C2H2-type domain-containing protein

Overview
NameC2H2-type domain-containing protein
Smed IDSMED30015938
Length (bp)1220
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of C2H2-type domain-containing protein (SMED30015938) t-SNE clustered cells

Violin plots show distribution of expression levels for C2H2-type domain-containing protein (SMED30015938) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of C2H2-type domain-containing protein (SMED30015938) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for C2H2-type domain-containing protein (SMED30015938) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30015938

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 4

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
muscle cellSMED30015938h1SMcG0002116 dd_Smed_v4_1345_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
neoblastSMED30015938h1SMcG0002116 dd_Smed_v4_1345_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30015938h1SMcG0002116 Contig42703uc_Smed_v2PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30015938h1SMcG0002116 Contig42703newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of C2H2-type domain-containing protein vs. Ensembl Human
Match: ZNF622 (zinc finger protein 622 [Source:HGNC Symbol;Acc:HGNC:30958])

HSP 1 Score: 93.9745 bits (232), Expect = 3.126e-20
Identity = 55/164 (33.54%), Postives = 89/164 (54.27%), Query Frame = 2
Query:  374 AIIPLTIIDCLFCKSSSKTIERNLNHMTNEHHFNLPYLDYISDLEGLIEYLVCLIDEYHVCLQCN---KQFDDRQAVRNHMSHMNHMQLFFNLESNGD------DLSDYYANLP--KQVSDMNKLS----------DSMGIEAVLPNGKKIGNRKMNIYFNQNL 802
              IP+T  DCLFC   S ++ +N+ HMT +H F +P ++Y+SD++GLI+YL   +    +CL CN   K F   +AV+ HM+  +H +LF    ++GD      D  D+ ++ P  K+  D NK            D   +E +LP+G ++G+R +  Y+ Q  
Sbjct:  247 GAIPIT--DCLFCSHHSSSLMKNVAHMTKDHSFFIPDIEYLSDIKGLIKYLGEKVGVGKICLWCNEKGKSFYSTEAVQAHMNDKSHCKLF----TDGDAALEFADFYDFRSSYPDHKEGEDPNKAEELPSEKNLEYDDETMELILPSGARVGHRSLMRYYKQRF 404          

HSP 2 Score: 58.151 bits (139), Expect = 1.593e-8
Identity = 28/98 (28.57%), Postives = 54/98 (55.10%), Query Frame = 2
Query:   50 CLVCKI---ESDDLLSHCKTEWHTYNLRRETFGLNVLSLEDFKTK-QNELILKNKVEIQKDYFC--CNKVFKSSKTYENHLNSKKHLQNSTNSIDTVD 325
            C+ C++   ++D   +H KT+WH YNLRR+   +  ++ E F+ + + +  +  +       +C  C+K F S   YENHL S++H++    ++  V+
Sbjct:    6 CITCRVAFRDADMQRAHYKTDWHRYNLRRKVASMAPVTAEGFQERVRAQRAVAEEESKGSATYCTVCSKKFASFNAYENHLKSRRHVELEKKAVQAVN 103          
BLAST of C2H2-type domain-containing protein vs. Ensembl Celegans
Match: C16A3.4 (pep chromosome:WBcel235:III:6381634:6383024:1 gene:WBGene00015809.1 transcript:C16A3.4.2 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:C16A3.4)

HSP 1 Score: 101.293 bits (251), Expect = 1.463e-23
Identity = 93/358 (25.98%), Postives = 145/358 (40.50%), Query Frame = 2
Query:   50 CLVCKI--ESDDL-LSHCKTEWHTYNLRRETFGLNVLSLEDFKTK-----QNELILKNKVEIQKDYFC--CNKVFKSSKTYENHLNSKKHLQNSTNSIDTV-----------------------DEDEIIEYTSGSDLEETAII--------PLTIIDCLFCKSSSKTIERNLNHMTNEHHFNLPYLDYISDLEGLIEYLVCLIDEYHVCLQC---NKQFDDRQAVRNHMSHMNHMQLFFNLES--NGDDLSDYYANLPKQVSDMNKLSDSMGIEAVLPNGKKIGNRKMNIYFNQNLTAVSSGDRFAIMSGPEKARMSLIAAGKYGQVADKSLLTPKEKKYKTLEARYIQLRKSRFSN 985
            C+ C++  E+ +L   H KTEWH YNL+R+   L  + +E F  K       + ++   VE     +C  C K  KS     +H+ SKKH +N     D V                        E++  + +SG + ++             L +  CLFC  +   ++    HM   H F LP   Y+SD  G + YL   +     C+ C     +++  Q+ + HM    H +L  + ES    DD  DY         D ++L D  G    LP+G KIG+R ++ YF Q L  V    R    +  +KA+    A    G     +    ++ K+     R   LR +  SN
Sbjct:    9 CVTCRVVFETAELQRDHYKTEWHRYNLKRQAAELPAIGIELFNEKAASFNPTKPVVAASVEP---LYCKACRKSIKSENAMTDHVASKKHKENEKKIEDDVKKGPKQPRKKPENLPKKPESLKEPENDEDDDSSGWETDDEEEGVEELNEDDALPVTSCLFCPQTKPNMDEMRTHMNFHHGFQLPDRQYLSDELGCLSYLGLKVGAGRCCIFCPDVKARYESVQSCQQHMRDKQHCKLRRDPESMIELDDYYDYSPMYDGDDQDKSELFDD-GWSLTLPSGAKIGHRNLHRYFKQYLRPVDGTQRLVSRAALDKAKGFYPALAWTGTTTVAAKKVARDMKFVERFRRRFDLRVAVKSN 362          
BLAST of C2H2-type domain-containing protein vs. Ensembl Celegans
Match: C16A3.4 (pep chromosome:WBcel235:III:6381634:6382996:1 gene:WBGene00015809.1 transcript:C16A3.4.1 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:C16A3.4)

HSP 1 Score: 101.293 bits (251), Expect = 1.463e-23
Identity = 93/358 (25.98%), Postives = 145/358 (40.50%), Query Frame = 2
Query:   50 CLVCKI--ESDDL-LSHCKTEWHTYNLRRETFGLNVLSLEDFKTK-----QNELILKNKVEIQKDYFC--CNKVFKSSKTYENHLNSKKHLQNSTNSIDTV-----------------------DEDEIIEYTSGSDLEETAII--------PLTIIDCLFCKSSSKTIERNLNHMTNEHHFNLPYLDYISDLEGLIEYLVCLIDEYHVCLQC---NKQFDDRQAVRNHMSHMNHMQLFFNLES--NGDDLSDYYANLPKQVSDMNKLSDSMGIEAVLPNGKKIGNRKMNIYFNQNLTAVSSGDRFAIMSGPEKARMSLIAAGKYGQVADKSLLTPKEKKYKTLEARYIQLRKSRFSN 985
            C+ C++  E+ +L   H KTEWH YNL+R+   L  + +E F  K       + ++   VE     +C  C K  KS     +H+ SKKH +N     D V                        E++  + +SG + ++             L +  CLFC  +   ++    HM   H F LP   Y+SD  G + YL   +     C+ C     +++  Q+ + HM    H +L  + ES    DD  DY         D ++L D  G    LP+G KIG+R ++ YF Q L  V    R    +  +KA+    A    G     +    ++ K+     R   LR +  SN
Sbjct:    9 CVTCRVVFETAELQRDHYKTEWHRYNLKRQAAELPAIGIELFNEKAASFNPTKPVVAASVEP---LYCKACRKSIKSENAMTDHVASKKHKENEKKIEDDVKKGPKQPRKKPENLPKKPESLKEPENDEDDDSSGWETDDEEEGVEELNEDDALPVTSCLFCPQTKPNMDEMRTHMNFHHGFQLPDRQYLSDELGCLSYLGLKVGAGRCCIFCPDVKARYESVQSCQQHMRDKQHCKLRRDPESMIELDDYYDYSPMYDGDDQDKSELFDD-GWSLTLPSGAKIGHRNLHRYFKQYLRPVDGTQRLVSRAALDKAKGFYPALAWTGTTTVAAKKVARDMKFVERFRRRFDLRVAVKSN 362          
BLAST of C2H2-type domain-containing protein vs. Ensembl Fly
Match: CG6769 (gene:FBgn0030878 transcript:FBtr0334034)

HSP 1 Score: 88.5817 bits (218), Expect = 6.936e-19
Identity = 65/228 (28.51%), Postives = 104/228 (45.61%), Query Frame = 2
Query:  383 PLTIIDCLFCKSSSKTIERNLNHMTNEHHFNLPYLDYISDLEGLIEYLVCLIDEYHVCLQCN---KQFDDRQAVRNHMSHMNHMQLFFNLESNGD--DLSDYYANLPKQVSDMN-------KLSDSMGIEAVLPNGKKIGNRKMNIYFNQNLTAVSSGDRFAIMSGPEKARMSLIAAGKYGQVADKSLLTPKEKK----YKTLEARYIQLRKSRFSNFQQHFRAQILM 1018
            PLT  DCLFC  +S+ +  NL HM+  H F +P  +Y +D+EGL+ YL   +  Y +CL CN   K F    AVR HM    H Q+     +  +  +  DY ++ P     M+        L D    + VLP+G  IG+R +  Y+ Q L    +     I     K    L      G    + L   ++ +     K +++++      + +  Q+H+RAQ+L+
Sbjct:  185 PLTERDCLFCTHASEDLVENLKHMSVAHSFFIPDTEYCTDIEGLLYYLGEKVANYFICLFCNDRGKTFYSLDAVRKHMIDKGHCQMLHEGVALAEYAEYYDYSSSYPDNNEGMDIDEEVVPDLLDGDEYQLVLPSGAVIGHRSLLRYYKQRLRPERA---VVIKKSDRKLHRVLSEYRALGWTQTQQLSAARKARDIHLMKRVQSKWQMKLGCKANKLQKHYRAQVLI 409          

