Protein tyrosine phosphatase, receptor type, M

Overview
NameProtein tyrosine phosphatase, receptor type, M
Smed IDSMED30015931
Length (bp)1129
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Protein tyrosine phosphatase, receptor type, M (SMED30015931) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Protein tyrosine phosphatase, receptor type, M (SMED30015931) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30015931

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 2

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
parenchymal cellSMED30015931SMESG000068931.1 dd_Smed_v4_9638_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
parenchymal cellSMED30015931SMESG000068931.1 dd_Smed_v6_9638_0dd_Smed_v6PMID:29674432
Plass et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Protein tyrosine phosphatase, receptor type, M vs. Ensembl Human
Match: PTPRJ (protein tyrosine phosphatase receptor type J [Source:HGNC Symbol;Acc:HGNC:9673])

HSP 1 Score: 72.4034 bits (176), Expect = 4.203e-13
Identity = 78/338 (23.08%), Postives = 156/338 (46.15%), Query Frame = 2
Query:  110 KKRSSKHKTEEPQPVQEEAKVLNRAIRISEFKNEYKKLCCNDFVILKKEYKDLINESMTMKESEYNIWTSIESMSNINLHGRIHIVQVDNLRVTMSSSLFS-NAKLDAVFIPDQVKHQVIQYIVSQDPSEDSIFDFFQMIWELNISYLITLTK-ISKRKGFIYEYWDSKSENKTYSKDKVSYKIKKTKETNSGNLTERLFILEN-NNLERREITQLHLMTSTCQ-----NDSVLN--YYEKLFIKLHEIKSLGLCYPLLFHSSNSNLDQCAMLICIDKIISTLAFGSDMVNIYRMMLELNQYRNLMLQQECHYLYIYEYIDWFLRKSFKIMKSKKRTK 1093
            +K+    K  E    Q ++   ++ IR+  F+  +KK   +      +EY+DL  + + + + +Y    + E   N   +   +++  D  RV +S    S +  ++A ++P    H    +I +Q P  +++ DF++M+WE N+  +I LTK + + +    EYW SK      ++D     +  T E      T R F ++N    E   + Q H  +          D ++N  Y  + ++K    +S     P+L H S + + +    I ID++I  +    + V++Y ++ +L  +R LM+Q E  Y+++ + +         I++S+K +K
Sbjct:  997 RKKRKDAKNNEVSFSQIKSLKRSKLIRVENFEAYFKKQQADSNCGFAEEYEDL--KLVGISQPKY----AAELAENRGKNRYNNVLPYDISRVKLSVQTHSTDDYINANYMPGY--HSKKDFIATQGPLPNTLKDFWRMVWEKNVYAIIMLTKCVEQGRTKCEEYWPSKQ-----AQDYGDITVAMTSEIVLPEWTIRDFTVKNIQTSESHPLRQFHFTSWPDHGVPDTTDLLINFRYLVRDYMKQSPPES-----PILVHCS-AGVGRTGTFIAIDRLIYQIE-NENTVDVYGIVYDLRMHRPLMVQTEDQYVFLNQCV-------LDIVRSQKDSK 1307          
BLAST of Protein tyrosine phosphatase, receptor type, M vs. Ensembl Human
Match: PTPRJ (protein tyrosine phosphatase receptor type J [Source:HGNC Symbol;Acc:HGNC:9673])

HSP 1 Score: 72.4034 bits (176), Expect = 4.205e-13
Identity = 78/338 (23.08%), Postives = 156/338 (46.15%), Query Frame = 2
Query:  110 KKRSSKHKTEEPQPVQEEAKVLNRAIRISEFKNEYKKLCCNDFVILKKEYKDLINESMTMKESEYNIWTSIESMSNINLHGRIHIVQVDNLRVTMSSSLFS-NAKLDAVFIPDQVKHQVIQYIVSQDPSEDSIFDFFQMIWELNISYLITLTK-ISKRKGFIYEYWDSKSENKTYSKDKVSYKIKKTKETNSGNLTERLFILEN-NNLERREITQLHLMTSTCQ-----NDSVLN--YYEKLFIKLHEIKSLGLCYPLLFHSSNSNLDQCAMLICIDKIISTLAFGSDMVNIYRMMLELNQYRNLMLQQECHYLYIYEYIDWFLRKSFKIMKSKKRTK 1093
            +K+    K  E    Q ++   ++ IR+  F+  +KK   +      +EY+DL  + + + + +Y    + E   N   +   +++  D  RV +S    S +  ++A ++P    H    +I +Q P  +++ DF++M+WE N+  +I LTK + + +    EYW SK      ++D     +  T E      T R F ++N    E   + Q H  +          D ++N  Y  + ++K    +S     P+L H S + + +    I ID++I  +    + V++Y ++ +L  +R LM+Q E  Y+++ + +         I++S+K +K
Sbjct: 1001 RKKRKDAKNNEVSFSQIKSLKRSKLIRVENFEAYFKKQQADSNCGFAEEYEDL--KLVGISQPKY----AAELAENRGKNRYNNVLPYDISRVKLSVQTHSTDDYINANYMPGY--HSKKDFIATQGPLPNTLKDFWRMVWEKNVYAIIMLTKCVEQGRTKCEEYWPSKQ-----AQDYGDITVAMTSEIVLPEWTIRDFTVKNIQTSESHPLRQFHFTSWPDHGVPDTTDLLINFRYLVRDYMKQSPPES-----PILVHCS-AGVGRTGTFIAIDRLIYQIE-NENTVDVYGIVYDLRMHRPLMVQTEDQYVFLNQCV-------LDIVRSQKDSK 1311          
BLAST of Protein tyrosine phosphatase, receptor type, M vs. Ensembl Human
Match: PTPRJ (protein tyrosine phosphatase receptor type J [Source:HGNC Symbol;Acc:HGNC:9673])

HSP 1 Score: 70.8626 bits (172), Expect = 1.393e-12
Identity = 79/338 (23.37%), Postives = 156/338 (46.15%), Query Frame = 2
Query:  110 KKRSSKHKTEEPQPVQEEAKVLNRAIRISEFKNEYKKLCCNDFVILKKEYKDLINESMTMKESEYNIWTSIESMSNINLHGRIHIVQVDNLRVTMSSSLFS-NAKLDAVFIPDQVKHQVIQYIVSQDPSEDSIFDFFQMIWELNISYLITLTK-ISKRKGFIYEYWDSKSENKTYSKDKVSYKIKKTKETNSGNLTERLFILEN-NNLERREITQLHLMTSTCQ-----NDSVLN--YYEKLFIKLHEIKSLGLCYPLLFHSSNSNLDQCAMLICIDKIISTLAFGSDMVNIYRMMLELNQYRNLMLQQECHYLYIYEYIDWFLRKSFKIMKSKKRTK 1093
            +K+    K  E    Q + K  ++ IR+  F+  +KK   +      +EY+DL  + + + + +Y    + E   N   +   +++  D  RV +S    S +  ++A ++P    H    +I +Q P  +++ DF++M+WE N+  +I LTK + + +    EYW SK      ++D     +  T E      T R F ++N    E   + Q H  +          D ++N  Y  + ++K    +S     P+L H S + + +    I ID++I  +    + V++Y ++ +L  +R LM+Q E  Y+++ + +         I++S+K +K
Sbjct:  997 RKKRKDAKNNEVSFSQIKPKK-SKLIRVENFEAYFKKQQADSNCGFAEEYEDL--KLVGISQPKY----AAELAENRGKNRYNNVLPYDISRVKLSVQTHSTDDYINANYMPGY--HSKKDFIATQGPLPNTLKDFWRMVWEKNVYAIIMLTKCVEQGRTKCEEYWPSKQ-----AQDYGDITVAMTSEIVLPEWTIRDFTVKNIQTSESHPLRQFHFTSWPDHGVPDTTDLLINFRYLVRDYMKQSPPES-----PILVHCS-AGVGRTGTFIAIDRLIYQIE-NENTVDVYGIVYDLRMHRPLMVQTEDQYVFLNQCV-------LDIVRSQKDSK 1306          
BLAST of Protein tyrosine phosphatase, receptor type, M vs. Ensembl Human
Match: PTPRM (protein tyrosine phosphatase receptor type M [Source:HGNC Symbol;Acc:HGNC:9675])

HSP 1 Score: 70.4774 bits (171), Expect = 1.774e-12
Identity = 80/323 (24.77%), Postives = 140/323 (43.34%), Query Frame = 2
Query:  116 RSSKHKTEEPQPVQEEAKVLNRAIRISEFKNEYKKLCCNDFVILKKEYKDLINESMTMKESEYNIWTSIESMSNINLHGRIHIVQVDNLRVTM-------SSSLFSNAKLDAVFIPDQVKHQVIQYIVSQDPSEDSIFDFFQMIWELNISYLITLTKISK-RKGFIYEYWDSKSENKTYSKDKVSYKIKKTKETNSGNLTE---RLFILENNNL-ERREITQLHLMTSTCQNDSVLNYYEK---LFIKLHEIKSLGLCYPLLFHSSNSNLDQCAMLICIDKIISTLAFGSDMVNIYRMMLELNQYRNLMLQQECHYLYIYEYI 1039
            +S  +K  EP  V  +   L+ AIR+++      ++ C +    K+EY+          E +   W S +   N   +   +I+  D+ RV +       +S   +   +D    P+        YI +Q P +++I+DF++M+W  N + +I +T + +  +    +YW   +E          YK  K     +  L E   R F +E   + E REI Q H    T   D  + Y+      F++  + KS     PL+ H S +   +    I ID I+  +A    +V+IY  + EL   R  M+Q E  Y++I++ I
Sbjct:  870 QSHTYKKREPADVPYQTGQLHPAIRVADLLQHITQMKCAEGYGFKEEYESFF-------EGQSAPWDSAKKDENRMKNRYGNIIAYDHSRVRLQTIEGDTNSDYINGNYIDGYHRPNH-------YIATQGPMQETIYDFWRMVWHENTASIIMVTNLVEVGRVKCCKYWPDDTE---------IYKDIKVTLIETELLAEYVIRTFAVEKRGVHEIREIRQFHF---TGWPDHGVPYHATGLLGFVRQVKSKSPPSAGPLVVHCS-AGAGRTGCFIVID-IMLDMAEREGVVDIYNCVRELRSRRVNMVQTEEQYVFIHDAI 1164          
BLAST of Protein tyrosine phosphatase, receptor type, M vs. Ensembl Human
Match: PTPRM (protein tyrosine phosphatase receptor type M [Source:HGNC Symbol;Acc:HGNC:9675])

HSP 1 Score: 70.4774 bits (171), Expect = 2.006e-12
Identity = 80/323 (24.77%), Postives = 140/323 (43.34%), Query Frame = 2
Query:  116 RSSKHKTEEPQPVQEEAKVLNRAIRISEFKNEYKKLCCNDFVILKKEYKDLINESMTMKESEYNIWTSIESMSNINLHGRIHIVQVDNLRVTM-------SSSLFSNAKLDAVFIPDQVKHQVIQYIVSQDPSEDSIFDFFQMIWELNISYLITLTKISK-RKGFIYEYWDSKSENKTYSKDKVSYKIKKTKETNSGNLTE---RLFILENNNL-ERREITQLHLMTSTCQNDSVLNYYEK---LFIKLHEIKSLGLCYPLLFHSSNSNLDQCAMLICIDKIISTLAFGSDMVNIYRMMLELNQYRNLMLQQECHYLYIYEYI 1039
            +S  +K  EP  V  +   L+ AIR+++      ++ C +    K+EY+          E +   W S +   N   +   +I+  D+ RV +       +S   +   +D    P+        YI +Q P +++I+DF++M+W  N + +I +T + +  +    +YW   +E          YK  K     +  L E   R F +E   + E REI Q H    T   D  + Y+      F++  + KS     PL+ H S +   +    I ID I+  +A    +V+IY  + EL   R  M+Q E  Y++I++ I
Sbjct:  857 QSHTYKKREPADVPYQTGQLHPAIRVADLLQHITQMKCAEGYGFKEEYESFF-------EGQSAPWDSAKKDENRMKNRYGNIIAYDHSRVRLQTIEGDTNSDYINGNYIDGYHRPNH-------YIATQGPMQETIYDFWRMVWHENTASIIMVTNLVEVGRVKCCKYWPDDTE---------IYKDIKVTLIETELLAEYVIRTFAVEKRGVHEIREIRQFHF---TGWPDHGVPYHATGLLGFVRQVKSKSPPSAGPLVVHCS-AGAGRTGCFIVID-IMLDMAEREGVVDIYNCVRELRSRRVNMVQTEEQYVFIHDAI 1151          
BLAST of Protein tyrosine phosphatase, receptor type, M vs. Ensembl Celegans
Match: ptp-3 (Tyrosine-protein phosphatase Lar-like [Source:UniProtKB/Swiss-Prot;Acc:Q9BMN8])

HSP 1 Score: 62.003 bits (149), Expect = 3.822e-10
Identity = 67/297 (22.56%), Postives = 137/297 (46.13%), Query Frame = 2
Query:  170 VLNRAIRISEFKNEYKKLCCNDFVILKKEYKDLINESMTMKESEYNIWTSIESMSNINLHGR--IHIVQVDNLRVTMSS--SLFSNAKLDAVFIPDQVKHQVIQYIVSQDPSEDSIFDFFQMIWELNISYLITLTKISKRKGF-IYEYWDSKSENKTYSKDKVSYKIKKTKETNSGNLTERLFILENNNLERREITQLHLMTSTCQNDSVLNYYEKLFIKLHEIKSLGL--CYPLLFHSSNSNLDQCAMLICIDKIISTLAFGSDMVNIYRMMLELNQYRNLMLQQECHYLYIYEYI 1039
            V + A+ I+E  N  ++L  N+    + E++       +++  ++  W    S +++N H     ++   D+ RV +S+         ++A ++    K +   YI +Q P  ++  DF++M+WE     ++ LT + +R      +YW S+    TY   +V+  ++     +    T RL ++     E REI   HL  +   +  V ++     I L  +K+L      P++ H S + + +    I ID ++  L +  + V+IY  +  L   R+ M+Q E  Y++I++ +
Sbjct:  505 VSHPAVPIAELANHIERLRMNNNAGFQSEFE-------SIETGQHFTWE--HSSADMNKHKNRYANVAAYDHSRVVLSNVEGYPGMDYINANYVDGYDKPR--SYIATQGPLPETFSDFWRMVWEEQSVTIVMLTNLEERSRVKCDQYWPSRG-TATYGDIEVTL-LESVHLAHYTMRTMRLKMV--GEPEVREIK--HLQYTAWPDHGVPDHPTPFLIFLKRVKTLNPNDAGPIISHCS-AGIGRTGAFIVIDCMLERLRY-DNTVDIYGCVTALRAQRSYMVQTEEQYIFIHDAV 782          
BLAST of Protein tyrosine phosphatase, receptor type, M vs. Ensembl Celegans
Match: dep-1 (Receptor-type tyrosine-protein phosphatase dep-1 [Source:UniProtKB/Swiss-Prot;Acc:G5EGJ9])

HSP 1 Score: 56.6102 bits (135), Expect = 1.319e-8
Identity = 61/302 (20.20%), Postives = 126/302 (41.72%), Query Frame = 2
Query:  176 NRAIRISEFKNEYKKLCCNDFVILKKEYKDLINESM--TMKESEYNIWTSIESMSNINL--HGRIHIVQVDNLRVTMSSSLFSNAKLDAVFIPDQVKHQVIQYIVSQDPSEDSIFDFFQMIWELNISYLITLTK-ISKRKGFIYEYWDSKSENKTYSKDKVSYKIKKTKETNSGNLTERLFILENNNLER--------REITQLHLMT----STCQNDSVLNYYEKLFIKLHEIKSLGLCYPLLFHSSNSNLDQCAMLICIDKIISTLAFGSDMVNIYRMMLELNQYRNLMLQQECHYLYIY 1030
            +R +RI +F +  + +  +      +EY  + N  +  ++  SE  I       +NI    H R+ +   +N+             ++A ++P     +  ++I +Q P   +   F+QM WE     +I LTK + K +   ++YW    EN       +   I   KE +        F++ +  LE+        R +   H M         + + +  + ++F   H +       P + H S + + +    I ID+++ + +FG D ++++  + E+   R  M+Q E  Y++I+
Sbjct:   97 SRPVRIEDFADHVRLMSADSDFRFSEEYDMMRNVGVGQSVAASELPINRPKNRFTNIPSYDHSRVKLSNPNNIE--------GGDYINANYVPGFSSRR--EFIAAQGPLPTTRDHFWQMTWEQQCPAIIALTKCVEKGRDKCHQYW-PDHENVPVLYGDIEVTIVAEKEFDE-------FVIRDIRLEKSGPDGRVTRFVRHWHYMAWPDFGAPSHPNGIIQFSRMF--RHHLPHSPHNAPTIVHCS-AGVGRSGTFISIDRLLQSSSFG-DPIDVFGTVCEMRYERCQMVQNEQQYIFIH 376          
BLAST of Protein tyrosine phosphatase, receptor type, M vs. Ensembl Celegans
Match: ptp-3 (Tyrosine-protein phosphatase Lar-like [Source:UniProtKB/Swiss-Prot;Acc:Q9BMN8])

HSP 1 Score: 56.6102 bits (135), Expect = 2.406e-8
Identity = 64/291 (21.99%), Postives = 133/291 (45.70%), Query Frame = 2
Query:  182 AIRISEFKNEYKKLCCNDFVILKKEYKDLINESMTMKESEYNIWTSIESMSNINLHGRIHIVQVDNLRVTMSS--SLFSNAKLDAVFIPDQVKHQVIQYIVSQDPSEDSIFDFFQMIWELNISYLITLTKISKRKGF-IYEYWDSKSENKTYSKDKVSYKIKKTKETNSGNLTERLFILENNNLERREITQLHLMTSTCQNDSVLNYYEKLFIKLHEIKSLGL--CYPLLFHSSNSNLDQCAMLICIDKIISTLAFGSDMVNIYRMMLELNQYRNLMLQQECHYLYIYEYI 1039
            A+ I+E  N  ++L  N+    + E++       +++  ++  W    +  N + +   ++   D+ RV +S+         ++A ++    K +   YI +Q P  ++  DF++M+WE     ++ LT + +R      +YW S+    TY   +V+  ++     +    T RL ++     E REI   HL  +   +  V ++     I L  +K+L      P++ H S + + +    I ID ++  L +  + V+IY  +  L   R+ M+Q E  Y++I++ +
Sbjct: 1650 AVPIAELANHIERLRMNNNAGFQSEFE-------SIETGQHFTWEHSSADMNKHKNRYANVAAYDHSRVVLSNVEGYPGMDYINANYVDGYDKPR--SYIATQGPLPETFSDFWRMVWEEQSVTIVMLTNLEERSRVKCDQYWPSRG-TATYGDIEVTL-LESVHLAHYTMRTMRLKMV--GEPEVREIK--HLQYTAWPDHGVPDHPTPFLIFLKRVKTLNPNDAGPIISHCS-AGIGRTGAFIVIDCMLERLRY-DNTVDIYGCVTALRAQRSYMVQTEEQYIFIHDAV 1923          
BLAST of Protein tyrosine phosphatase, receptor type, M vs. Ensembl Celegans
Match: ptp-3 (Tyrosine-protein phosphatase Lar-like [Source:UniProtKB/Swiss-Prot;Acc:Q9BMN8])

