Transposon Ty3-I Gag-Pol polyprotein

Overview
NameTransposon Ty3-I Gag-Pol polyprotein
Smed IDSMED30015933
Length (bp)2084
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Transposon Ty3-I Gag-Pol polyprotein (SMED30015933) t-SNE clustered cells

Violin plots show distribution of expression levels for Transposon Ty3-I Gag-Pol polyprotein (SMED30015933) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Transposon Ty3-I Gag-Pol polyprotein (SMED30015933) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Transposon Ty3-I Gag-Pol polyprotein (SMED30015933) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30015933

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 6

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
cephalic gangliaSMED30015933SMESG000032467.1 SMESG000032456.1 dd_Smed_v4_3787_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
neoblastSMED30015933SMESG000032467.1 SMESG000032456.1 dd_Smed_v4_3787_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
parenchymal cellSMED30015933SMESG000032467.1 SMESG000032456.1 dd_Smed_v4_3787_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30015933SMESG000032467.1 SMESG000032456.1 SMESG000032323.1 Contig10733newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30015933SMESG000032467.1 SMESG000032456.1 SMESG000032323.1 Contig10733uc_Smed_v2PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
parenchymal cellSMED30015933SMESG000033852.1 SMESG000032467.1 SMESG000032456.1 dd_Smed_v6_3787_0dd_Smed_v6PMID:29674432
Plass et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Transposon Ty3-I Gag-Pol polyprotein vs. Ensembl Zebrafish
Match: CR925755.2 (pep chromosome:GRCz11:17:42486740:42492668:-1 gene:ENSDARG00000116402.1 transcript:ENSDART00000183946.1 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:CR925755.2)

HSP 1 Score: 140.969 bits (354), Expect = 5.174e-34
Identity = 119/425 (28.00%), Postives = 187/425 (44.00%), Query Frame = 1
Query:  772 MEDLIKKLIKAKVIQRCKSSWNARLVIVGKKDGSIRMCVDYRGLNAITLKESFSMSNTKFLLDCLTDAIIFSSIDLDQAYYQVELAPDIQERTAFSIREGQFCFNRLLVRLSTAPTTFQ*LMHTVLEEMLLKGVVVYLDDILIYRKSKKDHDELLEELFKRIQMAGLKINPEKCEFNKTELCFLGHTFNCESIQTNSXXXXXXXXXXXXXXXS*DHFSD*RTTTEDSSKTM------AESQNRFMSQ----HLYVTN---------------ESFIVLKNRLCVAPILDYPREDRTFILETYASFGIIGSVWSHVKG----ICYSLWFETYDSV*KRLLYNEEKPSRCT*ICYEF*RIFLRK---KFIIRTDHYAFVFMNTTKTPI*PQFQT*LANLA----EYDFELKYKKGEEHSNADGLSRL 1938
            ME  I   + AK+I+   S   A    V KKDGS+R C+DYRGLN+IT+K ++ +       + L  A  F+ +DL  AY+ V + P  + +TAF+   G F +  L   LS AP  FQ L++ VL +M+ + + VYLDDILI+  S ++H + +  + +R+   GL +  EKC F+   + FLGHT + E ++ + +  +                      T DS K +      A    RF+         +TN                +F  LK     APIL  P   R F++E   S   +G++ S        I    +F    S  +R      +      +  E  R +L      FI+ TDH    ++ + K     +  +  A  A     ++F + Y+ G ++   D LSRL
Sbjct:  513 MEKYISDSLAAKIIRPSSSPAGAGFFFVKKKDGSLRPCIDYRGLNSITVKNTYPLPLMSSAFERLQGANFFTKLDLRNAYHLVRIRPGDEWKTAFNTPRGHFEYCVLPFGLSNAPAVFQALVNDVLRDMIDQFIYVYLDDILIFSHSLQEHVQHVRRVLQRLLENGLYVKAEKCVFHAQSVQFLGHTVSVEGMRMDPEKIQAVV----------------NWPTPDSRKALQRFLGFANFYRRFIRNFRQLAAPLTNLTSSKTPFRWSNAAEAAFSKLKGCFVSAPILIAPDPSRQFVVEVDVSEVGVGAILSQRSALDGKIHPCAYFSHRLSAAERNYDIGNRELLAVKLALEEWRHWLEGSGVPFIVSTDHKNLEYIKSAK-----RLNSRQARWALFFGRFNFSISYRPGSKNIKPDALSRL 916          
BLAST of Transposon Ty3-I Gag-Pol polyprotein vs. Ensembl Zebrafish
Match: BX511082.1 (pep chromosome:GRCz11:9:14291932:14297132:1 gene:ENSDARG00000113678.1 transcript:ENSDART00000183119.1 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:BX511082.1)

HSP 1 Score: 139.043 bits (349), Expect = 1.991e-33
Identity = 121/433 (27.94%), Postives = 186/433 (42.96%), Query Frame = 1
Query:  772 MEDLIKKLIKAKVIQRCKSSWNARLVIVGKKDGSIRMCVDYRGLNAITLKESFSMSNTKFLLDCLTDAIIFSSIDLDQAYYQVELAPDIQERTAFSIREGQFCFNRLLVRLSTAPTTFQ*LMHTVLEEMLLKGVVVYLDDILIYRKSKKDHDELLEELFKRIQMAGLKINPEKCEFNKTELCFLGHTFNCESIQTNSXXXXXXXXXXXXXXXS*DHFSD*RTTTEDSSKTM------AESQNRFMSQHLYVTNE-------------------SFIVLKNRLCVAPILDYPREDRTFILETYAS---FGIIGSVWSHVKGICYSLWF---------ETYDSV*KRLLYNEEKPSRCT*ICYEF*RIFLRK---KFIIRTDHYAFVFMNTTKTPI*PQFQT*LANLA----EYDFELKYKKGEEHSNADGLSRL 1938
            ME  I   + AK+I+   S   A    V KKDGS+R C+DYRGLNAIT+K ++ +       + L  A  F+ +DL  AY+ V +    + +TAF+   G F +  L   LS AP  FQ L++ VL +ML + + VYLDDILI+  S ++H + +  + +R+   GL +  EKC F+   + FLGH  + E ++ + +  +                      T DS K +      A    RF+     +                      +F  LK+    APIL  P   R F++E  AS    G I S  S   G  +   +         + YD   + LL           +  E  R +L      FI+ TDH    ++ + K     +  +  A  A     +DF + Y+ G ++   D LSR+
Sbjct:  540 MEKYISDSLAAKIIRPSSSPAGAGFFFVKKKDGSLRPCIDYRGLNAITVKNTYPLPLMSSAFERLQGASFFTKLDLRNAYHLVRIREGDEWKTAFNTPRGHFEYCVLPFGLSNAPAVFQALVNDVLRDMLDQFIYVYLDDILIFSHSLQEHVQHVRRVLQRLLENGLYVKAEKCVFHAQSVPFLGHIVSVEGMRMDPEKVQAVVDW----------------PTPDSRKALQRFLGFANFYRRFIRNFSQLAAPLTALTSLKTPFRWSNAAQVAFDRLKSCFVSAPILIAPDPSRQFVVEVDASEVGVGAILSQRSSSDGKMHPCAYFSHRLNNAEQNYDIGNRELL--------AVKLALEEWRHWLEGSGVPFIVWTDHKNLEYIQSAK-----RLNSRQARWALFFGRFDFSISYRPGSKNVKPDALSRI 943          
BLAST of Transposon Ty3-I Gag-Pol polyprotein vs. Ensembl Zebrafish
Match: BX511224.1 (pep chromosome:GRCz11:2:18017000:18022765:1 gene:ENSDARG00000113243.1 transcript:ENSDART00000186877.1 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:BX511224.1)

HSP 1 Score: 138.272 bits (347), Expect = 3.865e-33
Identity = 119/423 (28.13%), Postives = 190/423 (44.92%), Query Frame = 1
Query:  772 MEDLIKKLIKAKVIQRCKSSWNARLVIVGKKDGSIRMCVDYRGLNAITLKESFSMSNTKFLLDCLTDAIIFSSIDLDQAYYQVELAPDIQERTAFSIREGQFCFNRLLVRLSTAPTTFQ*LMHTVLEEMLLKGVVVYLDDILIYRKSKKDHDELLEELFKRIQMAGLKINPEKCEFNKTELCFLGHTFNCESIQTNSXXXXXXXXXXXXXXXS---------------*DHFSD*RTTTEDSSKTMAESQNRFMSQHLYVTNESFIVLKNRLCVAPILDYPREDRTFILETYASFGIIGSVWSH-------VKGICY-----SLWFETYDSV*KRLLYNEEKPSRCT*ICYEF*RIFLRK---KFIIRTDHYAFVFMNTTKTPI*PQFQT*LANLA----EYDFELKYKKGEEHSNADGLSRL 1938
            ME  I   + AK+I+   S   A    V KKDGS+R C+DYRGLN+IT+K ++ +       + L  A  F+ +DL  AY+ V + P  + +TAF+   G F +  L   LS AP  FQ L++ VL +M+ + + VYLDDILI+  S ++H + +  + +R+   GL +  EKC F+   + FLGH  + E ++ + +  +                             +FS  +     +S T +++  R+ S        +F  LK     APIL  P   R F++E  AS   +G++ S        V    Y     S     YD   + LL  +        +  E  R +L      FI+ TDH    ++ + K     +  +  A  A     ++F + Y+ G ++   D LSRL
Sbjct:  540 MEKYISDSLAAKIIRPSSSPAGAGFFFVKKKDGSLRPCIDYRGLNSITVKNTYPLPLMSSAFERLQGANFFTKLDLRNAYHLVCIRPGDEWKTAFNTPRGHFEYCVLPFGLSNAPAVFQALVNDVLRDMIDQFIYVYLDDILIFSHSLQEHIQHVRRVLQRLLENGLYVKAEKCVFHAQSVQFLGHIVSVEGMRMDPEKIQAVVNWPTPDSRKALQRFLGFANFYRRFIHNFS--QLAAPLTSLTSSKTPFRWSS----AAEAAFSKLKGCFVSAPILIAPDPSRQFVVEVDASEVGVGAILSQRSASDGKVHPCAYFSHRLSSAERNYDIGNRELLAVK--------LALEEWRHWLEGSGVPFIVWTDHKNLEYIKSAK-----RLNSRQARWALFFGRFNFTISYRPGSKNIKPDALSRL 943          
BLAST of Transposon Ty3-I Gag-Pol polyprotein vs. Ensembl Zebrafish
Match: BX546500.1 (pep chromosome:GRCz11:23:12926092:12931693:-1 gene:ENSDARG00000086495.3 transcript:ENSDART00000122176.3 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:BX546500.1)

HSP 1 Score: 138.272 bits (347), Expect = 4.184e-33
Identity = 119/433 (27.48%), Postives = 187/433 (43.19%), Query Frame = 1
Query:  772 MEDLIKKLIKAKVIQRCKSSWNARLVIVGKKDGSIRMCVDYRGLNAITLKESFSMSNTKFLLDCLTDAIIFSSIDLDQAYYQVELAPDIQERTAFSIREGQFCFNRLLVRLSTAPTTFQ*LMHTVLEEMLLKGVVVYLDDILIYRKSKKDHDELLEELFKRIQMAGLKINPEKCEFNKTELCFLGHTFNCESIQTNSXXXXXXXXXXXXXXXS*DHFSD*RTTTEDSSKTM------AESQNRFMS-------------------QHLYVTNESFIVLKNRLCVAPILDYPREDRTFILETYASFGIIGSVWSH-------VKGICY-----SLWFETYDSV*KRLLYNEEKPSRCT*ICYEF*RIFLRK---KFIIRTDHYAFVFMNTTKTPI*PQFQT*LANLA----EYDFELKYKKGEEHSNADGLSRL 1938
            ME  I   + AK+I+   S   A    V KKDGS+R C+DYRGLN+IT+K ++ +       + L  A  F+ +DL  AY+ V + P  + +TAF+   G F +  L   LS AP  FQ L++ VL +M+ + + VYLDDILI+  S ++H + +  + +R+   GL +  EKC F+   + FLGH  + E ++ + +  +                      T DS K +      A    RF+                    +       +F  LK     APIL  P   R F++E  AS   +G++ S        +    Y     S     YD   + LL  +        +  E  R +L      FI+ TDH    ++ + K     +  +  A  A     ++F + Y+ G ++   D LSRL
Sbjct:  514 MEKYISDSLAAKIIRPSSSPAGAGFFFVKKKDGSLRPCIDYRGLNSITVKNTYPLPLMSSAFERLQGANFFTKLDLRNAYHLVRIRPGDEWKTAFNTPRGHFEYCVLPFGLSNAPAVFQALVNDVLRDMIDQFIYVYLDDILIFSHSLQEHVQHVRRVLQRLLENGLYVKAEKCVFHAQSVQFLGHIVSVEGMRMDPEKIQAVVDW----------------PTPDSRKALQRFLGFANFYRRFIRNFSQLAAPLTSLTSSKMPFRWSSAAEAAFSKLKGCFVSAPILIAPDPSRQFVVEVDASEVGVGAILSQRSSSDGKIHPCAYFSHRLSPAERNYDIGNRELLAVK--------LALEEWRHWLEGSGVPFIVWTDHKNLEYIRSAK-----RLNSRQARWALFFGRFNFTISYRPGSKNIKPDALSRL 917          
BLAST of Transposon Ty3-I Gag-Pol polyprotein vs. Ensembl Zebrafish
Match: CR749164.1 (pep chromosome:GRCz11:21:30355767:30361679:1 gene:ENSDARG00000116832.1 transcript:ENSDART00000189948.1 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:CR749164.1)

HSP 1 Score: 130.568 bits (327), Expect = 1.085e-30
Identity = 113/426 (26.53%), Postives = 191/426 (44.84%), Query Frame = 1
Query:  739 IHGVNQCTEKRMEDLIKKLIKAKVIQRCKSSWNARLVIVGKKDGSIRMCVDYRGLNAITLKESFSMSNTKFLLDCLTDAIIFSSIDLDQAYYQVELAPDIQERTAFSIREGQFCFNRLLVRLSTAPTTFQ*LMHTVLEEMLLKGVVVYLDDILIYRKSKKDHDELLEELFKRIQMAGLKINPEKCEFNKTELCFLGHTFNCESIQTNSXXXXXXXXXXXXXXXS-----------*DHFSD*RTTTEDSSKTMAESQNRFMSQHLYVTNESFIVLKNRLCVAPILDYPREDRTFILETYASFGIIGSVWSH---VKGICYSLWF---------ETYDSV*KRLLYNEEKPSRCT*ICYEF*RIFL---RKKFIIRTDHYAFVFMNTTKTPI*PQFQT*LANLAEYDFELKYKKGEEHSNADGLSRL 1938
            I  ++Q   + M+  I + ++   I+   S  +A    V KKDGS+R C+DYRGLN IT+K  + +      L+ L  A  F+ +DL  AY  + +    + +T FS  +G + +  +   L+ +P+ FQ  ++ +  +ML K V+VY+DDIL+Y  S  +H + +  + KR+    L     KCEF++T + FLG+  + E +  + +      Q  Q                   F    ++       M ++ N  +  +      +F  LK R   APIL +P  ++ F++E YAS   IG++ S    V    +   F           YD   + LL  +           E  R +L   +  FI+ TDH    ++ + K  + P+          +DF++ Y  G ++  AD LSRL
Sbjct:  522 IFPLSQPETEAMKKYISEELEKGFIRPSTSPASAGFFFVKKKDGSLRPCIDYRGLNEITVKYRYPLPLVPAALEQLRSAQYFTKLDLRSAYNLIRIRQGDEWKTGFSTIDGHYEYLVMPFGLANSPSVFQAFVNEIFRDMLNKWVIVYIDDILVYSNSLSEHIQHVRAVLKRLIKNQLYAKSSKCEFHQTCISFLGYIISPEGVAMDQQKVDSVTQWPQPETIRQLQRFLGFANFYRRFIRNFSSVAAPLTAMVKANNARLKWNPDAV-RAFTQLKTRFSSAPILRHPDPEQPFVVEIYASNTGIGAILSQRSLVNKKLHPCAFYSRKLNSAERNYDVGNRELLAMK--------AALEEWRHWLEGAKHPFIVITDHKNLEYIRSCKR-LNPRQARWALFFTRFDFQVTYIPGSKNIKADALSRL 937          
BLAST of Transposon Ty3-I Gag-Pol polyprotein vs. Ensembl Xenopus
Match: ENSXETT00000006041.1 (pep primary_assembly:Xenopus_tropicalis_v9.1:6:37317867:37322724:1 gene:ENSXETG00000003070.1 transcript:ENSXETT00000006041.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 156.377 bits (394), Expect = 1.472e-43
Identity = 77/200 (38.50%), Postives = 129/200 (64.50%), Query Frame = 1
Query:  772 MEDL---IKKLIKAKVIQRCKSSWNARLVIVGKKDGSIRMCVDYRGLNAITLKESFSMSNTKFLLDCLTDAIIFSSIDLDQAYYQVELAPDIQERTAFSIREGQFCFNRLLVRLSTAPTTFQ*LMHTVLEEMLLKGVVVYLDDILIYRKSKKDHDELLEELFKRIQMAGLKINPEKCEFNKTELCFLGHTFNCESIQTNS 1362
            +EDL   +++L  A +I+  +S + + +V+V KK+GSIRMCVDYR LN  T+ + ++    +  L+CL  +  FS +DL   YYQ+ + P+ +E+TAF    G F FNR+   L  AP TFQ LM   + +M L  V+VYLDD++++ ++ ++H++ L ++F R++  GLK++PEKC+F +  + ++GH  + E I T+ 
Sbjct:  339 LEDLRKHLEELKAAGIIKESRSPYASPIVVVRKKNGSIRMCVDYRTLNQRTIPDQYTTPRIEDALNCLVGSKWFSVLDLRSGYYQLPMHPEDKEKTAFICPLGFFEFNRMPQGLCGAPATFQRLMERTVGDMHLLEVLVYLDDLIVFGRTLEEHEQRLLKVFDRLEKEGLKLSPEKCQFCQPSVNYVGHVVSAEGIATDP 538          