HSP 2 Score: 49.2914 bits (116), Expect = 3.503e-6
Identity = 34/125 (27.20%), Postives = 61/125 (48.80%), Query Frame = 2
Query:   50 CLVC--KIESDDL-LSHCKTEWHTYNLRRETFGLNVLSLEDFKTKQNELILKNKVEIQK---DYFC--CNKVFKSSKTYENHLNSKKHLQNSTNSIDTVDEDEIIEYTSGSDLEETAIIPLTIID 400
            CL C  +  S D+  +H KT+WH YNL+R    L  ++ E+F+ +           +++     +C  C + F S K ++NHLNS+KH       +    E E +  + GS    T++   ++++
Sbjct:    6 CLNCDARFASADVQRNHYKTDWHRYNLKRRVAQLPPVTAEEFQQRVLSARSATDAALEEQNLSVYCHACRRQFASQKAHDNHLNSRKH-----KELLARFEREQMTASGGSASTATSVCTRSVVE 125          
BLAST of C2H2-type domain-containing protein vs. Ensembl Fly
Match: CG6769 (gene:FBgn0030878 transcript:FBtr0074493)

HSP 1 Score: 88.5817 bits (218), Expect = 6.936e-19
Identity = 65/228 (28.51%), Postives = 104/228 (45.61%), Query Frame = 2
Query:  383 PLTIIDCLFCKSSSKTIERNLNHMTNEHHFNLPYLDYISDLEGLIEYLVCLIDEYHVCLQCN---KQFDDRQAVRNHMSHMNHMQLFFNLESNGD--DLSDYYANLPKQVSDMN-------KLSDSMGIEAVLPNGKKIGNRKMNIYFNQNLTAVSSGDRFAIMSGPEKARMSLIAAGKYGQVADKSLLTPKEKK----YKTLEARYIQLRKSRFSNFQQHFRAQILM 1018
            PLT  DCLFC  +S+ +  NL HM+  H F +P  +Y +D+EGL+ YL   +  Y +CL CN   K F    AVR HM    H Q+     +  +  +  DY ++ P     M+        L D    + VLP+G  IG+R +  Y+ Q L    +     I     K    L      G    + L   ++ +     K +++++      + +  Q+H+RAQ+L+
Sbjct:  185 PLTERDCLFCTHASEDLVENLKHMSVAHSFFIPDTEYCTDIEGLLYYLGEKVANYFICLFCNDRGKTFYSLDAVRKHMIDKGHCQMLHEGVALAEYAEYYDYSSSYPDNNEGMDIDEEVVPDLLDGDEYQLVLPSGAVIGHRSLLRYYKQRLRPERA---VVIKKSDRKLHRVLSEYRALGWTQTQQLSAARKARDIHLMKRVQSKWQMKLGCKANKLQKHYRAQVLI 409          

HSP 2 Score: 49.2914 bits (116), Expect = 3.503e-6
Identity = 34/125 (27.20%), Postives = 61/125 (48.80%), Query Frame = 2
Query:   50 CLVC--KIESDDL-LSHCKTEWHTYNLRRETFGLNVLSLEDFKTKQNELILKNKVEIQK---DYFC--CNKVFKSSKTYENHLNSKKHLQNSTNSIDTVDEDEIIEYTSGSDLEETAIIPLTIID 400
            CL C  +  S D+  +H KT+WH YNL+R    L  ++ E+F+ +           +++     +C  C + F S K ++NHLNS+KH       +    E E +  + GS    T++   ++++
Sbjct:    6 CLNCDARFASADVQRNHYKTDWHRYNLKRRVAQLPPVTAEEFQQRVLSARSATDAALEEQNLSVYCHACRRQFASQKAHDNHLNSRKH-----KELLARFEREQMTASGGSASTATSVCTRSVVE 125          
BLAST of C2H2-type domain-containing protein vs. Ensembl Zebrafish
Match: znf622 (zinc finger protein 622 [Source:ZFIN;Acc:ZDB-GENE-050927-1])

HSP 1 Score: 97.8265 bits (242), Expect = 7.799e-22
Identity = 76/257 (29.57%), Postives = 123/257 (47.86%), Query Frame = 2
Query:  347 TSGSDLEETAIIPLTIIDCLFCKSSSKTIERNLNHMTNEHHFNLPYLDYISDLEGLIEYLVCLIDEYHVCLQCN---KQFDDRQAVRNHMSHMNHMQLFFNLESNGD------DLSDYYANLPKQVSDMN------KLSDSMGI-------EAVLPNGKKIGNRKMNIYFNQNLTAVSSGDRFAIMSGPEKARMSLIAAGKY-GQVAD--KSLLTPKEKKYKTLEARYIQLRKSRF---------SNFQQHFRAQIL 1015
            TSG+ L   +I   T+ DCLFC   S ++ RN+ HMT  H F +P ++Y+ DL GL+ YL   +    VCL CN   K F   +AV+ HM+  +H +LF    ++GD      D  D+ ++ P     ++      +L D   +       E  LP+G KIG+R +  Y+ Q         R  + +  +KA   ++   K  G   D  K  ++ ++K     + +Y+Q  KS++         +  Q HFRAQ++
Sbjct:  212 TSGAALAPGSI---TVTDCLFCGHHSHSLSRNVTHMTKTHSFFIPDIEYLVDLRGLMSYLGEKVGVGKVCLWCNEKGKSFYSTEAVQAHMTDKSHCKLF----TDGDAALEFADFYDFRSSYPDAKDGVDVEMKDGELPDDKTVEFDDETLELTLPSGAKIGHRSLMRYYKQRFGV----QRALVPAHNQKAVGRVLKQYKALGWTGDFGKGFVSQQQK-----DMQYVQRMKSKWMLRTGMGNNATKQTHFRAQVM 452          

HSP 2 Score: 55.0694 bits (131), Expect = 7.185e-8
Identity = 30/106 (28.30%), Postives = 52/106 (49.06%), Query Frame = 2
Query:   50 CLVCKIESDD---LLSHCKTEWHTYNLRRETFGLNVLSLEDFKTKQNELILKNKVEIQKD--------YFC--CNKVFKSSKTYENHLNSKKHLQNSTNSIDTVDE 328
            C+ C+++  D     +H KT+WH YNL+R+   +  ++ E+F+    E +L  +   ++          +C  CNK F +   Y NH+ S KH Q    ++ T  E
Sbjct:    5 CISCRVQFSDGEVQRAHYKTDWHRYNLKRKVADMPPVTAENFQ----ERVLAQRAAAEQQSQGGGHDVAYCATCNKKFSTDNAYTNHIQSNKHQQAEKKALATAQE 106          
BLAST of C2H2-type domain-containing protein vs. Ensembl Xenopus
Match: bsg (basigin (Ok blood group) [Source:Xenbase;Acc:XB-GENE-5901795])

HSP 1 Score: 93.2041 bits (230), Expect = 5.005e-20
Identity = 73/273 (26.74%), Postives = 124/273 (45.42%), Query Frame = 2
Query:  287 HLQNSTNSIDTVDEDEIIEYTSGSDLEETAIIPLTIIDCLFCKSSSKTIERNLNHMTNEHHFNLPYLDYISDLEGLIEYLVCLIDEYHVCLQCN---KQFDDRQAVRNHMSHMNHMQLFFNLESNGD------DLSDYYANLP------------KQVSDMNKLSDSMGIEAVLPNGKKIGNRKMNIYFNQNLTAVSSGDRFAIMSGPEKARMSLIAAGK-YGQVADKSLLTPKEKKYKTLEARYIQLRKSRF---------SNFQQHFRAQI 1012
            H+  +     T +E E+              IP+T  DCLFC   S+++ +N+ HMT  H F +P ++Y+ DL GLI YL   +    +CL CN   K F   ++V+ HM+  +H +LF    ++GD      D  D+ ++ P            ++ SD N   D   +E +LP+G +IG+R +  Y+ Q         R  ++   +KA   L+   K  G       +  +E+     + +Y+Q  KS++         +  Q H+R Q+
Sbjct:  217 HMDGAEGEAITANESEL----------PVGTIPVT--DCLFCSHHSRSLVKNVAHMTKVHSFFIPDIEYLQDLHGLIRYLGEKVGVGKICLWCNEKGKSFYSTESVQAHMNDKSHCKLF----TDGDAALEFADFYDFRSSYPNHKEGEDIEMTEREESDKNLEYDEDTMELILPSGSRIGHRSLMRYYKQKFGIT----REVVVYKNQKAVGRLLQQYKALGWTGGTGSVVQRER-----DMQYVQRMKSKWMLKTGISNNATKQMHYRPQV 464          

HSP 2 Score: 59.3066 bits (142), Expect = 6.007e-9
Identity = 31/97 (31.96%), Postives = 51/97 (52.58%), Query Frame = 2
Query:   50 CLVCKI---ESDDLLSHCKTEWHTYNLRRETFGLNVLSLEDFKTK---QNELILKNKVEIQKDYFCCNKVFKSSKTYENHLNSKKHLQNSTNSIDTV 322
            C+ C++   + D   +H KT+WH YNL+R+   +  ++ E+F+ +   Q  ++ +   E       C+K F S   YENHL SKKHL     + D +
Sbjct:    6 CISCRVAFADPDIQRAHYKTDWHRYNLKRKVADMPPVTAENFQERVLAQRAVVEEQSKETATYCTACSKRFASFNAYENHLKSKKHLDLEKKATDAI 102          
BLAST of C2H2-type domain-containing protein vs. Ensembl Mouse
Match: Zfp622 (zinc finger protein 622 [Source:MGI Symbol;Acc:MGI:1289282])