HSP 1 Score: 56.225 bits (134), Expect = 2.508e-8
Identity = 64/291 (21.99%), Postives = 133/291 (45.70%), Query Frame = 2
Query:  182 AIRISEFKNEYKKLCCNDFVILKKEYKDLINESMTMKESEYNIWTSIESMSNINLHGRIHIVQVDNLRVTMSS--SLFSNAKLDAVFIPDQVKHQVIQYIVSQDPSEDSIFDFFQMIWELNISYLITLTKISKRKGF-IYEYWDSKSENKTYSKDKVSYKIKKTKETNSGNLTERLFILENNNLERREITQLHLMTSTCQNDSVLNYYEKLFIKLHEIKSLGL--CYPLLFHSSNSNLDQCAMLICIDKIISTLAFGSDMVNIYRMMLELNQYRNLMLQQECHYLYIYEYI 1039
            A+ I+E  N  ++L  N+    + E++       +++  ++  W    +  N + +   ++   D+ RV +S+         ++A ++    K +   YI +Q P  ++  DF++M+WE     ++ LT + +R      +YW S+    TY   +V+  ++     +    T RL ++     E REI   HL  +   +  V ++     I L  +K+L      P++ H S + + +    I ID ++  L +  + V+IY  +  L   R+ M+Q E  Y++I++ +
Sbjct: 1606 AVPIAELANHIERLRMNNNAGFQSEFE-------SIETGQHFTWEHSSADMNKHKNRYANVAAYDHSRVVLSNVEGYPGMDYINANYVDGYDKPR--SYIATQGPLPETFSDFWRMVWEEQSVTIVMLTNLEERSRVKCDQYWPSRG-TATYGDIEVTL-LESVHLAHYTMRTMRLKMV--GEPEVREIK--HLQYTAWPDHGVPDHPTPFLIFLKRVKTLNPNDAGPIISHCS-AGIGRTGAFIVIDCMLERLRY-DNTVDIYGCVTALRAQRSYMVQTEEQYIFIHDAV 1879          
BLAST of Protein tyrosine phosphatase, receptor type, M vs. Ensembl Celegans
Match: ptp-3 (Tyrosine-protein phosphatase Lar-like [Source:UniProtKB/Swiss-Prot;Acc:Q9BMN8])

HSP 1 Score: 56.225 bits (134), Expect = 2.652e-8
Identity = 64/291 (21.99%), Postives = 133/291 (45.70%), Query Frame = 2
Query:  182 AIRISEFKNEYKKLCCNDFVILKKEYKDLINESMTMKESEYNIWTSIESMSNINLHGRIHIVQVDNLRVTMSS--SLFSNAKLDAVFIPDQVKHQVIQYIVSQDPSEDSIFDFFQMIWELNISYLITLTKISKRKGF-IYEYWDSKSENKTYSKDKVSYKIKKTKETNSGNLTERLFILENNNLERREITQLHLMTSTCQNDSVLNYYEKLFIKLHEIKSLGL--CYPLLFHSSNSNLDQCAMLICIDKIISTLAFGSDMVNIYRMMLELNQYRNLMLQQECHYLYIYEYI 1039
            A+ I+E  N  ++L  N+    + E++       +++  ++  W    +  N + +   ++   D+ RV +S+         ++A ++    K +   YI +Q P  ++  DF++M+WE     ++ LT + +R      +YW S+    TY   +V+  ++     +    T RL ++     E REI   HL  +   +  V ++     I L  +K+L      P++ H S + + +    I ID ++  L +  + V+IY  +  L   R+ M+Q E  Y++I++ +
Sbjct: 1674 AVPIAELANHIERLRMNNNAGFQSEFE-------SIETGQHFTWEHSSADMNKHKNRYANVAAYDHSRVVLSNVEGYPGMDYINANYVDGYDKPR--SYIATQGPLPETFSDFWRMVWEEQSVTIVMLTNLEERSRVKCDQYWPSRG-TATYGDIEVTL-LESVHLAHYTMRTMRLKMV--GEPEVREIK--HLQYTAWPDHGVPDHPTPFLIFLKRVKTLNPNDAGPIISHCS-AGIGRTGAFIVIDCMLERLRY-DNTVDIYGCVTALRAQRSYMVQTEEQYIFIHDAV 1947          
BLAST of Protein tyrosine phosphatase, receptor type, M vs. Ensembl Fly
Match: Ptp69D (gene:FBgn0014007 transcript:FBtr0075913)

HSP 1 Score: 67.3958 bits (163), Expect = 8.460e-12
Identity = 54/200 (27.00%), Postives = 96/200 (48.00%), Query Frame = 2
Query:  467 QYIVSQDPSEDSIFDFFQMIWELNISYLITLTKISK-RKGFIYEYWDSKSENKTYSKDKVSYKIKKTKETNSGNLTERLFILENNNL------ERREITQLHLMTSTCQNDSVLNYYEKLFIKLHEIKSLGLCY-----PLLFHSSNSNLDQCAMLICIDKIISTLAFGSDMVNIYRMMLELNQYRNLMLQQECHYLYIY 1030
            ++I +Q P E +I DF++MIWE ++  ++ LT + +  K    +YW  K  +     D +   +K  +E  +G+  ER   +  N        +RR+ITQ H +T     D +   +    IK   I+ +   Y     P+L H S + + +   L+ +D +I  L    D V+IY  + +L   RN ++Q    Y+++Y
Sbjct:  961 KFICAQGPMESTIDDFWRMIWEQHLEIIVMLTNLEEYNKAKCAKYWPEKVFDTKQFGDIL---VKFAQERKTGDYIERTLNVSKNKANVGEEEDRRQITQYHYLT---WKDFMAPEHPHGIIKF--IRQINSVYSLQRGPILVHCS-AGVGRTGTLVALDSLIQQLE-EEDSVSIYNTVCDLRHQRNFLVQSLKQYIFLY 1150          
BLAST of Protein tyrosine phosphatase, receptor type, M vs. Ensembl Fly
Match: Ptp69D (gene:FBgn0014007 transcript:FBtr0075914)

HSP 1 Score: 67.3958 bits (163), Expect = 8.922e-12
Identity = 54/200 (27.00%), Postives = 96/200 (48.00%), Query Frame = 2
Query:  467 QYIVSQDPSEDSIFDFFQMIWELNISYLITLTKISK-RKGFIYEYWDSKSENKTYSKDKVSYKIKKTKETNSGNLTERLFILENNNL------ERREITQLHLMTSTCQNDSVLNYYEKLFIKLHEIKSLGLCY-----PLLFHSSNSNLDQCAMLICIDKIISTLAFGSDMVNIYRMMLELNQYRNLMLQQECHYLYIY 1030
            ++I +Q P E +I DF++MIWE ++  ++ LT + +  K    +YW  K  +     D +   +K  +E  +G+  ER   +  N        +RR+ITQ H +T     D +   +    IK   I+ +   Y     P+L H S + + +   L+ +D +I  L    D V+IY  + +L   RN ++Q    Y+++Y
Sbjct:  960 KFICAQGPMESTIDDFWRMIWEQHLEIIVMLTNLEEYNKAKCAKYWPEKVFDTKQFGDIL---VKFAQERKTGDYIERTLNVSKNKANVGEEEDRRQITQYHYLT---WKDFMAPEHPHGIIKF--IRQINSVYSLQRGPILVHCS-AGVGRTGTLVALDSLIQQLE-EEDSVSIYNTVCDLRHQRNFLVQSLKQYIFLY 1149          
BLAST of Protein tyrosine phosphatase, receptor type, M vs. Ensembl Fly
Match: Lar (gene:FBgn0000464 transcript:FBtr0331239)

HSP 1 Score: 67.3958 bits (163), Expect = 1.063e-11
Identity = 67/291 (23.02%), Postives = 137/291 (47.08%), Query Frame = 2
Query:  185 IRISEFKNEYKKLCCNDFVILKKEYKDLINESMTMKESEYNIWTSIESMSNINLHGRIHIVQVDNLRVTMSS--SLFSNAKLDAVFIPDQVKHQVIQYIVSQDPSEDSIFDFFQMIWELNISYLITLTKISKRKGF-IYEYWDSKSENKTYSKDKVSYKIKKTKETNSGNLTERLFILENNNL-ERREITQLHLMTSTCQNDSVLNYYEKLFIKLHEIKSLG--LCYPLLFHSSNSNLDQCAMLICIDKIISTLAFGSDMVNIYRMMLELNQYRNLMLQQECHYLYIYEYI 1039
            I ISEF N  ++L  ND     +EY+       +++  +   W +     N + +   ++   D+ RV + +   +  +  ++A +     KH    Y+ +Q P +++  DF++M WEL  + ++ +T++ +R      +YW ++   +TY +  V+  I +T+E  + ++  R F L      +RREI QL    +   +  V ++       L   ++L      P++ H S + + +    I ID ++  +     +++IY  +  L   RN M+Q E  Y++I++ I
Sbjct: 1457 IPISEFANHIERLKSNDNQKFSQEYE-------SIEPGQQFTWDNSNLEHNKSKNRYANVTAYDHSRVQLPAVEGVVGSDYINANYCDGYRKHNA--YVATQGPLQETFVDFWRMCWELKTATIVMMTRLEERTRIKCDQYWPTRG-TETYGQIFVT--ITETQELATYSI--RTFQLCRQGFNDRREIKQLQF--TAWPDHGVPDHPAPFLQFLRRCRALTPPESGPVIVHCS-AGVGRTGCYIVIDSMLERMKH-EKIIDIYGHVTCLRAQRNYMVQTEDQYIFIHDAI 1729          
BLAST of Protein tyrosine phosphatase, receptor type, M vs. Ensembl Fly
Match: Lar (gene:FBgn0000464 transcript:FBtr0331240)

HSP 1 Score: 67.3958 bits (163), Expect = 1.124e-11
Identity = 67/291 (23.02%), Postives = 137/291 (47.08%), Query Frame = 2
Query:  185 IRISEFKNEYKKLCCNDFVILKKEYKDLINESMTMKESEYNIWTSIESMSNINLHGRIHIVQVDNLRVTMSS--SLFSNAKLDAVFIPDQVKHQVIQYIVSQDPSEDSIFDFFQMIWELNISYLITLTKISKRKGF-IYEYWDSKSENKTYSKDKVSYKIKKTKETNSGNLTERLFILENNNL-ERREITQLHLMTSTCQNDSVLNYYEKLFIKLHEIKSLG--LCYPLLFHSSNSNLDQCAMLICIDKIISTLAFGSDMVNIYRMMLELNQYRNLMLQQECHYLYIYEYI 1039
            I ISEF N  ++L  ND     +EY+       +++  +   W +     N + +   ++   D+ RV + +   +  +  ++A +     KH    Y+ +Q P +++  DF++M WEL  + ++ +T++ +R      +YW ++   +TY +  V+  I +T+E  + ++  R F L      +RREI QL    +   +  V ++       L   ++L      P++ H S + + +    I ID ++  +     +++IY  +  L   RN M+Q E  Y++I++ I
Sbjct: 1360 IPISEFANHIERLKSNDNQKFSQEYE-------SIEPGQQFTWDNSNLEHNKSKNRYANVTAYDHSRVQLPAVEGVVGSDYINANYCDGYRKHNA--YVATQGPLQETFVDFWRMCWELKTATIVMMTRLEERTRIKCDQYWPTRG-TETYGQIFVT--ITETQELATYSI--RTFQLCRQGFNDRREIKQLQF--TAWPDHGVPDHPAPFLQFLRRCRALTPPESGPVIVHCS-AGVGRTGCYIVIDSMLERMKH-EKIIDIYGHVTCLRAQRNYMVQTEDQYIFIHDAI 1632          
BLAST of Protein tyrosine phosphatase, receptor type, M vs. Ensembl Fly
Match: Lar (gene:FBgn0000464 transcript:FBtr0081260)

HSP 1 Score: 67.3958 bits (163), Expect = 1.131e-11
Identity = 67/291 (23.02%), Postives = 137/291 (47.08%), Query Frame = 2
Query:  185 IRISEFKNEYKKLCCNDFVILKKEYKDLINESMTMKESEYNIWTSIESMSNINLHGRIHIVQVDNLRVTMSS--SLFSNAKLDAVFIPDQVKHQVIQYIVSQDPSEDSIFDFFQMIWELNISYLITLTKISKRKGF-IYEYWDSKSENKTYSKDKVSYKIKKTKETNSGNLTERLFILENNNL-ERREITQLHLMTSTCQNDSVLNYYEKLFIKLHEIKSLG--LCYPLLFHSSNSNLDQCAMLICIDKIISTLAFGSDMVNIYRMMLELNQYRNLMLQQECHYLYIYEYI 1039
            I ISEF N  ++L  ND     +EY+       +++  +   W +     N + +   ++   D+ RV + +   +  +  ++A +     KH    Y+ +Q P +++  DF++M WEL  + ++ +T++ +R      +YW ++   +TY +  V+  I +T+E  + ++  R F L      +RREI QL    +   +  V ++       L   ++L      P++ H S + + +    I ID ++  +     +++IY  +  L   RN M+Q E  Y++I++ I
Sbjct: 1454 IPISEFANHIERLKSNDNQKFSQEYE-------SIEPGQQFTWDNSNLEHNKSKNRYANVTAYDHSRVQLPAVEGVVGSDYINANYCDGYRKHNA--YVATQGPLQETFVDFWRMCWELKTATIVMMTRLEERTRIKCDQYWPTRG-TETYGQIFVT--ITETQELATYSI--RTFQLCRQGFNDRREIKQLQF--TAWPDHGVPDHPAPFLQFLRRCRALTPPESGPVIVHCS-AGVGRTGCYIVIDSMLERMKH-EKIIDIYGHVTCLRAQRNYMVQTEDQYIFIHDAI 1726          
BLAST of Protein tyrosine phosphatase, receptor type, M vs. Ensembl Zebrafish
Match: ptprk (protein tyrosine phosphatase receptor type K [Source:ZFIN;Acc:ZDB-GENE-030131-9834])

HSP 1 Score: 66.6254 bits (161), Expect = 2.125e-11
Identity = 71/303 (23.43%), Postives = 135/303 (44.55%), Query Frame = 2
Query:  173 LNRAIRISEFKNEYKKLCCNDFVILKKEYKDLINESMTMKESEYNIWTSIESMSNINLHGRIHIVQVDNLRVTM------SSSLFSNAKLDAVFIPDQVKHQVIQYIVSQDPSEDSIFDFFQMIWELNISYLITLT---KISKRKGFIYEYWDSKSENKTYSKDKVSY-KIKKTKETNSGNLTERLFILENNNL-ERREITQLHLMTSTCQNDSVLNYYEKL---FIKLHEIKSLGLCYPLLFHSSNSNLDQCAMLICIDKIISTLAFGSDMVNIYRMMLELNQYRNLMLQQECHYLYIYEYI 1039
            L+ AIR+++       +  +D    K+EY+          E +   W + +   N   +   +I+  D+ RV +       SS + NA    +++      +   YI +Q P  ++++DF++MIW+   + ++ +T   ++ + K   Y+YW   +E   Y   KV++ +++   E        R F LE     E RE+ Q H    T   D  + Y+      FI+  ++ +     P++ H S +   +    I ID I+  +A    +V+IY  +  L   R  M+Q E  Y++I++ I
Sbjct:  545 LHPAIRVADLLQHINLMKTSDSYGFKEEYESFF-------EGQSASWDAAKKEQNRTKNRYGNIIAYDHSRVILQPMEDDPSSDYINANYIDIWLYRDGYQRPSHYIATQGPVHETVYDFWRMIWQEQSACIVMVTNLVEVGRVK--CYKYWPDDAE--VYGDFKVTFVEVEPLAE-----YVVRTFTLERRGFNEVREVKQFHF---TGWPDHGVPYHATGLLSFIRRVKMSNPPTAGPIVVHCS-AGAGRTGCYIVID-IMLDMAEREGVVDIYNCVKALRSRRINMVQTEEQYIFIHDAI 826          
BLAST of Protein tyrosine phosphatase, receptor type, M vs. Ensembl Zebrafish
Match: ptprsa (protein tyrosine phosphatase receptor type Sa [Source:ZFIN;Acc:ZDB-GENE-020107-3])

HSP 1 Score: 66.2402 bits (160), Expect = 2.424e-11
Identity = 70/292 (23.97%), Postives = 127/292 (43.49%), Query Frame = 2
Query:  185 IRISEFKNEYKKLCCNDFVILKKEYKDL-INESMTMKESEYNIWTSIESMSNINL--HGRIHIVQVDNLRVTMSSSLFSNAKLDAVFIPDQVKHQVIQYIVSQDPSEDSIFDFFQMIWELNISYLITLTKI-SKRKGFIYEYWDSKSENKTYSKDKVSYKIKKTKETNSGNLTERLFIL-ENNNLERREITQLHLMTSTCQNDSVLNYYEKLFIKLHEIKSLGL--CYPLLFHSSNSNLDQCAMLICIDKIISTLAFGSDMVNIYRMMLELNQYRNLMLQQECHYLYIYEYI 1039
            I +SE     ++L  ND + L +EY+ +   +  T + S   +       +N+    H R+ +  VD +   M S       ++A +I    K     YI +Q P  ++  DF++M+WE   + ++ +T++  K +    +YW S+    T S   V   +  T E  +     R F L +N + ERRE+ Q     +   +  V  Y       L  +K+       P++ H S + + +    I ID ++  L      V++Y  +  +   RN M+Q E  Y +I+E +
Sbjct:  208 IPVSELPEHMERLKANDNLHLSQEYESIDPGQQFTWEHSNLEVNKQKNRYANVIAYDHTRVILAPVDGI---MGSDY-----INANYIDGYRKQNA--YIATQGPLPETFADFWRMVWEQRAATVVMMTRLEEKSRVKCDQYWPSRG---TDSFGAVQVSLLDTMELAT--FCVRTFSLHKNGSNERREVRQFQF--TAWPDHGVPEYPTPFLAFLRRVKACNPPDAGPVIVHCS-AGVGRTGCFIVIDAMLERLR-QERAVDVYGHVTLMRSQRNYMVQTEDQYGFIHEAL 480          
BLAST of Protein tyrosine phosphatase, receptor type, M vs. Ensembl Zebrafish
Match: ptpn13 (protein tyrosine phosphatase non-receptor type 13 [Source:ZFIN;Acc:ZDB-GENE-070410-72])

HSP 1 Score: 65.4698 bits (158), Expect = 5.602e-11
Identity = 55/234 (23.50%), Postives = 110/234 (47.01%), Query Frame = 2
Query:  359 HIVQVDNLRVTMSSSLFSNAKLDAVFIPDQVKHQVIQYIVSQDPSEDSIFDFFQMIWELNISYLITLTK-ISKRKGFIYEYWDSKSENKTYSKDKVSYKIKKTKETNSGNLTERLFILENNNLERREITQL-HLMTSTCQNDSVLNYYEKLFIKLHEIKSLGLCYPLLFHSSNSNLDQCAMLICIDKIISTLAFGSDMVNIYRMMLELNQYRNLMLQQECHYLYIYEYIDWFLR 1054
            +IV  D  RV + +       ++A FI   VK +   YI  Q P   ++ DF+QM+WE   + +  +T+ +   K     YW     +     D++  ++   K+ +  N   RL  +E  +++  E+ ++ HL  +   +       E+L   +  ++ + L  P++ H S + + +   LICID ++  ++  +D  +I  ++  +   R  M+Q E  Y++ Y+ I + LR
Sbjct: 2241 NIVPFDTTRVLLGND---GGYINANFIKMAVKDESFMYIACQGPLPTTLGDFWQMVWEQKSNVIAMMTQEVEGGKVKCQRYWPDTPRSPQMVDDRL--QVTLVKDQHLDNFVIRL--IELKDVQTNELQRVTHLNYTGWPDHGTPTQPEQLLTFISYMRHIHLSGPIITHCS-AGIGRSGTLICIDVVLGLISKDADF-DISDIVRTMRLQRQGMVQTEEQYIFCYQVILYVLR 2465          
BLAST of Protein tyrosine phosphatase, receptor type, M vs. Ensembl Zebrafish
Match: ptpn13 (protein tyrosine phosphatase non-receptor type 13 [Source:ZFIN;Acc:ZDB-GENE-070410-72])