HSP 2 Score: 41.5874 bits (96), Expect = 1.472e-43
Identity = 15/41 (36.59%), Postives = 26/41 (63.41%), Query Frame = 3
Query: 1362 QVEEIEKAEEPKCSKQLRSFLRLTNYYRRFIKDYGRIAEPF 1484
            ++E +    +P+   +LRSFL    YYRRF+K + ++A+P 
Sbjct:  540 KIEAVSSWPKPRTITELRSFLGFCGYYRRFVKGFSKVAQPL 580          
BLAST of Transposon Ty3-I Gag-Pol polyprotein vs. Ensembl Xenopus
Match: anxa6 (annexin A6 [Source:Xenbase;Acc:XB-GENE-989741])

HSP 1 Score: 159.844 bits (403), Expect = 2.151e-40
Identity = 117/411 (28.47%), Postives = 200/411 (48.66%), Query Frame = 1
Query:  748 VNQCTEKRMEDLIKKLIKAKVIQRCKSSWNARLVIVGKKDGSIRMCVDYRGLNAITLKESFSMSNTKFLLDCLTDAIIFSSIDLDQAYYQVELAPDIQERTAFSIREGQFCFNRLLVRLSTAPTTFQ*LMHTVLEEMLLKGVVVYLDDILIYRKSKKDHDELLEELFKRIQMAGLKINPEKCEFNKTELCFLGHTFNCESIQTNSX--------XXXXXXXXXXXXXXS*DHFSD*RTTTEDSSKTMAESQNRFMSQHLYVTNE---SFIVLKNRLCVAPILDYPREDRTFILETYASFGIIGSVWSHVK--GICYSLWFETYDSV*KRLLYNE-EKPSRCT*ICYEF*RI---FLRKKFIIRTDHYAFVFMNTTKTPI*PQFQT*LANLAEYDFELKYKKGEEHSNADGL 1929
            V +     M+  I +++   VI    S W + +V+V KKDGS R CVDYR LN +T  +++ M     LLD L +A   +++DL + Y+Q+ LAP  QE++AF    G + F  +   +  AP TFQ L++ +LE M       YLDDI ++ ++ ++H + L+ +F +IQ AGL + PEKC     E+ +LGH      ++ +               +++      +  ++          +K + +  +R  S+ +  T E   +   LK  L  +P+L  P   R FIL+T AS   +G+V S V   G  + + + +   + +   Y   EK   C  I +   ++      ++F + TDH    ++           +  L  L +Y+F ++++KG+EH NADGL
Sbjct:  345 VAEAVRPEMKSQIDEMLAFGVITPSHSPWASPVVLVPKKDGSTRFCVDYRRLNDVTTTDAYPMPRVDELLDRLGNAKYLTTLDLSRGYWQIPLAPSAQEKSAFLTPFGLYQFTVMPFGMRNAPATFQRLVNRLLEGM-QDFAQAYLDDIAVFSQTWEEHLQHLQRVFAQIQDAGLTLKPEKCHLAMAEVQYLGHRVGGGQLRPDPAKVEAICQWPIPKTQKQVLAFLGTSGYYRKFIPNYSTVAKPLTDLTSRQRSRTIVWTPECESAMNALKQALASSPVLAAPDFSRRFILQTDASNFGLGAVLSQVNTYGEEHPVAYLSRKLLPREAAYATIEK--ECLAIVWALQKLQPYLYGREFTVVTDHNPLSWLQRVSGDNGKLLRWSLL-LQQYNFTIQHRKGKEHHNADGL 751          
BLAST of Transposon Ty3-I Gag-Pol polyprotein vs. Ensembl Xenopus
Match: alkbh5 (alkB homolog 5, RNA demethylase [Source:Xenbase;Acc:XB-GENE-987580])

HSP 1 Score: 129.798 bits (325), Expect = 4.885e-36
Identity = 73/221 (33.03%), Postives = 118/221 (53.39%), Query Frame = 1
Query:  670 DIIEKFGVKYDTRCGRQEVQ*CNIHGVNQCTEKRMEDLIKKLIKAKVIQRCKSSWNARLVIVGKKDGSIRMCVDYRGLNAITLKESFSMSNTKFLLDCLTDAIIFSSIDLDQAYYQVELAPDIQERTAFSIREGQFCFNRLLVRLSTAPTTFQ*LMHTVLEEMLLKGVV-VYLDDILIYRKSKKDHDELLEELFKRIQMAGLKINPEKCEFNKTELCFLGH 1329
            DII   GVK + R  R          + +   + +   IK++++  VI+   S W++ +V+V K DGSIR C D+R LN ++  +++ M     L++ L  A   +++DL + Y+QV L    +E+TAFS  EGQ+ + RL   L  AP TFQ +M  +L+    +G    YLDD++I+    + H   ++ +   I  AGL  NP+KC     E  +LG+
Sbjct:  227 DIITGPGVKVNVRPYR----------IPEARRQAVAGEIKRMLELDVIEESHSEWSSPIVLVPKPDGSIRFCNDFRKLNEVSKFDAYPMPRVDELIERLGQARYITTLDLTKGYWQVPLTEGAKEKTAFSTPEGQWQYKRLPFGLHGAPATFQRMMDRILKPH--RGYASAYLDDVVIFSPDWESHLPRVQAVLDSIWKAGLTANPKKCAMGLEEARYLGY 435          

HSP 2 Score: 43.1282 bits (100), Expect = 4.885e-36
Identity = 16/45 (35.56%), Postives = 28/45 (62.22%), Query Frame = 3
Query: 1362 QVEEIEKAEEPKCSKQLRSFLRLTNYYRRFIKDYGRIAEPFYEST 1496
            ++E I++   P   KQ+R+FL +  YYRRF+ ++  +A P  + T
Sbjct:  448 KIEGIQQWPRPNSKKQVRAFLGIVGYYRRFVPNFASLASPLTDLT 492          
BLAST of Transposon Ty3-I Gag-Pol polyprotein vs. Ensembl Xenopus
Match: ENSXETT00000034712.1 (pep primary_assembly:Xenopus_tropicalis_v9.1:9:33567219:33572531:-1 gene:ENSXETG00000011772.1 transcript:ENSXETT00000034712.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 115.931 bits (289), Expect = 5.868e-30
Identity = 65/197 (32.99%), Postives = 104/197 (52.79%), Query Frame = 1
Query:  772 MEDLIKKLIKAKVIQRCKSSWNARLVIVGKKDGSIRMCVDYRGLNAITLKESFSMSNTKFLLDCLTDAIIFSSIDLDQAYYQVELAPDIQERTAFSIREGQFCFNRLLVRLSTAPTTFQ*LMHTVLEEMLLKGVVVYLDDILIYRKSKKDHDELLEELFKRIQMAGLKINPEKCEFNKTELCFLGHTFNCESIQTNS 1362
            M++ I + ++   I+   S   A    V KKDG +R C+DYRGLN IT+K  + +     L D L  A IFS +DL  AY  + +    + +TAF+ R+G + +  +   L  AP  FQ  ++ +  ++L K VVVYLDDILI+ +  + H   ++E   R++   L    EKC F   ++ FLG+  +    + + 
Sbjct:  536 MKEYISENLQRGFIRPSTSPAGAGFFFVEKKDGGLRPCIDYRGLNKITVKNRYPLPLISELFDQLKGAKIFSKLDLRGAYNLIRIREGDEWKTAFNTRDGHYEYLVMPFGLCNAPAVFQEFVNDIFRDLLGKSVVVYLDDILIFSQDLETHRSQVKEALSRLRENFLFAKLEKCTFEVPKISFLGYIISSRGFEMDP 732          

HSP 2 Score: 36.5798 bits (83), Expect = 5.868e-30
Identity = 17/39 (43.59%), Postives = 26/39 (66.67%), Query Frame = 3
Query: 1362 QVEEIEKAEEPKCSKQLRSFLRLTNYYRRFIKDY-GRIA 1475
            +V  I+K   P+ +K ++ F+   NYYR+FIKD+  RIA
Sbjct:  734 KVSAIQKWPLPQSTKAIQRFIGFANYYRQFIKDFSSRIA 772          
BLAST of Transposon Ty3-I Gag-Pol polyprotein vs. Ensembl Xenopus
Match: ENSXETT00000035398.1 (pep primary_assembly:Xenopus_tropicalis_v9.1:3:9869556:9871940:-1 gene:ENSXETG00000011182.1 transcript:ENSXETT00000035398.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 117.857 bits (294), Expect = 8.589e-30
Identity = 65/197 (32.99%), Postives = 104/197 (52.79%), Query Frame = 1
Query:  772 MEDLIKKLIKAKVIQRCKSSWNARLVIVGKKDGSIRMCVDYRGLNAITLKESFSMSNTKFLLDCLTDAIIFSSIDLDQAYYQVELAPDIQERTAFSIREGQFCFNRLLVRLSTAPTTFQ*LMHTVLEEMLLKGVVVYLDDILIYRKSKKDHDELLEELFKRIQMAGLKINPEKCEFNKTELCFLGHTFNCESIQTNS 1362
            M++ I + ++   I+   S   A    V KKDG +R C+DYRGLN IT+K  + +     L D L  A IFS +DL  AY  + +    + +TAF+ R+G + +  +   L  AP  FQ  ++ +  ++L K VVVYLDDILI+ +  + H   ++E   R++   L    EKC F   ++ FLG+  +    + + 
Sbjct:   18 MKEYISENLQRGFIRPSTSPAGAGFFFVEKKDGGLRPCIDYRGLNKITVKNRYPLPLISELFDQLKGAKIFSKLDLRGAYNLIRIREGDEWKTAFNTRDGHYEYLVMPFGLCNAPAVFQEFVNDIFRDLLGKSVVVYLDDILIFSQDLETHRSQVKEALSRLRENSLFAKLEKCTFEVPKISFLGYIISSRGFEMDP 214          

HSP 2 Score: 33.8834 bits (76), Expect = 8.589e-30
Identity = 16/39 (41.03%), Postives = 25/39 (64.10%), Query Frame = 3
Query: 1362 QVEEIEKAEEPKCSKQLRSFLRLTNYYRRFIKDY-GRIA 1475
            +V  I+K   P+ +K ++ F+   NYYR+FIK +  RIA
Sbjct:  216 KVSAIQKWPLPQSTKAIQRFIGFANYYRQFIKGFSSRIA 254          
BLAST of Transposon Ty3-I Gag-Pol polyprotein vs. UniProt/SwissProt
Match: sp|P20825|POL2_DROME (Retrovirus-related Pol polyprotein from transposon 297 OS=Drosophila melanogaster OX=7227 GN=pol PE=4 SV=1)

HSP 1 Score: 148.673 bits (374), Expect = 1.034e-35
Identity = 125/441 (28.34%), Postives = 211/441 (47.85%), Query Frame = 1
Query:  754 QCTEKRMEDLIKKLIKAKVIQRCKSSWNARLVIVGKK-DGS----IRMCVDYRGLNAITLKESFSMSNTKFLLDCLTDAIIFSSIDLDQAYYQVELAPDIQERTAFSIREGQFCFNRLLVRLSTAPTTFQ*LMHTVLEEMLLKGVVVYLDDILIYRKSKKDHDELLEELFKRIQMAGLKINPEKCEFNKTELCFLGHTFNCESIQTNSXXXXXXXXXXXXXXXS--------*DHFSD*RTTTEDSSKTMA---ESQNRFMSQHL-YVTNESFIVLKNRLCVAPILDYPREDRTFILETYASFGIIGSVWSHVKGICYSLWFET-------YDSV*KRLLYNEEKPSRCT*ICYEF*RIFLRKKFIIRTDHYAFVFMNTTKTPI*PQFQT*LANLAEYDFELKYKKGEEHSNADGLSRLKGMICTKRQTRHEESKEGKSNI 2004
            Q  E  +E+ +++++   +I+   S +N+   +V KK D S     R+ +DYR LN IT+ + + + N   +L  L     F++IDL + ++Q+E+  +   +TAFS + G + + R+   L  AP TFQ  M+ +L  +L K  +VYLDDI+I+  S  +H   ++ +F ++  A LK+  +KCEF K E  FLGH    + I+ N    K         ++           ++        D +K M    + + +  +Q L Y+  E+F  LK  +   PIL  P  ++ F+L T AS   +G+V S   G   S    T       Y ++ K LL               F    L ++F+I +DH    +++  K P   + +     L+EY F++ Y KG+E+S AD LSR+K       +     ++E  SN+
Sbjct:  216 QTHEIEVENQVQEMLNQGLIRESNSPYNSPTWVVPKKPDASGANKYRVVIDYRKLNEITIPDRYPIPNMDEILGKLGKCQYFTTIDLAKGFHQIEMDEESISKTAFSTKSGHYEYLRMPFGLRNAPATFQRCMNNILRPLLNKHCLVYLDDIIIFSTSLTEHLNSIQLVFTKLADANLKLQLDKCEFLKKEANFLGHIVTPDGIKPNPIKVKAIVSYPIPTKDKEIRAFLGLTGYYRKFIPNYADIAKPMTSCLKKRTKIDTQKLEYI--EAFEKLKALIIRDPILQLPDFEKKFVLTTDASNLALGAVLSQ-NGHPISFISRTLNDHELNYSAIEKELL-------AIVWATKTFRHYLLGRQFLIASDHQPLRWLHNLKEPG-AKLERWRVRLSEYQFKIDYIKGKENSVADALSRIKIEENHHSEATQHSAEEDNSNL 645          
BLAST of Transposon Ty3-I Gag-Pol polyprotein vs. UniProt/SwissProt
Match: sp|P04323|POL3_DROME (Retrovirus-related Pol polyprotein from transposon 17.6 OS=Drosophila melanogaster OX=7227 GN=pol PE=4 SV=1)