HSP 1 Score: 96.2857 bits (238), Expect = 3.412e-21
Identity = 76/270 (28.15%), Postives = 127/270 (47.04%), Query Frame = 2
Query:  314 DTVDEDEIIEYTSGSDLEETAIIPLTIIDCLFCKSSSKTIERNLNHMTNEHHFNLPYLDYISDLEGLIEYLVCLIDEYHVCLQCN---KQFDDRQAVRNHMSHMNHMQLFFNLESNGD------DLSDYYANLP-----KQVSDMNKLS-------DSMGIEAVLPNGKKIGNRKMNIYFNQNLTAVSSGDRFAIMSGPEKARMSLIAAGKY-------GQVADKSLLTPKEKKYKTLEARYIQLRKSRF---------SNFQQHFRAQI 1012
            D   ED+  E  +  +      IP+T  DCLFC   S ++ +N+ HMT  H F +P ++Y+SDL+GLI+YL   +    +CL CN   K F   +AV+ HM+  +H +LF    ++GD      D  D+ ++ P     +  +++  LS       D   +E +LP+G ++G+R +  Y+ Q         RF +      AR +  A G+        G +        +E+     + +Y+Q  KS++         +  Q HFRAQ+
Sbjct:  226 DPGVEDQDAEDAAAEESPPLGAIPIT--DCLFCSHHSSSLVKNVAHMTKVHSFFIPDIEYLSDLKGLIKYLGEKVGVGKICLWCNEKGKSFYSTEAVQAHMNDKSHCKLF----TDGDAALEFADFYDFRSSYPDYKEGQDPAELEALSTDKILECDDETMELILPSGARVGHRSLMRYYKQ---------RFGLPRAVTVAR-NQKAVGRVLQQYRALGWMGSTGAALMRER-----DMQYVQRMKSKWMLKIGMKNNATKQMHFRAQV 474          

HSP 2 Score: 55.8398 bits (133), Expect = 5.406e-8
Identity = 28/90 (31.11%), Postives = 47/90 (52.22%), Query Frame = 2
Query:   50 CLVCKIESDDL---LSHCKTEWHTYNLRRETFGLNVLSLEDFKTK-QNELILKNKVEIQKDY--FC--CNKVFKSSKTYENHLNSKKHLQ 295
            C+ C++   D     +H KT+WH YNLRR+   +  ++ E F+ + + +  +    E  K    +C  C K F +   YENHL S++H +
Sbjct:    6 CITCRVAFRDAELQRAHYKTDWHRYNLRRKVAAMAPVTAEGFQERVRAQRAVAEAAEASKGAATYCTACGKKFATFNAYENHLGSRRHAE 95          
BLAST of C2H2-type domain-containing protein vs. Ensembl Mouse
Match: Zfp622 (zinc finger protein 622 [Source:MGI Symbol;Acc:MGI:1289282])

HSP 1 Score: 80.4925 bits (197), Expect = 7.439e-17
Identity = 69/258 (26.74%), Postives = 118/258 (45.74%), Query Frame = 2
Query:  326 EDEIIEYTSGSDLEETAIIPLTIIDCLFCKSSSKTIERNLNHMTNEHHFNLPYLDYISDLEGLIEYLVCLIDEYHVCLQCNKQFDDRQAVRNHMSHMNHMQLFFNLESNGD------DLSDYYANLP-----KQVSDMNKLS-------DSMGIEAVLPNGKKIGNRKMNIYFNQNLTAVSSGDRFAIMSGPEKARMSLIAAGKYGQV--ADKSLLTPKEKKYKTLEARYIQLRKSRF---------SNFQQHFRAQI 1012
            ED+  E  +  +      IP+T  DCLFC   S ++ +N+ HMT  H F +P ++Y+SDL+GLI+YL                    +AV+ HM+  +H +LF    ++GD      D  D+ ++ P     +  +++  LS       D   +E +LP+G ++G+R +  Y+ Q         RF +      AR +  A G+  Q   A   + +      +  + +Y+Q  KS++         +  Q HFRAQ+
Sbjct:   20 EDQDAEDAAAEESPPLGAIPIT--DCLFCSHHSSSLVKNVAHMTKVHSFFIPDIEYLSDLKGLIKYL--------------------EAVQAHMNDKSHCKLF----TDGDAALEFADFYDFRSSYPDYKEGQDPAELEALSTDKILECDDETMELILPSGARVGHRSLMRYYKQ---------RFGLPRAVTVAR-NQKAVGRVLQQYRALGWMGSTGAALMRERDMQYVQRMKSKWMLKIGMKNNATKQMHFRAQV 241          
BLAST of C2H2-type domain-containing protein vs. UniProt/SwissProt
Match: sp|Q06709|REH1_YEAST (Cytoplasmic 60S subunit biogenesis factor REH1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=REH1 PE=1 SV=1)

HSP 1 Score: 97.8265 bits (242), Expect = 5.790e-21
Identity = 106/439 (24.15%), Postives = 170/439 (38.72%), Query Frame = 2
Query:   50 CLVCKIESDDLLS-HCKTEWHTYNLRRETFGLNVLSLEDFKTKQNELILKNKVEIQKDYF-------CCNKVFKSSKTYENHLNSKKHLQNSTNSIDTVD-------------------------------------EDEIIEY--TSGSDLE--------ETAIIP-------LTIIDCLFCKSSSKTIERNLNHMTNEHHFNLPYLDYISDLEGLIEYLVCLIDEYHVCLQCNKQFDDRQAVRNHMSHMNHMQLFFNLESNGDDLSDYY----------ANLPKQVSDMNKLS----------------------------------DSMGIEAVLPNGKKIGNRKMNIYFNQNLTAVSSGDRFAIMSGPEKARMSLIAAGKYGQVADKSLLTP-KEKKYKTLEARYIQLRKSRFS----------NFQQHFRAQIL 1015
            C V + ++ DL   H KTEWH YNL+R    L  +  E F  K  ++  K + E Q D F         N+     +  +  + SK+  +  TN +   D                                     ED + EY  TS S+ E        + A  P       +TI +C++C   +K +ERN+ HM +EH   +P   Y+ DL GL+E+L+ +I   H CL CN      +++R HM+   H +L +  +      + +Y           NL    +  +KLS                                  D  G+E  LP G ++G+R    Y+ QNL +            P ++R ++ A       AD+ +++   EK+YK    +  QL K+  +          NFQ H+R ++L
Sbjct:   10 CCVIQFKTSDLQRYHMKTEWHRYNLKRRIANLPPIGAEQFAEKL-QISEKEQAENQVDEFGFPVLKPVMNQSNALPQKQKKPIKSKRGRKVGTNLLKRKDRDIAKEKQNRSVSPSGSISSQLSNLTVGTENTNTDYGEDTVSEYGFTSDSNYEYATSDEELDIADKPSDKENEKITITECIYCGKDNKEVERNVKHMFSEHGLFIPERSYLIDLNGLLEFLIKMIVIDHNCLCCNFHGSGLESIRAHMASKRHCRLPYETKEERQLFAPFYDFTYDDHSISKNLQNDRAITSKLSSVYGAKNDEEDGEVDITLVSSENDINANYTTVSIDESGLELTLPTGARLGHRAGQRYYRQNLPS---------QPNPNESRRTITA-------ADRRMVSGVTEKQYKKGMKKMQQLEKNAINTQIRREIKRVNFQTHYRDELL 431          
BLAST of C2H2-type domain-containing protein vs. UniProt/SwissProt
Match: sp|Q91VY9|ZN622_MOUSE (Zinc finger protein 622 OS=Mus musculus OX=10090 GN=Znf622 PE=1 SV=1)

HSP 1 Score: 96.2857 bits (238), Expect = 2.387e-20
Identity = 76/270 (28.15%), Postives = 127/270 (47.04%), Query Frame = 2
Query:  314 DTVDEDEIIEYTSGSDLEETAIIPLTIIDCLFCKSSSKTIERNLNHMTNEHHFNLPYLDYISDLEGLIEYLVCLIDEYHVCLQCN---KQFDDRQAVRNHMSHMNHMQLFFNLESNGD------DLSDYYANLP-----KQVSDMNKLS-------DSMGIEAVLPNGKKIGNRKMNIYFNQNLTAVSSGDRFAIMSGPEKARMSLIAAGKY-------GQVADKSLLTPKEKKYKTLEARYIQLRKSRF---------SNFQQHFRAQI 1012
            D   ED+  E  +  +      IP+T  DCLFC   S ++ +N+ HMT  H F +P ++Y+SDL+GLI+YL   +    +CL CN   K F   +AV+ HM+  +H +LF    ++GD      D  D+ ++ P     +  +++  LS       D   +E +LP+G ++G+R +  Y+ Q         RF +      AR +  A G+        G +        +E+     + +Y+Q  KS++         +  Q HFRAQ+
Sbjct:  226 DPGVEDQDAEDAAAEESPPLGAIPIT--DCLFCSHHSSSLVKNVAHMTKVHSFFIPDIEYLSDLKGLIKYLGEKVGVGKICLWCNEKGKSFYSTEAVQAHMNDKSHCKLF----TDGDAALEFADFYDFRSSYPDYKEGQDPAELEALSTDKILECDDETMELILPSGARVGHRSLMRYYKQ---------RFGLPRAVTVAR-NQKAVGRVLQQYRALGWMGSTGAALMRER-----DMQYVQRMKSKWMLKIGMKNNATKQMHFRAQV 474          