HSP 1 Score: 65.4698 bits (158), Expect = 5.973e-11
Identity = 55/234 (23.50%), Postives = 110/234 (47.01%), Query Frame = 2
Query:  359 HIVQVDNLRVTMSSSLFSNAKLDAVFIPDQVKHQVIQYIVSQDPSEDSIFDFFQMIWELNISYLITLTK-ISKRKGFIYEYWDSKSENKTYSKDKVSYKIKKTKETNSGNLTERLFILENNNLERREITQL-HLMTSTCQNDSVLNYYEKLFIKLHEIKSLGLCYPLLFHSSNSNLDQCAMLICIDKIISTLAFGSDMVNIYRMMLELNQYRNLMLQQECHYLYIYEYIDWFLR 1054
            +IV  D  RV + +       ++A FI   VK +   YI  Q P   ++ DF+QM+WE   + +  +T+ +   K     YW     +     D++  ++   K+ +  N   RL  +E  +++  E+ ++ HL  +   +       E+L   +  ++ + L  P++ H S + + +   LICID ++  ++  +D  +I  ++  +   R  M+Q E  Y++ Y+ I + LR
Sbjct: 2083 NIVPFDTTRVLLGND---GGYINANFIKMAVKDESFMYIACQGPLPTTLGDFWQMVWEQKSNVIAMMTQEVEGGKVKCQRYWPDTPRSPQMVDDRL--QVTLVKDQHLDNFVIRL--IELKDVQTNELQRVTHLNYTGWPDHGTPTQPEQLLTFISYMRHIHLSGPIITHCS-AGIGRSGTLICIDVVLGLISKDADF-DISDIVRTMRLQRQGMVQTEEQYIFCYQVILYVLR 2307          
BLAST of Protein tyrosine phosphatase, receptor type, M vs. Ensembl Zebrafish
Match: ptprfb (protein tyrosine phosphatase receptor type Fb [Source:NCBI gene;Acc:799867])

HSP 1 Score: 64.6994 bits (156), Expect = 9.256e-11
Identity = 69/290 (23.79%), Postives = 127/290 (43.79%), Query Frame = 2
Query:  185 IRISEFKNEYKKLCCNDFVILKKEYKDL-INESMTMKESEYNIWTSIESMSNINL--HGRIHIVQVDNLRVTMSSSLFSNAKLDAVFIPDQVKHQVIQYIVSQDPSEDSIFDFFQMIWELNISYLITLTKI-SKRKGFIYEYWDSKSENKTYSKDKVSYKIKKTKETNSGNLTERLFIL-ENNNLERREITQLHLMTSTCQNDSVLNYYEKLFIKLHEIKSLGL--CYPLLFHSSNSNLDQCAMLICIDKIISTLAFGSDMVNIYRMMLELNQYRNLMLQQECHYLYIYE 1033
            I +SE  +  ++L  ND +   +EY+ +   +  T + S   +       +N+    H R+ +  VD   V  S  + SN      +I    K     YI +Q P  +++ DF++MIWE   S ++ +T++  K +    +YW  +   +TY   +V+              + R F L +N + E+RE+ Q   M     +  V  Y   +   L  +K+       P++ H S + + +    I ID ++  +      V+IY  +  +   RN M+Q E  Y++I+E
Sbjct: 1340 ISVSELADHIERLKANDALRFSQEYESIDPGQQFTWENSNLEVNKPKNRYANVIAYDHSRVVLTPVDG--VPGSDYINSN------YIDGYRKQNA--YIATQGPLPETLSDFWRMIWEQRASTIVMMTRLEEKSRVKCDQYWPIRG-TETYGMIQVTM----LDAVELATYSVRTFALYKNGSSEKREVRQFQFM--AWPDHGVPEYPTPILAFLRRVKACNPPDAGPMVVHCS-AGVGRTGCFIVIDAMLERMKH-EKTVDIYGHVTCMRSQRNYMVQTEDQYIFIHE 1610          
BLAST of Protein tyrosine phosphatase, receptor type, M vs. Ensembl Xenopus
Match: PTPRM (protein tyrosine phosphatase, receptor type M [Source:NCBI gene;Acc:100127701])

HSP 1 Score: 64.6994 bits (156), Expect = 1.200e-10
Identity = 77/319 (24.14%), Postives = 139/319 (43.57%), Query Frame = 2
Query:  128 HKTEEPQPVQEEAKVLNRAIRISEFKNEYKKLCCNDFVILKKEYKDLINESMTMKESEYNIWTSIESMSNINLHGRIHIVQVDNLRVTM-------SSSLFSNAKLDAVFIPDQVKHQVIQYIVSQDPSEDSIFDFFQMIWELNISYLITLTKISK-RKGFIYEYWDSKSENKTYSKDKVSYKIKKTKETNSGNLTE---RLFILENNNL-ERREITQLHLMTSTCQNDSVLNYYEK---LFIKLHEIKSLGLCYPLLFHSSNSNLDQCAMLICIDKIISTLAFGSDMVNIYRMMLELNQYRNLMLQQECHYLYIYEYI 1039
            +K  +P  +  +   L+ AIR+++      ++ C +    K+EY+       T  E +   W S +   N   +   +I+  D+ RV +       SS   +   +D    P+        YI +Q P +++++DF++MIW  N + ++ +T + +  +    +YW   +E          YK  K     +  L E   R F +E   + E REI Q H    T   D  + Y+      F++  + K+     PL+ H S +   +    I ID I+  +A    +V+IY  + EL   R  M+Q E  Y++I++ I
Sbjct:  798 YKKRDPVDIPYQTGQLHPAIRVADLLQHITQMKCAEGYGFKEEYE-------TFFEGQSAPWESAKKDENRMKNRYGNIIAYDHSRVRLQSIEDEASSDYINGNYVDGYHRPNH-------YIATQGPMQETVYDFWRMIWHENTASIVMVTNLVEVGRVKCCKYWPDDTE---------IYKDIKVTLIETELLAEYVIRTFAVEKRGVHEIREIRQFHF---TGWPDHGVPYHATGLLGFVRQVKSKNPPNSGPLVVHCS-AGAGRTGCFIVID-IMLDMAEREGVVDIYNCVRELRSRRVNMVQTEEQYVFIHDAI 1088          
BLAST of Protein tyrosine phosphatase, receptor type, M vs. Ensembl Xenopus
Match: PTPRM (protein tyrosine phosphatase, receptor type M [Source:NCBI gene;Acc:100127701])

HSP 1 Score: 64.6994 bits (156), Expect = 1.262e-10
Identity = 77/319 (24.14%), Postives = 139/319 (43.57%), Query Frame = 2
Query:  128 HKTEEPQPVQEEAKVLNRAIRISEFKNEYKKLCCNDFVILKKEYKDLINESMTMKESEYNIWTSIESMSNINLHGRIHIVQVDNLRVTM-------SSSLFSNAKLDAVFIPDQVKHQVIQYIVSQDPSEDSIFDFFQMIWELNISYLITLTKISK-RKGFIYEYWDSKSENKTYSKDKVSYKIKKTKETNSGNLTE---RLFILENNNL-ERREITQLHLMTSTCQNDSVLNYYEK---LFIKLHEIKSLGLCYPLLFHSSNSNLDQCAMLICIDKIISTLAFGSDMVNIYRMMLELNQYRNLMLQQECHYLYIYEYI 1039
            +K  +P  +  +   L+ AIR+++      ++ C +    K+EY+       T  E +   W S +   N   +   +I+  D+ RV +       SS   +   +D    P+        YI +Q P +++++DF++MIW  N + ++ +T + +  +    +YW   +E          YK  K     +  L E   R F +E   + E REI Q H    T   D  + Y+      F++  + K+     PL+ H S +   +    I ID I+  +A    +V+IY  + EL   R  M+Q E  Y++I++ I
Sbjct:  848 YKKRDPVDIPYQTGQLHPAIRVADLLQHITQMKCAEGYGFKEEYE-------TFFEGQSAPWESAKKDENRMKNRYGNIIAYDHSRVRLQSIEDEASSDYINGNYVDGYHRPNH-------YIATQGPMQETVYDFWRMIWHENTASIVMVTNLVEVGRVKCCKYWPDDTE---------IYKDIKVTLIETELLAEYVIRTFAVEKRGVHEIREIRQFHF---TGWPDHGVPYHATGLLGFVRQVKSKNPPNSGPLVVHCS-AGAGRTGCFIVID-IMLDMAEREGVVDIYNCVRELRSRRVNMVQTEEQYVFIHDAI 1138          
BLAST of Protein tyrosine phosphatase, receptor type, M vs. Ensembl Xenopus
Match: PTPRM (protein tyrosine phosphatase, receptor type M [Source:NCBI gene;Acc:100127701])

HSP 1 Score: 64.6994 bits (156), Expect = 1.286e-10
Identity = 77/319 (24.14%), Postives = 139/319 (43.57%), Query Frame = 2
Query:  128 HKTEEPQPVQEEAKVLNRAIRISEFKNEYKKLCCNDFVILKKEYKDLINESMTMKESEYNIWTSIESMSNINLHGRIHIVQVDNLRVTM-------SSSLFSNAKLDAVFIPDQVKHQVIQYIVSQDPSEDSIFDFFQMIWELNISYLITLTKISK-RKGFIYEYWDSKSENKTYSKDKVSYKIKKTKETNSGNLTE---RLFILENNNL-ERREITQLHLMTSTCQNDSVLNYYEK---LFIKLHEIKSLGLCYPLLFHSSNSNLDQCAMLICIDKIISTLAFGSDMVNIYRMMLELNQYRNLMLQQECHYLYIYEYI 1039
            +K  +P  +  +   L+ AIR+++      ++ C +    K+EY+       T  E +   W S +   N   +   +I+  D+ RV +       SS   +   +D    P+        YI +Q P +++++DF++MIW  N + ++ +T + +  +    +YW   +E          YK  K     +  L E   R F +E   + E REI Q H    T   D  + Y+      F++  + K+     PL+ H S +   +    I ID I+  +A    +V+IY  + EL   R  M+Q E  Y++I++ I
Sbjct:  853 YKKRDPVDIPYQTGQLHPAIRVADLLQHITQMKCAEGYGFKEEYE-------TFFEGQSAPWESAKKDENRMKNRYGNIIAYDHSRVRLQSIEDEASSDYINGNYVDGYHRPNH-------YIATQGPMQETVYDFWRMIWHENTASIVMVTNLVEVGRVKCCKYWPDDTE---------IYKDIKVTLIETELLAEYVIRTFAVEKRGVHEIREIRQFHF---TGWPDHGVPYHATGLLGFVRQVKSKNPPNSGPLVVHCS-AGAGRTGCFIVID-IMLDMAEREGVVDIYNCVRELRSRRVNMVQTEEQYVFIHDAI 1143          
BLAST of Protein tyrosine phosphatase, receptor type, M vs. Ensembl Xenopus
Match: PTPRM (protein tyrosine phosphatase, receptor type M [Source:NCBI gene;Acc:100127701])

HSP 1 Score: 64.6994 bits (156), Expect = 1.346e-10
Identity = 77/319 (24.14%), Postives = 139/319 (43.57%), Query Frame = 2
Query:  128 HKTEEPQPVQEEAKVLNRAIRISEFKNEYKKLCCNDFVILKKEYKDLINESMTMKESEYNIWTSIESMSNINLHGRIHIVQVDNLRVTM-------SSSLFSNAKLDAVFIPDQVKHQVIQYIVSQDPSEDSIFDFFQMIWELNISYLITLTKISK-RKGFIYEYWDSKSENKTYSKDKVSYKIKKTKETNSGNLTE---RLFILENNNL-ERREITQLHLMTSTCQNDSVLNYYEK---LFIKLHEIKSLGLCYPLLFHSSNSNLDQCAMLICIDKIISTLAFGSDMVNIYRMMLELNQYRNLMLQQECHYLYIYEYI 1039
            +K  +P  +  +   L+ AIR+++      ++ C +    K+EY+       T  E +   W S +   N   +   +I+  D+ RV +       SS   +   +D    P+        YI +Q P +++++DF++MIW  N + ++ +T + +  +    +YW   +E          YK  K     +  L E   R F +E   + E REI Q H    T   D  + Y+      F++  + K+     PL+ H S +   +    I ID I+  +A    +V+IY  + EL   R  M+Q E  Y++I++ I
Sbjct:  869 YKKRDPVDIPYQTGQLHPAIRVADLLQHITQMKCAEGYGFKEEYE-------TFFEGQSAPWESAKKDENRMKNRYGNIIAYDHSRVRLQSIEDEASSDYINGNYVDGYHRPNH-------YIATQGPMQETVYDFWRMIWHENTASIVMVTNLVEVGRVKCCKYWPDDTE---------IYKDIKVTLIETELLAEYVIRTFAVEKRGVHEIREIRQFHF---TGWPDHGVPYHATGLLGFVRQVKSKNPPNSGPLVVHCS-AGAGRTGCFIVID-IMLDMAEREGVVDIYNCVRELRSRRVNMVQTEEQYVFIHDAI 1159          
BLAST of Protein tyrosine phosphatase, receptor type, M vs. Ensembl Xenopus
Match: mfsd14b (major facilitator superfamily domain containing 14B [Source:Xenbase;Acc:XB-GENE-5783273])

HSP 1 Score: 63.5438 bits (153), Expect = 3.541e-10
Identity = 67/290 (23.10%), Postives = 132/290 (45.52%), Query Frame = 2
Query:  185 IRISEFKNEYKKLCCNDFVILKKEYKDL-INESMTMKESEYNIWTSIESMSNINLHGRIHIVQVDNLRVTMSS--SLFSNAKLDAVFIPDQVKHQVIQYIVSQDPSEDSIFDFFQMIWELNISYLITLTKI-SKRKGFIYEYWDSKSENKTYSKDKVSYKIKKTKETNSGNLTERLFIL-ENNNLERREITQLHLMTSTCQNDSVLNYYEKLFIKLHEIKSLGL--CYPLLFHSSNSNLDQCAMLICIDKIISTLAFGSDMVNIYRMMLELNQYRNLMLQQECHYLYIYE 1033
            I IS+  +  ++L  ND +   +EY+ +   +  T + S   +       +N+        +  D+ RV ++S   +  +  ++A +I    K     YI +Q P  ++I DF++M+WE   + ++ +T++  K +    +YW  +  ++TY   +V+  +  T E      T R F L +N + E+R++ Q   M     +  V  Y   +   L  +K        P++ H S + + +    I ID ++  +      V+IY  +  +   RN M+Q E  Y++I+E
Sbjct: 1296 IPISDLADNIERLKANDGLKFSQEYESIDPGQQFTWENSNLEVNKPKNRYANV--------IAYDHSRVILTSVDGVPGSDYINANYIDGYRKQNA--YIATQGPLPETITDFWRMVWEQRTATIVMMTRLEEKSRVKCDQYWPGRG-SETYGMIQVT--LMDTVEL--ATYTVRTFTLYKNGSSEKRDVRQFQFM--AWPDHGVPEYPTPILGFLRRVKGCNPPDAGPMVVHCS-AGVGRTGCFIVIDAMLERVKL-EKTVDIYGHVTCMRSQRNYMVQTEDQYIFIHE 1566          
BLAST of Protein tyrosine phosphatase, receptor type, M vs. Ensembl Mouse
Match: Ptprj (protein tyrosine phosphatase, receptor type, J [Source:MGI Symbol;Acc:MGI:104574])

HSP 1 Score: 72.0182 bits (175), Expect = 3.954e-13
Identity = 75/336 (22.32%), Postives = 156/336 (46.43%), Query Frame = 2
Query:  110 KKRSSKHKTEEPQPVQEEAKVLNRAIRISEFKNEYKKLCCNDFVILKKEYKDLINESMTMKESEYNIWTSIESMSNINLHGRIHIVQVDNLRVTMSSSLFS-NAKLDAVFIPDQVKHQVIQYIVSQDPSEDSIFDFFQMIWELNISYLITLTK-ISKRKGFIYEYWDSKSENKTYSKDKVSYKIKKTKETNSGNLTERLFILEN-NNLERREITQLHLMTSTCQ-----NDSVLNYYEKLFIKLHEIKSLGLCYPLLFHSSNSNLDQCAMLICIDKIISTLAFGSDMVNIYRMMLELNQYRNLMLQQECHYLYIYEYIDWFLRKSFKIMKSKKRTK 1093
            +K+ +  K  E    Q + K  ++ IR+  F+  +KK   +      +EY+DL    +++ +       + E   N   +   +++  D  RV +S    S +  ++A ++P    H    +I +Q P  +++ DF++M+WE N+  ++ LTK + + +    EYW SK      ++D     +  T E      T R F+++N  N E   + Q H  +          D ++N+    ++    +K +    P+L H S + + +    I ID++I  +    + V++Y ++ +L  +R LM+Q E  Y+++ + +         I++++K +K
Sbjct: 1010 RKKRTDAKNNEVSFSQIKPKK-SKLIRVENFEAYFKKQQADSNCGFAEEYEDLKLIGISLPK------YTAEIAENRGKNRYNNVLPYDISRVKLSVQTHSTDDYINANYMPGY--HSKKDFIATQGPLPNTLKDFWRMVWEKNVYAIVMLTKCVEQGRTKCEEYWPSKQ-----AQDYGDITVAMTSEVVLPEWTIRDFVVKNMQNSESHPLRQFHFTSWPDHGVPDTTDLLINFR---YLVRDYMKQIPPESPILVHCS-AGVGRTGTFIAIDRLIYQIE-NENTVDVYGIVYDLRMHRPLMVQTEDQYVFLNQCV-------LDIIRAQKDSK 1319          
BLAST of Protein tyrosine phosphatase, receptor type, M vs. Ensembl Mouse
Match: Ptprj (protein tyrosine phosphatase, receptor type, J [Source:MGI Symbol;Acc:MGI:104574])

