + V   ++  L+  CKKI+KEKQ FERLE+  + LLEMF YN+FKCRIL E+V T  TT+YRCG LIDLC+GPHVR+TGK+KAL + KNS++YWEG A  E+LQRIYGISFPDPK +KEW+  QEEA  RDHRK+G +Q LF FHELSPGSCFFLPKG  IYN L++F++ +Y  RGF EV++PN+YNSKLW TSGHW+HY ENMF  E+EK  FA+KPMNCPGHCLMF    RS+R+LP+R+ADFGVLHRNE SGALTGLTRVRRFQQDDAHIFC  DQI +EI+ CL FL   Y VFGF F+L LSTRPEKFLGE  MWD+AE QL ++LN FG+KW LNP DGAFYGPKIDI I DA+ R+HQCATIQLDFQLPIRF+L Y++      EGD K    RPVIIHRAILGSVERM AIL ENYGGKWP WLSP Q +++P  P+C+EYA  +++  H +GF  D+DLD     NKKI  AQ +QYNF+LVVG+KE  + TVN+RTRDNKVHGE S+E+ I+R + L+ SR+ + + EF
Sbjct:   44 GKSELSPPPQYIDERLSLYTKLKAEHDALTAERAAKESRPIKVTLPDGKVLEAESWKTTPYQLACGISQGLADNTVIAKVNNSVWDLDRPLEDDCSLQLLKFDDEEAQAVYWHSSAHILGEAMEKVYGGCLCYGPPIESGFYYDMFLDNNEGVSSNDFPCLENLCKKIIKEKQPFERLEIKKETLLEMFKYNKFKCRILNEKVTTPTTTVYRCGPLIDLCRGPHVRHTGKIKALKIHKNSSTYWEGKADMETLQRIYGISFPDPKMLKEWEKFQEEAKNRDHRKLGREQDLFFFHELSPGSCFFLPKGAFIYNTLIEFIRSEYRNRGFQEVVTPNIYNSKLWVTSGHWQHYSENMFSFEVEKEIFALKPMNCPGHCLMFDHRPRSWRELPLRMADFGVLHRNELSGALTGLTRVRRFQQDDAHIFCSMDQIEEEIKGCLHFLRAVYDVFGFTFKLNLSTRPEKFLGEPEMWDQAEKQLENSLNEFGEKWVLNPGDGAFYGPKIDIQIKDAIGRYHQCATIQLDFQLPIRFNLAYVS-----HEGDDK---KRPVIIHRAILGSVERMIAILTENYGGKWPLWLSPRQVMLVPVGPTCEEYAEKVKQEFHSSGFMADVDLDPSCTLNKKIRNAQLSQYNFILVVGEKEKTSNTVNVRTRDNKVHGECSVEECIQRLKRLKASRSRNAEEEF 725          
BLAST of Threonine--tRNA ligase, cytoplasmic vs. Ensembl Medaka
Match: ENSORLT00000013023.2 (threonine--tRNA ligase, cytoplasmic [Source:NCBI gene;Acc:101157805])

HSP 1 Score: 612.838 bits (1579), Expect = 0.000e+0
Identity = 324/692 (46.82%), Postives = 446/692 (64.45%), Query Frame = 1
Query:   61 VWVILGFQRMITKPEFIEKRIKLWDEWKKEYDEFVEKQERKEITITLKDGQNVIGKAWETSPYICMKEICQSV-ADNAVIAKVNGVLWDLDRPLENDSSLELLNFDSKDGEYVFWHSSAHILGEVMELEYAGHLCYGPPIEEGFYYDMFLKDRQVKPEEYKTLDXXXXXXXXXXXXXXRLEVSIDRLLEMFDYNEFKCRILKERVKTDKTTIYRCGDLIDLCQGPHVRNTGKVKALSVIKNSASYWEGDATRES-LQRIYGISFPDPKQMKEWKTIQEEAAKRDHRKIGTKQQLFMFHELSPGSCFFLPKGTVIYNKLVDFMKEQYWTRGFTEVISPNLYNSKLWETSGHWEHYKENMFQTEIEKCK-FAMKPMNCPGHCLMFGSTIRSYRDLPIRLADFGVLHRNEASGALTGLTRVRRFQQDDAHIFCREDQITKEIESCLDFLDYTYRVFGFDFQLKLSTRPEKFLGEISMWDKAEAQLTDALNNFGKKWELNPADGAFYGPKIDITITDALRRHHQCATIQLDFQLPIRFSLEYMTDSAAQREGDSKITLARPVIIHRAILGSVERMFAILAENYGGKWPFWLSPFQAIVIPFNPSCDEYALSIQKAVHDAGFHVDIDLDTKSIFNKKISKAQEAQYNFMLVVGKKEVENKTVNIRTRDNKVHGERSIEKVIERFRELETSRASDNQF 2127
            +W++  F R+   P   E R+ +++  K +      +   K + I L +G+ V G A  T+P      + QSV    A+++KVNG LW+L RPLE D  L+LL FD+ +G+   W ++A ILG V+E  +A  +        GF+ D  L +  +   +   ++ +C+          RL+++I+   ++F  ++ + ++ +++      T+YRCGD + +C  P + +TG +K   +++ S S   GD T  S L+R+ G++FP  K+ +EW+  QEEA +RDHR+IGT Q+LF FH++SPGSCFFLPKG  IYN L DF+K +Y  RGF+EV++P LY++ LWE SGHWEHY ENMF   +E  + FA+KPMNCP HCLMF   +RS+R+LP+R ADFG LHRNE SGAL GLTRVRRF QDDAHIFC  +Q+  EI SCLDF+   Y+VFGF F   LSTRP   LGE   WD AE QL  +L  FG+ WELNP DGAFYGPK+DI I DA+ R HQCATIQLDFQLP RF L+Y+              L RPV+IHRA+LGS+ERM AILAEN+GGKWP WLSP Q +V+P   + + YA  + +  ++AGF VD++ D  + FNKKI  AQ AQYN++ VVG KE E+ TVNIR+R  K  G R + +V+    +L  SR++ ++F