HSP 2 Score: 55.8398 bits (133), Expect = 3.782e-7
Identity = 28/90 (31.11%), Postives = 47/90 (52.22%), Query Frame = 2
Query:   50 CLVCKIESDDL---LSHCKTEWHTYNLRRETFGLNVLSLEDFKTK-QNELILKNKVEIQKDY--FC--CNKVFKSSKTYENHLNSKKHLQ 295
            C+ C++   D     +H KT+WH YNLRR+   +  ++ E F+ + + +  +    E  K    +C  C K F +   YENHL S++H +
Sbjct:    6 CITCRVAFRDAELQRAHYKTDWHRYNLRRKVAAMAPVTAEGFQERVRAQRAVAEAAEASKGAATYCTACGKKFATFNAYENHLGSRRHAE 95          
BLAST of C2H2-type domain-containing protein vs. UniProt/SwissProt
Match: sp|Q969S3|ZN622_HUMAN (Zinc finger protein 622 OS=Homo sapiens OX=9606 GN=ZNF622 PE=1 SV=1)

HSP 1 Score: 93.9745 bits (232), Expect = 1.501e-19
Identity = 55/164 (33.54%), Postives = 89/164 (54.27%), Query Frame = 2
Query:  374 AIIPLTIIDCLFCKSSSKTIERNLNHMTNEHHFNLPYLDYISDLEGLIEYLVCLIDEYHVCLQCN---KQFDDRQAVRNHMSHMNHMQLFFNLESNGD------DLSDYYANLP--KQVSDMNKLS----------DSMGIEAVLPNGKKIGNRKMNIYFNQNL 802
              IP+T  DCLFC   S ++ +N+ HMT +H F +P ++Y+SD++GLI+YL   +    +CL CN   K F   +AV+ HM+  +H +LF    ++GD      D  D+ ++ P  K+  D NK            D   +E +LP+G ++G+R +  Y+ Q  
Sbjct:  247 GAIPIT--DCLFCSHHSSSLMKNVAHMTKDHSFFIPDIEYLSDIKGLIKYLGEKVGVGKICLWCNEKGKSFYSTEAVQAHMNDKSHCKLF----TDGDAALEFADFYDFRSSYPDHKEGEDPNKAEELPSEKNLEYDDETMELILPSGARVGHRSLMRYYKQRF 404          

HSP 2 Score: 58.151 bits (139), Expect = 7.652e-8
Identity = 28/98 (28.57%), Postives = 54/98 (55.10%), Query Frame = 2
Query:   50 CLVCKI---ESDDLLSHCKTEWHTYNLRRETFGLNVLSLEDFKTK-QNELILKNKVEIQKDYFC--CNKVFKSSKTYENHLNSKKHLQNSTNSIDTVD 325
            C+ C++   ++D   +H KT+WH YNLRR+   +  ++ E F+ + + +  +  +       +C  C+K F S   YENHL S++H++    ++  V+
Sbjct:    6 CITCRVAFRDADMQRAHYKTDWHRYNLRRKVASMAPVTAEGFQERVRAQRAVAEEESKGSATYCTVCSKKFASFNAYENHLKSRRHVELEKKAVQAVN 103          
BLAST of C2H2-type domain-containing protein vs. UniProt/SwissProt
Match: sp|Q8H1G5|REIL1_ARATH (Cytoplasmic 60S subunit biogenesis factor REI1 homolog 1 OS=Arabidopsis thaliana OX=3702 GN=REIL1 PE=1 SV=1)

HSP 1 Score: 89.3521 bits (220), Expect = 3.205e-18
Identity = 75/256 (29.30%), Postives = 112/256 (43.75%), Query Frame = 2
Query:   50 CLVCKIESDDLLS---HCKTEWHTYNLRRETFGLNVLSLEDFKTKQNELIL-KNKV-EIQKDYFC--CNKVFKSSKTYENHLNSKKHL----QNST--------------------NSIDTVDEDEIIEYTSGSDLE-ETAIIPLTIID-------------------------CLFCKSSSKTIERNLNHMTNEHHFNLPYLDYISDLEGLIEYLVCLIDEYHVCLQCN---KQFDDRQAVRNHMSHMNHMQLFF 637
            C  C +E  D      H K++WH YNL+R+  G+  ++   F+ +Q+ L   KNK  E    Y C  C K ++SSK +E HL S+ H+    Q ++                     SID   EDE +E  S  +L  E A   L+ ++                         CL C    KT+E  + HM   H F +P ++Y+ D EGL+ YL   +    +CL CN   + F   +AVR HM   +H +L +
Sbjct:    6 CNACNMEFKDEEERNLHYKSDWHRYNLKRKVAGVPGVTEALFEARQSALAQEKNKSNEAPMLYTCAICAKGYRSSKAHEQHLQSRSHVLRVSQGTSINGEEDIAIIRQLPRRVQHRGSIDDDSEDEWVEVDSDEELAAEEASDSLSKLNVNESGSAEDMDDDGDADKYELDPTCCLMCDKKHKTLESCMLHMHKHHGFFIPDIEYLKDPEGLLTYLGLKVKRDFMCLYCNELCRPFSSLEAVRKHMEAKSHCKLHY 261          
BLAST of C2H2-type domain-containing protein vs. UniProt/SwissProt
Match: sp|Q9ZQ18|REIL2_ARATH (Cytoplasmic 60S subunit biogenesis factor REI1 homolog 2 OS=Arabidopsis thaliana OX=3702 GN=REIL2 PE=1 SV=1)

HSP 1 Score: 86.6557 bits (213), Expect = 2.554e-17
Identity = 70/250 (28.00%), Postives = 107/250 (42.80%), Query Frame = 2
Query:   89 HCKTEWHTYNLRRETFGLNVLSLEDFKTKQNELILKN--KVEIQKDYFC--CNKVFKSSKTYENHLNSKKHLQNSTNSIDTVDEDEII-------------------------------EYTSGSDLEE--------------TAIIPLTIIDCLFCKSSSKTIERNLNHMTNEHHFNLPYLDYISDLEGLIEYLVCLIDEYHVCLQCNK---QFDDRQAVRNHMSHMNHMQLFFNLESNGDD--LSDYY 676
            H K+EWH YNL+R+  G+  ++   F+ +Q  +  +    VE    Y C  CNK ++SSK +E HL SK H+  ++ S  T +ED+ I                               E  S  DL+                    L    CL C    KTIE+ + HM   H F +P ++Y+ D +G + YL   +    VCL CN+    F   +AVR HM    H ++ +    + +D  L ++Y
Sbjct:   22 HYKSEWHRYNLKRKIAGVPGVTEALFEARQAAIAQEKVKAVEAPMLYSCGICNKGYRSSKAHEQHLKSKSHVLKASTS--TGEEDKAIIKQLPPRRVEKNNTAQLKGSIEEEESEDEWIEVDSDEDLDAEMNEDGEEEDMDEDGIEFELDPACCLMCDKKHKTIEKCMVHMHKFHGFFIPDIEYLKDPKGFLTYLGLKVKRDFVCLYCNELCHPFSSLEAVRKHMDAKGHCKVHYGDGGDEEDAELEEFY 269          
BLAST of C2H2-type domain-containing protein vs. TrEMBL
Match: A0A4Y7NKA2 (EOG090X06E3 OS=Moina brachiata OX=675436 GN=EOG090X06E3 PE=2 SV=1)

HSP 1 Score: 149.828 bits (377), Expect = 1.068e-37
Identity = 108/366 (29.51%), Postives = 178/366 (48.63%), Query Frame = 2
Query:   50 CLVCKIESDDL---LSHCKTEWHTYNLRRETFGLNVLSLEDFKTK---QNELILKNKVEIQKDYFC--CNKVFKSSKTYENHLNSKKHLQN-------STNSIDT-VDEDEIIEYTSG-SDLEE----------TAIIPLTIIDCLFCKSSSKTIERNLNHMTNEHHFNLPYLDYISDLEGLIEYLVCLIDEYHVCLQC---NKQFDDRQAVRNHMSHMNHMQLFFNLES--NGDDLSDYYANLPK-----QVSDMNKLSDSMGIEAVLPNGKKIGNRKMNIYFNQNLTAVSSGDRFAIMSGPEKARMSLIAAGKYGQVADKSLLTPKEKKYKTLEARYI-------QLRKSRFSN-FQQHFRAQI 1012
            C+ C +   D      H K++WH YNL+R+   L  ++ E F+ +   Q     + +V      +C  C K F + K+Y+NHL SKKH +N        T  I+T   + E ++     SD EE              P+ +  CLFC   S T++ NL HM+++H F +P ++Y++DLE L+EYL   + + H+CL C    +QF   +AV+ HM    H +++   E      D  DY  + P+     +  ++N +SD+ G E VLP+G  IG+R +N Y+ Q L A+           P  +R ++ A   +  +   S  +PK+ + K  +  ++       QL  S  +N  Q+H+R Q+
Sbjct:    5 CISCHVAFKDASVQRDHYKSDWHRYNLKRKVAELPPVTAEVFQQRVLEQRAQTAQAEVSKSTTLYCEFCGKKFGTEKSYQNHLGSKKHHENVIYGSKNPTKVIETNTGQQETVQMEGEVSDNEEMEEVDSDEWEEDEEPIPVTSCLFCNEQSATLKDNLEHMSHQHAFFIPDMEYVTDLEALLEYLGGRVGQGHMCLWCGHQGRQFPSAEAVQKHMLDKGHCRMYHEGEVLLEYSDFYDYSTSYPEAGDANEEVELNVISDA-GFELVLPSGAVIGHRSLNRYYRQKLNALP--------RPPRPSRSAIRAGSMFKALGWTS--SPKDIERKAKDMTFMRKIFTKHQLNVSVKANKLQKHYRPQV 359          
BLAST of C2H2-type domain-containing protein vs. TrEMBL
Match: A0A2P6K575 (Zinc finger protein OS=Nephila clavipes OX=2585209 GN=NCL1_51595 PE=4 SV=1)