HSP 1 Score: 71.633 bits (174), Expect = 6.413e-13
Identity = 75/336 (22.32%), Postives = 156/336 (46.43%), Query Frame = 2
Query:  110 KKRSSKHKTEEPQPVQEEAKVLNRAIRISEFKNEYKKLCCNDFVILKKEYKDLINESMTMKESEYNIWTSIESMSNINLHGRIHIVQVDNLRVTMSSSLFS-NAKLDAVFIPDQVKHQVIQYIVSQDPSEDSIFDFFQMIWELNISYLITLTK-ISKRKGFIYEYWDSKSENKTYSKDKVSYKIKKTKETNSGNLTERLFILEN-NNLERREITQLHLMT-----STCQNDSVLNYYEKLFIKLHEIKSLGLCYPLLFHSSNSNLDQCAMLICIDKIISTLAFGSDMVNIYRMMLELNQYRNLMLQQECHYLYIYEYIDWFLRKSFKIMKSKKRTK 1093
            +K+ +  K  E    Q + K  ++ IR+  F+  +KK   +      +EY+DL    +++ +       + E   N   +   +++  D  RV +S    S +  ++A ++P    H    +I +Q P  +++ DF++M+WE N+  ++ LTK + + +    EYW SK      ++D     +  T E      T R F+++N  N E   + Q H  +          D ++N+    ++    +K +    P+L H S + + +    I ID++I  +    + V++Y ++ +L  +R LM+Q E  Y+++ + +         I++++K +K
Sbjct:  917 RKKRTDAKNNEVSFSQIKPKK-SKLIRVENFEAYFKKQQADSNCGFAEEYEDLKLIGISLPK------YTAEIAENRGKNRYNNVLPYDISRVKLSVQTHSTDDYINANYMPGY--HSKKDFIATQGPLPNTLKDFWRMVWEKNVYAIVMLTKCVEQGRTKCEEYWPSKQ-----AQDYGDITVAMTSEVVLPEWTIRDFVVKNMQNSESHPLRQFHFTSWPDHGVPDTTDLLINFR---YLVRDYMKQIPPESPILVHCS-AGVGRTGTFIAIDRLIYQIE-NENTVDVYGIVYDLRMHRPLMVQTEDQYVFLNQCV-------LDIIRAQKDSK 1226          
BLAST of Protein tyrosine phosphatase, receptor type, M vs. Ensembl Mouse
Match: Ptprj (protein tyrosine phosphatase, receptor type, J [Source:MGI Symbol;Acc:MGI:104574])

HSP 1 Score: 70.4774 bits (171), Expect = 1.324e-12
Identity = 75/336 (22.32%), Postives = 156/336 (46.43%), Query Frame = 2
Query:  110 KKRSSKHKTEEPQPVQEEAKVLNRAIRISEFKNEYKKLCCNDFVILKKEYKDLINESMTMKESEYNIWTSIESMSNINLHGRIHIVQVDNLRVTMSSSLFS-NAKLDAVFIPDQVKHQVIQYIVSQDPSEDSIFDFFQMIWELNISYLITLTK-ISKRKGFIYEYWDSKSENKTYSKDKVSYKIKKTKETNSGNLTERLFILEN-NNLERREITQLHLMT-----STCQNDSVLNYYEKLFIKLHEIKSLGLCYPLLFHSSNSNLDQCAMLICIDKIISTLAFGSDMVNIYRMMLELNQYRNLMLQQECHYLYIYEYIDWFLRKSFKIMKSKKRTK 1093
            +K+ +  K  E    Q + K  ++ IR+  F+  +KK   +      +EY+DL    +++ +       + E   N   +   +++  D  RV +S    S +  ++A ++P    H    +I +Q P  +++ DF++M+WE N+  ++ LTK + + +    EYW SK      ++D     +  T E      T R F+++N  N E   + Q H  +          D ++N+    ++    +K +    P+L H S + + +    I ID++I  +    + V++Y ++ +L  +R LM+Q E  Y+++ + +         I++++K +K
Sbjct:  824 RKKRTDAKNNEVSFSQIKPKK-SKLIRVENFEAYFKKQQADSNCGFAEEYEDLKLIGISLPK------YTAEIAENRGKNRYNNVLPYDISRVKLSVQTHSTDDYINANYMPGY--HSKKDFIATQGPLPNTLKDFWRMVWEKNVYAIVMLTKCVEQGRTKCEEYWPSKQ-----AQDYGDITVAMTSEVVLPEWTIRDFVVKNMQNSESHPLRQFHFTSWPDHGVPDTTDLLINFR---YLVRDYMKQIPPESPILVHCS-AGVGRTGTFIAIDRLIYQIE-NENTVDVYGIVYDLRMHRPLMVQTEDQYVFLNQCV-------LDIIRAQKDSK 1133          
BLAST of Protein tyrosine phosphatase, receptor type, M vs. Ensembl Mouse
Match: Ptprm (protein tyrosine phosphatase, receptor type, M [Source:MGI Symbol;Acc:MGI:102694])

HSP 1 Score: 67.3958 bits (163), Expect = 1.216e-11
Identity = 78/314 (24.84%), Postives = 138/314 (43.95%), Query Frame = 2
Query:  128 HKTEEPQPVQEEAKVLNRAIRISEFKNEYKKLCCNDFVILKKEYKDLINESMTMKESEYNIWTSIESMSN--INLHGRIHIVQVDNLRVTMSSSLFSNAKLDAVFIPDQVKHQVIQYIVSQDPSEDSIFDFFQMIWELNISYLITLTKISK-RKGFIYEYWDSKSENKTYSKDKVSYKIKKTKETNSGNLTE---RLFILENNNL-ERREITQLHLMTSTCQNDSVLNYYEK---LFIKLHEIKSLGLCYPLLFHSSNSNLDQCAMLICIDKIISTLAFGSDMVNIYRMMLELNQYRNLMLQQECHYLYIYEYI 1039
            +K  E   V  +   L+ AIR+++      ++ C +    K+EY+          E +   W S +   N   N +G I       +R+ M     ++  ++  +I     H+   YI +Q P +++I+DF++M+W  N + +I +T + +  +    +YW   +E          YK  K    ++  L E   R F +E   + E REI Q H    T   D  + Y+      F++  + KS     PL+ H S +   +    I ID I+  +A    +V+IY  + EL   R  M+Q E  Y++I++ I
Sbjct:  895 YKKREAADVPYQTGQLHPAIRVADLLQHITQMKCAEGYGFKEEYESFF-------EGQSAPWDSAKKDENRMKNRYGNIIAYDHSRVRLQMLEGDNNSDYINGNYIDGY--HRPNHYIATQGPMQETIYDFWRMVWHENTASIIMVTNLVEVGRVKCCKYWPDDTE---------IYKDIKVTLIDTELLAEYVIRTFAVEKRGIHEIREIRQFHF---TGWPDHGVPYHATGLLGFVRQVKSKSPPNAGPLVVHCS-AGAGRTGCFIVID-IMLDMAEREGVVDIYNCVRELRSRRVNMVQTEEQYVFIHDAI 1185          
BLAST of Protein tyrosine phosphatase, receptor type, M vs. Ensembl Mouse
Match: Ptprm (protein tyrosine phosphatase, receptor type, M [Source:MGI Symbol;Acc:MGI:102694])

HSP 1 Score: 67.3958 bits (163), Expect = 1.485e-11
Identity = 78/314 (24.84%), Postives = 138/314 (43.95%), Query Frame = 2
Query:  128 HKTEEPQPVQEEAKVLNRAIRISEFKNEYKKLCCNDFVILKKEYKDLINESMTMKESEYNIWTSIESMSN--INLHGRIHIVQVDNLRVTMSSSLFSNAKLDAVFIPDQVKHQVIQYIVSQDPSEDSIFDFFQMIWELNISYLITLTKISK-RKGFIYEYWDSKSENKTYSKDKVSYKIKKTKETNSGNLTE---RLFILENNNL-ERREITQLHLMTSTCQNDSVLNYYEK---LFIKLHEIKSLGLCYPLLFHSSNSNLDQCAMLICIDKIISTLAFGSDMVNIYRMMLELNQYRNLMLQQECHYLYIYEYI 1039
            +K  E   V  +   L+ AIR+++      ++ C +    K+EY+          E +   W S +   N   N +G I       +R+ M     ++  ++  +I     H+   YI +Q P +++I+DF++M+W  N + +I +T + +  +    +YW   +E          YK  K    ++  L E   R F +E   + E REI Q H    T   D  + Y+      F++  + KS     PL+ H S +   +    I ID I+  +A    +V+IY  + EL   R  M+Q E  Y++I++ I
Sbjct:  861 YKKREAADVPYQTGQLHPAIRVADLLQHITQMKCAEGYGFKEEYESFF-------EGQSAPWDSAKKDENRMKNRYGNIIAYDHSRVRLQMLEGDNNSDYINGNYIDGY--HRPNHYIATQGPMQETIYDFWRMVWHENTASIIMVTNLVEVGRVKCCKYWPDDTE---------IYKDIKVTLIDTELLAEYVIRTFAVEKRGIHEIREIRQFHF---TGWPDHGVPYHATGLLGFVRQVKSKSPPNAGPLVVHCS-AGAGRTGCFIVID-IMLDMAEREGVVDIYNCVRELRSRRVNMVQTEEQYVFIHDAI 1151          
BLAST of Protein tyrosine phosphatase, receptor type, M vs. UniProt/SwissProt
Match: sp|Q12913|PTPRJ_HUMAN (Receptor-type tyrosine-protein phosphatase eta OS=Homo sapiens OX=9606 GN=PTPRJ PE=1 SV=3)

HSP 1 Score: 70.8626 bits (172), Expect = 6.689e-12
Identity = 79/338 (23.37%), Postives = 156/338 (46.15%), Query Frame = 2
Query:  110 KKRSSKHKTEEPQPVQEEAKVLNRAIRISEFKNEYKKLCCNDFVILKKEYKDLINESMTMKESEYNIWTSIESMSNINLHGRIHIVQVDNLRVTMSSSLFS-NAKLDAVFIPDQVKHQVIQYIVSQDPSEDSIFDFFQMIWELNISYLITLTK-ISKRKGFIYEYWDSKSENKTYSKDKVSYKIKKTKETNSGNLTERLFILEN-NNLERREITQLHLMTSTCQ-----NDSVLN--YYEKLFIKLHEIKSLGLCYPLLFHSSNSNLDQCAMLICIDKIISTLAFGSDMVNIYRMMLELNQYRNLMLQQECHYLYIYEYIDWFLRKSFKIMKSKKRTK 1093
            +K+    K  E    Q + K  ++ IR+  F+  +KK   +      +EY+DL  + + + + +Y    + E   N   +   +++  D  RV +S    S +  ++A ++P    H    +I +Q P  +++ DF++M+WE N+  +I LTK + + +    EYW SK      ++D     +  T E      T R F ++N    E   + Q H  +          D ++N  Y  + ++K    +S     P+L H S + + +    I ID++I  +    + V++Y ++ +L  +R LM+Q E  Y+++ + +         I++S+K +K
Sbjct:  997 RKKRKDAKNNEVSFSQIKPKK-SKLIRVENFEAYFKKQQADSNCGFAEEYEDL--KLVGISQPKY----AAELAENRGKNRYNNVLPYDISRVKLSVQTHSTDDYINANYMPGY--HSKKDFIATQGPLPNTLKDFWRMVWEKNVYAIIMLTKCVEQGRTKCEEYWPSKQ-----AQDYGDITVAMTSEIVLPEWTIRDFTVKNIQTSESHPLRQFHFTSWPDHGVPDTTDLLINFRYLVRDYMKQSPPES-----PILVHCS-AGVGRTGTFIAIDRLIYQIE-NENTVDVYGIVYDLRMHRPLMVQTEDQYVFLNQCV-------LDIVRSQKDSK 1306          
BLAST of Protein tyrosine phosphatase, receptor type, M vs. UniProt/SwissProt
Match: sp|Q64455|PTPRJ_MOUSE (Receptor-type tyrosine-protein phosphatase eta OS=Mus musculus OX=10090 GN=Ptprj PE=1 SV=2)

HSP 1 Score: 70.8626 bits (172), Expect = 7.125e-12
Identity = 75/336 (22.32%), Postives = 156/336 (46.43%), Query Frame = 2
Query:  110 KKRSSKHKTEEPQPVQEEAKVLNRAIRISEFKNEYKKLCCNDFVILKKEYKDLINESMTMKESEYNIWTSIESMSNINLHGRIHIVQVDNLRVTMSSSLFS-NAKLDAVFIPDQVKHQVIQYIVSQDPSEDSIFDFFQMIWELNISYLITLTK-ISKRKGFIYEYWDSKSENKTYSKDKVSYKIKKTKETNSGNLTERLFILEN-NNLERREITQLHLMT-----STCQNDSVLNYYEKLFIKLHEIKSLGLCYPLLFHSSNSNLDQCAMLICIDKIISTLAFGSDMVNIYRMMLELNQYRNLMLQQECHYLYIYEYIDWFLRKSFKIMKSKKRTK 1093
            +K+ +  K  E    Q + K  ++ IR+  F+  +KK   +      +EY+DL    +++ +       + E   N   +   +++  D  RV +S    S +  ++A ++P    H    +I +Q P  +++ DF++M+WE N+  ++ LTK + + +    EYW SK      ++D     +  T E      T R F+++N  N E   + Q H  +          D ++N+    ++    +K +    P+L H S + + +    I ID++I  +    + V++Y ++ +L  +R LM+Q E  Y+++ + +         I++++K +K
Sbjct:  898 RKKRTDAKNNEVSFSQIKPKK-SKLIRVENFEAYFKKQQADSNCGFAEEYEDLKLIGISLPK------YTAEIAENRGKNRYNNVLPYDISRVKLSVQTHSTDDYINANYMPGY--HSKKDFIATQGPLPNTLKDFWRMVWEKNVYAIVMLTKCVEQGRTKCEEYWPSKQ-----AQDYGDITVAMTSEVVLPEWTIRDFVVKNMQNSESHPLRQFHFTSWPDHGVPDTTDLLINFR---YLVRDYMKQIPPESPILVHCS-AGVGRTGTFIAIDRLIYQIE-NENTVDVYGIVYDLRMHRPLMVQTEDQYVFLNQCV-------LDIIRAQKDSK 1207          
BLAST of Protein tyrosine phosphatase, receptor type, M vs. UniProt/SwissProt
Match: sp|P28827|PTPRM_HUMAN (Receptor-type tyrosine-protein phosphatase mu OS=Homo sapiens OX=9606 GN=PTPRM PE=1 SV=2)

HSP 1 Score: 70.4774 bits (171), Expect = 9.635e-12
Identity = 80/323 (24.77%), Postives = 140/323 (43.34%), Query Frame = 2
Query:  116 RSSKHKTEEPQPVQEEAKVLNRAIRISEFKNEYKKLCCNDFVILKKEYKDLINESMTMKESEYNIWTSIESMSNINLHGRIHIVQVDNLRVTM-------SSSLFSNAKLDAVFIPDQVKHQVIQYIVSQDPSEDSIFDFFQMIWELNISYLITLTKISK-RKGFIYEYWDSKSENKTYSKDKVSYKIKKTKETNSGNLTE---RLFILENNNL-ERREITQLHLMTSTCQNDSVLNYYEK---LFIKLHEIKSLGLCYPLLFHSSNSNLDQCAMLICIDKIISTLAFGSDMVNIYRMMLELNQYRNLMLQQECHYLYIYEYI 1039
            +S  +K  EP  V  +   L+ AIR+++      ++ C +    K+EY+          E +   W S +   N   +   +I+  D+ RV +       +S   +   +D    P+        YI +Q P +++I+DF++M+W  N + +I +T + +  +    +YW   +E          YK  K     +  L E   R F +E   + E REI Q H    T   D  + Y+      F++  + KS     PL+ H S +   +    I ID I+  +A    +V+IY  + EL   R  M+Q E  Y++I++ I
Sbjct:  857 QSHTYKKREPADVPYQTGQLHPAIRVADLLQHITQMKCAEGYGFKEEYESFF-------EGQSAPWDSAKKDENRMKNRYGNIIAYDHSRVRLQTIEGDTNSDYINGNYIDGYHRPNH-------YIATQGPMQETIYDFWRMVWHENTASIIMVTNLVEVGRVKCCKYWPDDTE---------IYKDIKVTLIETELLAEYVIRTFAVEKRGVHEIREIRQFHF---TGWPDHGVPYHATGLLGFVRQVKSKSPPSAGPLVVHCS-AGAGRTGCFIVID-IMLDMAEREGVVDIYNCVRELRSRRVNMVQTEEQYVFIHDAI 1151          
BLAST of Protein tyrosine phosphatase, receptor type, M vs. UniProt/SwissProt
Match: sp|Q9W6V5|PTPRJ_CHICK (Receptor-type tyrosine-protein phosphatase eta OS=Gallus gallus OX=9031 GN=PTPRJ PE=2 SV=2)

HSP 1 Score: 67.781 bits (164), Expect = 7.173e-11
Identity = 73/310 (23.55%), Postives = 149/310 (48.06%), Query Frame = 2
Query:  191 ISEFKNEYKKLCCNDFVILKKEYKDLINESMTMKESEYNIWTSIESMSNINLHGRIHIVQVDNLRVTMSS-SLFSNAKLDAVFIPDQVKHQVIQYIVSQDPSEDSIFDFFQMIWELNISYLITLTK-ISKRKGFIYEYWDSKSENKTYSKDKVSYKIKKTKETNSGNLTERLFILEN-NNLERREITQLHLMT----STCQNDSVLNYYEKLFIKLHEIKSLG-LCYPLLFHSSNSNLDQCAMLICIDKIISTLAFGSDMVNIYRMMLELNQYRNLMLQQECHYLYIYEYIDWFLRKSFKIMKSKKRTKT 1096
            +  F++ +KK   +      +EY++L  +S  + + ++    + E   N   +   +++  D  RV +S+ S  ++  ++A ++P     +   +I +Q P  ++I DF++MIWE NI  ++ LTK + + +    +YW  K ++K+Y    V+       E      T R F +EN + +E   + Q H  +       +   +L  +  L   +HE  S   +  P+L H S + + +    I ID++I  +    + V++Y ++ +L  +R LM+Q E  Y+++ + +         I++S+K  KT
Sbjct: 1092 VENFESYFKKQQADSNCGFAEEYEEL--KSAGVHQPKF----AAEIAENRGKNRYNNVLPYDISRVKLSNPSCTTDDYINANYMPGYSSKKA--FIAAQGPLPNTIEDFWRMIWEKNIYSIVMLTKCVEQARTKCEQYWPDK-QSKSYGDIIVTM----VSEVVLPEWTIRDFNVENADTMESHTVRQFHFTSWPDHGVPETTDLLINFRHL---VHEYSSQNPIDSPILVHCS-AGVGRTGTFIAIDRLIQQIEM-ENTVDVYGVVYDLRMHRPLMVQTEDQYVFLNQCV-------MDIIRSQKEKKT 1376          
BLAST of Protein tyrosine phosphatase, receptor type, M vs. UniProt/SwissProt
Match: sp|P16620|PTP69_DROME (Tyrosine-protein phosphatase 69D OS=Drosophila melanogaster OX=7227 GN=Ptp69D PE=1 SV=2)

HSP 1 Score: 67.3958 bits (163), Expect = 8.480e-11
Identity = 54/200 (27.00%), Postives = 96/200 (48.00%), Query Frame = 2
Query:  467 QYIVSQDPSEDSIFDFFQMIWELNISYLITLTKISK-RKGFIYEYWDSKSENKTYSKDKVSYKIKKTKETNSGNLTERLFILENNNL------ERREITQLHLMTSTCQNDSVLNYYEKLFIKLHEIKSLGLCY-----PLLFHSSNSNLDQCAMLICIDKIISTLAFGSDMVNIYRMMLELNQYRNLMLQQECHYLYIY 1030
            ++I +Q P E +I DF++MIWE ++  ++ LT + +  K    +YW  K  +     D +   +K  +E  +G+  ER   +  N        +RR+ITQ H +T     D +   +    IK   I+ +   Y     P+L H S + + +   L+ +D +I  L    D V+IY  + +L   RN ++Q    Y+++Y
Sbjct:  961 KFICAQGPMESTIDDFWRMIWEQHLEIIVMLTNLEEYNKAKCAKYWPEKVFDTKQFGDIL---VKFAQERKTGDYIERTLNVSKNKANVGEEEDRRQITQYHYLT---WKDFMAPEHPHGIIKF--IRQINSVYSLQRGPILVHCS-AGVGRTGTLVALDSLIQQLE-EEDSVSIYNTVCDLRHQRNFLVQSLKQYIFLY 1150          
BLAST of Protein tyrosine phosphatase, receptor type, M vs. TrEMBL
Match: A0A087T6U5 (Uncharacterized protein (Fragment) OS=Stegodyphus mimosarum OX=407821 GN=X975_15368 PE=4 SV=1)