HSP 1 Score: 145.976 bits (367), Expect = 8.859e-35
Identity = 122/420 (29.05%), Postives = 199/420 (47.38%), Query Frame = 1
Query:  754 QCTEKRMEDLIKKLIKAKVIQRCKSSWNARLVIVGKK-DGS----IRMCVDYRGLNAITLKESFSMSNTKFLLDCLTDAIIFSSIDLDQAYYQVELAPDIQERTAFSIREGQFCFNRLLVRLSTAPTTFQ*LMHTVLEEMLLKGVVVYLDDILIYRKSKKDHDELLEELFKRIQMAGLKINPEKCEFNKTELCFLGHTFNCESIQTNSXXXXXXXXXXXXXXXS--------*DHFSD*RTTTEDSSKTMAESQNRFMSQHLYVTNE----SFIVLKNRLCVAPILDYPREDRTFILETYASFGIIGSVWSHVKGICYSLWFET-------YDSV*KRLLYNEEKPSRCT*ICYEF*RIFLRKKFIIRTDHYAFVFMNTTKTPI*PQFQT*LANLAEYDFELKYKKGEEHSNADGLSRLK 1941
            Q  E+ +E  I+ ++   +I+   S +N+ + +V KK D S     R+ +DYR LN IT+ +   + N   +L  L     F++IDL + ++Q+E+ P+   +TAFS + G + + R+   L  AP TFQ  M+ +L  +L K  +VYLDDI+++  S  +H + L  +F+++  A LK+  +KCEF K E  FLGH    + I+ N +  +  ++     +            ++        D +K M +   + M   +  TN     +F  LK  +   PIL  P   + F L T AS   +G+V S   G   S    T       Y ++ K LL               F    L + F I +DH    ++   K P   +       L+E+DF++KY KG+E+  AD LSR+K
Sbjct:  217 QAYEQEVESQIQDMLNQGIIRTSNSPYNSPIWVVPKKQDASGKQKFRIVIDYRKLNEITVGDRHPIPNMDEILGKLGRCNYFTTIDLAKGFHQIEMDPESVSKTAFSTKHGHYEYLRMPFGLKNAPATFQRCMNDILRPLLNKHCLVYLDDIIVFSTSLDEHLQSLGLVFEKLAKANLKLQLDKCEFLKQETTFLGHVLTPDGIKPNPEKIEAIQKYPIPTKPKEIKAFLGLTGYYRKFIPNFADIAKPMTKCLKKNMK--IDTTNPEYDSAFKKLKYLISEDPILKVPDFTKKFTLTTDASDVALGAVLSQ-DGHPLSYISRTLNEHEINYSTIEKELL-------AIVWATKTFRHYLLGRHFEISSDHQPLSWLYRMKDPN-SKLTRWRVKLSEFDFDIKYIKGKENCVADALSRIK 625          
BLAST of Transposon Ty3-I Gag-Pol polyprotein vs. UniProt/SwissProt
Match: sp|Q99315|YG31B_YEAST (Transposon Ty3-G Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=TY3B-G PE=1 SV=3)

HSP 1 Score: 136.346 bits (342), Expect = 1.296e-31
Identity = 121/445 (27.19%), Postives = 212/445 (47.64%), Query Frame = 1
Query:  658 IGGIDIIEKFGVKYDTRCGRQEVQ*CNIHGVNQCTEKRMEDLIKKLIKAKVIQRCKSSWNARLVIVGKKDGSIRMCVDYRGLNAITLKESFSMSNTKFLLDCLTDAIIFSSIDLDQAYYQVELAPDIQERTAFSIREGQFCFNRLLVRLSTAPTTFQ*LMHTVLEEMLLKGVVVYLDDILIYRKSKKDHDELLEELFKRIQMAGLKINPEKCEFNKTELCFLGHTFN----------CESIQTNSXXXXXXXXXXXXXXXS*DHFSD*RTTTEDSSKTMAESQNRFM---SQHLYVTNESFIVLKNRLCVAPILDYPREDRTFILETYASFGIIGSVWSHVK------GICYSLWFETYDSV*KRLLYNEEKPSRCT*ICYEF*RIFLRKKFIIRTDHYAFVFMNTTKTPI*PQFQT*LANLAEYDFELKYKKGEEHSNADGLSR 1935
            I  I +     +K   R  R +      + V +  E+ +  +++KL+  K I   KS  ++ +V+V KKDG+ R+CVDYR LN  T+ + F +     LL  + +A IF+++DL   Y+Q+ + P  + +TAF    G++ +  +   L  AP+TF   M     +  L+ V VYLDDILI+ +S ++H + L+ + +R++   L +  +KC+F   E  FLG++            C +I+     K +++ +        +++   R    + SK +A+    F+   SQ     +++   LK+ LC +P+L        + L T AS   IG+V   V       G+    + ++ +S  K     E +        + F  +   K F +RTDH + + +     P   + Q  L +LA YDF L+Y  G ++  AD +SR
Sbjct:  579 INNIPVKHDIEIKPGARLPRLQP-----YHVTEKNEQEINKIVQKLLDNKFIVPSKSPCSSPVVLVPKKDGTFRLCVDYRTLNKATISDPFPLPRIDNLLSRIGNAQIFTTLDLHSGYHQIPMEPKDRYKTAFVTPSGKYEYTVMPFGLVNAPSTFARYMADTFRD--LRFVNVYLDDILIFSESPEEHWKHLDTVLERLKNENLIVKKKKCKFASEETEFLGYSIGIQKIAPLQHKCAAIRDFPTPKTVKQAQRFLGMI--NYY---RRFIPNCSK-IAQPIQLFICDKSQWTEKQDKAIDKLKDALCNSPVLVPFNNKANYRLTTDASKDGIGAVLEEVDNKNKLVGVV-GYFSKSLESAQKNYPAGELELLGIIKALHHFRYMLHGKHFTLRTDHISLLSLQNKNEPA-RRVQRWLDDLATYDFTLEYLAGPKNVVADAISR 1008          
BLAST of Transposon Ty3-I Gag-Pol polyprotein vs. UniProt/SwissProt
Match: sp|Q7LHG5|YI31B_YEAST (Transposon Ty3-I Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=TY3B-I PE=1 SV=2)

HSP 1 Score: 135.576 bits (340), Expect = 2.035e-31
Identity = 121/445 (27.19%), Postives = 211/445 (47.42%), Query Frame = 1
Query:  658 IGGIDIIEKFGVKYDTRCGRQEVQ*CNIHGVNQCTEKRMEDLIKKLIKAKVIQRCKSSWNARLVIVGKKDGSIRMCVDYRGLNAITLKESFSMSNTKFLLDCLTDAIIFSSIDLDQAYYQVELAPDIQERTAFSIREGQFCFNRLLVRLSTAPTTFQ*LMHTVLEEMLLKGVVVYLDDILIYRKSKKDHDELLEELFKRIQMAGLKINPEKCEFNKTELCFLGHTFN----------CESIQTNSXXXXXXXXXXXXXXXS*DHFSD*RTTTEDSSKTMAESQNRFM---SQHLYVTNESFIVLKNRLCVAPILDYPREDRTFILETYASFGIIGSVWSHVK------GICYSLWFETYDSV*KRLLYNEEKPSRCT*ICYEF*RIFLRKKFIIRTDHYAFVFMNTTKTPI*PQFQT*LANLAEYDFELKYKKGEEHSNADGLSR 1935
            I  I +     +K   R  R +      + V +  E+ +  +++KL+  K I   KS  ++ +V+V KKDG+ R+CVDYR LN  T+ + F +     LL  + +A IF+++DL   Y+Q+ + P  + +TAF    G++ +  +   L  AP+TF   M     +  L+ V VYLDDILI+ +S ++H + L+ + +R++   L +  +KC+F   E  FLG++            C +I+     K +++ +        +++   R    + SK +A+    F+   SQ     +++   LK  LC +P+L        + L T AS   IG+V   V       G+    + ++ +S  K     E +        + F  +   K F +RTDH + + +     P   + Q  L +LA YDF L+Y  G ++  AD +SR
Sbjct:  605 INNIPVKHDIEIKPGARLPRLQP-----YHVTEKNEQEINKIVQKLLDNKFIVPSKSPCSSPVVLVPKKDGTFRLCVDYRTLNKATISDPFPLPRIDNLLSRIGNAQIFTTLDLHSGYHQIPMEPKDRYKTAFVTPSGKYEYTVMPFGLVNAPSTFARYMADTFRD--LRFVNVYLDDILIFSESPEEHWKHLDTVLERLKNENLIVKKKKCKFASEETEFLGYSIGIQKIAPLQHKCAAIRDFPTPKTVKQAQRFLGMI--NYY---RRFIPNCSK-IAQPIQLFICDKSQWTEKQDKAIEKLKAALCNSPVLVPFNNKANYRLTTDASKDGIGAVLEEVDNKNKLVGVV-GYFSKSLESAQKNYPAGELELLGIIKALHHFRYMLHGKHFTLRTDHISLLSLQNKNEPA-RRVQRWLDDLATYDFTLEYLAGPKNVVADAISR 1034          
BLAST of Transposon Ty3-I Gag-Pol polyprotein vs. UniProt/SwissProt
Match: sp|P10394|POL4_DROME (Retrovirus-related Pol polyprotein from transposon 412 OS=Drosophila melanogaster OX=7227 GN=POL PE=4 SV=1)

HSP 1 Score: 106.686 bits (265), Expect = 1.898e-29
Identity = 62/188 (32.98%), Postives = 101/188 (53.72%), Query Frame = 1
Query:  784 IKKLIKAKVIQRCKSSWNARLVIVGKKDGS------IRMCVDYRGLNAITLKESFSMSNTKFLLDCLTDAIIFSSIDLDQAYYQVELAPDIQERTAFSIREGQFCFNRLLVRLSTAPTTFQ*LMHTVLEEMLLKGVVVYLDDILIYRKSKKDHDELLEELFKRIQMAGLKINPEKCEFNKTELCFLGH 1329
            ++KLIK K+++   S +N+ L++V KK          R+ +DYR +N   L + F +     +LD L  A  FS +DL   ++Q+EL    ++ T+FS   G + F RL   L  AP +FQ +M      +      +Y+DD+++   S+K   + L E+F + +   LK++PEKC F   E+ FLGH
Sbjct:  334 VQKLIKDKIVEPSVSQYNSPLLLVPKKSSPNSDKKKWRLVIDYRQINKKLLADKFPLPRIDDILDQLGRAKYFSCLDLMSGFHQIELDEGSRDITSFSTSNGSYRFTRLPFGLKIAPNSFQRMMTIAFSGIEPSQAFLYMDDLIVIGCSEKHMLKNLTEVFGKCREYNLKLHPEKCSFFMHEVTFLGH 521          

HSP 2 Score: 38.1206 bits (87), Expect = 1.898e-29
Identity = 38/147 (25.85%), Postives = 65/147 (44.22%), Query Frame = 1
Query: 1513 ESFIVLKNRLCVAPILDYPREDRTFILETYASFGIIGSVWS-----HVKGICYSLWFETYDSV*KRLLYNEEKPSRCT*ICYEF*RIFLRKKFIIRTDHYAFVFMNTTKTPI*PQFQT*LANLAEYDFELKYKKGEEHSNADGLSRL 1938
            ++FI LK++L    +L YP   + F + T AS    G+V +     H   + Y+    T     K     E++ +        F      K F ++TDH    ++ +   P   +       L EY+F ++Y KG+++  AD LSR+
Sbjct:  592 KAFIHLKSQLINPTLLQYPDFSKEFCITTDASKQACGAVLTQNHNGHQLPVAYASRAFTKGESNKST--TEQELAAIHWAIIHFRPYIYGKHFTVKTDHRPLTYLFSMVNPS-SKLTRIRLELEEYNFTVEYLKGKDNHVADALSRI 735          

HSP 3 Score: 27.7202 bits (60), Expect = 1.898e-29
Identity = 12/31 (38.71%), Postives = 17/31 (54.84%), Query Frame = 3
Query: 1374 IEKAEEPKCSKQLRSFLRLTNYYRRFIKDYG 1466
            I+    P  +   R F+   NYYRRFIK++ 
Sbjct:  538 IQNYPVPHDADSARRFVAFCNYYRRFIKNFA 568          
BLAST of Transposon Ty3-I Gag-Pol polyprotein vs. TrEMBL
Match: A0A4Y2PDL7 (Retrovirus-related Pol polyprotein from transposon 297 (Fragment) OS=Araneus ventricosus OX=182803 GN=pol_1756 PE=4 SV=1)

HSP 1 Score: 162.54 bits (410), Expect = 2.611e-57
Identity = 75/196 (38.27%), Postives = 125/196 (63.78%), Query Frame = 1
Query:  775 EDLIKKLIKAKVIQRCKSSWNARLVIVGKKDGSIRMCVDYRGLNAITLKESFSMSNTKFLLDCLTDAIIFSSIDLDQAYYQVELAPDIQERTAFSIREGQFCFNRLLVRLSTAPTTFQ*LMHTVLEEMLLKGVVVYLDDILIYRKSKKDHDELLEELFKRIQMAGLKINPEKCEFNKTELCFLGHTFNCESIQTNS 1362
            E L+K+++   +I+     W + +V+V KKDGS R CVDYR LN IT+K+S+ +      LD L  +  FS++DL   Y+QVE+ P+ +E+TAF+  +G + F  +   L  AP TF+ LM TVL  +  +  +VYLDDI+I  ++ ++H   + ++F+R+Q A LK++P+KC F + E+ +LGH  + + ++T+ 
Sbjct:  718 ERLVKEMVDNGIIEESSGPWASPIVLVKKKDGSTRFCVDYRKLNEITIKDSYPLPRIDDTLDALNGSQWFSTLDLKSGYWQVEIQPEDKEKTAFTTGQGLWQFKVMPFGLCNAPATFERLMETVLRGLTSEACLVYLDDIIIVGRTFQEHLNNIRKVFQRLQKANLKLSPKKCRFFRKEVSYLGHIISADGVKTDP 913          

HSP 2 Score: 72.4034 bits (176), Expect = 2.611e-57
Identity = 65/194 (33.51%), Postives = 88/194 (45.36%), Query Frame = 1
Query: 1519 FIVLKNRLCVAPILDYPREDRTFILETYASFGIIGSVWSHVKGI--CYSLWFETYDSV*KRLLYNEEKPSRCT*ICYE-----------F*RIFLRKKFIIRTDHYAFVFMNTTKTPI*PQFQT*LANLAEYDFELKYKKGEEHSNADGLSRLKGMICTKRQTRHEESKEGKSNIRYVYSIKRTETMEKYWSSS 2061
            F  LK  L   P+L YPR D+ FIL+T AS   IG+V S   G   C   +F       K L     KP R   +  +           F      +KF++RTDH +  ++   + P   Q    +  L EYDFE++++KG  H NAD LSR     C K   +H  + E K  +    S+K   T E  WSSS
Sbjct:  975 FNSLKQALITPPVLTYPRTDKEFILDTDASNEGIGAVLSQKIGNEECVIAYFS------KSL----GKPERNYCVTRKELLAIVKSIEHFHHYLYGRKFLLRTDHASLRWLLNFREPE-GQIARWIQRLQEYDFEIQHRKGTSHGNADALSRRP---C-KENCKHCTNAEKKFGMETDISVK-VLTTEDAWSSS 1152          

HSP 3 Score: 39.6614 bits (91), Expect = 2.611e-57
Identity = 20/48 (41.67%), Postives = 29/48 (60.42%), Query Frame = 3
Query: 1392 PKCSKQLRSFLRLTNYYRRFIKDYGRIAEPFYESTSVCDK*KFHSTEE 1535
            P+    LRSFL L  YYRRF++++  IA P ++ T    +  F+ TEE
Sbjct:  925 PETVHDLRSFLGLCTYYRRFVRNFSAIARPLHKLTEA--RSNFNWTEE 970          
BLAST of Transposon Ty3-I Gag-Pol polyprotein vs. TrEMBL
Match: A0A4Y2LPA5 (Transposon Ty3-I Gag-Pol polyprotein OS=Araneus ventricosus OX=182803 GN=TY3B-I_314 PE=4 SV=1)