Sbjct:   27 LWLVFIFVRV--SPSSSE-RLLVFESLKSKQAHSRSEVAEKPLRIHLGNGRTVKGTASVTTPLT----VAQSVRVKGALVSKVNGELWELGRPLEADCELQLLGFDTVEGKQAAWRTAACILGGVLERTFAAEVYREGATAFGFFCDHVLDNSALSLTD---VELQCQAAAALNLPLSRLDLNIEEFRKLFQGSDLRLQLAEDQTNGSTVTVYRCGDSLAVCSSPLLPHTGFLKVFKMLQLS-SVTLGDQTGPSDLRRLLGVAFPGEKEREEWEREQEEARRRDHRRIGTDQELFFFHDVSPGSCFFLPKGAHIYNTLTDFIKSEYRRRGFSEVVTPTLYSTALWERSGHWEHYSENMFTVTLEDSQTFALKPMNCPAHCLMFEQRVRSWRELPLRWADFGALHRNELSGALGGLTRVRRFCQDDAHIFCTTEQLEVEILSCLDFVRSVYQVFGFSFHCLLSTRPTPCLGEPEQWDNAEQQLQSSLQQFGEHWELNPGDGAFYGPKVDILIKDAIGRQHQCATIQLDFQLPSRFDLQYVGQDG---------QLHRPVMIHRAVLGSLERMMAILAENFGGKWPLWLSPAQIMVLPAGGNSEPYARQVVQQFNEAGFMVDLNADQGTTFNKKIRSAQLAQYNYIFVVGDKENESGTVNIRSRGGKQLGRRPVVEVLTSLSQLRDSRSNLDEF 698          
BLAST of Threonine--tRNA ligase, cytoplasmic vs. Ensembl Medaka
Match: ENSORLT00000040837.1 (threonine--tRNA ligase, cytoplasmic [Source:NCBI gene;Acc:101157805])

HSP 1 Score: 573.163 bits (1476), Expect = 0.000e+0
Identity = 301/636 (47.33%), Postives = 412/636 (64.78%), Query Frame = 1
Query:  115 KRIKLWDEWKKEYDEFVEKQERKEITITLKDGQNVIGKAWETSPYICMKEICQSV-ADNAVIAKVNGVLWDLDRPLENDSSLELLNFDSKDGEYVFWHSSAHILGEVMELEYAGHLCYGPPIEEGFYYDMFLKDRQVKPEEYKTLDXXXXXXXXXXXXXXRLEVSIDRLLEMFDYNEFKCRILKERVKTDKTTIYRCGDLIDLCQGPHVRNTGKVKALSVIKNSASYWEGDATRES-LQRIYGISFPDPKQMKEWKTIQEEAAKRDHRKIGTKQQLFMFHELSPGSCFFLPKGTVIYNKLVDFMKEQYWTRGFTEVISPNLYNSKLWETSGHWEHYKENMFQTEIEKCK-FAMKPMNCPGHCLMFGSTIRSYRDLPIRLADFGVLHRNEASGALTGLTRVRRFQQDDAHIFCREDQITKEIESCLDFLDYTYRVFGFDFQLKLSTRPEKFLGEISMWDKAEAQLTDALNNFGKKWELNPADGAFYGPKIDITITDALRRHHQCATIQLDFQLPIRFSLEYMTDSAAQREGDSKITLARPVIIHRAILGSVERMFAILAENYGGKWPFWLSPFQAIVIPFNPSCDEYALSIQKAVHDAGFHVDIDLDTKSIFNKKISKAQEAQYNFMLVVGKKEVEN 2013
            +R+ +++  K +      +   K + I L +G+ V G A  T+P      + QSV    A+++KVNG LW+L RPLE D  L+LL FD+ +G+   W ++A ILG V+E  +A  +        GF+ D  L +  +   +   ++ +C+          RL+++I+   ++F  ++ + ++ +++      T+YRCGD + +C  P + +TG +K   +++ S S   GD T  S L+R+ G++FP  K+ +EW+  QEEA +RDHR+IGT Q+LF FH++SPGSCFFLPKG  IYN L DF+K +Y  RGF+EV++P LY++ LWE SGHWEHY ENMF   +E  + FA+KPMNCP HCLMF   +RS+R+LP+R ADFG LHRNE SGAL GLTRVRRF QDDAHIFC  +Q+  EI SCLDF+   Y+VFGF F   LSTRP   LGE   WD AE QL  +L  FG+ WELNP DGAFYGPK+DI I DA+ R HQCATIQLDFQLP RF L+Y+              L RPV+IHRA+LGS+ERM AILAEN+GGKWP WLSP Q +V+P   + + YA  + +  ++AGF VD++ D  + FNKKI  AQ AQYN+  + GK  + +
Sbjct:   32 ERLLVFESLKSKQAHSRSEVAEKPLRIHLGNGRTVKGTASVTTPLT----VAQSVRVKGALVSKVNGELWELGRPLEADCELQLLGFDTVEGKQAAWRTAACILGGVLERTFAAEVYREGATAFGFFCDHVLDNSALSLTD---VELQCQAAAALNLPLSRLDLNIEEFRKLFQGSDLRLQLAEDQTNGSTVTVYRCGDSLAVCSSPLLPHTGFLKVFKMLQLS-SVTLGDQTGPSDLRRLLGVAFPGEKEREEWEREQEEARRRDHRRIGTDQELFFFHDVSPGSCFFLPKGAHIYNTLTDFIKSEYRRRGFSEVVTPTLYSTALWERSGHWEHYSENMFTVTLEDSQTFALKPMNCPAHCLMFEQRVRSWRELPLRWADFGALHRNELSGALGGLTRVRRFCQDDAHIFCTTEQLEVEILSCLDFVRSVYQVFGFSFHCLLSTRPTPCLGEPEQWDNAEQQLQSSLQQFGEHWELNPGDGAFYGPKVDILIKDAIGRQHQCATIQLDFQLPSRFDLQYVGQDG---------QLHRPVMIHRAVLGSLERMMAILAENFGGKWPLWLSPAQIMVLPAGGNSEPYARQVVQQFNEAGFMVDLNADQGTTFNKKIRSAQLAQYNY--IFGKDHIRH 648          
BLAST of Threonine--tRNA ligase, cytoplasmic vs. Planmine SMEST
Match: SMESG000061707.1 (SMESG000061707.1)

HSP 1 Score: 1388.25 bits (3592), Expect = 0.000e+0
Identity = 680/682 (99.71%), Postives = 680/682 (99.71%), Query Frame = 1