HSP 1 Score: 80.8777 bits (198), Expect = 1.123e-12
Identity = 58/217 (26.73%), Postives = 109/217 (50.23%), Query Frame = 2
Query:  422 LDAVFIPDQVKHQVIQYIVSQDPSEDSIFDFFQMIWELNISYLITLTKISKR-KGFIYEYWDSKSENKTYSKDKVSYKIKKTKETNSGNLTERLFILENNNLERREITQLHLM---TSTCQN--DSVLNYYEKLFIKLHEIKSLGLCYPLLFHSSNSNLDQCAMLICIDKIISTLAFGSDMVNIYRMMLELNQYRNLMLQQECHYLYIYEYIDWFLR 1054
            ++A +IP      +++YI SQ P  +++ DF+ M+W+ ++S ++ LT+  +R K    +YW S  E   Y       ++    E+  G+   R+F ++NN+   R I Q+H +    S C    D  LN+   +  ++   K      P+L H S + + +    I +D+I   L    D +++Y  +LE+ +YR  M+Q E  Y++I+  I   ++
Sbjct:  921 INASYIPGN--SYMLEYIASQGPLPNTLDDFWTMVWQQSVSVIVMLTQCVERAKRTCEKYWPSSGETGRYG----YIQVHTLSESILGSYVIRIFQIQNNS-HSRHIVQMHFVNWPVSGCPRSPDDFLNFARAIRDRVPSSKP----GPILVHCS-AGVGRTGTYIAVDRIAQHLQHSQD-IDVYGTVLEMRKYRTNMVQTEDQYIFIHSCIQQLIQ 1124          
BLAST of Protein tyrosine phosphatase, receptor type, M vs. TrEMBL
Match: A0A2G8KK86 (Putative receptor-type tyrosine-protein phosphatase alpha OS=Stichopus japonicus OX=307972 GN=BSL78_14714 PE=4 SV=1)

HSP 1 Score: 78.1814 bits (191), Expect = 6.007e-12
Identity = 90/341 (26.39%), Postives = 156/341 (45.75%), Query Frame = 2
Query:  101 MSQKKRSSKHKTEEPQPVQEEAKVLNRAIRISEFKNEYKKLCCNDFVILKKEYKDLINESMTMKESEYNIWTSIESMSNINLHGRIHIVQVDNLRVTMSSSLFSNAKLDAVFIPDQVKHQVIQ--YIVSQDPSEDSIFDFFQMIWELNISYLITLT-KISKRKGFIYEYWDSKSENKTYSKDKVSYKIKKTKETNSGNLTERLFILENNNLERREITQLHLMTSTCQNDSVLNYYEKLFIKLHEI----KSLGLCYPLLFHSSNSNLDQCAMLICIDKIISTLAFGSDMVNIYRMMLELNQYRNLMLQQECHYLYIYE-YIDWFLRK--SFKIMKSKKRTK 1093
            MS  ++S   +T    P++ +       IR++EF   Y+++  +D      EY DL         S+ +      + SN   +   +I+  D+ RV ++SSL  +  ++A +I    K  V +  YI +Q P E +I DF+QMIWE N   ++ LT  I KRK    +YW    E  TY +D    K++  +E        R   +   N  R   T +H   ++  + + L     ++  L EI    +   L   L  H S + + +    I +  ++ +L F +  VN+Y ++ ++   R  M+Q E  Y +IYE  + W+L K  SF++   ++  K
Sbjct:    1 MSSAQKSFVKRTP---PLKGKWPQKRNPIRLNEFLTCYQRMASSDPSEFTTEYLDL-------PASDISRCKVANTESNKKKNRFKNILPYDDCRVKLNSSLDGSDYINASYIQGVFKGVVNERLYIATQGPLEHTIPDFWQMIWEQNSPVIVMLTNPIEKRKVKCAQYW---PEQGTY-RDVQVMKLQGVEENVEPFYVARKIKMIKGNEWR---TLMHYQFTSWDDKATLETAMPIWQVLDEIGQELQHKDLQGSLTIHCS-AGIGRTGTFIAL-AVLRSLLFHASEVNVYNIVFDMRTRRMSMVQIEEQYKFIYESLVIWYLLKQTSFRVSGFRRDMK 322          
BLAST of Protein tyrosine phosphatase, receptor type, M vs. TrEMBL
Match: A0A087TPC7 (Phosphotidylinositol phosphatase PTPRQ (Fragment) OS=Stegodyphus mimosarum OX=407821 GN=X975_02474 PE=4 SV=1)

HSP 1 Score: 78.5666 bits (192), Expect = 8.065e-12
Identity = 55/218 (25.23%), Postives = 111/218 (50.92%), Query Frame = 2
Query:  422 LDAVFIPDQVKHQVIQYIVSQDPSEDSIFDFFQMIWELNISYLITLTK-ISKRKGFIYEYWDSKSENKTYSKDKVSYKIKKTKETNSGNLTERLFILENNNLERREITQLHLMTST---CQN--DSVLNYYEKLFIKLHEIKSLGLCYPLLFHSSNSNLDQCAMLICIDKIISTLAFGSDMVNIYRMMLELNQYRNLMLQQECHYLYIYEYIDWFLRK 1057
            ++A +IP      + +YI SQ P  +++ DF++MIWE +++ ++ LT+ + + K    +YW +  E K Y       +++   E+   +   R+F ++    E R + Q+H        C    D ++N+   +   L  ++      P+L H S + + +    I +D++   L   SD++++Y  +L+L QYR  M+Q E  Y+YI+  ++  +R+
Sbjct: 1345 VNANYIPGN--SSLREYIASQGPLPNTVDDFWRMIWEQSVTVIVMLTQCVERGKNKCEQYWPAPGEMKYYG----DLQVRTLSESMLSSYVIRVFHVQLGPRELR-VKQMHFTRWPDFGCPESPDDLINFVRAVRDHLPRVRP----GPILVHCS-AGVGRTGTFIAVDRLSQQL-MRSDVIDVYGTVLDLRQYRTNMVQTEDQYIYIHLCVNQLIRE 1549          
BLAST of Protein tyrosine phosphatase, receptor type, M vs. TrEMBL
Match: A0A210PXZ6 (Tyrosine-protein phosphatase 10D OS=Mizuhopecten yessoensis OX=6573 GN=KP79_PYT07778 PE=4 SV=1)

HSP 1 Score: 78.1814 bits (191), Expect = 8.984e-12
Identity = 77/306 (25.16%), Postives = 144/306 (47.06%), Query Frame = 2
Query:  158 EEAKVLNRAIRISEFKNEYKKLCCNDFVILKKEYKDLINESMTMKESEYNIWTSIESMSNINLHGR-IHIVQVDNLRVTMSSSLFSNAK--LDAVFIPDQVKHQVIQYIVSQDPSEDSIFDFFQMIWELNISYLITLTKISKR-KGFIYEYWDSKSENKTYSKDKVSYKIKKTKETNSGNLTERLFILENNNLERREITQLHL----MTSTCQNDSVLNYYEKLFIKLHEIKSLGLCYPLLFHSSNSNLDQCAMLICIDKIISTLAFGSDMVNIYRMMLELNQYRNLMLQQECHYLYIYEYIDWFL 1051
            E   V  R I++SEF  ++ +L  +  +   +E K L   S   K       TS      + +  R  +I+  D+ RV +      +    ++A +IP     +  +YI +Q P   +  DF++MIWE N+S ++ LT++ +R +    +YW        Y  D +   ++   E+N  +   R+  L+  +++R+    L+L    M +   ++S+L++ E       + K+  L  P++ H S + + +    I +D +I  L  G   V+I+ M+L +   R  M+Q E  Y++I+E I  FL
Sbjct: 1258 EMVVVKARKIKVSEFAEKFYELSKDSNMKFSEEVKLLKEISPVHK-------TSCAEEQAVRIKNRYTNILAFDHSRVKLLPLDEEDGSDYINANYIPGHNSKR--EYIAAQGPLVCTKDDFWRMIWEQNVSVIVMLTQLVERGRRKCDQYWPEVVSEPFYFGDLI---VRIDSESNLPDYVIRVISLQLGDIQRQVKQLLYLAWPDMGTPTTSNSMLHFVE----SCRKHKNPSLHGPIVVHCS-AGVGRTGTFIAVDHLIQKLNAGHQEVDIFNMVLGMRNERPNMVQTEDQYIFIHECIKDFL 1546          
BLAST of Protein tyrosine phosphatase, receptor type, M vs. TrEMBL
Match: A0A2B4R8C8 (Tyrosine-protein phosphatase Lar OS=Stylophora pistillata OX=50429 GN=Lar PE=4 SV=1)

HSP 1 Score: 77.7962 bits (190), Expect = 1.139e-11
Identity = 82/319 (25.71%), Postives = 154/319 (48.28%), Query Frame = 2
Query:  131 KTEEPQPVQEEAKVL--------NRAIRISEFKNEYKKLCCNDFVILKKEYKDLINESMTMKESEYNIWTSIESMSNINLHGRIHIVQVDNLRVTMSS--SLFSNAKLDAVFIP--DQVKHQVIQYIVSQDPSEDSIFDFFQMIWELNISYLITLTKISK-RKGFIYEYWDSKSENKTYSKDKVSYKIKKTKETNSGNLTERLFILENNNLERREITQLHLMTSTCQNDSVLNYYEKLFI---KLHEIKSLGLCYPLLFHSSNSNLDQCAMLICIDKIISTLAFGSDMVNIYRMMLELNQYRNLMLQQECHYLYIYEYI 1039
            K  E QPV EE + +         + I ++EF N +K    N  ++L++E+K L      M+ S    W   +S    N +G  +IV  D+ RV +       +++ ++A +IP  D+V    + YI +Q P+  +I DF++M+W+ NIS ++ LT + +  KG   +YW     + T+    ++  + KT ET +  +   L + +  + E R + Q H +  T  +  V ++   L     K+H  + L    PLL H S + + +    I ID ++ + A     V I   +  + + R  M+Q++  Y+++++ +
Sbjct:  643 KGAEQQPVSEEKEAIYSEADDGKPKPIPVAEFVNYFKHKSKNGAIVLREEFKYLPG---GMQFS----WEIGKSNRGKNRYG--NIVSYDHSRVLLEEIEGDTNSSYINASYIPTYDEVS---MTYIATQGPTSSTIADFWRMVWQENISTVVMLTNLVELGKGKCDQYW----PDDTFRFGAITVTLHKT-ETFADYVIRSLIVTK--DAENRNVQQFHYV--TWPDKGVPHHSTALLGFRQKIHA-RHLATGGPLLVHCS-AGVGRTGTYIAIDAMLES-AEKIKTVFIQNYVQVMRKSRPHMIQKDDQYVFLHQAV 937          
BLAST of Protein tyrosine phosphatase, receptor type, M vs. Ensembl Cavefish
Match: PTPRM (protein tyrosine phosphatase receptor type M [Source:HGNC Symbol;Acc:HGNC:9675])

HSP 1 Score: 65.4698 bits (158), Expect = 3.921e-11
Identity = 78/325 (24.00%), Postives = 142/325 (43.69%), Query Frame = 2
Query:  110 KKRSSKHKTEEPQPVQEEAKVLNRAIRISEFKNEYKKLCCNDFVILKKEYKDLINESMTMKESEYNIWTSIESMSNINLHGRIHIVQVDNLRVTMS------SSLFSNAK-LDAVFIPDQVKHQVIQYIVSQDPSEDSIFDFFQMIWELNISYLITLTKISK-RKGFIYEYWDSKSENKTYSKDKVSYKIKKTKETNSGNLTE---RLFILENNNL-ERREITQLHLMTSTCQNDSVLNYYEK---LFIKLHEIKSLGLCYPLLFHSSNSNLDQCAMLICIDKIISTLAFGSDMVNIYRMMLELNQYRNLMLQQECHYLYIYEYI 1039
            +  +  +K  E   V  +   L+ AIR+++      ++ C +    K+EY+          E +   W S +   N   +   +I+  D+ RV +       SS + NA  +D    P+        YI +Q P +++++DF++M+W+ N + ++ +T + +  +    +YW   +E          Y+  K     +  L+E   R F +E     E REI Q H    T   D  + Y+      FI+  + KS     P++ H S +   +    I ID I+  +A    +V+IY  + EL   R  M+Q E  Y++I++ I
Sbjct:  894 QSHTHSYKKREAVDVPYQTGQLHPAIRVADLLQHITQMKCAEGYGFKEEYESFF-------EGQAAPWDSAKKDENRMKNRYGNIIAYDHSRVRLQALEGEQSSDYINANYIDGYHRPNH-------YIATQGPMQETVYDFWRMVWQENTATIVMVTNLVEVGRVKCCKYWPDDTE---------IYRDMKVTLIETQLLSEYVIRTFAVEKRGAHEIREIRQFHF---TGWPDHGVPYHATGLLGFIRRVKSKSPANAGPMVVHCS-AGAGRTGCFIVID-IMLDMAEREGVVDIYNCVRELRSRRVNMVQTEEQYVFIHDAI 1190          
BLAST of Protein tyrosine phosphatase, receptor type, M vs. Ensembl Cavefish
Match: PTPRM (protein tyrosine phosphatase receptor type M [Source:HGNC Symbol;Acc:HGNC:9675])

HSP 1 Score: 65.4698 bits (158), Expect = 4.267e-11
Identity = 76/320 (23.75%), Postives = 143/320 (44.69%), Query Frame = 2
Query:  110 KKRSSKHKTEEPQPVQEEAKVLNRAIRISEFKNEYKKLCCNDFVILKKEYKDLINESMTMKESEYNIWTSIESMSNINLHGRIHIVQVDNLRVTMSS--SLFSNAKLDAVFIPDQVKHQVIQYIVSQDPSEDSIFDFFQMIWELNISYLITLTKISK-RKGFIYEYWDSKSENKTYSKDKVSYKIKKTKETNSGNLTE---RLFILENNNL-ERREITQLHLMTSTCQNDSVLNYYEK---LFIKLHEIKSLGLCYPLLFHSSNSNLDQCAMLICIDKIISTLAFGSDMVNIYRMMLELNQYRNLMLQQECHYLYIYEYI 1039
            +  +  +K  E   V  +   L+ AIR+++      ++ C +    K+EY+          E +   W S +   N   +   +I+  D+ RV + +     S+  ++A +I     H+   YI +Q P +++++DF++M+W+ N + ++ +T + +  +    +YW   +E          Y+  K     +  L+E   R F +E     E REI Q H    T   D  + Y+      FI+  + KS     P++ H S +   +    I ID I+  +A    +V+IY  + EL   R  M+Q E  Y++I++ I
Sbjct:  860 QSHTHSYKKREAVDVPYQTGQLHPAIRVADLLQHITQMKCAEGYGFKEEYESFF-------EGQAAPWDSAKKDENRMKNRYGNIIAYDHSRVRLQALEGEQSSDYINANYIDGY--HRPNHYIATQGPMQETVYDFWRMVWQENTATIVMVTNLVEVGRVKCCKYWPDDTE---------IYRDMKVTLIETQLLSEYVIRTFAVEKRGAHEIREIRQFHF---TGWPDHGVPYHATGLLGFIRRVKSKSPANAGPMVVHCS-AGAGRTGCFIVID-IMLDMAEREGVVDIYNCVRELRSRRVNMVQTEEQYVFIHDAI 1156          
BLAST of Protein tyrosine phosphatase, receptor type, M vs. Ensembl Cavefish
Match: PTPRM (protein tyrosine phosphatase receptor type M [Source:HGNC Symbol;Acc:HGNC:9675])

HSP 1 Score: 65.4698 bits (158), Expect = 4.483e-11
Identity = 76/320 (23.75%), Postives = 143/320 (44.69%), Query Frame = 2
Query:  110 KKRSSKHKTEEPQPVQEEAKVLNRAIRISEFKNEYKKLCCNDFVILKKEYKDLINESMTMKESEYNIWTSIESMSNINLHGRIHIVQVDNLRVTMSS--SLFSNAKLDAVFIPDQVKHQVIQYIVSQDPSEDSIFDFFQMIWELNISYLITLTKISK-RKGFIYEYWDSKSENKTYSKDKVSYKIKKTKETNSGNLTE---RLFILENNNL-ERREITQLHLMTSTCQNDSVLNYYEK---LFIKLHEIKSLGLCYPLLFHSSNSNLDQCAMLICIDKIISTLAFGSDMVNIYRMMLELNQYRNLMLQQECHYLYIYEYI 1039
            +  +  +K  E   V  +   L+ AIR+++      ++ C +    K+EY+          E +   W S +   N   +   +I+  D+ RV + +     S+  ++A +I     H+   YI +Q P +++++DF++M+W+ N + ++ +T + +  +    +YW   +E          Y+  K     +  L+E   R F +E     E REI Q H    T   D  + Y+      FI+  + KS     P++ H S +   +    I ID I+  +A    +V+IY  + EL   R  M+Q E  Y++I++ I
Sbjct:  904 QSHTHSYKKREAVDVPYQTGQLHPAIRVADLLQHITQMKCAEGYGFKEEYESFF-------EGQAAPWDSAKKDENRMKNRYGNIIAYDHSRVRLQALEGEQSSDYINANYIDGY--HRPNHYIATQGPMQETVYDFWRMVWQENTATIVMVTNLVEVGRVKCCKYWPDDTE---------IYRDMKVTLIETQLLSEYVIRTFAVEKRGAHEIREIRQFHF---TGWPDHGVPYHATGLLGFIRRVKSKSPANAGPMVVHCS-AGAGRTGCFIVID-IMLDMAEREGVVDIYNCVRELRSRRVNMVQTEEQYVFIHDAI 1200          
BLAST of Protein tyrosine phosphatase, receptor type, M vs. Ensembl Cavefish
Match: PTPRM (protein tyrosine phosphatase receptor type M [Source:HGNC Symbol;Acc:HGNC:9675])