HSP 1 Score: 162.54 bits (410), Expect = 2.838e-57
Identity = 75/196 (38.27%), Postives = 125/196 (63.78%), Query Frame = 1
Query:  775 EDLIKKLIKAKVIQRCKSSWNARLVIVGKKDGSIRMCVDYRGLNAITLKESFSMSNTKFLLDCLTDAIIFSSIDLDQAYYQVELAPDIQERTAFSIREGQFCFNRLLVRLSTAPTTFQ*LMHTVLEEMLLKGVVVYLDDILIYRKSKKDHDELLEELFKRIQMAGLKINPEKCEFNKTELCFLGHTFNCESIQTNS 1362
            E L+K+++   +I+     W + +V+V KKDGS R CVDYR LN IT+K+S+ +      LD L  +  FS++DL   Y+QVE+ P+ +E+TAF+  +G + F  +   L  AP TF+ LM TVL  +  +  +VYLDDI+I  ++ ++H   + ++F+R+Q A LK++P+KC F + E+ +LGH  + + ++T+ 
Sbjct:  282 ERLVKEMVDNGIIEESSGPWASPIVLVKKKDGSTRFCVDYRKLNEITIKDSYPLPRIDDTLDALNGSQWFSTLDLKSGYWQVEIQPEDKEKTAFTTGQGLWQFKVMPFGLCNAPATFERLMETVLRGLTSEACLVYLDDIIIVGRTFQEHLNNIRKVFQRLQKANLKLSPKKCRFFRKEVSYLGHIISADGVKTDP 477          

HSP 2 Score: 72.4034 bits (176), Expect = 2.838e-57
Identity = 66/196 (33.67%), Postives = 91/196 (46.43%), Query Frame = 1
Query: 1513 ESFIVLKNRLCVAPILDYPREDRTFILETYASFGIIGSVWSHVKGI--CYSLWFETYDSV*KRLLYNEEKPSRCT*ICYE-----------F*RIFLRKKFIIRTDHYAFVFMNTTKTPI*PQFQT*LANLAEYDFELKYKKGEEHSNADGLSRLKGMICTKRQTRHEESKEGKSNIRYVYSIKRTETMEKYWSSS 2061
            +SF  LK  L  +P+L YPR D+ FIL+T AS   IG+V S   G   C   +F       K L     KP R   +  +           F      +KF++RTDH +  ++   + P   Q    +  L EYDFE++++KG  H NAD LSR     C K   +H  + E K  +    S+K   T E  WSSS
Sbjct:  537 KSFNSLKQALITSPVLTYPRTDKEFILDTDASNEGIGAVLSQKIGNEECVIAYFS------KSL----GKPERNYCVTRKELLAIVKSIEHFHHYLYGRKFLLRTDHASLRWLLNFREPE-GQIARWIQRLQEYDFEIQHRKGTSHGNADALSRRP---C-KENCKHCTNAEKKFGMETDISVK-VLTTEDAWSSS 716          

HSP 3 Score: 39.6614 bits (91), Expect = 2.838e-57
Identity = 20/48 (41.67%), Postives = 29/48 (60.42%), Query Frame = 3
Query: 1392 PKCSKQLRSFLRLTNYYRRFIKDYGRIAEPFYESTSVCDK*KFHSTEE 1535
            P+    LRSFL L  YYRRF++++  IA P ++ T    +  F+ TEE
Sbjct:  489 PETVHDLRSFLGLCTYYRRFVRNFSAIARPLHKLTEA--RTNFNWTEE 534          
BLAST of Transposon Ty3-I Gag-Pol polyprotein vs. TrEMBL
Match: A0A4Y2F7R8 (Transposon Ty3-I Gag-Pol polyprotein OS=Araneus ventricosus OX=182803 GN=TY3B-I_165 PE=4 SV=1)

HSP 1 Score: 162.925 bits (411), Expect = 7.605e-57
Identity = 75/196 (38.27%), Postives = 125/196 (63.78%), Query Frame = 1
Query:  775 EDLIKKLIKAKVIQRCKSSWNARLVIVGKKDGSIRMCVDYRGLNAITLKESFSMSNTKFLLDCLTDAIIFSSIDLDQAYYQVELAPDIQERTAFSIREGQFCFNRLLVRLSTAPTTFQ*LMHTVLEEMLLKGVVVYLDDILIYRKSKKDHDELLEELFKRIQMAGLKINPEKCEFNKTELCFLGHTFNCESIQTNS 1362
            E L+K+++   +I+     W + +V+V KKDGS R CVDYR LN IT+K+S+ +      LD L  +  FS++DL   Y+QVE+ P+ +E+TAF+  +G + F  +   L  AP TF+ LM TVL  +  +  +VYLDDI+I  ++ ++H   + ++F+R+Q A LK++P+KC F + E+ +LGH  + + ++T+ 
Sbjct:  574 ERLVKEMVDNGIIEESSGPWASPIVLVKKKDGSTRFCVDYRKLNEITIKDSYPLPRIDDTLDALNGSQWFSTLDLKSGYWQVEIQPEDKEKTAFTTGQGLWQFKVMPFGLCNAPATFERLMETVLRGLTSEACLVYLDDIIIVGRTFQEHLNNIRKVFQRLQKANLKLSPKKCRFFRKEVSYLGHIISADGVKTDP 769          

HSP 2 Score: 72.0182 bits (175), Expect = 7.605e-57
Identity = 65/197 (32.99%), Postives = 91/197 (46.19%), Query Frame = 1
Query: 1513 ESFIVLKNRLCVAPILDYPREDRTFILETYASFGIIGSVWSHVKGI--CYSLWFETYDSV*KRLLYNEEKPSRCT*ICYE-----------F*RIFLRKKFIIRTDHYAFVFMNTTKTPI*PQFQT*LANLAEYDFELKYKKGEEHSNADGLSRLKGMICTKRQTRHEESKEGKSNIRYVYSIKRTETMEKYWSSSR 2064
            +SF  LK  L  +P+L YPR D+ FIL+T AS   IG+V S   G   C   +F       K L     KP R   +  +           F      +KF++RTDH +  ++   + P   Q    +  L EYDFE++++KG  H NAD LSR     C K   +H  + E K  +    S+K   T E  WS +R
Sbjct:  829 KSFNSLKQALITSPVLTYPRTDKEFILDTDASNEGIGAVLSQKIGNEECVIAYFS------KSL----GKPERNYCVTRKELLAIVKSIEHFHHYLYGRKFLLRTDHASLRWLLNFREPE-GQIARWIQRLQEYDFEIQHRKGTSHGNADALSRRP---C-KESCKHCTNAEKKFGMETDISVK-VLTTEDAWSPNR 1009          

HSP 3 Score: 38.5058 bits (88), Expect = 7.605e-57
Identity = 19/48 (39.58%), Postives = 29/48 (60.42%), Query Frame = 3
Query: 1392 PKCSKQLRSFLRLTNYYRRFIKDYGRIAEPFYESTSVCDK*KFHSTEE 1535
            P+    +RSFL L  YYRRF++++  IA P ++ T    +  F+ TEE
Sbjct:  781 PETVHDVRSFLGLCTYYRRFVRNFSAIARPLHKLTEA--RSNFNWTEE 826          
BLAST of Transposon Ty3-I Gag-Pol polyprotein vs. TrEMBL
Match: A0A4Y2GV68 (Transposon Ty3-I Gag-Pol polyprotein OS=Araneus ventricosus OX=182803 GN=TY3B-I_1030 PE=4 SV=1)

HSP 1 Score: 162.925 bits (411), Expect = 1.195e-56
Identity = 75/196 (38.27%), Postives = 125/196 (63.78%), Query Frame = 1
Query:  775 EDLIKKLIKAKVIQRCKSSWNARLVIVGKKDGSIRMCVDYRGLNAITLKESFSMSNTKFLLDCLTDAIIFSSIDLDQAYYQVELAPDIQERTAFSIREGQFCFNRLLVRLSTAPTTFQ*LMHTVLEEMLLKGVVVYLDDILIYRKSKKDHDELLEELFKRIQMAGLKINPEKCEFNKTELCFLGHTFNCESIQTNS 1362
            E L+K+++   +I+     W + +V+V KKDGS R CVDYR LN IT+K+S+ +      LD L  +  FS++DL   Y+QVE+ P+ +E+TAF+  +G + F  +   L  AP TF+ LM TVL  +  +  +VYLDDI+I  ++ ++H   + ++F+R+Q A LK++P+KC F + E+ +LGH  + + ++T+ 
Sbjct:  720 ERLVKEMVDNGIIEESSGPWASPIVLVKKKDGSTRFCVDYRKLNEITIKDSYPLPRIDDTLDALNGSQWFSTLDLKSGYWQVEIQPEDKEKTAFTTGQGLWQFKVMPFGLCNAPATFERLMETVLRGLTSEACLVYLDDIIIVGRTFQEHINNIRKVFQRLQKANLKLSPKKCRFFRKEVSYLGHIISADGVKTDP 915          

HSP 2 Score: 69.707 bits (169), Expect = 1.195e-56
Identity = 53/154 (34.42%), Postives = 74/154 (48.05%), Query Frame = 1
Query: 1513 ESFIVLKNRLCVAPILDYPREDRTFILETYASFGIIGSVWSHVKGI--CYSLWFETYDSV*KRLLYNEEKPSRCT*ICYE-----------F*RIFLRKKFIIRTDHYAFVFMNTTKTPI*PQFQT*LANLAEYDFELKYKKGEEHSNADGLSR 1935
            +SF  LK  L  +P+L YPR D+ FIL+T AS   IG+V S   G   C   +F       K L     KP R   +  +           F      +KF++RTDH +  ++   + P   Q    +  L EYDFE++++KG  H NAD LSR
Sbjct:  975 KSFNSLKQALITSPVLTYPRTDKEFILDTDASNEGIGAVLSQKIGNEECVIAYFS------KSL----GKPERNYCVTRKELLAIVKSIEHFHHYLYGRKFLLRTDHASLRWLLNFREPE-GQIARWIQRLQEYDFEIQHRKGTSHGNADALSR 1117          

HSP 3 Score: 40.0466 bits (92), Expect = 1.195e-56
Identity = 20/48 (41.67%), Postives = 29/48 (60.42%), Query Frame = 3
Query: 1392 PKCSKQLRSFLRLTNYYRRFIKDYGRIAEPFYESTSVCDK*KFHSTEE 1535
            P+    LRSFL L  YYRRF++++  IA P ++ T    +  F+ TEE
Sbjct:  927 PETVHDLRSFLGLCTYYRRFVRNFSAIARPLHKLTEA--RTNFNWTEE 972          
BLAST of Transposon Ty3-I Gag-Pol polyprotein vs. TrEMBL
Match: A0A4Y1ZYF3 (Transposon Ty3-I Gag-Pol polyprotein OS=Araneus ventricosus OX=182803 GN=TY3B-I_1211 PE=4 SV=1)

HSP 1 Score: 167.548 bits (423), Expect = 1.205e-56
Identity = 77/196 (39.29%), Postives = 128/196 (65.31%), Query Frame = 1
Query:  775 EDLIKKLIKAKVIQRCKSSWNARLVIVGKKDGSIRMCVDYRGLNAITLKESFSMSNTKFLLDCLTDAIIFSSIDLDQAYYQVELAPDIQERTAFSIREGQFCFNRLLVRLSTAPTTFQ*LMHTVLEEMLLKGVVVYLDDILIYRKSKKDHDELLEELFKRIQMAGLKINPEKCEFNKTELCFLGHTFNCESIQTNS 1362
            E LIK+++  ++I+     W + +V+V KKDGS R CVDYR LN IT+K+S+ +      LD L  +  FS++DL   Y+QVE+ P+ +E+TAF+  +G + F  +   L  AP TF+ LM TVL E+  +  +VYLDDI+I  ++ ++H + + ++F+R+Q A LK++P+KC F + E+ +LGH  + + ++T+ 
Sbjct:   30 ERLIKEMVDNRIIEESSGPWASPIVLVKKKDGSTRFCVDYRKLNEITIKDSYPLPRIDDTLDALNGSQWFSTLDLKSGYWQVEIQPEDKEKTAFTTGQGLWQFKVMPFGLCNAPATFERLMETVLRELTSEACLVYLDDIIIAGRTFQEHLDNIRKVFQRLQKANLKLSPKKCRFFRKEVSYLGHIISADGVKTDP 225          

HSP 2 Score: 65.4698 bits (158), Expect = 1.205e-56
Identity = 65/196 (33.16%), Postives = 90/196 (45.92%), Query Frame = 1
Query: 1513 ESFIVLKNRLCVAPILDYPREDRTFILETYASFGIIGSVWSHVKGI--CYSLWFETYDSV*KRLLYNEEKPSRCT*ICYE-----------F*RIFLRKKFIIRTDHYAFVFMNTTKTPI*PQFQT*LANLAEYDFELKYKKGEEHSNADGLSRLKGMICTKRQTRHEESKEGKSNIRYVYSIKRTETMEKYWSSS 2061
            +SF  LK  L  +P+L Y R D+ FIL+T AS   IG+V S   G   C   +F       K L     KP R   +  +           F      +KF++RTDH +  ++   + P   Q    +  L EYDFE++++KG  H NAD LSR     C K   +H  + E K  +    S+K   T E  WSSS
Sbjct:  285 KSFNSLKQTLITSPVLTYLRTDKEFILDTDASNEGIGAVLSQKIGNEECVIAYFS------KSL----GKPERNYCVTRKELLAIVKSIEHFHHYLYGRKFLLRTDHASLRWLLNFREPE-GQIARWIQRLQEYDFEIQHRKGTSHGNADALSRRP---C-KENCKHCTNAEKKFGMETDISVK-VLTTEDAWSSS 464          

HSP 3 Score: 39.6614 bits (91), Expect = 1.205e-56
Identity = 20/48 (41.67%), Postives = 29/48 (60.42%), Query Frame = 3
Query: 1392 PKCSKQLRSFLRLTNYYRRFIKDYGRIAEPFYESTSVCDK*KFHSTEE 1535
            P+    LRSFL L  YYRRF++++  IA P ++ T    +  F+ TEE
Sbjct:  237 PETVHDLRSFLGLCTYYRRFVRNFSAIARPLHKLTEA--RSNFNWTEE 282          
BLAST of Transposon Ty3-I Gag-Pol polyprotein vs. Ensembl Cavefish
Match: ENSAMXT00000034038.1 (pep primary_assembly:Astyanax_mexicanus-2.0:14:3120146:3124090:1 gene:ENSAMXG00000040885.1 transcript:ENSAMXT00000034038.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 147.902 bits (372), Expect = 4.811e-48
Identity = 71/193 (36.79%), Postives = 124/193 (64.25%), Query Frame = 1
Query:  784 IKKLIKAKVIQRCKSSWNARLVIVGKKDGSIRMCVDYRGLNAITLKESFSMSNTKFLLDCLTDAIIFSSIDLDQAYYQVELAPDIQERTAFSIREGQFCFNRLLVRLSTAPTTFQ*LMHTVLEEMLLKGVVVYLDDILIYRKSKKDHDELLEELFKRIQMAGLKINPEKCEFNKTELCFLGHTFNCESIQTNS 1362
            I ++ +A VI+  KS + + +V+V KKDGS+R+C+DYR LN+ + +++F +   +  L+ L +A  FS++DL   Y+QVE+A   + +TAFS   G F  NR+   L  +P+TFQ LM     ++  + +++YLDDI+I+ ++  +H E L+ +F R++  GLK+ P+KC   + E+ +LGH  + + I+T+ 
Sbjct:  258 ITEMEEAGVIRPSKSPYASPIVVVTKKDGSLRICMDYRKLNSCSTRDAFPLPRVEEALEALGEAKYFSTLDLTSGYWQVEVAEADKHKTAFSTPMGLFEANRMPFGLQNSPSTFQRLMTCCFGDLNFESLLIYLDDIVIFSRTFDEHLERLQMVFDRLRKYGLKLKPQKCHLLRREVLYLGHVVSSDGIKTDP 450          