Query:   88 MITKPEFIEKRIKLWDEWKKEYDEFVEKQERKEITITLKDGQNVIGKAWETSPYICMKEICQSVADNAVIAKVNGVLWDLDRPLENDSSLELLNFDSKDGEYVFWHSSAHILGEVMELEYAGHLCYGPPIEEGFYYDMFLKDRQVKPEEYKTLDXXXXXXXXXXXXXXRLEVSIDRLLEMFDYNEFKCRILKERVKTDKTTIYRCGDLIDLCQGPHVRNTGKVKALSVIKNSASYWEGDATRESLQRIYGISFPDPKQMKEWKTIQEEAAKRDHRKIGTKQQLFMFHELSPGSCFFLPKGTVIYNKLVDFMKEQYWTRGFTEVISPNLYNSKLWETSGHWEHYKENMFQTEIEKCKFAMKPMNCPGHCLMFGSTIRSYRDLPIRLADFGVLHRNEASGALTGLTRVRRFQQDDAHIFCREDQITKEIESCLDFLDYTYRVFGFDFQLKLSTRPEKFLGEISMWDKAEAQLTDALNNFGKKWELNPADGAFYGPKIDITITDALRRHHQCATIQLDFQLPIRFSLEYMTDSAAQREGDSKITLARPVIIHRAILGSVERMFAILAENYGGKWPFWLSPFQAIVIPFNPSCDEYALSIQKAVHDAGFHVDIDLDTKSIFNKKISKAQEAQYNFMLVVGKKEVENKTVNIRTRDNKVHGERSIEKVIERFRELETSRASDNQFEF 2133
            MITKPEFIEKRIKLWDEWKKEYDEFVEKQERKEITITLKDGQNVIGKAWETSPYICMKEICQSVADNAVIAKVNGVLWDLDRPLENDSSLELLNFDSKDGEYVFWHSSAHILGE MELEYAGHLCYGP IEEGFYYDMFLKDRQVKPEEYKTLDEKCKKIVKEKQKFERLEVSIDRLLEMFDYNEFKCRILKERVKTDKTTIYRCGDLIDLCQGPHVRNTGKVKALSVIKNSASYWEGDATRESLQRIYGISFPDPKQMKEWKTIQEEAAKRDHRKIGTKQQLFMFHELSPGSCFFLPKGTVIYNKLVDFMKEQYWTRGFTEVISPNLYNSKLWETSGHWEHYKENMFQTEIEKCKFAMKPMNCPGHCLMFGSTIRSYRDLPIRLADFGVLHRNEASGALTGLTRVRRFQQDDAHIFCREDQITKEIESCLDFLDYTYRVFGFDFQLKLSTRPEKFLGEISMWDKAEAQLTDALNNFGKKWELNPADGAFYGPKIDITITDALRRHHQCATIQLDFQLPIRFSLEYMTDSAAQREGDSKITLARPVIIHRAILGSVERMFAILAENYGGKWPFWLSPFQAIVIPFNPSCDEYALSIQKAVHDAGFHVDIDLDTKSIFNKKISKAQEAQYNFMLVVGKKEVENKTVNIRTRDNKVHGERSIEKVIERFRELETSRASDNQFEF
Sbjct:    1 MITKPEFIEKRIKLWDEWKKEYDEFVEKQERKEITITLKDGQNVIGKAWETSPYICMKEICQSVADNAVIAKVNGVLWDLDRPLENDSSLELLNFDSKDGEYVFWHSSAHILGEAMELEYAGHLCYGPAIEEGFYYDMFLKDRQVKPEEYKTLDEKCKKIVKEKQKFERLEVSIDRLLEMFDYNEFKCRILKERVKTDKTTIYRCGDLIDLCQGPHVRNTGKVKALSVIKNSASYWEGDATRESLQRIYGISFPDPKQMKEWKTIQEEAAKRDHRKIGTKQQLFMFHELSPGSCFFLPKGTVIYNKLVDFMKEQYWTRGFTEVISPNLYNSKLWETSGHWEHYKENMFQTEIEKCKFAMKPMNCPGHCLMFGSTIRSYRDLPIRLADFGVLHRNEASGALTGLTRVRRFQQDDAHIFCREDQITKEIESCLDFLDYTYRVFGFDFQLKLSTRPEKFLGEISMWDKAEAQLTDALNNFGKKWELNPADGAFYGPKIDITITDALRRHHQCATIQLDFQLPIRFSLEYMTDSAAQREGDSKITLARPVIIHRAILGSVERMFAILAENYGGKWPFWLSPFQAIVIPFNPSCDEYALSIQKAVHDAGFHVDIDLDTKSIFNKKISKAQEAQYNFMLVVGKKEVENKTVNIRTRDNKVHGERSIEKVIERFRELETSRASDNQFEF 682          
BLAST of Threonine--tRNA ligase, cytoplasmic vs. Planmine SMEST
Match: SMESG000047630.1 (SMESG000047630.1)

HSP 1 Score: 590.112 bits (1520), Expect = 0.000e+0
Identity = 285/628 (45.38%), Postives = 418/628 (66.56%), Query Frame = 1
Query:  241 SPYICMKEICQSVADNAVIAKVNGVLWDLDRPLENDSSLELLNFDSKDGEYVFWHSSAHILGEVMELEYAGHLCYGPPIEEGFYYDMFLKDRQVKPEEYKTLDXXXXXXXXXXXXXXRLEVSIDRLLEMFDYNEFKCRILKERVKTDK-TTIYRCGDLIDLCQGPHVRNTGKVKALSVIKNSASYWEGDATRESLQRIYGISFPDPKQMKEWKTIQEEAAKRDHRKIGTKQQLFMFHELSPGSCFFLPKGTVIYNKLVDFMKEQYWTRGFTEVISPNLYNSKLWETSGHWEHYKENMFQTEIE-KCKFAMKPMNCPGHCLMFGSTIRSYRDLPIRLADFGVLHRNEASGALTGLTRVRRFQQDDAHIFCREDQITKEIESCLDFLDYTYRVFGFDFQLKLSTRPEKFLGEISMWDKAEAQLTDALNNFGKKWELNPADGAFYGPKIDITITDALRRHHQCATIQLDFQLPIRFSLEYMTDSAAQREGDSKITLARPVIIHRAILGSVERMFAILAENYGGKWPFWLSPFQAIVIPFNPSCDEYALSIQKAVHDAGFHVDIDLDTKSIFNKKISKAQEAQYNFMLVVGKKEVENKTVNIRTRDNKVHGERSIEKVIERFRELETSRASD 2118