HSP 1 Score: 141.354 bits (355), Expect = 2.064e-34
Identity = 115/379 (30.34%), Postives = 172/379 (45.38%), Query Frame = 2
Query:   50 CLVCKIESDDLLS-------HCKTEWHTYNLRRETFGLNVLSLEDFKTK----QNELILKNKVEIQKDYFCCNKVFKSSKTYENHLNSKKHLQ------------------------------NSTNSIDTVDE-----DEIIEYTSGSDLE-ETAIIPLTIIDCLFCKSSSKTIERNLNHMTNEHHFNLPYLDYISDLEGLIEYLVCLIDEYHVCLQCN---KQFDDRQAVRNHMSHMNHMQLFFNLESNGD--DLSDYYANLPKQVSDMNKLSDSM---GIEAVLPNGKKIGNRKMNIYFNQNLTAVSSGDRFAIMSGPEKARMSLIAAGKYGQVADKSLLTPKEKKY-KTLEARYIQLRKSRFSNFQQHFRAQILM 1018
            CL CK+    L S       H K+EWH YN +R+   L  L+ E+F+TK    + +   K KV ++ +   CNK F S     NH  SKKHL+                              N  +SID  DE     D+  E  S  D + E   I +   DCLFC  SS++ E N++HMT EH F +P ++Y+SDL+ LI  L   I   H+CL CN   + F   ++VR HM    H ++ +  +   D  D  DY      +  DM+ + D +     E VLP+G  IG+R + +Y+ QNL  +SS  +  +    +K      A G  G     ++   ++  Y + ++  Y      + +  Q HFR Q+L 
Sbjct:    5 CLTCKL----LFSVPALHQEHYKSEWHRYNCKRKIAELPSLTKEEFETKIAAFKEDAEKKKKVPLRCEK--CNKQFSSENALANHFQSKKHLEQLNKPDKHLDPMSKPDNSKKIDQVPAEKASNIASSIDDEDEWSDVEDDDCELESVDDGDNEMKRITIDTNDCLFCDHSSESTESNVSHMTKEHSFFIPDIEYVSDLDALIASLAAKIYLGHICLWCNGKGRSFRSVKSVRRHMFDKGHFKMLYEGDVVLDYADCYDYSTIEGGESRDMSGIEDILENPDFELVLPSGATIGHRSLAVYYKQNLKPISSDSKQKV----KKVLQQYKALGYTGTSGPMAVKVARDISYVQRIKQHYNLKLGLKKNKLQPHFRHQVLF 373          
BLAST of C2H2-type domain-containing protein vs. TrEMBL
Match: A0A026X1G9 (C2H2-type domain-containing protein OS=Ooceraea biroi OX=2015173 GN=DMN91_004869 PE=4 SV=1)

HSP 1 Score: 140.198 bits (352), Expect = 3.970e-34
Identity = 109/360 (30.28%), Postives = 173/360 (48.06%), Query Frame = 2
Query:   50 CLVCKI---ESDDLLSHCKTEWHTYNLRRETFGLNVLSLEDFKTKQNELILKNKVEIQKDYFCCNKVFKSSKTYENHLNSKKHLQNSTNSIDTVDEDEI---------IEYTSGSDLEETAII---PLTIIDCLFCKSSSKTIERNLNHMTNEHHFNLPYLDYISDLEGLIEYLVCLIDEYHVCLQCN---KQFDDRQAVRNHMSHMNHMQLFFNLESNGDDLS--DYYANLP-----------KQVSDMNKLSDSMGIEAVLPNGKKIGNRKMNIYFNQNLTAVSSGDRFAIMSGPEKARMSLIAAGKYGQVADKSLLTPKEKKYKTLEARYIQLRKSRFSN--------FQQHFRAQI 1012
            CL C I   E +    H K+EWH YNL R+   L  ++ ++F+ + ++    N+ +  K+   C K F S K YENHL SKKH Q     +  +DED+          ++ +  SDL  + +    P+   +CLFC+  S++I RNL HM  EH F +P L+Y  D  GL+ YL   I   + C+ C+   +Q     AV+ HM    H ++ F  E+  + L   DY ++ P            +V D+  L D+ G E  LP+GK IG+R +  Y+ QNL    +     +     K R  ++   +Y  +    L     +K +  + RY+Q  ++++S          Q+HFRAQ+
Sbjct:   14 CLTCCIMFREVEVRNKHYKSEWHRYNLNRKVANLPSITFDEFERRTHKDATGNQTKQSKNCNMCRKKFSSEKQYENHLTSKKHKQR----VKEMDEDQTSSAVQTETEMDVSDASDLSHSDLELENPIERNNCLFCEHHSRSITRNLKHMMVEHSFFVPDLEYCIDKRGLLTYLGEKIYAEYKCIWCDNSGRQLRSADAVKAHMIDKGHCKMLFEGEALLEYLQFYDYTSSYPDAGDADPDEELSEVPDV--LLDNDGYELELPSGKVIGHRALVRYYKQNLPTSGT---ITVAKNGHKLRKFML---QYRALGGPELQAEAIRK-RARDVRYLQRVQTKYSTQLQFKQNKLQKHFRAQV 360          
BLAST of C2H2-type domain-containing protein vs. TrEMBL
Match: A0A4Y7NIE9 (EOG090X06E3 OS=Megafenestra aurita OX=2291010 GN=EOG090X06E3 PE=2 SV=1)

HSP 1 Score: 139.043 bits (349), Expect = 8.770e-34
Identity = 109/379 (28.76%), Postives = 171/379 (45.12%), Query Frame = 2
Query:   50 CLVCKI---ESDDLLSHCKTEWHTYNLRRETFGLNVLSLEDFKTKQNELILK-NKVEIQKDY--FC--CNKVFKSSKTYENHLNSKKHLQN----------STNSIDTVDEDEIIEYTSGSDLEET---------AIIPLTIIDCLFCKSSSKTIERNLNHMTNEHHFNLPYLDYISDLEGLIEYLVCLIDEYHVCLQC---NKQFDDRQAVRNHMSHMNHMQLFFNLE---------------SNGDDLSDYYANLPKQVSDMNKLSDSMGIEAVLPNGKKIGNRKMNIYFNQNLTAVSSGDRFAIMSGPEKARMSLIAAGKYGQVADKSLLTPKEKKYKTLEARYIQLRKSRFSN-----------FQQHFRAQILM 1018
            C+ C +   E+     H KT+WH YNL+R+   L  ++ E F+ +  E   + NK E+ K    +C  C K F S  +YENHL SKKH +N            N+ +   ++++ +  +  ++E+            IP +   CLFC   S ++E NL HM++ H F +P +DY+ D+EGLI YL   + + H+C+ C    +QF    AV+ HM    H ++F   E                +G D ++          +MN L+DS G E +LP+G  IG+R +N Y+ QNL              P +  +   +A  YG        T   K+    +AR I   +  F+             Q+HFR Q+ M
Sbjct:    5 CISCHVAFKEASTQRDHYKTDWHRYNLKRKVVDLPPITAEAFQQRVLEQRAQVNKQEVSKSLTPYCNFCKKKFNSENSYENHLPSKKHQENVLKESTKIPKQLNNPEIPGDEQVSKEGTDEEMEDVDSDEWVDDDEAIPTSC--CLFCNHESVSMETNLEHMSSRHSFFIPDVDYVIDMEGLITYLGERVGQGHICMWCGHLGRQFPSTDAVKKHMLDKGHCKMFHEGEVLLEYSSFYDYSSSYPDGGDANEEV--------EMNVLNDS-GFELILPSGATIGHRSLNRYYRQNLN-------------PNQRPVPSRSAIHYGNYFKALGWTSSTKEIVERKARDISYMRKVFARKQLDVSVKANKLQKHFRRQVDM 359          
BLAST of C2H2-type domain-containing protein vs. TrEMBL
Match: A0A4Y7LXD0 (EOG090X06E3 OS=Daphnia atkinsoni OX=342845 GN=EOG090X06E3 PE=2 SV=1)

HSP 1 Score: 138.272 bits (347), Expect = 1.879e-33
Identity = 106/361 (29.36%), Postives = 166/361 (45.98%), Query Frame = 2
Query:   50 CLVCKI---ESDDLLSHCKTEWHTYNLRRETFGLNVLSLEDFKTK---QNELILKNKVEIQKDYFC--CNKVFKSSKTYENHLNSKKHLQNSTNSI-----------DTVDEDEIIEYTSGSDLEETAIIPLTIIDCLFCKSSSKTIERNLNHMTNEHHFNLPYLDYISDLEGLIEYLVCLIDEYHVCLQC---NKQFDDRQAVRNHMSHMNHMQLFFNLES--NGDDLSDYYANLPK-----QVSDMNKLSDSMGIEAVLPNGKKIGNRKMNIYFNQNLTAVSSGDRFAIMSGPEKARMSLIAAGKYGQVADKSLLTPKEKKYKTLEARYIQLRKSRF-----------SNFQQHFRAQI 1012
            C+ C +   E +    H KT+WH YNL+R+   L  ++ E F+ +   Q     + +       +C  C K F S K++ENHL SKKH +N  N +           DTV  DE  +  S    ++   IP+T   CLFC   S TIE +L HM+ +H F +P  +++ D+EG++ YL   + + H+C+ C    +QF   +AV+ HM    H ++F   E      D  DY ++ P+     +  + N ++DS G E VLP+G  IG+R +N Y+ Q L              P    +   AA ++G        T   K+    + R I   +  F           +  Q+HFR Q+
Sbjct:    6 CISCHVAFKEPNVQREHYKTDWHRYNLKRKVVDLPPVTAEVFQQRVLEQRAHADQQEASKSVTPYCNYCKKKFGSEKSHENHLLSKKHQENVLNGLKYVSVKPETAEDTVVMDEANDDDSDEWEDDDEAIPVT--SCLFCNHKSDTIESSLKHMSFQHSFFIPDFEFVIDMEGMLAYLGERVGQGHICMWCGHLGRQFPSAEAVQKHMLDKGHCKMFHEGEVLLEYSDFYDYSSSYPEGGDANEEVEANVINDS-GFELVLPSGSTIGHRSLNRYYRQKLN-------------PNPRPVPTRAAIQHGNYFKALGWTTSTKEIVEKKVRDITFMRKLFLKNQLGVSVKANKLQKHFRRQV 350          
BLAST of C2H2-type domain-containing protein vs. Ensembl Cavefish
Match: znf622 (zinc finger protein 622 [Source:NCBI gene;Acc:111194276])