HSP 2 Score: 47.3654 bits (111), Expect = 4.811e-48
Identity = 40/156 (25.64%), Postives = 73/156 (46.79%), Query Frame = 1
Query: 1516 SFIVLKNRLCVAPILDYPREDRTFILETYASFGIIGSVWSHVKGICYSLWFETYDSV*KRLLYNEE--KPSRCT*ICYEF*RIFLR-------------KKFIIRTDHYAFVFMNTTKTPI*PQFQT*LANLAEYDFELKYKKGEEHSNADGLSRL 1938
            +F  LK +L  AP+L Y    + F+L+T AS   +G+V + V+           D   + + Y      P+      ++   + L+              KF + TD+    ++ TT   +    Q  +A L+ +DF+++Y++G  ++NADGLSR+
Sbjct:  526 AFQTLKTKLTTAPVLGYADYSQPFVLQTDASLAGLGAVLAQVQ-----------DGRERVIAYASRGLNPAETRYPAHKLEFLALKWAVTDKFYDHLYGHKFSVLTDNNPLKYVMTTAK-LDATGQRWVAQLSMFDFDIRYRQGGCNANADGLSRM 669          

HSP 3 Score: 37.3502 bits (85), Expect = 4.811e-48
Identity = 17/46 (36.96%), Postives = 25/46 (54.35%), Query Frame = 3
Query: 1362 QVEEIEKAEEPKCSKQLRSFLRLTNYYRRFIKDYGRIAEPFYESTS 1499
            ++ ++   + P+   +L  FL    YYRRFI+ Y  IA P Y  TS
Sbjct:  452 KISKVAGWKVPENRHELLQFLGFAGYYRRFIEGYASIAAPLYRLTS 497          
BLAST of Transposon Ty3-I Gag-Pol polyprotein vs. Ensembl Cavefish
Match: ENSAMXT00000052546.1 (pep primary_assembly:Astyanax_mexicanus-2.0:2:13031363:13036570:1 gene:ENSAMXG00000033629.1 transcript:ENSAMXT00000052546.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 144.05 bits (362), Expect = 3.890e-47
Identity = 73/193 (37.82%), Postives = 116/193 (60.10%), Query Frame = 1
Query:  784 IKKLIKAKVIQRCKSSWNARLVIVGKKDGSIRMCVDYRGLNAITLKESFSMSNTKFLLDCLTDAIIFSSIDLDQAYYQVELAPDIQERTAFSIREGQFCFNRLLVRLSTAPTTFQ*LMHTVLEEMLLKGVVVYLDDILIYRKSKKDHDELLEELFKRIQMAGLKINPEKCEFNKTELCFLGHTFNCESIQTNS 1362
            ++ L+   +++   S W +  VIV KKDG++R C DYR LN +T K+++ +   +  LD L +A  FS++DL   Y+QV +    +E+TA +   G F ++R+   L  AP TFQ LM  VL ++    ++VYLDDI+I+ +  K H E LE +F R++  GLK+ P KC   K E+ FLGH  + + +Q ++
Sbjct:  742 VQSLVDRGILEESCSPWASPAVIVIKKDGTVRFCCDYRRLNQVTCKDAYPLPRVEESLDALGNAQWFSTLDLTAGYFQVAVKDSDREKTAVTTPFGLFQWSRMPFGLCNAPATFQRLMGVVLGDLAFDILLVYLDDIIIFSRDFKSHCERLELVFNRLRHHGLKLKPSKCFLLKPEVKFLGHIISAKGVQVDA 934          

HSP 2 Score: 52.373 bits (124), Expect = 3.890e-47
Identity = 54/201 (26.87%), Postives = 82/201 (40.80%), Query Frame = 1
Query: 1516 SFIVLKNRLCVAPILDYPREDRTFILETYASFGIIGSVWSHVKG-----ICYSLWFETYDSV*KRLLYNEEKPSRC------------T*ICYEF*RIFLRKKFIIRTDHYAFVFMNTTKTPI*PQFQT*LANLAEYDFELKYKKGEEHSNADGLSRLKGMICTKRQTRHEESKEGKSNIRYVYSIKRTETMEKYWSSSRR 2067
            +F  LK  L   P+L YP   + FIL T  S   +G+V S  +G     I Y+           R L   EK  +               +  +F    +  KF + TDH    ++++    +  Q    +A +AEY+F++ YK G +++NAD LSRL           HEE  E K   +    I   E     W ++ R
Sbjct: 1002 AFDKLKGCLMSPPVLAYPDFTQPFILTTDGSLHGLGAVLSQKQGGTERVIAYA----------SRGLRGSEKNDKNYSAFKLELLALKWAVTEKFRDFLMFAKFSVVTDHNPLRYLDSANLGVVEQRW--VAQMAEYNFDISYKPGRQNANADVLSRLPA---------HEEP-EAKDTGKDFILINTEEVRACLWPAAER 1180          

HSP 3 Score: 33.4982 bits (75), Expect = 3.890e-47
Identity = 14/42 (33.33%), Postives = 24/42 (57.14%), Query Frame = 3
Query: 1362 QVEEIEKAEEPKCSKQLRSFLRLTNYYRRFIKDYGRIAEPFY 1487
            +V  +E    PK  K +R  L   +YYRRF+  + ++A+P +
Sbjct:  936 KVRVLETWPIPKTVKDIRQVLGFMSYYRRFVPKFAQLAKPLH 977          
BLAST of Transposon Ty3-I Gag-Pol polyprotein vs. Ensembl Cavefish
Match: ENSAMXT00000048318.1 (pep primary_assembly:Astyanax_mexicanus-2.0:14:10030146:10034843:1 gene:ENSAMXG00000044052.1 transcript:ENSAMXT00000048318.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 147.902 bits (372), Expect = 1.143e-46
Identity = 70/193 (36.27%), Postives = 129/193 (66.84%), Query Frame = 1
Query:  784 IKKLIKAKVIQRCKSSWNARLVIVGKKDGSIRMCVDYRGLNAITLKESFSMSNTKFLLDCLTDAIIFSSIDLDQAYYQVELAPDIQERTAFSIREGQFCFNRLLVRLSTAPTTFQ*LMHTVLEEMLLKGVVVYLDDILIYRKSKKDHDELLEELFKRIQMAGLKINPEKCEFNKTELCFLGHTFNCESIQTNS 1362
            +++L++A VI+  +SS+++ +V+V KK+G +R+CVDYR LN  T+K+++++ N +     LT +  FS +DL   YYQ+EL    + +TAF    G + FN+L   ++ AP+TFQ LM   + ++ LK V+V+LDD++++ ++ ++H+  L  + +R++  GLK++PEKC F +T + +LGH  +   ++T+ 
Sbjct:  357 LEELLEAGVIRESESSFSSPIVVVRKKNGDVRLCVDYRKLNLQTVKDAYALPNLEETFSVLTGSQWFSVLDLKSGYYQIELNEADKHKTAFVCPLGFWEFNKLPQGITNAPSTFQRLMEKCMSDLNLKEVIVFLDDLIVFSETLEEHEHRLLRVLQRLKEYGLKLSPEKCRFFQTSVRYLGHIVSRNGVETDP 549          

HSP 2 Score: 45.4394 bits (106), Expect = 1.143e-46
Identity = 19/46 (41.30%), Postives = 30/46 (65.22%), Query Frame = 3
Query: 1362 QVEEIEKAEEPKCSKQLRSFLRLTNYYRRFIKDYGRIAEPFYESTS 1499
            ++E ++    PK  K+LRSFL    YYRRFI+D+ +I +P  + T+
Sbjct:  551 KIEALKNWPNPKNLKELRSFLGFAGYYRRFIQDFSKIVKPLNDLTA 596          

HSP 3 Score: 35.039 bits (79), Expect = 1.143e-46
Identity = 36/152 (23.68%), Postives = 70/152 (46.05%), Query Frame = 1
Query: 1513 ESFIVLKNRLCVAPILDYPREDRTFILETYAS-FGIIGSVWSHVKGICYSLWFETYDSV*KRLLYNEEK-PSRCT-------*ICYEF*RIFLRKKFIIRTDHYAFVFMNTTKTPI*PQFQT*LANLAEYDFELKYKKGEEHSNADGLSRLK 1941
            E+F  + N+L  AP+L Y      +IL T AS  G+  +++    G   ++ F +     + L ++E + P+           +  +F        F + TD     ++ T+       ++  L+ L+ + F+L+Y+ G+ + +AD LSRL 
Sbjct:  631 EAFDTIINKLTSAPVLAYANPKLPYILHTDASTTGLGAALYQEQNGQIRAIAFAS-----RGLSHSESRYPAHKLEFLALKWAVTEKFSDYLYGNSFTVITDSNPLTYILTSAKLDATSYRW-LSALSTFSFKLQYRPGKHNLDADALSRLP 776          
BLAST of Transposon Ty3-I Gag-Pol polyprotein vs. Ensembl Cavefish
Match: ENSAMXT00000048050.1 (pep primary_assembly:Astyanax_mexicanus-2.0:19:20134742:20139355:-1 gene:ENSAMXG00000043312.1 transcript:ENSAMXT00000048050.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 150.599 bits (379), Expect = 2.515e-46
Identity = 72/193 (37.31%), Postives = 129/193 (66.84%), Query Frame = 1
Query:  784 IKKLIKAKVIQRCKSSWNARLVIVGKKDGSIRMCVDYRGLNAITLKESFSMSNTKFLLDCLTDAIIFSSIDLDQAYYQVELAPDIQERTAFSIREGQFCFNRLLVRLSTAPTTFQ*LMHTVLEEMLLKGVVVYLDDILIYRKSKKDHDELLEELFKRIQMAGLKINPEKCEFNKTELCFLGHTFNCESIQTNS 1362
            +++L++A VI+  +SS+++ +V+V KK+G +R+CVDYR LN  T+K+++++ N +     LT +  FS +DL   YYQ+EL    + +TAF    G + FNRL   ++ AP+TFQ LM   + ++ LK V+V+LDD++I+  + ++H+  L  + +R++  GLK++PEKC+F +T + +LGH  +   ++T+ 
Sbjct:  357 LEELLEAGVIRESESSFSSPIVVVRKKNGDVRLCVDYRKLNLQTVKDAYALPNLEETFSVLTGSQWFSVLDLKSGYYQIELEEADKHKTAFVCPMGFWEFNRLPQGITNAPSTFQRLMEKCMSDLHLKEVIVFLDDLIIFSATLEEHEHRLLRVLQRLKEYGLKLSPEKCKFFQTSVRYLGHIVSRNGVETDP 549          

HSP 2 Score: 45.8246 bits (107), Expect = 2.515e-46
Identity = 19/46 (41.30%), Postives = 30/46 (65.22%), Query Frame = 3
Query: 1362 QVEEIEKAEEPKCSKQLRSFLRLTNYYRRFIKDYGRIAEPFYESTS 1499
            +++ ++    PK  K+LRSFL    YYRRFI+DY +I +P  + T+
Sbjct:  551 KIQSLKNWPNPKNLKELRSFLGFAGYYRRFIQDYSKIVKPLNDLTA 596          

HSP 3 Score: 30.4166 bits (67), Expect = 2.515e-46
Identity = 33/145 (22.76%), Postives = 63/145 (43.45%), Query Frame = 1
Query: 1513 ESFIVLKNRLCVAPILDYPREDRTFILETYAS-FGIIGSVWSHVKGICYSLWFETYDSV*KRLLYNEEKPSRCT---*ICYEF*RIFLRKKFIIRTDHYAFVFMNTTKTPI*PQFQT*LANLAEYDFELKYKKGEEHSNADGLSR 1935
            E+F  + ++L  AP+L Y      +IL T AS  G+  +++    G   ++ F +         Y   K         +  +F        F + TD     ++ T+       ++  L+ L+ + F+L+Y+ G+ + +AD LSR
Sbjct:  631 EAFNTIISKLTSAPVLAYANSQLPYILHTDASTTGLGAALYQEQDGQIRAIAFASRGLSRSESRYPAHKLEFLALKWAVTEKFSDYLYGNSFTVITDSNPLTYILTSAKLDATSYRW-LSALSTFSFKLQYRPGKHNLDADALSR 774          
BLAST of Transposon Ty3-I Gag-Pol polyprotein vs. Ensembl Cavefish
Match: ENSAMXT00000047338.1 (pep primary_assembly:Astyanax_mexicanus-2.0:9:32004976:32009589:-1 gene:ENSAMXG00000038997.1 transcript:ENSAMXT00000047338.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 150.599 bits (379), Expect = 2.753e-46
Identity = 72/193 (37.31%), Postives = 129/193 (66.84%), Query Frame = 1
Query:  784 IKKLIKAKVIQRCKSSWNARLVIVGKKDGSIRMCVDYRGLNAITLKESFSMSNTKFLLDCLTDAIIFSSIDLDQAYYQVELAPDIQERTAFSIREGQFCFNRLLVRLSTAPTTFQ*LMHTVLEEMLLKGVVVYLDDILIYRKSKKDHDELLEELFKRIQMAGLKINPEKCEFNKTELCFLGHTFNCESIQTNS 1362
            +++L++A VI+  +SS+++ +V+V KK+G +R+CVDYR LN  T+K+++++ N +     LT +  FS +DL   YYQ+EL    + +TAF    G + FNRL   ++ AP+TFQ LM   + ++ LK V+V+LDD++I+  + ++H+  L  + +R++  GLK++PEKC+F +T + +LGH  +   ++T+ 
Sbjct:  357 LEELLEAGVIRESESSFSSPIVVVRKKNGDVRLCVDYRKLNLQTVKDAYALPNLEETFSVLTGSQWFSVLDLKSGYYQIELEEADKHKTAFVCPMGFWEFNRLPQGITNAPSTFQRLMEKCMSDLHLKEVIVFLDDLIIFSATLEEHEHRLLRVLQRLKEYGLKLSPEKCKFFQTSVRYLGHIVSRNGVETDP 549          

HSP 2 Score: 45.8246 bits (107), Expect = 2.753e-46
Identity = 19/46 (41.30%), Postives = 30/46 (65.22%), Query Frame = 3
Query: 1362 QVEEIEKAEEPKCSKQLRSFLRLTNYYRRFIKDYGRIAEPFYESTS 1499
            +++ ++    PK  K+LRSFL    YYRRFI+DY +I +P  + T+
Sbjct:  551 KIQSLKNWPNPKNLKELRSFLGFAGYYRRFIQDYSKIVKPLNDLTA 596          