            +PYI M+     ++++ +I+KVNG+ WDL++PL NDS +E L F++      FW S+A +L  ++E  ++         ++GF  D  LK++ +   +++++++K    V     FER+++ I+   ++F ++  K  +++     +K  ++YRC DLID+C+ P VRNTG++K L ++++ +          SLQRIYG+SFP+ + +  W   QEEA KR+HR IG +Q+LF FH  SPGS F LP+GT I NKL+D ++EQY  RGF+EV +P ++ ++LWETSGHW+HY+EN+F+  ++ K +F++KPMNCP HCL++    R  +DLP+RLADFG LHR E +G L+GLTR+R+F QDDAHIFCR DQI +EIE  LDF+ + Y +  F+F L LSTRP+ FLG+I +W+ AE QL  +L  FGK W LN  DGAFYGPKIDI I DAL R HQCATIQLDFQLP+RF+L+Y  +           +  RPVIIHRAILGSVER  AIL E+  GKWPFWL+P Q +V+  +    EYA  I + + DAGF  D DL    +  +KI   ++ +YN +L++G+KEV+++ V++R    + H    +E++I++F+  E +R  D
Sbjct:   76 TPYIIMQNDNNQLSNSILISKVNGLFWDLNKPLVNDSDIEFLLFENDIARDAFWRSTAFLLNGILEHLFSSETYRSHSNDKGFICDFILKNKSISSLQFQSIEDKFMNYVASGADFERIDIPIEIARDLFSFSSMKLDLIEMLHSENKPISLYRCLDLIDICEAPLVRNTGQLKYLKIVRSGSVQMNSTDNCNSLQRIYGVSFPNKELLDGWLLHQEEAGKRNHRLIGEEQELFFFHNSSPGSAFMLPRGTHICNKLIDLIREQYRKRGFSEVTTPQIFKNELWETSGHWDHYQENLFKISLKSKEEFSIKPMNCPAHCLIYSHKQRYSKDLPLRLADFGALHRFELTGELSGLTRLRKFHQDDAHIFCRPDQIEQEIERSLDFIKHVYGILNFEFDLHLSTRPDNFLGDIEIWNLAEEQLKKSLEKFGKSWSLNSGDGAFYGPKIDIIIKDALNRRHQCATIQLDFQLPLRFNLKYFPNEG---------SFERPVIIHRAILGSVERFLAILIESNSGKWPFWLNPRQVLVVSVSDKFIEYANEICQQIKDAGFLCDTDLRNLRM-ARKILNGEQQRYNCILIIGQKEVDSRQVSVRKGHGEDHESWDLEELIKKFKYWEKNRTFD 693          
BLAST of Threonine--tRNA ligase, cytoplasmic vs. Planmine SMEST
Match: SMESG000067020.1 (SMESG000067020.1)

HSP 1 Score: 61.2326 bits (147), Expect = 1.036e-9
Identity = 71/273 (26.01%), Postives = 119/273 (43.59%), Query Frame = 1
Query:  133 DEWKKEYDEFVEKQER--KEIT---------ITLKDGQNVIGKAWETSPYICMKEICQSVADNAVIAKVNGVLWDLDRPLENDSSLELLNFDSKDGEYV---FWHSSAHILGEVMEL----EYAGHLCYGPPIEEGFYYDMFLKDRQV----KPE---------EYKTLDXXXXXXXXXXXXXXRLEVSIDRLLEMFDYNEFKCR---ILKERVKTDKTTIYRCGDLIDLCQGPHVRNTGKVKALSVIKNSASYWEGDATRESLQRIYGISFP 849
            D + KE++E ++   R  +++T         ITLK  +N+      ++P+ C   I + +A+ +V+A VN    D+ +PL  D  LE LNF S +   V   FW S + I   ++E     ++  +LC  P          F+ D Q+     PE           K++    +KI+ E   +  L V+     EMF     K +    + E    +K  IY+ G  +D+C+GP + NT  V   S+   ++ Y         L R  G++ P
Sbjct:   23 DLFDKEFNENLQLNTRHLEKVTVHCKNLSQQITLKMNKNI------STPHDCAIHIQEYLANKSVMALVNNQPHDMHKPLFEDCELEFLNFHSDNCIPVNLSFWRSCSFITNWILENCFHEDFQVNLCSFP--YPNLQSGSFVCDVQILYKDSPEFDEQLITTVNLKSISTTARKIMLENYNYIPLSVNQSTAEEMFRDCPLKMKQIPFMMENANQNKIRIYKVGQHVDICRGPLISNTSHVGRYSL---TSVYPIKTNDYGRLFRFQGVAIP 284          
The following BLAST results are available for this feature:
BLAST of Threonine--tRNA ligase, cytoplasmic vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
TARS10.000e+063.58threonyl-tRNA synthetase 1 [Source:HGNC Symbol;Acc... [more]
TARS10.000e+063.58threonyl-tRNA synthetase 1 [Source:HGNC Symbol;Acc... [more]
TARS30.000e+062.13threonyl-tRNA synthetase 3 [Source:HGNC Symbol;Acc... [more]
TARS10.000e+060.78threonyl-tRNA synthetase 1 [Source:HGNC Symbol;Acc... [more]
TARS30.000e+063.78threonyl-tRNA synthetase 3 [Source:HGNC Symbol;Acc... [more]
back to top
BLAST of Threonine--tRNA ligase, cytoplasmic vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 4
Match NameE-valueIdentityDescription
tars-10.000e+061.62Threonine--tRNA ligase, cytoplasmic [Source:UniPr... [more]
tars-10.000e+061.62Threonine--tRNA ligase, cytoplasmic [Source:UniPr... [more]