HSP 1 Score: 101.679 bits (252), Expect = 3.389e-23
Identity = 77/251 (30.68%), Postives = 125/251 (49.80%), Query Frame = 2
Query:  371 TAIIPLTI--IDCLFCKSSSKTIERNLNHMTNEHHFNLPYLDYISDLEGLIEYLVCLIDEYHVCLQCN---KQFDDRQAVRNHMSHMNHMQLFFNLESNGD------DLSDYYANLP--KQVSDM----NKLSDSMGIEA-------VLPNGKKIGNRKMNIYFNQNLTAVSSGDRFAIMSGPEKARMSLIA---AGKYGQVADKSLLTPKEKKYKTLEARYIQLRKSRF------SN---FQQHFRAQIL 1015
            TA  P TI   DCLFC   S+++ +N+ HMT+ H F +P ++Y+ DL GLI YL   +    VCL CN   K F   +AV+ HM+  +H +LF    ++GD      D  D+ ++ P  K+  D+     +L D   +E         LP+G K+G+R + IY+ Q   A  +      ++  ++A   ++    A  +G    K  +  ++K     + +Y+Q  KS++      SN    Q HFRAQ++
Sbjct:  224 TAAAPGTISVTDCLFCSHHSRSLSKNMAHMTSTHSFFIPDIEYLVDLRGLIAYLGEKVGFGKVCLWCNEKGKSFYSTEAVQAHMTDKSHCKLF----TDGDAALEFADFYDFRSSYPDAKEGGDVEMKDGELPDEKTVEVDDETLELTLPSGAKVGHRSLMIYYKQRFGAPKA----VALAHNQRAVGRVLKQYRALGWGGETGKGFVNQQQK-----DMQYVQRMKSKWMLKMSMSNNVTKQAHFRAQVM 461          

HSP 2 Score: 51.2174 bits (121), Expect = 1.272e-6
Identity = 30/101 (29.70%), Postives = 51/101 (50.50%), Query Frame = 2
Query:   50 CLVCKIESDD---LLSHCKTEWHTYNLRRETFGLNVLSLEDFKTK---QNELILKNKVEIQKDYFC--CNKVFKSSKTYENHLNSKKHLQNSTNSIDTVDE 328
            C+ C+++  D     +H KT+WH YNL+R+   +  ++ E+F+ +   Q     + +  +     C  CNK F ++  Y NHL S KHLQ    ++    E
Sbjct:    6 CISCRVQFVDGEVQRAHYKTDWHRYNLKRKVADMPPVTAENFQERVLAQRAAAEQQQQNLTSFSTCSTCNKKFSTTNAYTNHLQSNKHLQAERKALAAAQE 106          
BLAST of C2H2-type domain-containing protein vs. Ensembl Sea Lamprey
Match: znf622 (zinc finger protein 622 [Source:ZFIN;Acc:ZDB-GENE-050927-1])

HSP 1 Score: 85.5001 bits (210), Expect = 1.978e-18
Identity = 64/233 (27.47%), Postives = 109/233 (46.78%), Query Frame = 2
Query:  401 CLFCKSSSKTIERNLNHMTNEHHFNLPYLDYISDLEGLIEYLVCLIDEYHVCLQCN---KQFDDRQAVRNHMSHMNHMQLFFNLESNGD---DLSDYYANLPKQV--------SDMNKLSDSMGIEAV----LPNGKKIGNRKMNIYFNQNLTAVSSGDRFAI-MSGPEKARM--SLIAAGKYGQVADKSLLTPKEKKYKTLEARYIQLRKSRFS--------NFQQHFRAQI 1012
            C FC   S+T+ R+L HM+ EH F +P + Y+ DL GL+ YL   +   +VCL CN   + F    AVR HM    H +LF    ++GD   + +D+Y    + V         + ++L +   +E      LP+G K+G+R + +Y+ Q     + G    +  SG    R+     A G  G    ++ +       +  + R++Q  K++++          Q HFR+Q+
Sbjct:  254 CFFCPQRSRTLARSLAHMSREHGFFIPDVQYLVDLPGLMRYLGEKVGAGNVCLWCNEKGRSFYSLDAVRKHMRDKGHCKLF----TDGDAALEFADFYDFRGRDVDGEDEEDDEEDSRLGEKQLVETTMELQLPSGVKVGHRSLLVYYRQRF---APGQAVVVHRSGRLLGRVMQQYRALGWNGNAGGEAAMR------RQRDMRFLQRHKAKWAMKMGMRGNMLQHHFRSQV 473          

HSP 2 Score: 54.299 bits (129), Expect = 2.250e-8
Identity = 27/88 (30.68%), Postives = 43/88 (48.86%), Query Frame = 2
Query:   50 CLVCKIE---SDDLLSHCKTEWHTYNLRRETFGLNVLSLEDFKTK---QNELILKNKVEIQKDYFCCNKVFKSSKTYENHLNSKKHLQ 295
            C+ C++    +D   +H KT+WH YNL+R+   +  ++ E F  +   Q          + +    C K F S   Y+NHL S +HLQ
Sbjct:    6 CMSCRVAFACADLQRAHYKTDWHRYNLKRKVAQMAPVTAESFAERVLAQRAAAQVPGAVVHQPCATCGKGFASHNAYDNHLRSHRHLQ 93          
BLAST of C2H2-type domain-containing protein vs. Ensembl Yeast
Match: REH1 (Cytoplasmic 60S subunit biogenesis factor; associates with pre-60S particles; similar to Rei1p and shares partially redundant function in cytoplasmic 60S subunit maturation; contains dispersed C2H2 zinc finger domains [Source:SGD;Acc:S000004379])

HSP 1 Score: 97.8265 bits (242), Expect = 8.339e-23
Identity = 106/439 (24.15%), Postives = 170/439 (38.72%), Query Frame = 2
Query:   50 CLVCKIESDDLLS-HCKTEWHTYNLRRETFGLNVLSLEDFKTKQNELILKNKVEIQKDYF-------CCNKVFKSSKTYENHLNSKKHLQNSTNSIDTVD-------------------------------------EDEIIEY--TSGSDLE--------ETAIIP-------LTIIDCLFCKSSSKTIERNLNHMTNEHHFNLPYLDYISDLEGLIEYLVCLIDEYHVCLQCNKQFDDRQAVRNHMSHMNHMQLFFNLESNGDDLSDYY----------ANLPKQVSDMNKLS----------------------------------DSMGIEAVLPNGKKIGNRKMNIYFNQNLTAVSSGDRFAIMSGPEKARMSLIAAGKYGQVADKSLLTP-KEKKYKTLEARYIQLRKSRFS----------NFQQHFRAQIL 1015
            C V + ++ DL   H KTEWH YNL+R    L  +  E F  K  ++  K + E Q D F         N+     +  +  + SK+  +  TN +   D                                     ED + EY  TS S+ E        + A  P       +TI +C++C   +K +ERN+ HM +EH   +P   Y+ DL GL+E+L+ +I   H CL CN      +++R HM+   H +L +  +      + +Y           NL    +  +KLS                                  D  G+E  LP G ++G+R    Y+ QNL +            P ++R ++ A       AD+ +++   EK+YK    +  QL K+  +          NFQ H+R ++L
Sbjct:   10 CCVIQFKTSDLQRYHMKTEWHRYNLKRRIANLPPIGAEQFAEKL-QISEKEQAENQVDEFGFPVLKPVMNQSNALPQKQKKPIKSKRGRKVGTNLLKRKDRDIAKEKQNRSVSPSGSISSQLSNLTVGTENTNTDYGEDTVSEYGFTSDSNYEYATSDEELDIADKPSDKENEKITITECIYCGKDNKEVERNVKHMFSEHGLFIPERSYLIDLNGLLEFLIKMIVIDHNCLCCNFHGSGLESIRAHMASKRHCRLPYETKEERQLFAPFYDFTYDDHSISKNLQNDRAITSKLSSVYGAKNDEEDGEVDITLVSSENDINANYTTVSIDESGLELTLPTGARLGHRAGQRYYRQNLPS---------QPNPNESRRTITA-------ADRRMVSGVTEKQYKKGMKKMQQLEKNAINTQIRREIKRVNFQTHYRDELL 431          
BLAST of C2H2-type domain-containing protein vs. Ensembl Yeast
Match: REI1 (Cytoplasmic pre-60S factor; required for the correct recycling of shuttling factors Alb1, Arx1 and Tif6 at the end of the ribosomal large subunit biogenesis; involved in bud growth in the mitotic signaling network [Source:SGD;Acc:S000000471])