HSP 3 Score: 30.4166 bits (67), Expect = 2.753e-46
Identity = 33/145 (22.76%), Postives = 63/145 (43.45%), Query Frame = 1
Query: 1513 ESFIVLKNRLCVAPILDYPREDRTFILETYAS-FGIIGSVWSHVKGICYSLWFETYDSV*KRLLYNEEKPSRCT---*ICYEF*RIFLRKKFIIRTDHYAFVFMNTTKTPI*PQFQT*LANLAEYDFELKYKKGEEHSNADGLSR 1935
            E+F  + ++L  AP+L Y      +IL T AS  G+  +++    G   ++ F +         Y   K         +  +F        F + TD     ++ T+       ++  L+ L+ + F+L+Y+ G+ + +AD LSR
Sbjct:  631 EAFNTIISKLTSAPVLAYANSQLPYILHTDASTTGLGAALYQEQDGQIRAIAFASRGLSRSESRYPAHKLEFLALKWAVTEKFSDYLYGNSFTVITDSNPLTYILTSAKLDATSYRW-LSALSTFSFKLQYRPGKHNLDADALSR 774          
BLAST of Transposon Ty3-I Gag-Pol polyprotein vs. Ensembl Medaka
Match: ENSORLT00000040305.1 (pep primary_assembly:ASM223467v1:1:25459511:25466649:-1 gene:ENSORLG00000028409.1 transcript:ENSORLT00000040305.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 187.963 bits (476), Expect = 2.440e-49
Identity = 131/407 (32.19%), Postives = 209/407 (51.35%), Query Frame = 1
Query:  784 IKKLIKAKVIQRCKSSWNARLVIVGKKDGSIRMCVDYRGLNAITLKESFSMSNTKFLLDCLTDAIIFSSIDLDQAYYQVELAPDIQERTAFSIREGQFCFNRLLVRLSTAPTTFQ*LMHTVLEEMLLKGVVVYLDDILIYRKSKKDHDELLEELFKRIQMAGLKINPEKCEFNKTELCFLGHTFNCESIQTNSXXXXXXXXXXXXXXXS*DHFSD*RTTTEDSS---------KTMAESQNRFMSQHL---YVT--NESFIVLKNRLCVAPILDYPREDRTFILETYASFGIIGSVWSHVKGICYSLWFETYDSV*KRLLYNEEKPSRCT---------*ICYEF*RIFLRKKFIIRTDHYAFVFMNTTKTPI*PQFQT*LANLAEYDFELKYKKGEEHSNADGLSR 1935
            +++ ++A + +   SSW A +V+V KKD S R+CVDYR LN  T+K+++ +   +  LD L+ A  FS++DL   Y+QVE+ P  ++  AF  R+G F +N +   L  AP TFQ LM  VL  +  +  +VYLDDI++   +     E LE++F R++ A LK+ P KC   + ++ +LGH  + + I T+ +  +  +           + S+ R     +S          T+A   +    ++    + T   E+F  LK RL  APIL YP +    +L+T AS   +G+V S V+G    +    Y S  +RL   E+  + CT              F +  L + F++RTDH +  ++   K P   Q    L  LAEYDF++ ++ G+ H NAD LSR
Sbjct:  852 VQQSLEAGLARHSNSSWAAPIVMVKKKDQSPRLCVDYRPLNDRTIKDAYPLPRIQDTLDTLSTAKYFSTLDLTSGYWQVEMTPRARKAAAFCTRKGLFEWNVMPFGLCNAPATFQRLMDRVLAGLQWEACLVYLDDIIVLGCNSNQMMERLEQVFTRLRQANLKLKPSKCRLFQEQVAYLGHVVSAQGISTDPQKIQKVQDWPIPK-----NISEVRQFVGLASYYRRFVADFATIARPLHELTKKYARFDWTTECQEAFEELKERLTSAPILGYPLDSGELLLDTDASDWGVGAVLSQVQGGEERVL--AYGS--RRLTTTEQ--NYCTTRRELLAVVEFTSHFRQYLLGRSFVLRTDHSSLRWLTRLKEPE-GQLARWLEKLAEYDFQVLHRPGKVHQNADALSR 1246          

HSP 2 Score: 52.373 bits (124), Expect = 1.798e-6
Identity = 26/54 (48.15%), Postives = 34/54 (62.96%), Query Frame = 2
Query: 1643 KESVTAYGLRHMTAYEKGYCIMRKNLLAVHEYVMNFREYFYGKSL*FVQITMHS 1804
            +E V AYG R +T  E+ YC  R+ LLAV E+  +FR+Y  G+S  FV  T HS
Sbjct: 1150 EERVLAYGSRRLTTTEQNYCTTRRELLAVVEFTSHFRQYLLGRS--FVLRTDHS 1201          
BLAST of Transposon Ty3-I Gag-Pol polyprotein vs. Ensembl Medaka
Match: ENSORLT00000045600.1 (pep primary_assembly:ASM223467v1:4:26167161:26171153:-1 gene:ENSORLG00000023514.1 transcript:ENSORLT00000045600.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 151.754 bits (382), Expect = 1.208e-46
Identity = 75/193 (38.86%), Postives = 120/193 (62.18%), Query Frame = 1
Query:  784 IKKLIKAKVIQRCKSSWNARLVIVGKKDGSIRMCVDYRGLNAITLKESFSMSNTKFLLDCLTDAIIFSSIDLDQAYYQVELAPDIQERTAFSIREGQFCFNRLLVRLSTAPTTFQ*LMHTVLEEMLLKGVVVYLDDILIYRKSKKDHDELLEELFKRIQMAGLKINPEKCEFNKTELCFLGHTFNCESIQTNS 1362
            I++L++++VI+   S + + +V+V KKDG +RMCVDYR LNA T K++F +      LD L  A  F+++DL   Y QVE+A   + +TAF    G F FNR+   L  AP+TFQ LM  +  +   + V++YLDD++I+  S + H + LE++F R++  GLK+   KC F + ++ +LGH  + E + T+ 
Sbjct:  360 IQQLLQSQVIRESSSPYASPIVLVQKKDGGLRMCVDYRQLNARTRKDAFPLPRIDESLDALAGAQWFTTLDLASGYSQVEVAEKDKAKTAFCTPFGLFEFNRMPFGLCNAPSTFQRLMERLFGDCRFQSVLLYLDDVIIFSSSVEQHLQRLEQVFSRLEAQGLKVKLSKCHFFQKQVKYLGHVVSAEGVSTDP 552          

HSP 2 Score: 40.817 bits (94), Expect = 1.208e-46
Identity = 42/154 (27.27%), Postives = 67/154 (43.51%), Query Frame = 1
Query: 1513 ESFIVLKNRLCVAPILDYPREDRTFILETYASFGIIGSVWSHV-KGICYSLWFET------------YDSV*KRLLYNEEKPSRCT*ICYEF*RIFLRKKFIIRTDHYAFVFMNTTKTPI*PQFQT*LANLAEYDFELKYKKGEEHSNADGLSR 1935
            +SF  LK  L  AP+L Y    + F+LE  AS G +G+V S   +G    + F +            Y S+   L+  +        +  +F    L     + TD+     + T K  +    Q   + LA +D  +KY+ G +++NAD LSR
Sbjct:  625 KSFQELKTALITAPVLAYANFQKPFVLEVDASHGGLGAVLSQEHEGRRRPVAFASRSLKPTERNMNNYSSMKLELVALKWA------VTEKFREYLLGNACTVFTDNNPLSHLATAK--LGATEQRWASELAAFDLTIKYRPGSQNANADALSR 770          

HSP 3 Score: 35.8094 bits (81), Expect = 1.208e-46
Identity = 15/31 (48.39%), Postives = 18/31 (58.06%), Query Frame = 3
Query: 1392 PKCSKQLRSFLRLTNYYRRFIKDYGRIAEPF 1484
            P     LRSFL   +YYRRFI  + +IA P 
Sbjct:  564 PANLADLRSFLGFASYYRRFIAGFAKIASPL 594          
BLAST of Transposon Ty3-I Gag-Pol polyprotein vs. Ensembl Medaka
Match: ENSORLT00000040501.1 (pep primary_assembly:ASM223467v1:1:1251188:1255180:-1 gene:ENSORLG00000023024.1 transcript:ENSORLT00000040501.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 149.828 bits (377), Expect = 2.449e-46
Identity = 75/193 (38.86%), Postives = 118/193 (61.14%), Query Frame = 1
Query:  784 IKKLIKAKVIQRCKSSWNARLVIVGKKDGSIRMCVDYRGLNAITLKESFSMSNTKFLLDCLTDAIIFSSIDLDQAYYQVELAPDIQERTAFSIREGQFCFNRLLVRLSTAPTTFQ*LMHTVLEEMLLKGVVVYLDDILIYRKSKKDHDELLEELFKRIQMAGLKINPEKCEFNKTELCFLGHTFNCESIQTNS 1362
            I++L++++VI+   S + + +V+V KKDG +RMCVDYR LNA T K++F        LD L  A  F+++DL   Y QVE+A   + +TAF    G F FNR+   L  AP+TFQ LM  +  +   + V++YLDD++I+  S + H + LE++F R+   GLK+   KC F + ++ +LGH  + E + T+ 
Sbjct:  360 IQQLLQSQVIRESSSPYASPIVLVQKKDGGLRMCVDYRQLNARTRKDAFPSPRIDESLDALAGAQWFTTLDLASGYSQVEVAEKDKAKTAFCTPFGLFEFNRMPFGLCNAPSTFQRLMERLFGDCRFQSVLLYLDDVIIFSSSVEQHLQRLEQVFSRLDAQGLKVKLSKCHFFQKQVKYLGHVVSAEGVSTDP 552          

HSP 2 Score: 42.3578 bits (98), Expect = 2.449e-46
Identity = 43/154 (27.92%), Postives = 67/154 (43.51%), Query Frame = 1
Query: 1513 ESFIVLKNRLCVAPILDYPREDRTFILETYASFGIIGSVWSHV-KGICYSLWFET------------YDSV*KRLLYNEEKPSRCT*ICYEF*RIFLRKKFIIRTDHYAFVFMNTTKTPI*PQFQT*LANLAEYDFELKYKKGEEHSNADGLSR 1935
            ESF  LK  L  AP+L Y    + F+LE  AS G +G+V S   +G    + F +            Y S+   L+  +        +  +F    L     + TD+     + T K  +    Q   + LA +D  +KY+ G +++NAD LSR
Sbjct:  625 ESFQELKTALITAPVLAYADFQKPFVLEVDASHGGLGAVLSQEHEGKRRPVAFASRSLKPTERNMNNYSSMKLELVALKWA------VTEKFREYLLGNACTVFTDNNPLSHLATAK--LGATEQRWASELAAFDLTIKYRPGSQNANADALSR 770          

HSP 3 Score: 35.4242 bits (80), Expect = 2.449e-46
Identity = 15/31 (48.39%), Postives = 18/31 (58.06%), Query Frame = 3
Query: 1392 PKCSKQLRSFLRLTNYYRRFIKDYGRIAEPF 1484
            P     LRSFL   +YYRRFI  + +IA P 
Sbjct:  564 PANLADLRSFLGFASYYRRFIAGFAKIASPL 594          
BLAST of Transposon Ty3-I Gag-Pol polyprotein vs. Ensembl Medaka
Match: ENSORLT00000036827.1 (pep primary_assembly:ASM223467v1:16:28613823:28617539:1 gene:ENSORLG00000023550.1 transcript:ENSORLT00000036827.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 172.555 bits (436), Expect = 2.358e-44
Identity = 141/459 (30.72%), Postives = 213/459 (46.41%), Query Frame = 1
Query:  775 EDLIKKLIKAKVIQRCKSSWNARLVIVGKKDGS-IRMCVDYRGLNAITLKESFSMSNTKFLLDCLTDAIIFSSIDLDQAYYQVELAPDIQERTAFSIREGQFCFNRLLVRLSTAPTTFQ*LMHTVLEEMLLKGVVVYLDDILIYRKSKKDHDELLEELFKRIQMAGLKINPEKCEFNKTELCFLGHTFNCESIQTNSXXXXXXXXXXXXXXXS*DHFSD*RTTTED--SSKTMAESQNRFMSQ---------HLYVTN----------ESFIVLKNRLCVAPILDYPREDRTFILETYASFGIIGSVWSHVKGI---CYSLWFETYDSV*KRLLYNEEKPSRCT*ICYEF*RIFLRKKFIIRTDHYAFVFMNTTKTPI*PQFQT*LANLAEYDFELKYKKGEEHSNADGLSR----LKG-MICTKRQ------TRHEESKEGKSNI---RYVYSIKRTE 2034
            +  I+++++  +I+   S W + +V+V KK G  +R CVDYR LN +T K+S+ +      LD ++ +  FSS+DL   Y+QV L+P  + +TAF    G + F  L   L  AP TF+ LM  VL  +  +  +VYLDDIL++  S K   E L ++ +RI  AGLK++P+KC F + EL FLGH    E I T  +  +  +                 TT  D  S   +A    RF+           HL   +          ++F  LK  L  +PIL  P     FIL+T AS   +G+V S +        + + +T     +R      +          F        F +RTDH A  ++ T K P   Q    L  LA + F ++++ G  H+NAD +SR    L G   C KR+      +R E+S  G+S+    R V  +  TE
Sbjct:  289 DSAIEEMLRGGIIEPSDSPWASGVVMVKKKKGPKMRFCVDYRPLNGVTKKDSYPLPRIDESLDLVSGSSWFSSLDLRSGYWQVPLSPAARPKTAFCTGRGLWQFRVLSFGLCNAPATFERLMEKVLASIPRQECLVYLDDILVHGGSFKAALESLRKVLQRIAAAGLKLHPDKCCFMRRELEFLGHKIGGEGISTLEEKVQAVRDWPTP------------TTLRDLKSFLGLASYYRRFVRGFSCIAAPLFHLQRKDCDFVWTQECEQAFSSLKKALTNSPILTPPDPKLPFILDTDASDVGMGAVLSQMGSAGERVVAYFSKTLSKAERRYCVTRRELLAVVKAIGHFRYYLCGLPFTVRTDHSALQWLMTFKEPE-GQIARWLEELASFSFTVEHRPGSRHANADAMSRRPCALAGCQYCEKREAREAVISREEQSHTGESSWPVCRLVQGVDSTE 734          
BLAST of Transposon Ty3-I Gag-Pol polyprotein vs. Ensembl Medaka
Match: ENSORLT00000033871.1 (pep primary_assembly:ASM223467v1:5:24767545:24770648:1 gene:ENSORLG00000024878.1 transcript:ENSORLT00000033871.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 139.428 bits (350), Expect = 3.623e-44
Identity = 67/193 (34.72%), Postives = 127/193 (65.80%), Query Frame = 1
Query:  784 IKKLIKAKVIQRCKSSWNARLVIVGKKDGSIRMCVDYRGLNAITLKESFSMSNTKFLLDCLTDAIIFSSIDLDQAYYQVELAPDIQERTAFSIREGQFCFNRLLVRLSTAPTTFQ*LMHTVLEEMLLKGVVVYLDDILIYRKSKKDHDELLEELFKRIQMAGLKINPEKCEFNKTELCFLGHTFNCESIQTNS 1362
            +++L  A VI+  +SS+++ +V+V KK+G +R+C+DYR LN  T+K+++++ N +     LT +  FS +DL   YYQ+E+    +++TAF    G + FNR+   ++ AP+TFQ LM   + ++ LK V+V+LDD++++ ++ ++H+  L  +  R++  GLK++ EKC+F +T + +LGH  +   ++T+ 
Sbjct:  206 LQELSHAGVIRESESSFSSPIVVVRKKNGDVRLCIDYRKLNMQTIKDAYALPNLEETFSALTGSKWFSVLDLKSGYYQIEVDEVDKQKTAFVCPLGFWEFNRMPQGITNAPSTFQRLMEKCMGDINLKEVLVFLDDLIVFSETLEEHEARLLNVLNRLRAYGLKLSLEKCKFFQTSVRYLGHIVSQHGVETDP 398          

HSP 2 Score: 45.8246 bits (107), Expect = 3.623e-44
Identity = 21/45 (46.67%), Postives = 29/45 (64.44%), Query Frame = 3
Query: 1362 QVEEIEKAEEPKCSKQLRSFLRLTNYYRRFIKDYGRIAEPFYEST 1496
            +VE ++    PK  K+LRSFL    YYRRFI+DY +I +P  + T
Sbjct:  400 KVEALKTWPVPKNLKELRSFLGFAGYYRRFIRDYSKIVKPLNDLT 444          

HSP 3 Score: 34.6538 bits (78), Expect = 3.623e-44
Identity = 34/145 (23.45%), Postives = 64/145 (44.14%), Query Frame = 1
Query: 1513 ESFIVLKNRLCVAPILDYPREDRTFILETYAS-FGIIGSVWSHVKGICYSLWFETYDSV*KRLLYNEEKPSRCT---*ICYEF*RIFLRKKFIIRTDHYAFVFMNTTKTPI*PQFQT*LANLAEYDFELKYKKGEEHSNADGLSR 1935
            E+F  +  +L  APIL +      ++L T AS  G+  +++   +G    + F +         Y   K         +  +F        F + TD     ++ TT       ++  L+ L+ + F+L+Y+ G+++ +ADGLSR
Sbjct:  480 EAFETIIEKLTTAPILAFANPKLPYVLHTDASTIGLGAALYQEQEGELRVIAFASRGLSRSEARYPAHKLEFLALKWAVTEKFCDYLYGSFFTVVTDSNPLTYILTTAKLDATSYRW-LSALSTFSFQLQYRAGKQNMDADGLSR 623          
BLAST of Transposon Ty3-I Gag-Pol polyprotein vs. Planmine SMEST
Match: SMESG000081257.1 (SMESG000081257.1)