tars-10.000e+061.62Threonine--tRNA ligase, cytoplasmic [Source:UniPr... [more]
tars-10.000e+061.62Threonine--tRNA ligase, cytoplasmic [Source:UniPr... [more]
back to top
BLAST of Threonine--tRNA ligase, cytoplasmic vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ThrRS0.000e+062.01gene:FBgn0027081 transcript:FBtr0080333[more]
ThrRS0.000e+062.01gene:FBgn0027081 transcript:FBtr0080331[more]
ThrRS0.000e+062.01gene:FBgn0027081 transcript:FBtr0080332[more]
ThrRS0.000e+062.01gene:FBgn0027081 transcript:FBtr0346436[more]
mRpL399.101e-1825.68gene:FBgn0036462 transcript:FBtr0075672[more]
back to top
BLAST of Threonine--tRNA ligase, cytoplasmic vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
tars10.000e+062.55threonyl-tRNA synthetase 1 [Source:ZFIN;Acc:ZDB-GE... [more]
tars10.000e+060.40threonyl-tRNA synthetase 1 [Source:ZFIN;Acc:ZDB-GE... [more]
tars10.000e+059.51threonyl-tRNA synthetase 1 [Source:ZFIN;Acc:ZDB-GE... [more]
tars10.000e+060.78threonyl-tRNA synthetase 1 [Source:ZFIN;Acc:ZDB-GE... [more]
tars10.000e+059.81threonyl-tRNA synthetase 1 [Source:ZFIN;Acc:ZDB-GE... [more]
back to top
BLAST of Threonine--tRNA ligase, cytoplasmic vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
tars0.000e+063.14threonyl-tRNA synthetase 1 [Source:NCBI gene;Acc:4... [more]
tars0.000e+063.14threonyl-tRNA synthetase 1 [Source:NCBI gene;Acc:4... [more]
tars0.000e+063.14threonyl-tRNA synthetase 1 [Source:NCBI gene;Acc:4... [more]
tars0.000e+063.29threonyl-tRNA synthetase 1 [Source:NCBI gene;Acc:4... [more]
tars30.000e+063.58threonyl-tRNA synthetase 3 [Source:NCBI gene;Acc:1... [more]
back to top
BLAST of Threonine--tRNA ligase, cytoplasmic vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Tarsl20.000e+062.30threonyl-tRNA synthetase-like 2 [Source:MGI Symbol... [more]
Tars0.000e+062.56threonyl-tRNA synthetase [Source:MGI Symbol;Acc:MG... [more]
Tars20.000e+048.64threonyl-tRNA synthetase 2, mitochondrial (putativ... [more]
Tars20.000e+046.22threonyl-tRNA synthetase 2, mitochondrial (putativ... [more]
Tars22.648e-1550.78threonyl-tRNA synthetase 2, mitochondrial (putativ... [more]
back to top
BLAST of Threonine--tRNA ligase, cytoplasmic vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q8BLY2|SYTC2_MOUSE0.000e+062.30Threonine--tRNA ligase 2, cytoplasmic OS=Mus muscu... [more]
sp|Q3ZBV8|SYTC_BOVIN0.000e+063.29Threonine--tRNA ligase 1, cytoplasmic OS=Bos tauru... [more]
sp|Q9D0R2|SYTC_MOUSE0.000e+062.56Threonine--tRNA ligase 1, cytoplasmic OS=Mus muscu... [more]
sp|Q5XHY5|SYTC_RAT0.000e+062.85Threonine--tRNA ligase 1, cytoplasmic OS=Rattus no... [more]
sp|P26639|SYTC_HUMAN0.000e+063.58Threonine--tRNA ligase 1, cytoplasmic OS=Homo sapi... [more]
back to top
BLAST of Threonine--tRNA ligase, cytoplasmic vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
V4CSN30.000e+066.03AA_TRNA_LIGASE_II domain-containing protein OS=Lot... [more]
A0A2C9JJK60.000e+066.22AA_TRNA_LIGASE_II domain-containing protein OS=Bio... [more]
A0A2C9JJI50.000e+066.22AA_TRNA_LIGASE_II domain-containing protein OS=Bio... [more]
A0A2C9JJI70.000e+066.42AA_TRNA_LIGASE_II domain-containing protein OS=Bio... [more]