HSP 1 Score: 78.5666 bits (192), Expect = 1.747e-16
Identity = 68/245 (27.76%), Postives = 112/245 (45.71%), Query Frame = 2
Query:  380 IPLTIIDCLFCKSSS--KTIERNLNHMTNEHHFNLPYLDYISDLEGLIEYLVCLIDEYHVCLQCNKQFDDRQAVRNHMSHMNHMQLFFNLESNGDDLSDY------YANL-----PKQVSDMNKL-SDSM---------------GIEAVLPNGKKIGNRKMNIYFNQNLTAVSSGDRFAIMSGPEKARMSLIAA--GKYGQVADKSLLTPKEKKYKT--LEARYIQLRKSRFSNFQQHFRAQIL 1015
            IPL    CLFC+ +   K +E NL HM   H F +P   Y+ D  GL++Y+   I   ++C+ CN Q     AVR HM    H ++ +  E    ++S++      YAN      P    D   + SD                 GIE  LP G K+G+R +  Y+ Q+L          I++   + + +L+AA    +    DK  +  +++ ++T   + + +  R ++F N Q H+R Q+L
Sbjct:  159 IPLE--QCLFCEHNKHFKDVEENLEHMFRTHGFYIPEQKYLVDKIGLVKYMSEKIGLGNICIVCNYQGRTLTAVRQHMLAKRHCKIPYESEDERLEISEFYDFTSSYANFNSNTTPDNEDDWEDVGSDEAGSDDEDLPQEYLYNDGIELHLPTGIKVGHRSLQRYYKQDLKPE------VILT---EGQGTLVAAETRSFLPAFDKKGVQTQQRVWQTERFDKKRLDKRSAKFVNNQPHYRDQLL 392          
BLAST of C2H2-type domain-containing protein vs. Ensembl Nematostella
Match: EDO42506 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S1H2])

HSP 1 Score: 120.553 bits (301), Expect = 1.031e-30
Identity = 110/370 (29.73%), Postives = 175/370 (47.30%), Query Frame = 2
Query:   50 CLVCKI---ESDDLLSHCKTEWHTYNLRRETFGLNVLSLEDFKTK---QNELILKNKVEIQKDYFC--CNKVFKSSKTYENHLNSKKHLQ----------------NSTNSIDTVDEDEIIEYTSGSDLEETAII---PLTIIDCLFCKSSSKTIERNLNHMTNEHHFNLPYLDYISDLEGLIEYLVCLIDEYHVCLQCN---KQFDDRQAVRNHMSHMNHMQLFFNLESNGDDLSDYY--------ANLPKQVSDMNKLS---DSMGIEAVLPNGKKIGNRKMNIYFNQNLTAVSSGDRFAIMSGPEKARMSLI----AAGKYGQVADKSLLTPKE-KKYKTLEARYIQLRKSRFSNFQQ-HFRAQILM 1018
            C+ C++   +SD    H KT+WH YNL+R+   L  ++ E F+ K   Q   +   + E      C  C K F S   ++NH+ SKKH +                N T  ++ + +++  E     D E+  II    L I  CLFC   S+T E NL HM+  H F LP L+YI DL+G +EYL   +    VCL CN   K+F   +A ++HM    HM++ +  ++   + SDYY         N  K++ +    +   D    E  LP+G + G+R++  Y+ QNL       +        K R S++    A G +G + + +    K+  K +  +AR+  L+ S  +N QQ +FR Q++ 
Sbjct:    6 CMTCRVAFSDSDIQRQHYKTDWHRYNLKRKIAELAPVTAEVFQEKVFAQRAEVDAKEQEKNTTMRCESCCKNFSSGNAFKNHMQSKKHNEIVLRASKTSLLVRQPGNMTKKVEKIAKEDEEENMVEEDDEDGEIIEDDSLEITQCLFCPHESQTYEENLRHMSRSHSFFLPDLEYIVDLKGFLEYLGEKVGLGKVCLYCNEKGKKFHTVEAAQSHMVDKGHMKIDYEGDA-ALEYSDYYDFSTSYPSDNPDKEIDETASGTLSVDETTNELCLPSGARAGHRELRHYYRQNLPPEKDIHQLT------KIRKSIMADYKALGWHGTIGEGAKQKIKDIHKEQRHQARH-DLKLSLKANKQQKYFRPQVVF 367          
BLAST of C2H2-type domain-containing protein vs. Ensembl Medaka
Match: znf622 (zinc finger protein 622 [Source:NCBI gene;Acc:101166826])

HSP 1 Score: 98.9821 bits (245), Expect = 2.594e-22
Identity = 74/253 (29.25%), Postives = 121/253 (47.83%), Query Frame = 2
Query:  359 DLEETAIIP--LTIIDCLFCKSSSKTIERNLNHMTNEHHFNLPYLDYISDLEGLIEYLVCLIDEYHVCLQCN---KQFDDRQAVRNHMSHMNHMQLFFNLESNGD------DLSDYYANLPKQ-------------VSDMNKLSDSMGIEAVLPNGKKIGNRKMNIYFNQNLTAVSSGDRFAIMSGPEKARMSLIAAGK-YGQVADKSLLTPKEKKYKTLEARYIQLRKSRF---------SNFQQHFRAQIL 1015
            D   +A +P  L + DCLFC   SK++ +N+ HMT  H F LP ++++ DL GLI YL   +   +VCL CN   + F   +AV++HM+  +H +LF    ++GD      D  D+ ++ P +               D N   D   +E  LP+G K+G+R +  Y+ Q         R  +++   KA   ++   K  G     S L       +  + +++Q  KSR+         +N Q+HFRAQ++
Sbjct:  216 DPSGSAPLPGSLPVTDCLFCPHHSKSLLKNVAHMTKVHGFFLPDVEFLVDLRGLIRYLGEKVGAGNVCLWCNEKGRSFYSTEAVQSHMTDKSHCKLF----TDGDAALEFADFYDFRSSYPDRKEGEEEEEAEEELPDDGNLEYDEDTLELTLPSGAKVGHRSLVRYYKQRFGT----QRALVLTHNTKAVGRVLRQYKALGWGGSSSALQ------RQRDMQFVQRMKSRWMLKMGMSNNANLQKHFRAQVM 454          

HSP 2 Score: 53.1434 bits (126), Expect = 2.975e-7
Identity = 31/99 (31.31%), Postives = 51/99 (51.52%), Query Frame = 2
Query:   50 CLVCKIESDD---LLSHCKTEWHTYNLRRETFGLNVLSLEDFKTKQNELILKNKVEIQK------DYFC--CNKVFKSSKTYENHLNSKKHLQNSTNSI 313
            C+ C++   D     +H KT+WH YNL+R+   +  ++ E+F   Q  ++L+  V  Q+         C  CNK F S+  ++NHL S KH Q    ++
Sbjct:    6 CISCRVTFADGEVQRAHYKTDWHRYNLKRKVADMPPVTAENF---QERVLLQRAVAEQQLSESTATEVCGVCNKRFSSANAHQNHLQSHKHQQAEKQAL 101          
BLAST of C2H2-type domain-containing protein vs. Planmine SMEST
Match: SMESG000065334.1 (SMESG000065334.1)