HSP 1 Score: 358.221 bits (918), Expect = 7.177e-110
Identity = 202/458 (44.10%), Postives = 275/458 (60.04%), Query Frame = 1
Query:  736 NIHGVNQCTEKRMEDLIKKLIKAKVIQRCKSSWNARLVIVGKKDGSIRMCVDYRGLNAITLKESFSMSNTKFLLDCLTDAIIFSSIDLDQAYYQVELAPDIQERTAFSIREGQFCFNRLLVRLSTAPTTFQ*LMHTVLEEMLLKGVVVYLDDILIYRKSKKDHDELLEELFKRIQMAGLKINPEKCEFNKTELCFLGHTFNCESIQTNSXXXXXXXXXXXXXXXS*DHFSD*RTTTE-DSSKTMAESQNRFMSQH------LYVTN--------------ESFIVLKNRLCVAPILDYPREDRTFILETYASFGIIGSVWSHVKGICYSLWFETYDSV*KRLLYNEEKPSRCT*ICYEF*RIFLRKKFIIRTDHYAFVFMNTTKTPI*PQFQT*LANLAEYDFELKYKKGEEHSNADGLSRLKGMICTKRQTRHEESKEGKSNIRYVYSIKRTETMEK 2046
            N  G     E ++E+L++ L++A V+++C+S WN  LVIVGK DGS+R+C+D+R LN++T K SF M + + LLDCL  + IF SIDL QAYY VEL  + Q +TAFS +EGQFCFNRL   LSTAP TFQ LMH +LE ++ KGVVVYLDDILIY ++++ HD+LL E+F RI+ +GLK+NPEKC FNK+ L F+GHT + + IQTN +                ++ ++ ++TTE  S   +     RF+  +      LY                 + FI LK  LC APIL+YPR DR FI++T  SF  IG +  H  G C +          K LL   E           F +    ++F+ RTDH A  FMNTTK PI PQFQT +AN +EYDF L+Y+KG EH NA G SRL   IC+  Q  H+++K+ K   R + S++ +  + K
Sbjct:  456 NPRGQPMHLEAKVEELVQNLLEAGVVRKCQSPWNTPLVIVGKPDGSVRICLDFRLLNSVTEKFSFPMPDMQLLLDCLGKSKIFYSIDLGQAYYLVELNENSQIKTAFSTKEGQFCFNRLPFGLSTAPATFQKLMHQILEGLVFKGVVVYLDDILIYGENQETHDKLLFEVFTRIRDSGLKVNPEKCAFNKSVLNFIGHTVSEKGIQTNKRKISEI-----------ENATEPKSTTELRSFLGLTTYYRRFIKNYSMIAAPLYAATTGCDKMIVWTEECRKRFINLKKLLCEAPILEYPRADRLFIIDTDDSFEAIGHLTKHEIGYCVTR---------KELLVLHE-------FIVHFRQYLYGRRFVARTDHKALTFMNTTKKPISPQFQTWMANFSEYDFALQYRKGNEHGNAGGWSRLNNTICSHYQMEHKDAKKAKCRTRCINSLQGSSNIMK 886          

HSP 2 Score: 70.4774 bits (171), Expect = 3.539e-12
Identity = 32/54 (59.26%), Postives = 40/54 (74.07%), Query Frame = 3
Query: 1350 SNK*QVEEIEKAEEPKCSKQLRSFLRLTNYYRRFIKDYGRIAEPFYESTSVCDK 1511
            +NK ++ EIE A EPK + +LRSFL LT YYRRFIK+Y  IA P Y +T+ CDK
Sbjct:  662 TNKRKISEIENATEPKSTTELRSFLGLTTYYRRFIKNYSMIAAPLYAATTGCDK 715          

HSP 3 Score: 66.2402 bits (160), Expect = 6.541e-11
Identity = 39/106 (36.79%), Postives = 62/106 (58.49%), Query Frame = 1
Query:  397 MYQTKDGRIWGKIILNSTEVDMLWDSGTSVTVMSKNLWEVIGKPDLQRSAILLCGVFST------GEESMVCMXXXXXXXXXXXXXXXXXXXFIGGIDIIEKFGVK 696
            M++  D R W  + +N   V+MLW+SG S++VMS+  W +IG P L  S ILL  VFS       G   +V       + + V+++++I P FIGG+D ++ FG++
Sbjct:  276 MFKKDDDRKWSIMEINGFHVEMLWNSGASISVMSEKCWRLIGSPILMDSRILLSEVFSNEDKKPLGSVKIVAKWNKKFRELNVIIVRKIHPNFIGGVDTMKIFGME 381          

HSP 4 Score: 50.8322 bits (120), Expect = 3.400e-6
Identity = 20/37 (54.05%), Postives = 25/37 (67.57%), Query Frame = 2
Query:    2 KLTVGDCFCCGERLHKRYKCPLKN*CLKPGNEDHGFR 112
            +L  G CFCCG+  H R++CPLK+ CL  G E H FR
Sbjct:  180 RLKPGKCFCCGQNDHMRFECPLKDKCLICGKEGHSFR 216          
BLAST of Transposon Ty3-I Gag-Pol polyprotein vs. Planmine SMEST
Match: SMESG000038955.1 (SMESG000038955.1)

HSP 1 Score: 354.755 bits (909), Expect = 1.007e-109
Identity = 203/437 (46.45%), Postives = 265/437 (60.64%), Query Frame = 1
Query:  763 EKRMEDLIKKLIKAKVIQRCKSSWNARLVIVGKKDGSIRMCVDYRGLNAITLKESFSMSNTKFLLDCLTDAIIFSSIDLDQAYYQVELAPDIQERTAFSIREGQFCFNRLLVRLSTAPTTFQ*LMHTVLEEMLLKGVVVYLDDILIYRKSKKDHDELLEELFKRIQMAGLKINPEKCEFNKTELCFLGHTFNCESIQTNSXXXXXXXXXXXXXXXS*DHFSD*RTTTEDSSKTMAESQNRFMSQHLYVTNESFIVLKNRLCVAPILDYPREDRTFILETYASFGIIGSVWSHVKGICYSLWFETYDSV*KRLLYNEEKPSRCT*I---------CYEF*RIFLRKKFIIRTDHYAFVFMNTTKTPI*PQFQT*LANLAEYDFELKYKKGEEHSNADGLSRLKGMICTKRQTRHEESKEGKSNIRYVYSIKRTETMEK 2046
            E ++E+L++ L++A V+++  S WN  LVIVGK DGSIRMC+D+R LN++T K SF   + K LLDCL ++ IFSSIDL QAYYQVEL  + Q +TAFS +EGQFCFNRL   LSTAP TFQ LMH +LE ++ KGVVVYLD+ILIY ++++ HD+LL E+F RI+ +GLK+NPEKC FNK+ L F+GHT N   I     +                      TT  D      E               SFI LK  LC APIL+YPR DR F+++T ASFG IG+V S +K  C  +    Y S   R L   E    C  I            F +    ++F+ RTDH A  FMNTTK PI PQFQT +ANL+E+DF L+Y+KGEEH NADG SRL    C+     ++++KE K   RY+ S++ +  + K
Sbjct:  154 EGKVEELVQNLLEAGVVRKSISPWNTPLVIVGKLDGSIRMCLDFRLLNSVTEKFSFYSPDMKLLLDCLGNSKIFSSIDLGQAYYQVELNENSQIKTAFSTKEGQFCFNRLPFGLSTAPATFQKLMHQILEGLVFKGVVVYLDEILIYGENQEIHDKLLFEVFTRIRDSGLKVNPEKCAFNKSVLNFIGHT-NYSIIAAPMYVA---------------------TTGNDKMIVWTEE-----------CRNSFINLKKLLCEAPILEYPRADRLFVIDTDASFGAIGAVLSQIKEDCTEVVI-AYGS---RHLTKHEM-GHCVTIKELLALHEFIVHFRQYLYGRRFVARTDHKALTFMNTTKKPISPQFQTWMANLSEHDFALQYRKGEEHGNADGKSRLNNTKCSHCLMENKDAKEAKCRTRYINSLQGSSNIMK 552          

HSP 2 Score: 58.5362 bits (140), Expect = 1.422e-8
Identity = 26/48 (54.17%), Postives = 32/48 (66.67%), Query Frame = 1
Query:  439 LNSTEVDMLWDSGTSVTVMSKNLWEVIGKPDLQRSAILLCGVFSTGEE 582
            +N   VDMLWDSG S++VMS   W +IG+P L  S I L GVFS  +E
Sbjct:    3 INGFHVDMLWDSGASISVMSDKYWRLIGRPILMDSRIRLSGVFSKEDE 50          
BLAST of Transposon Ty3-I Gag-Pol polyprotein vs. Planmine SMEST
Match: SMESG000065302.1 (SMESG000065302.1)

HSP 1 Score: 272.322 bits (695), Expect = 1.711e-91
Identity = 165/386 (42.75%), Postives = 227/386 (58.81%), Query Frame = 1
Query:  322 HFVGGVKTMNCGLRNERRTEKAEKEMYQTKDGRIWGKIILNSTEVDMLWDSGTSVTVMSKNLWEVIGKPDLQRSAILLCGVFST------GEESMVCMXXXXXXXXXXXXXXXXXXXFIGGIDIIEKFGVKY--------------------------------DTRCGRQEVQ*CNIHGVNQCTEKRMEDL--IKKLIKAKVIQRCKSSWNARLVIVGKKDGSIRMCVDYRGLNAITLKESFSMSNTKFLLDCLTDAIIFSSIDLDQAYYQVELAPDIQERTAFSIREGQFCFNRLLVRLSTAPTTFQ*LMHTVLEEMLLKGVVVYLDDILIYRKSKKDHDELLEELFKRIQMAGLKINPEKCEFNKTELCFLGHTFNCESIQTN 1359
            HFV  VKT++      +R    + EM++  D R W  + +N   ++MLWDSG S++VMS+  W +IG P L  S I L GVFS       G   +V       +   V+++++I P+FIGG+D ++ F +K                                 +++ G    Q  NI   ++       DL  IK L+ A V+++C+SSWN  LVIVGK DGS RMC+D+R LN++T K SF M + + LLDCL  + I SSIDL Q YYQVEL  + Q +TAFS +EGQFCFNRL   LSTAP TFQ LMH +LE ++ K VVVYLDDIL Y ++++ HD+LL E+F RI  +GLK++P KC FNK+ L F+ HT + + IQTN
Sbjct:   14 HFVSKVKTVD---EFNKRNVGKKNEMFKKDDDRKWSMMEINGFHLEMLWDSGASISVMSEKCWRLIGSPILMDSRIRLSGVFSKEYEKPFGSVKIVAKRNKKVREFNVIIVRKIHPDFIGGVDTMKIFCMKLKEVNIIESSLVNKRFTDSDRLKNTLLTLKLDKNSKLGTLISQFSNIFMASKF------DLGHIKNLLVAGVVRKCQSSWNTPLVIVGKPDGSSRMCLDFRCLNSVTEKVSFPMPDMQLLLDCLGKSKILSSIDLRQVYYQVELNENSQIKTAFSTKEGQFCFNRLPFGLSTAPATFQKLMHQILEGLVFKRVVVYLDDILKYAENQETHDKLLFEVFTRIIDSGLKVSPAKCAFNKSLLNFINHTVSEKGIQTN 390          

HSP 2 Score: 59.6918 bits (143), Expect = 1.711e-91
Identity = 34/65 (52.31%), Postives = 41/65 (63.08%), Query Frame = 3
Query: 1350 SNK*QVEEIEKAEEPKCSKQLRSFLRLTNYYRRFIKDYGRIAEPFYESTSVCDK*KFHSTEEQAV 1544
            +NK +  EI    E K + +LRSFL LTNYYRRFIK+Y  IA P Y +T+  DK     TEE AV
Sbjct:  389 TNKGKFSEIVNPIETKSTTELRSFLGLTNYYRRFIKNYSMIAAPLYAATTGNDK-MIVWTEECAV 452          

HSP 3 Score: 46.595 bits (109), Expect = 1.711e-91
Identity = 19/39 (48.72%), Postives = 29/39 (74.36%), Query Frame = 2
Query: 1646 ESVTAYGLRHMTAYEKGYCIMRKNLLAVHEYVMNFREYF 1762
            E V AY  RH+T +E GYC++RK LL ++E +++FR+Y 
Sbjct:  462 EGVIAYVSRHLTNHEMGYCVIRKELLVLYELIVHFRQYL 500          

HSP 4 Score: 51.6026 bits (122), Expect = 1.932e-6
Identity = 23/50 (46.00%), Postives = 32/50 (64.00%), Query Frame = 1
Query: 1897 KGEEHSNADGLSRLKGMICTKRQTRHEESKEGKSNIRYVYSIKRTETMEK 2046
            KGEEH N+DG+SRL   IC+  Q   ++SKEGK   RY+ S+  +  + K
Sbjct:  530 KGEEHGNSDGISRLNNTICSHCQIEQKDSKEGKCRTRYINSLHGSSNIMK 579          
BLAST of Transposon Ty3-I Gag-Pol polyprotein vs. Planmine SMEST
Match: SMESG000029259.1 (SMESG000029259.1)

HSP 1 Score: 258.84 bits (660), Expect = 4.699e-73
Identity = 164/430 (38.14%), Postives = 245/430 (56.98%), Query Frame = 1
Query:  763 EKRMEDLIKKLIKAKVIQRCKSSWNARLVIVGKKDG-SIRMCVDYRGLNAITLKESFSMSNTKFLLDCLTDAIIFSSIDLDQAYYQVELAPDIQERTAFSIREGQFCFNRLLVRLSTAPTTFQ*LMHTVLEEMLLKGVVVYLDDILIYRKSKKDHDELLEELFKRIQMAGLKINPEKCEFNKTELCFLGHTFNCESIQT-NSXXXXXXXXXXXXXXXS*DHF----SD*RTTTEDSSKTMAE-----SQNRFMSQHLYVTNESFIVLKNRLCVAPILDYPREDRTFILETYASFGIIGSVWSHV--KGICYSLWFETY--DSV*KRLLYNEEKPSRCT*ICYEF*RIFLRKKFIIRTDHYAFVFMNTTKTPI*PQFQT*LANLAEYDFELKYKKGEEHSNADGLSRLKGMICTKRQTRHEESKEGKSNIR 2007
            E ++E+ IK L    +I++C S WN  LV V KK+   IR+C+D+R LN IT +++F M N   +LD L  +  FSSIDL  AYYQV+L  + QE+TAFS +EGQFCFNR+   ++ AP TFQ LM  VL+++   GV+VYLDDILI+ K+++DH  +  ++  +I  AGL++NPEKC+  + E+ FLGH  N + IQT N+K++ ++  +      +   F    +  R   +D +K          +N    +   +  ++F  +K  L  AP+L +P   + FIL+T ASF  IG+V S    KG  + + + ++   S  K      ++       C  F      K+F++RTDH A  FM TTK PI  QFQT +  L+  D +++Y+KG  H+NAD LSR     C +    HE++K GK   R
Sbjct: 2740 EDKIEEAIKNLENNGIIRKCNSPWNTPLVCVWKKEKKDIRLCLDFRQLNKITERQAFPMPNVDEILDILHGSRYFSSIDLGNAYYQVKLDKESQEKTAFSTKEGQFCFNRMPFGIAAAPGTFQELMTKVLKDLWKDGVMVYLDDILIFTKTEEDHYNIFGKVLGKIATAGLRLNPEKCQIFRKEVKFLGHIINKDGIQTDNTKIEAIQSFQKPKCVKNLRSFLGICNYYRRFIKDYAKKARALESICGKNNEKIRWTEMCEKAFGEMKEALITAPVLVFPDFRKEFILDTDASFDTIGAVLSQKDEKGHEHVIAYGSHAMSSHEKGYCITRKELLAIYYFCKHFNHYLYGKRFVLRTDHKAITFMVTTKKPITAQFQTWINYLSSLDIKMEYRKGTSHTNADMLSRKTCGTCVQCMMEHEDAKTGKIKTR 3169          