A0A4E0REG10.000e+064.13Threonyl tRNA synthetase C OS=Fasciola hepatica OX... [more]
back to top
BLAST of Threonine--tRNA ligase, cytoplasmic vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
tars10.000e+062.99threonyl-tRNA synthetase 1 [Source:NCBI gene;Acc:1... [more]
tars30.000e+062.85threonyl-tRNA synthetase 3 [Source:ZFIN;Acc:ZDB-GE... [more]
ENSAMXT00000012886.20.000e+046.21threonine--tRNA ligase, cytoplasmic-like [Source:N... [more]
mrpl392.594e-1225.64mitochondrial ribosomal protein L39 [Source:NCBI g... [more]
mrpl393.105e-1225.64mitochondrial ribosomal protein L39 [Source:NCBI g... [more]
back to top
BLAST of Threonine--tRNA ligase, cytoplasmic vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 1
Match NameE-valueIdentityDescription
tars10.000e+062.26threonyl-tRNA synthetase 1 [Source:ZFIN;Acc:ZDB-GE... [more]
back to top
BLAST of Threonine--tRNA ligase, cytoplasmic vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 2
Match NameE-valueIdentityDescription
THS10.000e+053.75Threonyl-tRNA synthetase; essential cytoplasmic pr... [more]
MST11.593e-12344.29Mitochondrial threonyl-tRNA synthetase; aminoacyla... [more]
back to top
BLAST of Threonine--tRNA ligase, cytoplasmic vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 3
Match NameE-valueIdentityDescription
EDO311930.000e+067.20Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO272791.705e-7568.02Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO311942.272e-1753.52Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Threonine--tRNA ligase, cytoplasmic vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
tars30.000e+062.85threonine--tRNA ligase, cytoplasmic [Source:NCBI g... [more]
tars30.000e+062.85threonine--tRNA ligase, cytoplasmic [Source:NCBI g... [more]
tars10.000e+062.32threonine--tRNA ligase, cytoplasmic [Source:NCBI g... [more]
ENSORLT00000013023.20.000e+046.82threonine--tRNA ligase, cytoplasmic [Source:NCBI g... [more]
ENSORLT00000040837.10.000e+047.33threonine--tRNA ligase, cytoplasmic [Source:NCBI g... [more]
back to top
BLAST of Threonine--tRNA ligase, cytoplasmic vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 3
Match NameE-valueIdentityDescription
SMESG000061707.10.000e+099.71SMESG000061707.1[more]
SMESG000047630.10.000e+045.38SMESG000047630.1[more]
SMESG000067020.11.036e-926.01SMESG000067020.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30015942 ID=SMED30015942|Name=Threonine--tRNA ligase, cytoplasmic|organism=Schmidtea mediterranea sexual|type=transcript|length=2505bp
TTTTTATTACAATTAGTGATATTTCATCATTTTTAAAATAGGTTTATTTA
TTTATTAACTGTTTGGGTAATTTTAGGTTTTCAAAGAATGATTACAAAAC
CAGAATTTATTGAAAAAAGAATAAAGTTATGGGATGAATGGAAAAAGGAA
TATGACGAATTTGTTGAAAAGCAAGAAAGAAAAGAAATTACTATTACTTT
GAAAGATGGACAAAATGTTATAGGAAAAGCTTGGGAAACATCTCCATATA
TATGTATGAAAGAAATTTGCCAAAGTGTTGCAGATAATGCAGTTATCGCC
AAAGTTAATGGAGTACTGTGGGATCTTGATAGACCATTAGAAAATGATTC
CTCTCTAGAACTTCTGAATTTTGACAGTAAAGATGGTGAATATGTATTCT
GGCATTCGTCTGCGCATATTCTCGGCGAAGTCATGGAATTGGAATATGCA
GGTCATTTGTGCTACGGACCTCCAATTGAAGAAGGGTTTTATTATGATAT
GTTTTTAAAAGATCGTCAAGTTAAACCAGAAGAATATAAAACTCTTGATG