HSP 1 Score: 672.929 bits (1735), Expect = 0.000e+0
Identity = 323/326 (99.08%), Postives = 325/326 (99.69%), Query Frame = 2
Query:   41 MKKCLVCKIESDDLLSHCKTEWHTYNLRRETFGLNVLSLEDFKTKQNELILKNKVEIQKDYFCCNKVFKSSKTYENHLNSKKHLQNSTNSIDTVDEDEIIEYTSGSDLEETAIIPLTIIDCLFCKSSSKTIERNLNHMTNEHHFNLPYLDYISDLEGLIEYLVCLIDEYHVCLQCNKQFDDRQAVRNHMSHMNHMQLFFNLESNGDDLSDYYANLPKQVSDMNKLSDSMGIEAVLPNGKKIGNRKMNIYFNQNLTAVSSGDRFAIMSGPEKARMSLIAAGKYGQVADKSLLTPKEKKYKTLEARYIQLRKSRFSNFQQHFRAQILM 1018
            MKKCLVCKI+SDDLLSHCKTEWHTYNLRRETFGLNVLSLEDFKTKQNELILKNKVEIQKDYFCCNKVFKSSKTYENHLNSKKHLQNSTNSIDTVDEDEIIEYTSGSDLEETAIIPLTIIDCLFCKSSSKTIERNLNHMTNEHHFNLPYLDYISDLEGLIEYLVCLIDEYHVCLQCNKQFDDRQAVRNHMSHMNHMQLFFNLESNGDDLSDYY+NLPKQVSDMNKLSDSMGIEAVLPNGKKIGNRKMNIYFNQNLTAVSSGDR AIMSGPEKARMSLIAAGKYGQVADKSLLTPKEKKYKTLEARYIQLRKSRFSNFQQHFRAQILM
Sbjct:    1 MKKCLVCKIDSDDLLSHCKTEWHTYNLRRETFGLNVLSLEDFKTKQNELILKNKVEIQKDYFCCNKVFKSSKTYENHLNSKKHLQNSTNSIDTVDEDEIIEYTSGSDLEETAIIPLTIIDCLFCKSSSKTIERNLNHMTNEHHFNLPYLDYISDLEGLIEYLVCLIDEYHVCLQCNKQFDDRQAVRNHMSHMNHMQLFFNLESNGDDLSDYYSNLPKQVSDMNKLSDSMGIEAVLPNGKKIGNRKMNIYFNQNLTAVSSGDRLAIMSGPEKARMSLIAAGKYGQVADKSLLTPKEKKYKTLEARYIQLRKSRFSNFQQHFRAQILM 326          
The following BLAST results are available for this feature:
BLAST of C2H2-type domain-containing protein vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 1
Match NameE-valueIdentityDescription
ZNF6223.126e-2033.54zinc finger protein 622 [Source:HGNC Symbol;Acc:HG... [more]
back to top
BLAST of C2H2-type domain-containing protein vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 2
Match NameE-valueIdentityDescription
C16A3.41.463e-2325.98pep chromosome:WBcel235:III:6381634:6383024:1 gene... [more]
C16A3.41.463e-2325.98pep chromosome:WBcel235:III:6381634:6382996:1 gene... [more]
back to top
BLAST of C2H2-type domain-containing protein vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 2
Match NameE-valueIdentityDescription
CG67696.936e-1928.51gene:FBgn0030878 transcript:FBtr0334034[more]
CG67696.936e-1928.51gene:FBgn0030878 transcript:FBtr0074493[more]
back to top
BLAST of C2H2-type domain-containing protein vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 1
Match NameE-valueIdentityDescription
znf6227.799e-2229.57zinc finger protein 622 [Source:ZFIN;Acc:ZDB-GENE-... [more]
back to top
BLAST of C2H2-type domain-containing protein vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 1
Match NameE-valueIdentityDescription
bsg5.005e-2026.74basigin (Ok blood group) [Source:Xenbase;Acc:XB-GE... [more]
back to top
BLAST of C2H2-type domain-containing protein vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 2
Match NameE-valueIdentityDescription
Zfp6223.412e-2128.15zinc finger protein 622 [Source:MGI Symbol;Acc:MGI... [more]
Zfp6227.439e-1726.74zinc finger protein 622 [Source:MGI Symbol;Acc:MGI... [more]
back to top
BLAST of C2H2-type domain-containing protein vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q06709|REH1_YEAST5.790e-2124.15Cytoplasmic 60S subunit biogenesis factor REH1 OS=... [more]
sp|Q91VY9|ZN622_MOUSE2.387e-2028.15Zinc finger protein 622 OS=Mus musculus OX=10090 G... [more]
sp|Q969S3|ZN622_HUMAN1.501e-1933.54Zinc finger protein 622 OS=Homo sapiens OX=9606 GN... [more]
sp|Q8H1G5|REIL1_ARATH3.205e-1829.30Cytoplasmic 60S subunit biogenesis factor REI1 hom... [more]
sp|Q9ZQ18|REIL2_ARATH2.554e-1728.00Cytoplasmic 60S subunit biogenesis factor REI1 hom... [more]
back to top
BLAST of C2H2-type domain-containing protein vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A4Y7NKA21.068e-3729.51EOG090X06E3 OS=Moina brachiata OX=675436 GN=EOG090... [more]
A0A2P6K5752.064e-3430.34Zinc finger protein OS=Nephila clavipes OX=2585209... [more]
A0A026X1G93.970e-3430.28C2H2-type domain-containing protein OS=Ooceraea bi... [more]
A0A4Y7NIE98.770e-3428.76EOG090X06E3 OS=Megafenestra aurita OX=2291010 GN=E... [more]
A0A4Y7LXD01.879e-3329.36EOG090X06E3 OS=Daphnia atkinsoni OX=342845 GN=EOG0... [more]
back to top
BLAST of C2H2-type domain-containing protein vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 1
Match NameE-valueIdentityDescription
znf6223.389e-2330.68zinc finger protein 622 [Source:NCBI gene;Acc:1111... [more]
back to top
BLAST of C2H2-type domain-containing protein vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 1
Match NameE-valueIdentityDescription
znf6221.978e-1827.47zinc finger protein 622 [Source:ZFIN;Acc:ZDB-GENE-... [more]
back to top
BLAST of C2H2-type domain-containing protein vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 2
Match NameE-valueIdentityDescription
REH18.339e-2324.15Cytoplasmic 60S subunit biogenesis factor; associa... [more]
REI11.747e-1627.76Cytoplasmic pre-60S factor; required for the corre... [more]
back to top
BLAST of C2H2-type domain-containing protein vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 1
Match NameE-valueIdentityDescription
EDO425061.031e-3029.73Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of C2H2-type domain-containing protein vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 1
Match NameE-valueIdentityDescription
znf6222.594e-2229.25zinc finger protein 622 [Source:NCBI gene;Acc:1011... [more]
back to top
BLAST of C2H2-type domain-containing protein vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 1
Match NameE-valueIdentityDescription
SMESG000065334.10.000e+099.08SMESG000065334.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30015938 ID=SMED30015938|Name=C2H2-type domain-containing protein|organism=Schmidtea mediterranea sexual|type=transcript|length=1220bp
TAAATAATTACACTTTTTAATTTCAGTCATTTGATCAAATATGAAAAAAT
GCTTAGTTTGTAAAATAGAGTCGGATGACTTATTATCACATTGTAAAACT
GAATGGCACACATACAATTTAAGACGAGAAACTTTTGGTTTAAATGTCTT
ATCACTTGAGGATTTCAAGACCAAACAAAATGAACTAATTTTGAAAAATA
AAGTTGAAATACAAAAAGATTACTTTTGTTGCAACAAAGTTTTCAAAAGC
TCCAAAACTTATGAAAACCATTTAAATTCAAAAAAGCATTTACAAAATTC
TACAAACTCTATCGATACAGTTGATGAGGATGAAATTATTGAATATACAA
GTGGAAGCGACTTAGAAGAAACAGCCATAATACCTTTAACGATAATTGAC
TGTTTATTTTGCAAATCATCTTCTAAAACTATAGAAAGAAATCTTAATCA
TATGACAAATGAGCACCATTTTAATCTACCATATCTCGATTATATTTCGG
ATTTGGAAGGTTTAATCGAATATTTGGTATGTTTGATTGACGAATACCAC
GTTTGTCTGCAGTGCAACAAACAATTTGATGACCGACAAGCCGTTAGAAA
TCACATGTCTCACATGAATCACATGCAGCTTTTCTTTAATTTGGAATCGA
ATGGGGATGATTTGAGTGACTATTACGCAAATTTGCCGAAACAGGTTTCT
GATATGAATAAATTATCGGACAGCATGGGAATTGAAGCAGTTTTACCAAA
TGGTAAAAAAATAGGAAACAGAAAAATGAACATTTATTTCAACCAAAACT
TGACTGCGGTTTCGAGTGGCGATCGGTTTGCGATTATGAGTGGGCCGGAA
AAAGCGAGAATGAGCCTTATCGCTGCTGGAAAATACGGACAGGTGGCGGA
TAAATCATTGCTGACACCGAAGGAAAAGAAATATAAAACCCTCGAGGCGA
GATATATCCAGTTGAGGAAAAGCAGATTCAGCAATTTCCAGCAACATTTC
CGTGCTCAAATCTTAATGTAATACAGCAAAAATCTTTTCATTATTCGACC
TCGATAAAATTTATATTGTATTCATTAATTGATTTGTCTAATGTTTCATT
CTTCTGTGATTGGCTAATTGTTATTTGTTGATATTATTTATTGATCTGAT
GATGCGGTTGAATTTGTATTAATGATGCGATCAAGTCTTTTGTTAAAATT
GGCATTTTACGGCATAAGGG
back to top

protein sequence of SMED30015938-orf-1

>SMED30015938-orf-1 ID=SMED30015938-orf-1|Name=SMED30015938-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=327bp
MKKCLVCKIESDDLLSHCKTEWHTYNLRRETFGLNVLSLEDFKTKQNELI
LKNKVEIQKDYFCCNKVFKSSKTYENHLNSKKHLQNSTNSIDTVDEDEII
EYTSGSDLEETAIIPLTIIDCLFCKSSSKTIERNLNHMTNEHHFNLPYLD
YISDLEGLIEYLVCLIDEYHVCLQCNKQFDDRQAVRNHMSHMNHMQLFFN
LESNGDDLSDYYANLPKQVSDMNKLSDSMGIEAVLPNGKKIGNRKMNIYF
NQNLTAVSSGDRFAIMSGPEKARMSLIAAGKYGQVADKSLLTPKEKKYKT
LEARYIQLRKSRFSNFQQHFRAQILM*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000429neoblast
Vocabulary: INTERPRO
TermDefinition
IPR013087Znf_C2H2_type
IPR041661ZN622/Rei1/Reh1_Znf-C2H2
IPR040025Znf622/Rei1/Reh1
IPR036236Znf_C2H2_sf
IPR015880Znf_C2H2-like
IPR022755Znf_C2H2_jaz
IPR007087Znf_C2H2
Vocabulary: molecular function
TermDefinition
GO:0046872metal ion binding
GO:0003676nucleic acid binding
GO:0008270zinc ion binding
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR013087Zinc finger C2H2-typeSMARTSM00355c2h2final6coord: 170..194
e-value: 0.98
score: 18.4
coord: 61..83
e-value: 85.0
score: 5.0
coord: 119..142
e-value: 32.0
score: 8.8
IPR013087Zinc finger C2H2-typePROSITEPS00028ZINC_FINGER_C2H2_1coord: 172..194
IPR041661ZN622/Rei1/Reh1, zinc finger C2H2-typePFAMPF12756zf-C2H2_2coord: 121..213
e-value: 1.5E-22
score: 79.8
IPR022755Zinc finger, double-stranded RNA bindingPFAMPF12171zf-C2H2_jazcoord: 64..83
e-value: 3.3E-6
score: 27.2
IPR040025Zinc finger protein 622/Rei1/Reh1PANTHERPTHR13182ZINC FINGER PROTEIN 622coord: 94..325
IPR040025Zinc finger protein 622/Rei1/Reh1PANTHERPTHR13182ZINC FINGER PROTEIN 622coord: 4..97
NoneNo IPR availablePANTHERPTHR13182:SF8ZINC FINGER PROTEIN 622coord: 94..325
NoneNo IPR availablePANTHERPTHR13182:SF8ZINC FINGER PROTEIN 622coord: 4..97
IPR036236Zinc finger C2H2 superfamilySUPERFAMILYSSF57667beta-beta-alpha zinc fingerscoord: 63..87
IPR036236Zinc finger C2H2 superfamilySUPERFAMILYSSF57667beta-beta-alpha zinc fingerscoord: 115..156