HSP 1 Score: 65.4698 bits (158), Expect = 5.063e-11
Identity = 76/320 (23.75%), Postives = 143/320 (44.69%), Query Frame = 2
Query:  110 KKRSSKHKTEEPQPVQEEAKVLNRAIRISEFKNEYKKLCCNDFVILKKEYKDLINESMTMKESEYNIWTSIESMSNINLHGRIHIVQVDNLRVTMSS--SLFSNAKLDAVFIPDQVKHQVIQYIVSQDPSEDSIFDFFQMIWELNISYLITLTKISK-RKGFIYEYWDSKSENKTYSKDKVSYKIKKTKETNSGNLTE---RLFILENNNL-ERREITQLHLMTSTCQNDSVLNYYEK---LFIKLHEIKSLGLCYPLLFHSSNSNLDQCAMLICIDKIISTLAFGSDMVNIYRMMLELNQYRNLMLQQECHYLYIYEYI 1039
            +  +  +K  E   V  +   L+ AIR+++      ++ C +    K+EY+          E +   W S +   N   +   +I+  D+ RV + +     S+  ++A +I     H+   YI +Q P +++++DF++M+W+ N + ++ +T + +  +    +YW   +E          Y+  K     +  L+E   R F +E     E REI Q H    T   D  + Y+      FI+  + KS     P++ H S +   +    I ID I+  +A    +V+IY  + EL   R  M+Q E  Y++I++ I
Sbjct:  883 QSHTHSYKKREAVDVPYQTGQLHPAIRVADLLQHITQMKCAEGYGFKEEYESFF-------EGQAAPWDSAKKDENRMKNRYGNIIAYDHSRVRLQALEGEQSSDYINANYIDGY--HRPNHYIATQGPMQETVYDFWRMVWQENTATIVMVTNLVEVGRVKCCKYWPDDTE---------IYRDMKVTLIETQLLSEYVIRTFAVEKRGAHEIREIRQFHF---TGWPDHGVPYHATGLLGFIRRVKSKSPANAGPMVVHCS-AGAGRTGCFIVID-IMLDMAEREGVVDIYNCVRELRSRRVNMVQTEEQYVFIHDAI 1179          
BLAST of Protein tyrosine phosphatase, receptor type, M vs. Ensembl Cavefish
Match: ptprfb (protein tyrosine phosphatase receptor type Fb [Source:NCBI gene;Acc:799867])

HSP 1 Score: 65.4698 bits (158), Expect = 5.273e-11
Identity = 69/294 (23.47%), Postives = 134/294 (45.58%), Query Frame = 2
Query:  185 IRISEFKNEYKKLCCNDFVILKKEYKDLINESMTMKESEYNIWTSIESMSNINLHGRIHIVQVDNLRVTMSSSLFSNAKLDAVFIPDQVKHQVIQ-------YIVSQDPSEDSIFDFFQMIWELNISYLITLTKI-SKRKGFIYEYWDSKSENKTYSKDKVSYKIKKTKETNSGNLTERLFIL-ENNNLERREITQLHLMTSTCQNDSVLNYYEKLFIKLHEIKSLGL--CYPLLFHSSNSNLDQCAMLICIDKIISTLAFGSDMVNIYRMMLELNQYRNLMLQQECHYLYIYE 1033
            I +S+  +  ++L  ND +   +EY+       ++   +   W +     N   +   +++  D+ RV ++S       +DAV   D +    I        YI +Q P  +++ DF++M+WE   S ++ +T++  K +    +YW  +   +TY   +V+  +  T E  + ++  R F L +N + E+REI Q   M     +  V  Y   +   L  +K+       P++ H S + + +   LI ID ++  +      V+IY  +  +   RN M+Q E  Y++I+E
Sbjct: 1236 IPVSDLADHIERLKANDGLRFSQEYE-------SIDPGQQFTWENSNMEVNKPKNRYANVIAYDHSRVILTS-------VDAVPGSDYINANYIDGYRKQNAYIATQGPLPETLSDFWRMVWEQRTSTIVMMTRLEEKSRVKCDQYWPIRG-TETYGMIQVT--MLDTVELATYSV--RTFALYKNGSSEKREIRQFQFM--AWPDHGVPEYPTPILAFLRRVKACNPPDAGPMVVHCS-AGVGRTGCLIVIDAMLERMKH-EKSVDIYGHVTCMRSQRNYMVQTEDQYVFIHE 1506          
BLAST of Protein tyrosine phosphatase, receptor type, M vs. Ensembl Sea Lamprey
Match: ptprsa (protein tyrosine phosphatase receptor type Sa [Source:ZFIN;Acc:ZDB-GENE-020107-3])

HSP 1 Score: 65.855 bits (159), Expect = 5.719e-12
Identity = 66/304 (21.71%), Postives = 130/304 (42.76%), Query Frame = 2
Query:  155 QEEAKVLNRAIRISEFKNEYKKLCCNDFVILKKEYKDL-INESMTMKESEYNIWTSIESMSNINLHGRIHIVQVDNLRVTMSS--SLFSNAKLDAVFIPDQVKHQVIQYIVSQDPSEDSIFDFFQMIWELNISYLITLTKISKRKGF-IYEYWDSKSENKTYSKDKVSYKIKKTKETNSGNL---TERLFILENNN-LERREITQLHLMTSTCQNDSVLNYYEKLFIKLHEIK----SLGLCYPLLFHSSNSNLDQCAMLICIDKIISTLAFGSDMVNIYRMMLELNQYRNLMLQQECHYLYIY 1030
            Q     ++  I +SEF    ++L  ND ++  +EY+ +   +  T   S   I        N + +   ++V  D+ RV + +   +  +  ++A +I    +H    YI SQ P  D++ DF++M+WE   S ++ +TK+ +R      +YW ++           SY + +   T++  L   + R F L  +   ERR++ Q     +   +  V  +   +   L  ++    S     PL+ H    + D C     +   +    +G   V++Y  +  +   RN M+Q E  Y +++
Sbjct:  170 QTPGMEMHPPIPVSEFAGHVERLKANDNMLFSQEYESIDPGQQFTWDHSNLEI--------NKHKNRYANVVAYDHSRVILHTIDGVPGSDYINANYIDGYRRHNA--YIASQGPLADTVADFWRMVWEQRSSTIVMMTKLEERARVKCDQYWPNRGSE--------SYGLVQVTLTDTVELATYSTRSFTLTRSGCTERRDVRQFQF--TAWPDHGVPEFPTPVLAFLRRVRAAWGSSADGGPLIVHCRQRS-DVCGCFF-VGLFMQEGHYGCITVSLYLQVTCMRAQRNYMVQTEEQYAFVH 451          
BLAST of Protein tyrosine phosphatase, receptor type, M vs. Ensembl Sea Lamprey
Match: ptpra (protein tyrosine phosphatase receptor type A [Source:ZFIN;Acc:ZDB-GENE-020107-1])

HSP 1 Score: 54.299 bits (129), Expect = 3.110e-8
Identity = 58/246 (23.58%), Postives = 114/246 (46.34%), Query Frame = 2
Query:  356 IHIVQVDNLRVTMSSSLFSNAKLDAVFIPDQVKHQVI-------QYIVSQD--PSEDSIFDFFQMIWELNISYLITLTKISKRKGF-IYEYWDSKSENKTYSKDKVSYKIKKTKETNSGNLTERLFILE-----NNNLERREITQLHLMTSTCQNDSVLNYYEKLFIK-LHEIKSLGLCY--PLLFHSSNSNLDQCAMLICIDKIISTLAFGSDMVNIYRMMLELNQYRNLMLQQECHYLYIYEYI 1039
            ++I+  DN RV ++S       L+ V   D +    +       ++I +Q   P E+++ D+++MIWELN + ++ +T + +RK     +YW  +    TY   +VS +      T   + T R F+++      N    R ITQ H    T   D  + +     +K L ++K+    Y  P++ H S + + +    I ID ++  +      V+++  +  +   R  M+Q +  Y++IY+ +
Sbjct:  218 VNILPYDNFRVHLTS-------LEGVPDSDYINASYVNGYQEKNKFIAAQGKGPKEETLNDYWRMIWELNTATIVMVTNLKERKECKCAQYWPDQG-CWTYGNLRVSVE----DVTVLVDYTIRKFLIQVVGDIPNKKPPRLITQFHF---TSWPDFGVPFAPIGMLKFLKKVKTCNPPYAGPIVVHCS-AGVGRTGTFIVIDAMLDMIQT-ERKVDVFGFVTRIRAQRCQMVQTDMQYVFIYQAL 446          
BLAST of Protein tyrosine phosphatase, receptor type, M vs. Ensembl Sea Lamprey
Match: ENSPMAT00000008162.1 (pep scaffold:Pmarinus_7.0:GL477877:143952:159832:-1 gene:ENSPMAG00000007379.1 transcript:ENSPMAT00000008162.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 50.8322 bits (120), Expect = 2.505e-7
Identity = 67/286 (23.43%), Postives = 124/286 (43.36%), Query Frame = 2
Query:  218 KLCCNDFVILKKEYKDLINESMTMKESEYNIWTSIESMSNINLHGRIHIVQVDNLRVTMSS--SLFSNAKLDAVFIPDQVKHQVIQYIVSQDPSEDSIFDFFQMIWELNISYLITLTKISKRKGF-IYEYWDSKSENKTYSKDKVS---------YKIKKTKETNSGNLTERLFILENNNLERREITQLHLMTSTCQNDSVLNYYEKLFIK-LHEIKSLGLCY--PLLFHSSNSNLDQCAMLICIDKIISTLAFGSDMVNIYRMMLELNQYRNLMLQQECHYLYIY 1030
            KL  ++F  L  E+  L+ E+ + +E             N + +  I+I+  D  RV +S   S+  +  ++A +I    +    ++I +Q P E++I DF++MIWE N S ++ +T + +RK     +YW  K    TY   +VS         Y I+K           +L        + R +TQ H    T   D  + +     +K L ++K+    Y  P++ H S + + +    I ID ++  +      V+++  +  +   R  M+Q +   L  Y
Sbjct:   33 KLFRDEFNGLPSEHPQLMCEAASQEE-------------NKDKNRYINILPYDQSRVQLSPIESVPGSDYINASYINGYREKN--KFIAAQGPKEETINDFWRMIWEQNTSTIVMVTNLQERKHTKCSQYWPDKG-CWTYGSVRVSVEDITVLVDYTIRK--------FCVQLVGEGPGKHQARLVTQFHF---TSWPDFGVPFTPIGMLKFLKKVKTSNPSYSGPIVVHCS-AGVGRTGTFIVIDAMLDMIQ-AEQRVDVFGFVSRIRAQRCQMVQTDLQPLDCY 289          
BLAST of Protein tyrosine phosphatase, receptor type, M vs. Ensembl Sea Lamprey
Match: ca16b (carbonic anhydrase XVI b [Source:ZFIN;Acc:ZDB-GENE-080818-1])

HSP 1 Score: 50.447 bits (119), Expect = 4.571e-7
Identity = 45/204 (22.06%), Postives = 82/204 (40.20%), Query Frame = 2
Query:  470 YIVSQDPSEDSIFDFFQMIWELNISYLITLTK-ISKRKGFIYEYWDSKSENKTYSKDKVSYKIKKTKETNSGNLTERLFILENNNLER--------------REITQLHLMTSTCQNDSVLNYYEKLFIKLHEIKSLGLCYPLLFHSSNS-NLDQCAMLICIDKIISTLAFGSDMVNIYRMMLELNQYRNLMLQQECHYLYIYE 1033
            YI +Q P + +  DF++M+WE N   ++ +T  + K +    +YW S+S N+ Y    V+ K  +T        T R F + N  L +              R + Q H                  F++        L  P++ H   S  + +    I +D ++  +   S  VN+   +  +   RN ++Q +  Y +I+E
Sbjct:  164 YIAAQGPLKATFADFWRMVWEQNTGIIVMITNLVEKGRRKCDQYWPSES-NEEYGNILVTLKSTRTLAC----YTVRHFTIRNTKLRKGTSQKSSARGRQNERLVVQFHYTQWPDMGTPDYALPVLTFVRKSSATRTDLMGPVVVHCRRSAGVGRTGTYIVLDSMLQQIR-DSGTVNVLGFLKHIRTQRNYLVQPQEQYTFIHE 361          
BLAST of Protein tyrosine phosphatase, receptor type, M vs. Ensembl Nematostella
Match: EDO48187 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RK45])

HSP 1 Score: 63.5438 bits (153), Expect = 5.460e-11
Identity = 50/229 (21.83%), Postives = 114/229 (49.78%), Query Frame = 2
Query:  371 VDNLRVTMSSSLFSNAKLDAVFIPDQVKHQVIQYIVSQDPSEDSIFDFFQMIWELNISYLITLTK-ISKRKGFIYEYWDSKSENKTYSKDKVSYKIKKTKETNSGNLTERLFILENNNLER-REITQLHLMTSTCQN--DSVLNYYE--KLFIKLHEIKSLGLCYPLLFHSSNSNLDQCAMLICIDKIISTLAFGSDMVNIYRMMLELNQYRNLMLQQECHYLYIYEYI 1039
            V  +R++M   +  +  ++A +I   +  +   +I +Q P  ++I DF++M+WE N   ++TL + + + K  ++ YW  K +  T+     S  ++   +  SG+L  R+F L N  +   R++ Q H  + T +N  +  L+  +   L  ++   ++    +P++ H S + + +  +   +  +I  L     MV++++ + +L + R  M+Q +  Y + Y+ +
Sbjct:  347 VTRVRLSMQVGVEGSDYINANYIDGYMAKRT--FIATQAPIPETIPDFWRMVWEQNCCTIVTLAQEVEQAKAKMHRYWPGK-QPITFG----SLVVEMQDKVKSGHLVVRIFKLTNTEVSASRDVRQFHYTSWTEENPLEDGLSRCQLIDLIGQVQYWQAESGRHPIIVHCS-AGVGRTGVFCAVSILIERLK-AEAMVDVFQTVKQLREQRPAMVQTKGQYDFCYQVV 566          

HSP 2 Score: 60.077 bits (144), Expect = 6.700e-10
Identity = 63/276 (22.83%), Postives = 121/276 (43.84%), Query Frame = 2
Query:  314 TSIESMSNINLHGR--IHIVQVDNLRVTMSSSLFSNAK----LDAVFIPDQVKHQVIQYIVSQDPSEDSIFDFFQMIWELNISYLITLTKISKR-KGFIYEYWDSKSENKTYSKDKVSYKIKKTKETNSGNLTERLFILENNNLERREITQLHLMTSTCQN--DSVLNYYEKLFIKLHEIKSLGLCYPLLFHSSNSNLDQCAMLICIDKIISTLAFGSDMVNIYRMMLELNQYRNLMLQQECHYLYIYEY-IDWFLRKSFKIMKSKKRTKTRSMIE 1111
            T+  S+  +N H    I+IV  D+ RV +    F +      ++A F+P   +     YI +Q P  ++  DF++M+WE N   +I LT + +R +    +YW S+    + S + ++  +    E     +   L +      + R++ Q H  +        SV N     F++           P++ H S + + +    I ID ++  +      V+I   +  L ++RNLM+Q E  Y++I++  +D  +    +   S  R+  R + E
Sbjct:   35 TATHSLDPVNQHKNRYINIVAYDHSRVKLQD--FEDEPGSDYINANFLPGYRRDNA--YIAAQGPLAETCRDFWRMVWEQNSRTIIMLTNLKERCRDKCAQYWPSRG---SLSYEDITVTLDSVTELTP-YIVRTLSVQREGCDDVRQVKQFHFTSWPDHGVPTSVCNLLA--FVRDSTRADPPGAGPMVVHCS-AGVGRTGTFIVIDVMLQQI-HEEKTVDILGFVSTLRRHRNLMVQTEQQYIFIHDALLDAIISGETETSASDLRSHIRRLQE 298          
BLAST of Protein tyrosine phosphatase, receptor type, M vs. Ensembl Nematostella
Match: EDO47893 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RL98])

HSP 1 Score: 56.6102 bits (135), Expect = 4.002e-9
Identity = 52/229 (22.71%), Postives = 101/229 (44.10%), Query Frame = 2
Query:  374 DNLRVTMSSSLFSNAKLDAVFIPDQVKHQVIQYIVSQDPSEDSIFDFFQMIWELNISYLITLTKISKRKGF-IYEYWDSKSENKTYSKDKVSYKIKKTKETNSGNLTERLFILENNNLERREITQLHLMTS------TCQNDSVLNYYEKLFIKLHEIKSLGLCYPLLFHSSNSNLDQCAMLICIDKIISTLAFGSDMVNIYRMMLELNQYRNLMLQQECHYLYIYEYI 1039
            D+ RV +  +      ++A +I D        YI +Q P E S  DF+QM+W+   S ++ LT + +R     ++YW S  +   Y    VS    K KE  S      L + +   L+   +   +  TS        Q  ++L + + +  +   +   G   P + H S + + +  + + ID ++   A    +V+IY  +  + + R  ++Q +  Y++I++ I
Sbjct:   30 DHSRVMLRGAGSGCDYINATYIKD-FDGTPKTYIAAQGPLESSCNDFWQMVWQEKCSVIVMLTGLIERNELKCHQYWPSTDQPAAYGVLTVSL---KKKEEFSDYTVRSLLLSKQGTLKEVRLIHQYQFTSWPHRGVPQQTAALLRFRKNIINRSPHVSESG---PWIIHCS-AGVGRTGIFLVIDAMLRQ-AKEKKVVDIYNYVHSIEEDRPYIIQTKDQYVFIHQTI 249          
BLAST of Protein tyrosine phosphatase, receptor type, M vs. Ensembl Nematostella
Match: EDO33995 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SQN6])

HSP 1 Score: 56.6102 bits (135), Expect = 8.450e-9
Identity = 70/297 (23.57%), Postives = 136/297 (45.79%), Query Frame = 2
Query:  179 RAIRISEFKNEYKKLCCNDFVILKKEYKDLINE-SMTMKESEYNIWTSIESMSNINLHGRIHIVQVDNLRVTMSSSLFSNAKLD---AVFIPDQVKHQVIQYIVSQDPSEDSIFDFFQMIWELNISYLITLTK-ISKRKGFIYEYWDSKSENKTYSKDKVSYKIKKTKETNSGNLTERLFILE--NNNLERREITQLHLMTSTCQND------SVLNYYEKLFIKLHEIKSLGLCYPLLFHSSNSNLDQCAMLICIDKIISTLAFGSDMVNIYRMMLELNQYRNLMLQQECHYLYIY 1030
            + I ++E K  Y ++  N  ++ +KEYKD+    ++T +  +  I        NI  +        D+ RV +SS    +   D   A +I D  K Q  +YI +  P  ++  DF++M+WE   S ++ LTK + K K   ++YW    EN+ Y +  V+ + K+       +   R F L   +N +E R +   +  TS   +D       +L +++++       +S     P+  H S + + +    I ID ++  +    +++++Y  +  +   RN M+Q+   Y +I+
Sbjct:    7 QPIPVAELKQHYLRMHANSDLLFEKEYKDIKEPVNVTTRHCDNLINKPKNRYGNIKAY--------DHSRVILSSVQGDSESTDYINANWI-DGFK-QEKKYIATIGPKAETTSDFWRMMWEHKSSIVVMLTKLVEKGKVKCHKYW--PEENEQYGEIIVTLEEKE----ELADFEIRKFFLRKLSNQMETRMVKHFYF-TSWPDHDVPEYATGLLEFWKRVRNSWEGPQS----GPITVHCS-AGVGRTGTFIVIDAMMEQIK-EENLLDVYSYVSRIRAQRNFMVQRPSQYSFIH 280          
BLAST of Protein tyrosine phosphatase, receptor type, M vs. Ensembl Nematostella
Match: EDO29984 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7T229])