HSP 2 Score: 52.7582 bits (125), Expect = 1.266e-6
Identity = 25/50 (50.00%), Postives = 33/50 (66.00%), Query Frame = 3
Query: 1362 QVEEIEKAEEPKCSKQLRSFLRLTNYYRRFIKDYGRIAEPFYESTSVCDK 1511
            ++E I+  ++PKC K LRSFL + NYYRRFIKDY + A       S+C K
Sbjct: 2942 KIEAIQSFQKPKCVKNLRSFLGICNYYRRFIKDYAKKARAL---ESICGK 2988          
BLAST of Transposon Ty3-I Gag-Pol polyprotein vs. Planmine SMEST
Match: SMESG000035021.1 (SMESG000035021.1)

HSP 1 Score: 224.557 bits (571), Expect = 2.635e-65
Identity = 177/528 (33.52%), Postives = 261/528 (49.43%), Query Frame = 1
Query:  412 DGRIWGKIILNSTEVDMLWDSGTSVTVMSKNLWEVIGKPDLQRSAILLCGVFSTGEESM-----VCMXXXXXXXXXXXXXXXXXXXFIGGIDIIEKFGVKY--------------------------------DTRCGRQEVQ*CNIHGVNQCTEKRMEDLIKKLIKAKVIQRCKSSWNARLVIVGKKDGSIRMCVDYRGLNAITLKESFSMSNTKFLLDCLTDAIIFSSIDLDQAYYQVELAPDIQERTAFSIREGQFCFNRLLVRLSTAPTTFQ*LMHTVLEEMLLKGVVVYLDDILIYRKSKKDHDELLEELFKRIQMAGLKINPEKCEFNKTELCFLGHTFNCESIQTNSXXXXXXXXXXXXXXXS*DHFSD*RTTTE-DSSKTMAESQNRFMSQHLYVTNESFIVLKNRLCVAPILDYPREDRTFILETYASFGIIGSVWSHVKG------ICYSLWFET-----YDSV*KRLLYNEEKPSRCT*ICYEF*RIFLRKKFIIRTDHYAFVFMNTTKTPI*PQFQ 1848
            DGR W  + LN   V+MLWDSG S++V+S+  W +IG P L  S I L GVF   +E +     V       + + V+++++I P+FIGG+D I+ FG++                                 +T+ G    Q  NI   ++     ++ +I   IK       ++S    + + GK +  ++       L A  L++S S  NT  ++    D     ++   QAYYQVEL  + Q +TAFS +EGQ CFNRL + LSTAP TFQ  ++  L+ ++ KG V+YLDDILIY ++++ +D+LL E+F RI+ +GLK NPEKC FNK+ L F+GHT + + IQTN +                ++ ++ ++TTE  S   +     RF+  +  +    +         APIL+YPR DR FI++T  SFG IG+V S +K       I Y     T     Y    K L    E           F +    K+F+ R DH A  FMNTTK PI  QF 
Sbjct:    4 DGRKWSMMRLNGFHVEMLWDSGASISVISEKCWRLIGSPILMDSRIRLSGVFPKEDEKLLGSKIVAKWNKKFRKLNVIIVRKIYPDFIGGVDTIKIFGMELKEVNNIESLLVNKRFTDSELLKITLLTLKFDKNTKLGTLIFQFSNIFMASRFDFGHIK-VIAHEIKTSDSPILQNSRRQLMHLEGKVEELVQNL-----LEAGVLRKSQSPWNTPLVIVGKPDDS--KNVSRFQAYYQVELNENSQIKTAFSTKEGQLCFNRLPIGLSTAPATFQKHINQTLKGLVFKGEVLYLDDILIYAENQETYDKLLFEVFIRIRDSGLKANPEKCAFNKSVLNFIGHTVSEKGIQTNKRKISEI-----------ENATEPKSTTELRSFLGLTNFYQRFIKNYSMIAEPLYTA-----TTAPILEYPRADRLFIIDTDDSFGAIGAVLSQIKEDGTEGVIAYGSRHLTEHEMEYCMTRKELFALHE-------FIVHFRQYLYGKRFVARMDHKALTFMNTTKKPISSQFH 500          

HSP 2 Score: 56.9954 bits (136), Expect = 3.191e-8
Identity = 27/57 (47.37%), Postives = 36/57 (63.16%), Query Frame = 2
Query: 1622 GRFGATLK-------ESVTAYGLRHMTAYEKGYCIMRKNLLAVHEYVMNFREYFYGK 1771
            G  GA L        E V AYG RH+T +E  YC+ RK L A+HE++++FR+Y YGK
Sbjct:  418 GAIGAVLSQIKEDGTEGVIAYGSRHLTEHEMEYCMTRKELFALHEFIVHFRQYLYGK 474          
The following BLAST results are available for this feature:
BLAST of Transposon Ty3-I Gag-Pol polyprotein vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Transposon Ty3-I Gag-Pol polyprotein vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Transposon Ty3-I Gag-Pol polyprotein vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Transposon Ty3-I Gag-Pol polyprotein vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
CR925755.25.174e-3428.00pep chromosome:GRCz11:17:42486740:42492668:-1 gene... [more]
BX511082.11.991e-3327.94pep chromosome:GRCz11:9:14291932:14297132:1 gene:E... [more]
BX511224.13.865e-3328.13pep chromosome:GRCz11:2:18017000:18022765:1 gene:E... [more]
BX546500.14.184e-3327.48pep chromosome:GRCz11:23:12926092:12931693:-1 gene... [more]
CR749164.11.085e-3026.53pep chromosome:GRCz11:21:30355767:30361679:1 gene:... [more]
back to top
BLAST of Transposon Ty3-I Gag-Pol polyprotein vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ENSXETT00000006041.11.472e-4338.50pep primary_assembly:Xenopus_tropicalis_v9.1:6:373... [more]
anxa62.151e-4028.47annexin A6 [Source:Xenbase;Acc:XB-GENE-989741][more]
alkbh54.885e-3633.03alkB homolog 5, RNA demethylase [Source:Xenbase;Ac... [more]
ENSXETT00000034712.15.868e-3032.99pep primary_assembly:Xenopus_tropicalis_v9.1:9:335... [more]
ENSXETT00000035398.18.589e-3032.99pep primary_assembly:Xenopus_tropicalis_v9.1:3:986... [more]
back to top
BLAST of Transposon Ty3-I Gag-Pol polyprotein vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Transposon Ty3-I Gag-Pol polyprotein vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|P20825|POL2_DROME1.034e-3528.34Retrovirus-related Pol polyprotein from transposon... [more]
sp|P04323|POL3_DROME8.859e-3529.05Retrovirus-related Pol polyprotein from transposon... [more]
sp|Q99315|YG31B_YEAST1.296e-3127.19Transposon Ty3-G Gag-Pol polyprotein OS=Saccharomy... [more]
sp|Q7LHG5|YI31B_YEAST2.035e-3127.19Transposon Ty3-I Gag-Pol polyprotein OS=Saccharomy... [more]
sp|P10394|POL4_DROME1.898e-2932.98Retrovirus-related Pol polyprotein from transposon... [more]
back to top
BLAST of Transposon Ty3-I Gag-Pol polyprotein vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A4Y2PDL72.611e-5738.27Retrovirus-related Pol polyprotein from transposon... [more]
A0A4Y2LPA52.838e-5738.27Transposon Ty3-I Gag-Pol polyprotein OS=Araneus ve... [more]
A0A4Y2F7R87.605e-5738.27Transposon Ty3-I Gag-Pol polyprotein OS=Araneus ve... [more]
A0A4Y2GV681.195e-5638.27Transposon Ty3-I Gag-Pol polyprotein OS=Araneus ve... [more]
A0A4Y1ZYF31.205e-5639.29Transposon Ty3-I Gag-Pol polyprotein OS=Araneus ve... [more]
back to top
BLAST of Transposon Ty3-I Gag-Pol polyprotein vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ENSAMXT00000034038.14.811e-4836.79pep primary_assembly:Astyanax_mexicanus-2.0:14:312... [more]
ENSAMXT00000052546.13.890e-4737.82pep primary_assembly:Astyanax_mexicanus-2.0:2:1303... [more]
ENSAMXT00000048318.11.143e-4636.27pep primary_assembly:Astyanax_mexicanus-2.0:14:100... [more]
ENSAMXT00000048050.12.515e-4637.31pep primary_assembly:Astyanax_mexicanus-2.0:19:201... [more]
ENSAMXT00000047338.12.753e-4637.31pep primary_assembly:Astyanax_mexicanus-2.0:9:3200... [more]
back to top
BLAST of Transposon Ty3-I Gag-Pol polyprotein vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Transposon Ty3-I Gag-Pol polyprotein vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Transposon Ty3-I Gag-Pol polyprotein vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Transposon Ty3-I Gag-Pol polyprotein vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ENSORLT00000040305.12.440e-4932.19pep primary_assembly:ASM223467v1:1:25459511:254666... [more]
ENSORLT00000045600.11.208e-4638.86pep primary_assembly:ASM223467v1:4:26167161:261711... [more]
ENSORLT00000040501.12.449e-4638.86pep primary_assembly:ASM223467v1:1:1251188:1255180... [more]
ENSORLT00000036827.12.358e-4430.72pep primary_assembly:ASM223467v1:16:28613823:28617... [more]
ENSORLT00000033871.13.623e-4434.72pep primary_assembly:ASM223467v1:5:24767545:247706... [more]
back to top
BLAST of Transposon Ty3-I Gag-Pol polyprotein vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000081257.17.177e-11044.10SMESG000081257.1[more]
SMESG000038955.11.007e-10946.45SMESG000038955.1[more]
SMESG000065302.11.711e-9142.75SMESG000065302.1[more]
SMESG000029259.14.699e-7338.14SMESG000029259.1[more]
SMESG000035021.12.635e-6533.52SMESG000035021.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30015933 ID=SMED30015933|Name=Transposon Ty3-I Gag-Pol polyprotein|organism=Schmidtea mediterranea sexual|type=transcript|length=2084bp
AAAATTAACAGTAGGTGATTGTTTTTGTTGTGGTGAAAGGTTACATAAAA
GATATAAGTGCCCACTTAAAAATTAATGTCTAAAACCTGGCAATGAAGAT
CATGGGTTCCGAGACTGATTTTAATTGCAGAAAGAGGTTCCCCGACGATA
TCAAAGAACAGCATGCATAGAAGAATATTCAAAATCTCGAAAACAAGGTT
TTACCGAGAACAATAAAGATTTCAGGATAACTCACAGTGAAATAGAATAA
AGATGCAATGTTCCTGAGAAATATAGTACGATAAAAGAAGACGAAAAAAC
AATCGGCGACTTAATGGGTATCATTTTGTCGGTGGAGTCAAGACAATGAA
TTGTGGATTAAGAAATGAACGCCGAACAGAAAAGGCAGAAAAAGAGATGT
ATCAGACAAAAGATGGAAGAATTTGGGGTAAAATTATTTTGAATAGTACA
GAAGTAGATATGTTATGGGATTCGGGAACGTCAGTAACAGTCATGAGCAA
GAATTTGTGGGAGGTAATAGGCAAACCAGATCTTCAACGTAGTGCTATAC
TATTATGCGGAGTATTTTCAACTGGAGAAGAATCAATGGTATGTATGACT
ATACCAGCTACCAAAATTATTACAGTAGTGGTTATAAAAGAGATTAAGCC
AGAATTCATCGGTGGTATTGATATAATAGAAAAATTTGGAGTAAAGTACG
ATACGAGATGCGGACGTCAGGAGGTCCAATAATGCAACATCCACGGCGTC
AACCAATGCACAGAGAAAAGAATGGAAGACCTGATAAAAAAATTAATAAA
AGCAAAAGTTATTCAGCGTTGTAAGAGTTCTTGGAATGCTCGGTTAGTGA
TAGTAGGAAAGAAAGACGGATCCATAAGAATGTGTGTAGACTATCGTGGA
TTGAATGCAATAACATTAAAGGAATCTTTCTCGATGTCTAATACCAAATT
TTTACTGGACTGTCTCACAGATGCAATAATATTCTCGTCAATTGATTTAG
ATCAAGCGTATTACCAAGTAGAATTGGCTCCAGATATTCAAGAAAGGACT
GCATTTAGTATAAGAGAAGGACAATTCTGTTTCAATAGGCTACTGGTTAG
ATTATCAACCGCTCCTACAACTTTTCAGTGACTAATGCACACAGTATTGG
AAGAAATGCTACTGAAAGGAGTAGTTGTTTACTTAGATGACATTTTGATA
TATAGGAAAAGCAAAAAAGATCATGATGAGCTGCTAGAAGAATTATTTAA
AAGAATTCAAATGGCAGGGTTGAAGATAAATCCAGAAAAATGCGAATTCA
ATAAAACAGAACTATGCTTTCTTGGGCATACATTTAATTGTGAGAGTATT
CAAACAAATAGCAAGTTGAAGAAATTGAGAAAGCAGAAGAACCAAAATGT
TCAAAACAGTTAAGATCATTTCTCAGATTAACGAACTACTACAGAAGATT
CATCAAAGACTATGGCAGAATCGCAGAACCGTTTTATGAGTCAACATCTG
TATGTGACAAATGAAAGTTTCATAGTACTGAAGAACAGGCTGTGTGTGGC
ACCTATTCTCGATTATCCAAGAGAAGATAGAACATTTATCTTAGAAACAT
ACGCTAGCTTTGGAATTATTGGGTCGGTTTGGAGCCACGTTAAAGGAATC
TGTTACAGCTTATGGTTTGAGACATATGACAGCGTATGAAAAAGGCTACT
GTATAATGAGGAAAAACCTTCTCGCTGTACATGAATATGTTATGAATTTT
AGAGAATATTTTTACGGAAAAAGTTTATAATTCGTACAGATCACTATGCA
TTCGTGTTCATGAACACTACAAAAACACCAATTTGACCACAATTTCAAAC
ATGACTAGCGAATCTTGCTGAATATGATTTTGAATTGAAATACAAGAAAG
GGGAAGAACACTCGAATGCAGATGGGCTATCAAGATTGAAAGGTATGATT
TGCACCAAGCGTCAAACAAGACATGAAGAGTCCAAAGAAGGAAAATCAAA
TATAAGATATGTATACTCTATCAAAAGAACAGAGACTATGGAAAAGTATT
GGAGCAGCAGCAGAAGGATATCAAATTTCAAGAG
back to top

protein sequence of SMED30015933-orf-1

>SMED30015933-orf-1 ID=SMED30015933-orf-1|Name=SMED30015933-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=129bp
MNCGLRNERRTEKAEKEMYQTKDGRIWGKIILNSTEVDMLWDSGTSVTVM
SKNLWEVIGKPDLQRSAILLCGVFSTGEESMVCMTIPATKIITVVVIKEI
KPEFIGGIDIIEKFGVKYDTRCGRQEVQ*
back to top

protein sequence of SMED30015933-orf-2

>SMED30015933-orf-2 ID=SMED30015933-orf-2|Name=SMED30015933-orf-2|organism=Schmidtea mediterranea sexual|type=polypeptide|length=120bp
MEDLIKKLIKAKVIQRCKSSWNARLVIVGKKDGSIRMCVDYRGLNAITLK
ESFSMSNTKFLLDCLTDAIIFSSIDLDQAYYQVELAPDIQERTAFSIREG
QFCFNRLLVRLSTAPTTFQ*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0003116parenchymal cell
Vocabulary: INTERPRO
TermDefinition
IPR000477RT_dom
IPR021109Peptidase_aspartic_dom_sf
Vocabulary: molecular function
TermDefinition
GO:0003676nucleic acid binding
GO:0003677DNA binding
GO:0004190aspartic-type endopeptidase activity
Vocabulary: biological process
TermDefinition
GO:0006313transposition, DNA-mediated
GO:0006508proteolysis
GO:0015074DNA integration
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR021109Aspartic peptidase domain superfamilyGENE3DG3DSA:2.40.70.10coord: 21..119
e-value: 1.3E-6
score: 30.4
IPR021109Aspartic peptidase domain superfamilySUPERFAMILYSSF50630Acid proteasescoord: 19..116