AAAAATGTAAAAAAATTGTTAAAGAGAAACAAAAATTTGAAAGATTAGAA
GTTTCTATCGACAGATTGCTAGAAATGTTTGATTACAATGAATTTAAATG
TAGAATTTTGAAAGAACGAGTTAAAACCGATAAAACAACAATTTATCGTT
GTGGAGATTTAATAGATTTATGTCAAGGTCCTCATGTACGTAATACGGGT
AAAGTTAAAGCATTATCTGTTATTAAAAATAGTGCTTCTTACTGGGAAGG
TGATGCAACAAGAGAATCTTTGCAAAGGATATATGGAATTTCATTTCCAG
ATCCCAAACAGATGAAAGAATGGAAAACTATTCAAGAGGAAGCTGCTAAA
AGAGATCATCGCAAAATTGGCACAAAACAACAGTTATTCATGTTCCATGA
ATTATCTCCTGGATCATGTTTTTTCCTCCCGAAAGGAACAGTGATTTATA
ATAAATTAGTTGATTTTATGAAAGAACAATACTGGACTCGAGGCTTTACC
GAAGTAATTAGTCCTAATTTATATAATTCCAAATTATGGGAAACGAGTGG
TCATTGGGAGCATTATAAGGAAAATATGTTTCAAACCGAAATTGAAAAGT
GCAAGTTTGCAATGAAACCAATGAATTGTCCTGGTCATTGTTTAATGTTC
GGATCGACTATAAGATCGTATAGAGATCTACCAATAAGATTAGCTGATTT
CGGAGTTCTCCATCGCAATGAAGCGTCAGGTGCATTGACAGGACTCACTC
GTGTTCGTCGGTTTCAACAAGATGATGCCCACATCTTTTGTCGTGAAGAT
CAGATTACAAAAGAAATTGAATCGTGTCTCGATTTTTTGGATTATACATA
TAGAGTTTTTGGGTTTGATTTCCAATTGAAATTATCAACGAGACCAGAGA
AATTCCTCGGAGAAATTTCCATGTGGGATAAAGCTGAAGCTCAACTTACC
GACGCTTTAAATAATTTCGGTAAAAAATGGGAGCTAAATCCGGCAGATGG
AGCATTTTACGGACCTAAAATCGATATTACTATCACCGATGCTCTGAGAC
GTCATCACCAATGTGCAACTATTCAATTGGATTTCCAACTTCCAATAAGA
TTCTCCTTGGAATATATGACAGATTCTGCTGCTCAACGCGAAGGAGATTC
GAAAATTACTCTGGCTCGTCCAGTAATAATCCATCGAGCTATTCTTGGAT
CAGTTGAGCGCATGTTTGCTATTTTGGCTGAAAATTACGGCGGTAAATGG
CCTTTCTGGTTGAGTCCGTTTCAAGCTATCGTAATTCCATTCAATCCCTC
GTGTGACGAATACGCCCTGTCGATACAGAAGGCTGTCCACGATGCCGGTT
TCCATGTCGATATCGATTTGGACACTAAAAGCATTTTTAACAAGAAGATC
TCAAAAGCTCAAGAAGCCCAATACAATTTCATGTTGGTCGTCGGTAAAAA
GGAAGTCGAGAATAAAACGGTCAACATTAGAACGCGTGATAACAAAGTTC
ACGGGGAACGTTCGATCGAGAAAGTCATTGAGAGATTCCGGGAATTGGAG
ACGAGCCGTGCTTCTGATAACCAGTTTGAGTTTTAGTGAAAATTTTTTGG
TTTAAACACGGATTCGATAAAAACGCGTTTAATTAACTTATTTTACATTT
ATTTATTATTAATTTTTTTGAGATTTGTTGTATTTTTCTATACTATTCGT
TTCGCGAGCATTTGTATTAATATTGAGCAGGAATTACTCAATCCGACACA
TTAAATGCGGTTATTTTGTGTTTAAATTTCAGGTCTTTAATTTTTATCGC
GTAGCACAAATGAGATTCTCAACTCTCTTACCATTTGCCCCTTAGTTATT
ATTAACGATGAAAATTAAACTGTCGTGAAATTTAAACAAAATAACCGGTT
TAAAACATAATTTCAAGCTTGGTGCTTATTTTTTACCACTATTTTTAAAA
CTTAC
back to top

protein sequence of SMED30015942-orf-1

>SMED30015942-orf-1 ID=SMED30015942-orf-1|Name=SMED30015942-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=683bp
MITKPEFIEKRIKLWDEWKKEYDEFVEKQERKEITITLKDGQNVIGKAWE
TSPYICMKEICQSVADNAVIAKVNGVLWDLDRPLENDSSLELLNFDSKDG
EYVFWHSSAHILGEVMELEYAGHLCYGPPIEEGFYYDMFLKDRQVKPEEY
KTLDEKCKKIVKEKQKFERLEVSIDRLLEMFDYNEFKCRILKERVKTDKT
TIYRCGDLIDLCQGPHVRNTGKVKALSVIKNSASYWEGDATRESLQRIYG
ISFPDPKQMKEWKTIQEEAAKRDHRKIGTKQQLFMFHELSPGSCFFLPKG
TVIYNKLVDFMKEQYWTRGFTEVISPNLYNSKLWETSGHWEHYKENMFQT
EIEKCKFAMKPMNCPGHCLMFGSTIRSYRDLPIRLADFGVLHRNEASGAL
TGLTRVRRFQQDDAHIFCREDQITKEIESCLDFLDYTYRVFGFDFQLKLS
TRPEKFLGEISMWDKAEAQLTDALNNFGKKWELNPADGAFYGPKIDITIT
DALRRHHQCATIQLDFQLPIRFSLEYMTDSAAQREGDSKITLARPVIIHR
AILGSVERMFAILAENYGGKWPFWLSPFQAIVIPFNPSCDEYALSIQKAV
HDAGFHVDIDLDTKSIFNKKISKAQEAQYNFMLVVGKKEVENKTVNIRTR
DNKVHGERSIEKVIERFRELETSRASDNQFEF*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000028Category 2 cell
PLANA:0000099neuron
PLANA:0002032epidermal cell
Vocabulary: INTERPRO
TermDefinition
IPR036621Anticodon-bd_dom_sf
IPR033728ThrRS_core