HSP 1 Score: 54.6842 bits (130), Expect = 1.124e-8
Identity = 47/197 (23.86%), Postives = 89/197 (45.18%), Query Frame = 2
Query:  470 YIVSQDPSEDSIFDFFQMIWELNISYLITLTK-ISKRKGFIYEYWDSKSENKTYSKDKVSYKIKKTKETNSGNLTERLFILENNNLERREITQLHLMTS------TCQNDSVLNYYEKLFIKLHEIKSLGLCYPLLFHSSNSNLDQCAMLICIDKIISTLAFGSDMVNIYRMMLELNQYRNLMLQQECHYLYIYEYI 1039
            YI +Q P E S  DF+QM+W+   S ++ LT  I   +   ++YW S  +  TY    VS    K KE  S      L + +   L+   +   +  TS        Q  ++L + + +  +   +   G   P + H S + + +  + + ID ++   A    +V+IY  +  + + R  ++Q +  Y++I++ I
Sbjct:   32 YIAAQGPLESSCDDFWQMVWQEKCSVIVMLTGLIEGNELKCHQYWPSTDQPATYGVLTVSL---KKKEEFSDYTVRSLLLSKQGTLKEVRLIHQYQFTSWPHRGVPQQTAALLRFRKNIINRSPHVPKSG---PWIIHCS-AGVGRTGIFLVIDAMLRQ-AKEKKVVDIYNYVYAIEEDRPYIIQTKDQYVFIHQTI 220          
BLAST of Protein tyrosine phosphatase, receptor type, M vs. Ensembl Nematostella
Match: EDO44823 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RUW8])

HSP 1 Score: 55.4546 bits (132), Expect = 2.051e-8
Identity = 51/230 (22.17%), Postives = 102/230 (44.35%), Query Frame = 2
Query:  362 IVQVDNLRVTM-SSSLFSNAKLDAVFIPDQVKHQVIQYIVSQDPSEDSIFDFFQMIWELNISYLITLTKISKRKGF-IYEYWDSKSENKTYSKDKVSYKIKKTKETNSGNLTERLFILENNNLERREITQLHLMTSTCQN--DSVLNYYEKLFIKLHEIKSL--GLCYPLLFHSSNSNLDQCAMLICIDKIISTLAFGSDMVNIYRMMLELNQYRNLMLQQECHYLYIYE 1033
            I+  D  RV +   S + NA    + +P      V++YI +Q P E +  DF+QMIWE   + +I LT   +R     ++YW    +  T+   +V     K ++ +   +   +++ +   L  R I QL  +     +  D   ++ E  F+  H ++    G   P + H S + + +  +L+ I+     +  G++ V    ++  +   R  ++Q    +L++ E
Sbjct:  647 ILPYDETRVKLFKGSDYINANFVNMEVPSH--GIVLRYIAAQGPLEKTCGDFWQMIWEQESTLVIMLTTTMERGRVKCHQYWPEGEDTWTFGNLEVV--CNKIRDFSPSYVYREMYVTDTTTLRSRVIIQLQYLAWPDHDVPDDATDFLE--FV--HSVRHYREGTSTPAVVHCS-AGVGRSGVLMFIETAFGMIE-GAEPVYPLELVRRMRDQRGSLIQTPGQFLFVCE 866          
BLAST of Protein tyrosine phosphatase, receptor type, M vs. Ensembl Medaka
Match: ptprea (receptor-type tyrosine-protein phosphatase epsilon [Source:NCBI gene;Acc:101166342])

HSP 1 Score: 65.4698 bits (158), Expect = 3.234e-11
Identity = 69/301 (22.92%), Postives = 136/301 (45.18%), Query Frame = 2
Query:  182 AIRISEFKNEYKKLCCNDFVILKKEYKDLINESMTMKESEYNIWTSIESMSNINLHGRIHIVQVDNLRVTMSSSLFSNAKLDAVFIPDQVKHQVI-------QYIVSQDPSEDSIFDFFQMIWELNISYLITLTKISKRK-GFIYEYWDSKSENKTYSKDKVSYKIKKTKETNSGNLTERLFILENNNLER----REITQLHLMTSTCQNDSVLNYYEKLFIK-LHEIKSLGLCY--PLLFHSSNSNLDQCAMLICIDKIISTLAFGSDMVNIYRMMLELNQYRNLMLQQECHYLYIYEYI 1039
             I + + + EY+    +D  + ++EY  L + S+     E N   + E     N      I+  DN RV +S       +LD     D V    +       ++I +Q P ED++ DF++M+WE  ++ ++ LT + +RK    Y+YW  +    TY   +V+ +      T   + T R F ++    E     R +TQLH    T   D  + +     +K L ++K++   +  P++ H S + + +    I ID +I  +      V+++  +  + + R+ ++Q +  Y ++Y+ +
Sbjct:   69 PIPVEQLEEEYRLRSADDGKLFREEYISLPSGSVQGTYEEANKNENKEKNRYPN------ILPYDNSRVVLS-------QLDGNPCSDYVNASFVDGYTEKNKFIAAQGPKEDTVADFWRMVWEQKVATVVMLTNLKERKEDKCYQYWPDQG-CWTYGNVRVAVE----DFTVLVDYTIRKFCVQYQASEAAKTPRLVTQLHF---TSWPDFGVPFSPIGMLKFLKKVKAVNPPFSGPIVVHCS-AGVGRTGTFIVIDAMID-MMHAEQKVDVFGFVSRIREQRSQLIQTDMQYSFVYQAL 346          
BLAST of Protein tyrosine phosphatase, receptor type, M vs. Ensembl Medaka
Match: ptprea (receptor-type tyrosine-protein phosphatase epsilon [Source:NCBI gene;Acc:101166342])

HSP 1 Score: 65.4698 bits (158), Expect = 3.563e-11
Identity = 69/301 (22.92%), Postives = 136/301 (45.18%), Query Frame = 2
Query:  182 AIRISEFKNEYKKLCCNDFVILKKEYKDLINESMTMKESEYNIWTSIESMSNINLHGRIHIVQVDNLRVTMSSSLFSNAKLDAVFIPDQVKHQVI-------QYIVSQDPSEDSIFDFFQMIWELNISYLITLTKISKRK-GFIYEYWDSKSENKTYSKDKVSYKIKKTKETNSGNLTERLFILENNNLER----REITQLHLMTSTCQNDSVLNYYEKLFIK-LHEIKSLGLCY--PLLFHSSNSNLDQCAMLICIDKIISTLAFGSDMVNIYRMMLELNQYRNLMLQQECHYLYIYEYI 1039
             I + + + EY+    +D  + ++EY  L + S+     E N   + E     N      I+  DN RV +S       +LD     D V    +       ++I +Q P ED++ DF++M+WE  ++ ++ LT + +RK    Y+YW  +    TY   +V+ +      T   + T R F ++    E     R +TQLH    T   D  + +     +K L ++K++   +  P++ H S + + +    I ID +I  +      V+++  +  + + R+ ++Q +  Y ++Y+ +
Sbjct:  116 PIPVEQLEEEYRLRSADDGKLFREEYISLPSGSVQGTYEEANKNENKEKNRYPN------ILPYDNSRVVLS-------QLDGNPCSDYVNASFVDGYTEKNKFIAAQGPKEDTVADFWRMVWEQKVATVVMLTNLKERKEDKCYQYWPDQG-CWTYGNVRVAVE----DFTVLVDYTIRKFCVQYQASEAAKTPRLVTQLHF---TSWPDFGVPFSPIGMLKFLKKVKAVNPPFSGPIVVHCS-AGVGRTGTFIVIDAMID-MMHAEQKVDVFGFVSRIREQRSQLIQTDMQYSFVYQAL 393          
BLAST of Protein tyrosine phosphatase, receptor type, M vs. Ensembl Medaka
Match: ptprea (receptor-type tyrosine-protein phosphatase epsilon [Source:NCBI gene;Acc:101166342])

HSP 1 Score: 65.4698 bits (158), Expect = 3.821e-11
Identity = 69/301 (22.92%), Postives = 136/301 (45.18%), Query Frame = 2
Query:  182 AIRISEFKNEYKKLCCNDFVILKKEYKDLINESMTMKESEYNIWTSIESMSNINLHGRIHIVQVDNLRVTMSSSLFSNAKLDAVFIPDQVKHQVI-------QYIVSQDPSEDSIFDFFQMIWELNISYLITLTKISKRK-GFIYEYWDSKSENKTYSKDKVSYKIKKTKETNSGNLTERLFILENNNLER----REITQLHLMTSTCQNDSVLNYYEKLFIK-LHEIKSLGLCY--PLLFHSSNSNLDQCAMLICIDKIISTLAFGSDMVNIYRMMLELNQYRNLMLQQECHYLYIYEYI 1039
             I + + + EY+    +D  + ++EY  L + S+     E N   + E     N      I+  DN RV +S       +LD     D V    +       ++I +Q P ED++ DF++M+WE  ++ ++ LT + +RK    Y+YW  +    TY   +V+ +      T   + T R F ++    E     R +TQLH    T   D  + +     +K L ++K++   +  P++ H S + + +    I ID +I  +      V+++  +  + + R+ ++Q +  Y ++Y+ +
Sbjct:  101 PIPVEQLEEEYRLRSADDGKLFREEYISLPSGSVQGTYEEANKNENKEKNRYPN------ILPYDNSRVVLS-------QLDGNPCSDYVNASFVDGYTEKNKFIAAQGPKEDTVADFWRMVWEQKVATVVMLTNLKERKEDKCYQYWPDQG-CWTYGNVRVAVE----DFTVLVDYTIRKFCVQYQASEAAKTPRLVTQLHF---TSWPDFGVPFSPIGMLKFLKKVKAVNPPFSGPIVVHCS-AGVGRTGTFIVIDAMID-MMHAEQKVDVFGFVSRIREQRSQLIQTDMQYSFVYQAL 378          
BLAST of Protein tyrosine phosphatase, receptor type, M vs. Ensembl Medaka
Match: ptprfb (receptor-type tyrosine-protein phosphatase F [Source:NCBI gene;Acc:101168742])

HSP 1 Score: 65.4698 bits (158), Expect = 4.733e-11
Identity = 70/293 (23.89%), Postives = 133/293 (45.39%), Query Frame = 2
Query:  185 IRISEFKNEYKKLCCNDFVILKKEYKDL-INESMTMKESEYNIWTSIESMSNINL--HGRIHIVQVDNLRVTMSSSLFSNAKLDAVFIPDQVKHQVIQYIVSQDPSEDSIFDFFQMIWELNISYLITLTKI-SKRKGFIYEYWDSKSENKTYSKDKVSYKIKKTKETNSGNLTERLFIL-ENNNLERREITQLHLMTSTCQNDSVLNYYEKLFIKLHEIKSLGLCYPL-----LFHSSNSNLDQCAMLICIDKIISTLAFGSDMVNIYRMMLELNQYRNLMLQQECHYLYIYE 1033
            I ++   +  ++L  ND +   +EY+ +   +  T + S   +       +N+    H R+ +  +D   V  S  + +N      +I    K     YI +Q P  +++ DF++M+WE   S +I +T++  K +    +YW S+   +TY   +V+  +  T E  + ++  R F L +N + E+RE+ Q   M     +  V  Y   +   L  +K+   C PL     + H S + + +    I ID ++  +      V+IY  +  +   RN M+Q E  Y++I+E
Sbjct:  910 ISVAALADHIERLKANDSLRFSQEYESIDPGQQFTWEHSNMEVNKPKNRYANVIAYDHSRVVLTSIDGRTVPGSDYINAN------YIDGYRKQNA--YIATQGPLPETLSDFWRMVWEQRSSTVIMMTRLEEKSRVKCDQYWPSRG-TETYGMIQVT--MLDTVELATYSV--RTFALYKNGSSEKREVRQFQFM--AWPDHGVPEYPTPILAFLRRVKA---CNPLDAGPMVVHCS-AGVGRTGCFIVIDAMLERMKH-EKTVDIYGHVTCMRAQRNYMVQTEDQYIFIHE 1182          
BLAST of Protein tyrosine phosphatase, receptor type, M vs. Ensembl Medaka
Match: ptprsa (receptor-type tyrosine-protein phosphatase S [Source:NCBI gene;Acc:101169564])

HSP 1 Score: 64.6994 bits (156), Expect = 8.297e-11
Identity = 70/293 (23.89%), Postives = 129/293 (44.03%), Query Frame = 2
Query:  185 IRISEFKNEYKKLCCNDFVILKKEYKDL-INESMTMKESEYNIWTSIESMSNINLHGRIHIVQVDNLRVTMS--SSLFSNAKLDAVFIPDQVKHQVIQYIVSQDPSEDSIFDFFQMIWELNISYLITLTKISKRKGF-IYEYWDSKSENKTYSKDKVSYKIKKTKETNSGNLTERLFIL-ENNNLERREITQLHLMTSTCQNDSVLNYYEKLFIKLHEIKSLGLCY-----PLLFHSSNSNLDQCAMLICIDKIISTLAFGSDMVNIYRMMLELNQYRNLMLQQECHYLYIYE 1033
            I I E     + L  ND + L +EY+ +   +  T + S   +  +    +N+        +  D+ RV +S    +  +  ++A FI    K     YI +Q P  ++  DF++M+WE   + ++ +T++ ++      +YW S+   +TY   +V+  +  T E        R F L +N N ERRE+ Q      T   D  +  Y   F+    ++ +  C      P++ H S + + +    I ID ++  +      V+IY  +  +   RN M+Q E  Y +I+E
Sbjct:  939 IPIGELAEHIELLKANDNLRLSQEYESIDPGQQFTWEHSNLEVNKTKNRYANV--------IAYDHTRVILSPIEGILGSDYINANFIDGYRKQNA--YIATQGPLSETFGDFWRMVWEQRTASVVMMTRLEEKSRIKCDQYWPSRG-TETYGMIQVT--LLDTMEL--ATFCVRTFSLHKNGNSERREVRQFQF---TAWPDHGVPEYPTPFLNF--LRRVKACNPPDAGPIIAHCS-AGVGRTGCFIVIDAMLERIR-QERTVDIYGHVTLMRSQRNYMVQTEDQYSFIHE 1209          
BLAST of Protein tyrosine phosphatase, receptor type, M vs. Planmine SMEST
Match: SMESG000068931.1 (SMESG000068931.1)

HSP 1 Score: 713.761 bits (1841), Expect = 0.000e+0
Identity = 350/353 (99.15%), Postives = 350/353 (99.15%), Query Frame = 2
Query:   53 MNSGSKSPKLLFPLRMMSQKKRSSKHKTEEPQPVQEEAKVLNRAIRISEFKNEYKKLCCNDFVILKKEYKDLINESMTMKESEYNIWTSIESMSNINLHGRIHIVQVDNLRVTMSSSLFSNAKLDAVFIPDQVKHQVIQYIVSQDPSEDSIFDFFQMIWELNISYLITLTKISKRKGFIYEYWDSKSENKTYSKDKVSYKIKKTKETNSGNLTERLFILENNNLERREITQLHLMTSTCQNDSVLNYYEKLFIKLHEIKSLGLCYPLLFHSSNSNLDQCAMLICIDKIISTLAFGSDMVNIYRMMLELNQYRNLMLQQECHYLYIYEYIDWFLRKSFKIMKSKKRTKTRSMIE 1111
            MNSGSKSPK LFPLRMMSQKKRSSKHKTEEPQPVQEEAKVLNRAIRISEFKNEYKKLCCNDFVILKKEYKDLINESMTMKESEYNIWTSIESMSNINLH RIHIVQVDNLRVTMSSSLFSNAKLDAVFIPDQVKHQVIQYIVSQDPSEDSIFDFFQMIWELNISYLITLTKISKRKGFIYEYWDSKSENKTYSKDKVSYKIKKTKETNSGNLTERLFILENNNLE REITQLHLMTSTCQNDSVLNYYEKLFIKLHEIKSLGLCYPLLFHSSNSNLDQCAMLICIDKIISTLAFGSDMVNIYRMMLELNQYRNLMLQQECHYLYIYEYIDWFLRKSFKIMKSKKRTKTRSMIE
Sbjct:    1 MNSGSKSPKSLFPLRMMSQKKRSSKHKTEEPQPVQEEAKVLNRAIRISEFKNEYKKLCCNDFVILKKEYKDLINESMTMKESEYNIWTSIESMSNINLHDRIHIVQVDNLRVTMSSSLFSNAKLDAVFIPDQVKHQVIQYIVSQDPSEDSIFDFFQMIWELNISYLITLTKISKRKGFIYEYWDSKSENKTYSKDKVSYKIKKTKETNSGNLTERLFILENNNLECREITQLHLMTSTCQNDSVLNYYEKLFIKLHEIKSLGLCYPLLFHSSNSNLDQCAMLICIDKIISTLAFGSDMVNIYRMMLELNQYRNLMLQQECHYLYIYEYIDWFLRKSFKIMKSKKRTKTRSMIE 353          
BLAST of Protein tyrosine phosphatase, receptor type, M vs. Planmine SMEST
Match: SMESG000068926.1 (SMESG000068926.1)

HSP 1 Score: 193.356 bits (490), Expect = 2.171e-58
Identity = 112/338 (33.14%), Postives = 197/338 (58.28%), Query Frame = 2
Query:   53 MNSGSKSPKLLFPLRMMSQKKRSSKHKTEEPQPVQEEAKVLNRAIRISEFKNEYKKLCCNDFVILKKEYKDLINESMTMKESEYNIWTSIESMSNINLHGRIHIVQVDNLRVTMSSSLFSNAKLDAVFIPDQVKHQVIQYIVSQDPSEDSIFDFFQMIWELNISYLITLTKISKRKGFIYEYWDSKSENKTYSKDKVSYKIKKTKETNSGNLTERLFILENNNLERREITQLHLMTSTCQNDSVLNYYEKLFIKLHEIKSLGLCYPLLFHSSNSNLDQCAMLICIDKIISTLAFGSDMVNIYRMMLELNQYRNLMLQQECHYLYIYEYIDWFLRKSFK 1066
            M   S SPK     R +S K   ++   E     Q   ++ N +I  +EF + Y+ L  + ++ L KE+K+L+  SM + + + ++ + + ++S++  H +   +Q  +L+V +S S +S++ LD  +I +  +   IQYI+S DPS++SI +F +MIW+  + Y++TLT++S+ K     +W + +    +  +K S+ +   +E    NL +R+  +  N  + + I Q H+ T+   N+ V   +++LFI+L+E+K     YP+LFH+SN N +QC+MLI IDKII +L    + +NIY  + ++NQY+N ML +E  Y  IYEYI  +L+K  K
Sbjct:    1 MFPKSLSPKSPLLKRFLSMKTEITEIVLETENLYQYLEEIKNYSIPRNEFHDIYEGLLKDRYIPLNKEFKNLVEISMQINQEQSSLLSILSNISSLFDHQKQITLQALDLKVYISQSFYSSSGLDCTYIHNDRQTNCIQYIISTDPSKESIVEFLRMIWKSKVKYVVTLTRLSREKFHGIHFWPALNNTIQFQFEKDSFSLFTKEEVQRKNLVKRIIKIVKNGEKHKVIKQFHVTTTVANNEPVYKSFKRLFIQLNEVKETD--YPILFHTSNLNREQCSMLISIDKIIKSLENNEENINIYETVFQMNQYKNSMLVEERQYFDIYEYISCYLKKQSK 336          
BLAST of Protein tyrosine phosphatase, receptor type, M vs. Planmine SMEST
Match: SMESG000068926.1 (SMESG000068926.1)