IPR002320Thr-tRNA-ligase_IIa
IPR012947tRNA_SAD
IPR002314aa-tRNA-synt_IIb
IPR004154Anticodon-bd
IPR004095TGS
IPR012675Beta-grasp_dom_sf
IPR006195aa-tRNA-synth_II
IPR012676TGS-like
IPR018163Thr/Ala-tRNA-synth_IIc_edit
Vocabulary: cellular component
TermDefinition
GO:0005737cytoplasm
Vocabulary: biological process
TermDefinition
GO:0006435threonyl-tRNA aminoacylation
GO:0043039tRNA aminoacylation
GO:0006418tRNA aminoacylation for protein translation
Vocabulary: molecular function
TermDefinition
GO:0004829threonine-tRNA ligase activity
GO:0005524ATP binding
GO:0016876ligase activity, forming aminoacyl-tRNA and related compounds
GO:0000166nucleotide binding
GO:0004812aminoacyl-tRNA ligase activity
GO:0016874ligase activity
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
NoneNo IPR availableCOILSCoilCoilcoord: 150..180
NoneNo IPR availableGENE3DG3DSA:3.30.980.10coord: 97..252
e-value: 4.7E-52
score: 178.1
NoneNo IPR availableGENE3DG3DSA:3.30.930.10coord: 253..569
e-value: 8.9E-140
score: 467.4
NoneNo IPR availablePANTHERPTHR11451:SF38THREONINE--TRNA LIGASE 2, CYTOPLASMIC-RELATEDcoord: 3..679
NoneNo IPR availablePROSITEPS51880TGScoord: 32..94
score: 14.1
NoneNo IPR availableCDDcd01667TGS_ThrRScoord: 34..99
e-value: 5.60929E-18
score: 76.3725
NoneNo IPR availableCDDcd00860ThrRS_anticodoncoord: 577..668
e-value: 1.37204E-30
score: 112.982
NoneNo IPR availableSUPERFAMILYSSF55681Class II aaRS and biotin synthetasescoord: 273..563
NoneNo IPR availableSUPERFAMILYSSF52954Class II aaRS ABD-relatedcoord: 565..670
IPR002320Threonine-tRNA ligase, class IIaPRINTSPR01047TRNASYNTHTHRcoord: 392..415
score: 70.39
coord: 493..521
score: 58.25
coord: 359..387
score: 55.67
coord: 572..584
score: 59.07
coord: 545..558
score: 71.43
IPR002320Threonine-tRNA ligase, class IIaTIGRFAMTIGR00418TIGR00418coord: 105..669
e-value: 1.9E-195
score: 649.0
IPR002320Threonine-tRNA ligase, class IIaPANTHERPTHR11451TRNA SYNTHETASE-RELATEDcoord: 3..679
IPR012947Threonyl/alanyl tRNA synthetase, SADSMARTSM00863tRNA_SAD_4coord: 200..249
e-value: 5.7E-18
score: 75.7
IPR012947Threonyl/alanyl tRNA synthetase, SADPFAMPF07973tRNA_SADcoord: 201..249
e-value: 2.4E-11
score: 43.5
IPR036621Anticodon-binding domain superfamilyGENE3DG3DSA:3.40.50.800coord: 570..682
e-value: 2.9E-38
score: 132.6
IPR004154Anticodon-bindingPFAMPF03129HGTP_anticodoncoord: 579..669
e-value: 2.7E-20
score: 72.3
IPR002314Aminoacyl-tRNA synthetase, class II (G/ P/ S/T)PFAMPF00587tRNA-synt_2bcoord: 354..567
e-value: 4.2E-32
score: 111.5
IPR012675Beta-grasp domain superfamilyGENE3DG3DSA:3.10.20.30coord: 32..93
e-value: 1.5E-24
score: 88.0
IPR004095TGSPFAMPF02824TGScoord: 34..93
e-value: 4.3E-9
score: 36.3
IPR006195Aminoacyl-tRNA synthetase, class IIPROSITEPS50862AA_TRNA_LIGASE_IIcoord: 303..572
score: 21.995
IPR033728Threonine-tRNA ligase catalytic core domainCDDcd00771ThrRS_corecoord: 272..577
e-value: 3.43353E-175
score: 499.384
IPR012676TGS-likeSUPERFAMILYSSF81271TGS-likecoord: 34..94
IPR018163Threonyl/alanyl tRNA synthetase, class II-like, putative editing domain superfamilySUPERFAMILYSSF55186ThrRS/AlaRS common domaincoord: 96..271