HSP 1 Score: 190.66 bits (483), Expect = 2.444e-57
Identity = 113/338 (33.43%), Postives = 198/338 (58.58%), Query Frame = 2
Query:   53 MNSGSKSPKLLFPLRMMSQKKRSSKHKTEEPQPVQEEAKVLNRAIRISEFKNEYKKLCCNDFVILKKEYKDLINESMTMKESEYNIWTSIESMSNINLHGRIHIVQVDNLRVTMSSSLFSNAKLDAVFIPDQVKHQVIQYIVSQDPSEDSIFDFFQMIWELNISYLITLTKISKRKGFIYEYWDSKSENKTYSKDKVSYKIKKTKETNSGNLTERLFILENNNLERREITQLHLMTSTCQNDSVLNYYEKLFIKLHEIKSLGLCYPLLFHSSNSNLDQCAMLICIDKIISTLAFGSDMVNIYRMMLELNQYRNLMLQQECHYLYIYEYIDWFLRKSFK 1066
            M   S SPK     R +S K   ++   E     Q   ++ N +I  +EF + Y+ L  + ++ L KE+K+L+  SM + + + ++ + + ++S++  H +   +Q  +L+V +S S +S++ LD  +I +  +   IQYI+S DPS++SI +F +MIW+  + Y++TLT++S+ K     +W + +    +  +K S+ +   +E    NL +R  I++ N  + + I Q H+ T+   N+ V   +++LFI+L+E+K     YP+LFH+SN N +QC+MLI IDKII +L    + +NIY  + ++NQY+N ML +E  Y  IYEYI  +L+K  K
Sbjct:    1 MFPKSLSPKSPLLKRFLSMKTEITEIVLETENLYQYLEEIKNYSIPRNEFHDIYEGLLKDRYIPLNKEFKNLVEISMQINQEQSSLLSILSNISSLFDHQKQITLQALDLKVYISQSFYSSSGLDCTYIHNDRQTNCIQYIISTDPSKESIVEFLRMIWKSKVKYVVTLTRLSREKFHGIHFWPALNNTIQFQFEKDSFSLFTKEEVQRKNLVKR--IIKINGEKHKVIKQFHVTTTVANNEPVYKSFKRLFIQLNEVKETD--YPILFHTSNLNREQCSMLISIDKIIKSLENNEENINIYETVFQMNQYKNSMLVEERQYFDIYEYISCYLKKQSK 334          
BLAST of Protein tyrosine phosphatase, receptor type, M vs. Planmine SMEST
Match: SMESG000068926.1 (SMESG000068926.1)

HSP 1 Score: 186.422 bits (472), Expect = 5.403e-56
Identity = 103/300 (34.33%), Postives = 185/300 (61.67%), Query Frame = 2
Query:  167 KVLNRAIRISEFKNEYKKLCCNDFVILKKEYKDLINESMTMKESEYNIWTSIESMSNINLHGRIHIVQVDNLRVTMSSSLFSNAKLDAVFIPDQVKHQVIQYIVSQDPSEDSIFDFFQMIWELNISYLITLTKISKRKGFIYEYWDSKSENKTYSKDKVSYKIKKTKETNSGNLTERLFILENNNLERREITQLHLMTSTCQNDSVLNYYEKLFIKLHEIKSLGLCYPLLFHSSNSNLDQCAMLICIDKIISTLAFGSDMVNIYRMMLELNQYRNLMLQQECHYLYIYEYIDWFLRKSFK 1066
            ++ N +I  +EF + Y+ L  + ++ L KE+K+L+  SM + + + ++ + + ++S++  H +   +Q  +L+V +S S +S++ LD  +I +  +   IQYI+S DPS++SI +F +MIW+  + Y++TLT++S+ K     +W + +    +  +K S+ +   +E    NL +R  I++ N  + + I Q H+ T+   N+ V   +++LFI+L+E+K     YP+LFH+SN N +QC+MLI IDKII +L    + +NIY  + ++NQY+N ML +E  Y  IYEYI  +L+K  K
Sbjct:   21 EIKNYSIPRNEFHDIYEGLLKDRYIPLNKEFKNLVEISMQINQEQSSLLSILSNISSLFDHQKQITLQALDLKVYISQSFYSSSGLDCTYIHNDRQTNCIQYIISTDPSKESIVEFLRMIWKSKVKYVVTLTRLSREKFHGIHFWPALNNTIQFQFEKDSFSLFTKEEVQRKNLVKR--IIKINGEKHKVIKQFHVTTTVANNEPVYKSFKRLFIQLNEVKETD--YPILFHTSNLNREQCSMLISIDKIIKSLENNEENINIYETVFQMNQYKNSMLVEERQYFDIYEYISCYLKKQSK 316          
BLAST of Protein tyrosine phosphatase, receptor type, M vs. Planmine SMEST
Match: SMESG000068925.1 (SMESG000068925.1)

HSP 1 Score: 162.155 bits (409), Expect = 1.142e-46
Identity = 99/297 (33.33%), Postives = 169/297 (56.90%), Query Frame = 2
Query:  182 AIRISEFKNEYKKLCCNDFVILKKEYKDLINESMTMKESEYNIWTSIESMSNINLHGRIHIVQVDNLRVTMSSSLFSNAKLDAVFIPDQVKHQVIQYIVSQDPSEDSIFDFFQMIWELNISYLITLTKISKRKGFIYEYWDSKSENKTYSKDKVSYKIKKTKETNSGNLTERLFILENNNLERREITQLHLMTSTCQNDSVLNYYEKLFIKLHEIKSLGLCYPLLFHSSNSNLDQCAMLICIDKIISTLAFGSDMVNIYRMMLELNQYRNLMLQQECHYLYIYEYIDWFLRKSFKIM 1072
            +I    F ++Y++   NDF  +K EY+ L + S+++K  +  +   I+ ++ + ++ +     V+ + +++S S F+N  L A+++ +  K    QY++ QDP+ ++I DF +MI+E  IS +I ++     K  + EYW    +NK Y+     + + K  E    NL  R   LENN   +R+ITQLHL  S     ++   Y  L   +++IK+ G  + +LFH+S SNL++ + L+C+DKIIS L  G   +NIY  +LE+NQY    L++E  YL+IY+ I  FL  S K++
Sbjct:   24 SISTHGFISQYEQYRNNDFSKIKSEYEALQSMSVSLKSKQNQLMNQIQKLAKLQINLKNQYFHVNQVLISLSKSCFTNEHLKAIYVSESEKSNNYQYVLCQDPNTNTIVDFMKMIFENKISLVILISIKKSNKNNLLEYW---PKNKDYNYRNSQFTVMKEWEKKDNNLIIRNLSLENNFGCKRKITQLHLEVSLKDKVNLSMSYRNLIENMYDIKTCGKKFRILFHTSESNLEEISKLMCVDKIISNLFDGIQDINIYETVLEINQYERFSLKKESQYLFIYDCIYQFLVGSIKVI 317          
The following BLAST results are available for this feature:
BLAST of Protein tyrosine phosphatase, receptor type, M vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
PTPRJ4.203e-1323.08protein tyrosine phosphatase receptor type J [Sour... [more]
PTPRJ4.205e-1323.08protein tyrosine phosphatase receptor type J [Sour... [more]
PTPRJ1.393e-1223.37protein tyrosine phosphatase receptor type J [Sour... [more]
PTPRM1.774e-1224.77protein tyrosine phosphatase receptor type M [Sour... [more]
PTPRM2.006e-1224.77protein tyrosine phosphatase receptor type M [Sour... [more]
back to top
BLAST of Protein tyrosine phosphatase, receptor type, M vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ptp-33.822e-1022.56Tyrosine-protein phosphatase Lar-like [Source:Uni... [more]
dep-11.319e-820.20Receptor-type tyrosine-protein phosphatase dep-1 ... [more]
ptp-32.406e-821.99Tyrosine-protein phosphatase Lar-like [Source:Uni... [more]
ptp-32.508e-821.99Tyrosine-protein phosphatase Lar-like [Source:Uni... [more]
ptp-32.652e-821.99Tyrosine-protein phosphatase Lar-like [Source:Uni... [more]
back to top
BLAST of Protein tyrosine phosphatase, receptor type, M vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Ptp69D8.460e-1227.00gene:FBgn0014007 transcript:FBtr0075913[more]
Ptp69D8.922e-1227.00gene:FBgn0014007 transcript:FBtr0075914[more]
Lar1.063e-1123.02gene:FBgn0000464 transcript:FBtr0331239[more]
Lar1.124e-1123.02gene:FBgn0000464 transcript:FBtr0331240[more]
Lar1.131e-1123.02gene:FBgn0000464 transcript:FBtr0081260[more]
back to top
BLAST of Protein tyrosine phosphatase, receptor type, M vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ptprk2.125e-1123.43protein tyrosine phosphatase receptor type K [Sour... [more]
ptprsa2.424e-1123.97protein tyrosine phosphatase receptor type Sa [Sou... [more]
ptpn135.602e-1123.50protein tyrosine phosphatase non-receptor type 13 ... [more]
ptpn135.973e-1123.50protein tyrosine phosphatase non-receptor type 13 ... [more]
ptprfb9.256e-1123.79protein tyrosine phosphatase receptor type Fb [Sou... [more]
back to top
BLAST of Protein tyrosine phosphatase, receptor type, M vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
PTPRM1.200e-1024.14protein tyrosine phosphatase, receptor type M [Sou... [more]
PTPRM1.262e-1024.14protein tyrosine phosphatase, receptor type M [Sou... [more]
PTPRM1.286e-1024.14protein tyrosine phosphatase, receptor type M [Sou... [more]
PTPRM1.346e-1024.14protein tyrosine phosphatase, receptor type M [Sou... [more]
mfsd14b3.541e-1023.10major facilitator superfamily domain containing 14... [more]
back to top
BLAST of Protein tyrosine phosphatase, receptor type, M vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Ptprj3.954e-1322.32protein tyrosine phosphatase, receptor type, J [So... [more]
Ptprj6.413e-1322.32protein tyrosine phosphatase, receptor type, J [So... [more]
Ptprj1.324e-1222.32protein tyrosine phosphatase, receptor type, J [So... [more]
Ptprm1.216e-1124.84protein tyrosine phosphatase, receptor type, M [So... [more]
Ptprm1.485e-1124.84protein tyrosine phosphatase, receptor type, M [So... [more]
back to top
BLAST of Protein tyrosine phosphatase, receptor type, M vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q12913|PTPRJ_HUMAN6.689e-1223.37Receptor-type tyrosine-protein phosphatase eta OS=... [more]
sp|Q64455|PTPRJ_MOUSE7.125e-1222.32Receptor-type tyrosine-protein phosphatase eta OS=... [more]
sp|P28827|PTPRM_HUMAN9.635e-1224.77Receptor-type tyrosine-protein phosphatase mu OS=H... [more]
sp|Q9W6V5|PTPRJ_CHICK7.173e-1123.55Receptor-type tyrosine-protein phosphatase eta OS=... [more]
sp|P16620|PTP69_DROME8.480e-1127.00Tyrosine-protein phosphatase 69D OS=Drosophila mel... [more]
back to top
BLAST of Protein tyrosine phosphatase, receptor type, M vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A087T6U51.123e-1226.73Uncharacterized protein (Fragment) OS=Stegodyphus ... [more]
A0A2G8KK866.007e-1226.39Putative receptor-type tyrosine-protein phosphatas... [more]
A0A087TPC78.065e-1225.23Phosphotidylinositol phosphatase PTPRQ (Fragment) ... [more]
A0A210PXZ68.984e-1225.16Tyrosine-protein phosphatase 10D OS=Mizuhopecten y... [more]
A0A2B4R8C81.139e-1125.71Tyrosine-protein phosphatase Lar OS=Stylophora pis... [more]
back to top
BLAST of Protein tyrosine phosphatase, receptor type, M vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
PTPRM3.921e-1124.00protein tyrosine phosphatase receptor type M [Sour... [more]
PTPRM4.267e-1123.75protein tyrosine phosphatase receptor type M [Sour... [more]
PTPRM4.483e-1123.75protein tyrosine phosphatase receptor type M [Sour... [more]
PTPRM5.063e-1123.75protein tyrosine phosphatase receptor type M [Sour... [more]
ptprfb5.273e-1123.47protein tyrosine phosphatase receptor type Fb [Sou... [more]
back to top
BLAST of Protein tyrosine phosphatase, receptor type, M vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 4
Match NameE-valueIdentityDescription
ptprsa5.719e-1221.71protein tyrosine phosphatase receptor type Sa [Sou... [more]
ptpra3.110e-823.58protein tyrosine phosphatase receptor type A [Sour... [more]
ENSPMAT00000008162.12.505e-723.43pep scaffold:Pmarinus_7.0:GL477877:143952:159832:-... [more]
ca16b4.571e-722.06carbonic anhydrase XVI b [Source:ZFIN;Acc:ZDB-GENE... [more]
back to top
BLAST of Protein tyrosine phosphatase, receptor type, M vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Protein tyrosine phosphatase, receptor type, M vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
EDO481875.460e-1121.83Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO478934.002e-922.71Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO339958.450e-923.57Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO299841.124e-823.86Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO448232.051e-822.17Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Protein tyrosine phosphatase, receptor type, M vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ptprea3.234e-1122.92receptor-type tyrosine-protein phosphatase epsilon... [more]
ptprea3.563e-1122.92receptor-type tyrosine-protein phosphatase epsilon... [more]
ptprea3.821e-1122.92receptor-type tyrosine-protein phosphatase epsilon... [more]
ptprfb4.733e-1123.89receptor-type tyrosine-protein phosphatase F [Sour... [more]
ptprsa8.297e-1123.89receptor-type tyrosine-protein phosphatase S [Sour... [more]
back to top
BLAST of Protein tyrosine phosphatase, receptor type, M vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000068931.10.000e+099.15SMESG000068931.1[more]
SMESG000068926.12.171e-5833.14SMESG000068926.1[more]
SMESG000068926.12.444e-5733.43SMESG000068926.1[more]
SMESG000068926.15.403e-5634.33SMESG000068926.1[more]
SMESG000068925.11.142e-4633.33SMESG000068925.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30015931 ID=SMED30015931|Name=Protein tyrosine phosphatase, receptor type, M|organism=Schmidtea mediterranea sexual|type=transcript|length=1129bp
TTTTATTAAATAAATATCCACAATTCAGAAGAAGTTAAAAATATTTACAG
AAATGAATTCTGGATCAAAAAGTCCGAAATTACTTTTTCCTCTAAGGATG
ATGAGCCAAAAAAAGAGGTCATCAAAACATAAAACCGAAGAACCACAACC
GGTGCAGGAAGAGGCAAAAGTTTTAAATCGAGCTATTCGAATTAGTGAAT
TTAAAAATGAATACAAAAAACTATGTTGCAATGACTTTGTTATTTTGAAA
AAAGAATATAAAGATTTAATAAACGAGTCAATGACGATGAAAGAATCGGA
ATACAATATCTGGACATCCATAGAATCTATGTCCAATATAAATCTTCACG
GCAGGATCCATATAGTTCAAGTGGATAATTTGAGAGTAACGATGTCTTCG
TCTCTCTTCTCCAATGCCAAACTGGACGCTGTCTTTATACCTGATCAAGT
GAAGCATCAAGTCATTCAATATATAGTTAGCCAGGATCCATCAGAAGACA
GTATTTTTGATTTCTTTCAAATGATATGGGAACTAAATATTTCTTATCTC
ATTACACTTACAAAAATTTCGAAAAGAAAAGGATTTATATATGAATATTG
GGATTCAAAATCAGAAAATAAAACCTATTCTAAGGACAAAGTTTCGTATA
AGATTAAAAAAACAAAAGAAACAAACTCTGGAAATCTAACTGAGAGACTT
TTTATATTAGAAAACAATAATTTGGAACGCAGAGAAATTACGCAACTTCA
CCTAATGACATCAACATGTCAAAACGATTCCGTTCTTAATTATTATGAAA
AGCTTTTCATTAAGCTCCATGAAATTAAGTCCCTTGGGCTTTGCTACCCA
TTACTATTTCATTCCAGTAATTCAAATCTGGATCAGTGTGCAATGCTTAT
TTGTATCGATAAGATCATTTCCACCTTGGCTTTTGGATCAGACATGGTAA
ACATTTATAGAATGATGCTTGAACTGAACCAATATAGAAATCTGATGCTA
CAACAGGAATGCCACTATTTATACATATATGAGTACATAGATTGGTTTCT
CAGAAAATCTTTTAAAATTATGAAATCCAAAAAAAGAACAAAAACCAGGT
CGATGATTGAATAGTTTAAAATACTGTAG
back to top

protein sequence of SMED30015931-orf-1

>SMED30015931-orf-1 ID=SMED30015931-orf-1|Name=SMED30015931-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=354bp
MNSGSKSPKLLFPLRMMSQKKRSSKHKTEEPQPVQEEAKVLNRAIRISEF
KNEYKKLCCNDFVILKKEYKDLINESMTMKESEYNIWTSIESMSNINLHG
RIHIVQVDNLRVTMSSSLFSNAKLDAVFIPDQVKHQVIQYIVSQDPSEDS
IFDFFQMIWELNISYLITLTKISKRKGFIYEYWDSKSENKTYSKDKVSYK
IKKTKETNSGNLTERLFILENNNLERREITQLHLMTSTCQNDSVLNYYEK
LFIKLHEIKSLGLCYPLLFHSSNSNLDQCAMLICIDKIISTLAFGSDMVN
IYRMMLELNQYRNLMLQQECHYLYIYEYIDWFLRKSFKIMKSKKRTKTRS
MIE*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0003116parenchymal cell
Vocabulary: INTERPRO
TermDefinition
IPR000242PTPase_domain
IPR003595Tyr_Pase_cat
IPR029021Prot-tyrosine_phosphatase-like
Vocabulary: molecular function
TermDefinition
GO:0004725protein tyrosine phosphatase activity
GO:0004721phosphoprotein phosphatase activity
GO:0005001transmembrane receptor protein tyrosine phosphatase activity
GO:0016787hydrolase activity
GO:0016791phosphatase activity
Vocabulary: biological process
TermDefinition
GO:0006470protein dephosphorylation
GO:0016311dephosphorylation
GO:0035335peptidyl-tyrosine dephosphorylation
Vocabulary: cellular component
TermDefinition
GO:0016020membrane
GO:0016021integral component of membrane
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR000242PTP type protein phosphatasePRINTSPR00700PRTYPHPHTASEcoord: 299..314
score: 21.62
coord: 140..160
score: 40.34
coord: 315..325
score: 31.71
IPR000242PTP type protein phosphataseSMARTSM00194PTPc_3coord: 64..334
e-value: 5.0E-8
score: 24.5
IPR000242PTP type protein phosphatasePFAMPF00102Y_phosphatasecoord: 103..329
e-value: 1.6E-19
score: 70.4
IPR000242PTP type protein phosphatasePROSITEPS50055TYR_PHOSPHATASE_PTPcoord: 65..332
score: 17.825
IPR003595Protein-tyrosine phosphatase, catalyticSMARTSM00404ptp_7coord: 228..331
e-value: 6.7E-4
score: 24.1
IPR029021Protein-tyrosine phosphatase-likeGENE3DG3DSA:3.90.190.10coord: 40..336
e-value: 3.1E-28
score: 100.9
IPR029021Protein-tyrosine phosphatase-likeSUPERFAMILYSSF52799(Phosphotyrosine protein) phosphatases IIcoord: 43..333
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 1..35
NoneNo IPR availablePANTHERPTHR19134PROTEIN-TYROSINE PHOSPHATASEcoord: 24..330
NoneNo IPR availableCDDcd00047PTPccoord: 126..327
e-value: 5.94622E-22
score: 90.0372