Ran GTPase-activating protein 1

Overview
NameRan GTPase-activating protein 1
Smed IDSMED30015929
Length (bp)2215
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Ran GTPase-activating protein 1 (SMED30015929) t-SNE clustered cells

Violin plots show distribution of expression levels for Ran GTPase-activating protein 1 (SMED30015929) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Ran GTPase-activating protein 1 (SMED30015929) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Ran GTPase-activating protein 1 (SMED30015929) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30015929

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 4

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
X1 cellSMED30015929h1SMcG0010847 SmedASXL_010114SmedAsxl_ww_GCZZ01PMID:26114597
Zhu et al., 2015
FACS sorted cell population asexual adult RNA-sequencing evidence
neoblastSMED30015929h1SMcG0010847 dd_Smed_v4_7553_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
ovarySMED30015929h1SMcG0010847 DN312988smed_ncbi_20240424PMID:16344473
Zayas et al., 2005
whole organism adult hermaphrodite colorimetric in situ hybridization evidence
testisSMED30015929h1SMcG0010847 DN312988smed_ncbi_20240424PMID:16344473
Zayas et al., 2005
whole organism adult hermaphrodite colorimetric in situ hybridization evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Ran GTPase-activating protein 1 vs. Ensembl Human
Match: RANGAP1 (Ran GTPase activating protein 1 [Source:HGNC Symbol;Acc:HGNC:9854])

HSP 1 Score: 194.512 bits (493), Expect = 7.798e-53
Identity = 120/329 (36.47%), Postives = 193/329 (58.66%), Query Frame = 2
Query:  107 LSYTGLQKQWNTEEDIEHVVKDLNENVNCVTTLQLSGNTLGVNAAEKLIEPLSNQTKIQKLIWNDLFTGRLKSEISVALSSLSIGLMRAQVHLVELDLSDNAFGPNGVVGVTELLASSCCYTLKTLNMNNQGLGHQGCRQLVDALKKARINSNYKG--MNLEVFIAGRNRLENAGMEMLTEFFSDGMTSLKKIVLLQNGIGIHGIQGVDNLILSLKNHINLKVLNISDNTIKPEGVKRLSKILPYFEDLEELYLGDCLIKNSGLEHLTKVLNQMSLNLKTVSVSGNEITGHCAIKFISKIVETKHIIESIDLTENEIKKVALNEIKEIL 1087
            LS+ G   + NT ED + V+K++ E+ + +  L+L GNT+GV AA  + + L  ++++++  W+D+FTGRL++EI  AL SL  GL+ A   LVELDLSDNAFGP+GV G   LL SS C+TL+ L +NN G+G  G + L  AL +    S+ +G  + L+VF+AGRNRLEN G   L E F   + +L+++ + QNGI   GI     L  +   +  L+V+N++DNT   +G   +++ L     +E +  GDCL+++ G   +   +      LK +++S  EI    A+     + + K  +E +DL  N + +    +++E+L
Sbjct:   23 LSFKGKSLKLNTAEDAKDVIKEI-EDFDSLEALRLEGNTVGVEAARVIAKALEKKSELKRCHWSDMFTGRLRTEIPPALISLGEGLITAGAQLVELDLSDNAFGPDGVQGFEALLKSSACFTLQELKLNNCGMGIGGGKILAAALTECHRKSSAQGKPLALKVFVAGRNRLENDGATALAEAFRV-IGTLEEVHMPQNGINHPGITA---LAQAFAVNPLLRVINLNDNTFTEKGAVAMAETLKTLRQVEVINFGDCLVRSKGAVAIADAIRGGLPKLKELNLSFCEIKRDAALAVAEAMAD-KAELEKLDLNGNTLGEEGCEQLQEVL 345          
BLAST of Ran GTPase-activating protein 1 vs. Ensembl Human
Match: RANGAP1 (Ran GTPase activating protein 1 [Source:HGNC Symbol;Acc:HGNC:9854])

HSP 1 Score: 194.512 bits (493), Expect = 7.798e-53
Identity = 120/329 (36.47%), Postives = 193/329 (58.66%), Query Frame = 2
Query:  107 LSYTGLQKQWNTEEDIEHVVKDLNENVNCVTTLQLSGNTLGVNAAEKLIEPLSNQTKIQKLIWNDLFTGRLKSEISVALSSLSIGLMRAQVHLVELDLSDNAFGPNGVVGVTELLASSCCYTLKTLNMNNQGLGHQGCRQLVDALKKARINSNYKG--MNLEVFIAGRNRLENAGMEMLTEFFSDGMTSLKKIVLLQNGIGIHGIQGVDNLILSLKNHINLKVLNISDNTIKPEGVKRLSKILPYFEDLEELYLGDCLIKNSGLEHLTKVLNQMSLNLKTVSVSGNEITGHCAIKFISKIVETKHIIESIDLTENEIKKVALNEIKEIL 1087
            LS+ G   + NT ED + V+K++ E+ + +  L+L GNT+GV AA  + + L  ++++++  W+D+FTGRL++EI  AL SL  GL+ A   LVELDLSDNAFGP+GV G   LL SS C+TL+ L +NN G+G  G + L  AL +    S+ +G  + L+VF+AGRNRLEN G   L E F   + +L+++ + QNGI   GI     L  +   +  L+V+N++DNT   +G   +++ L     +E +  GDCL+++ G   +   +      LK +++S  EI    A+     + + K  +E +DL  N + +    +++E+L
Sbjct:   23 LSFKGKSLKLNTAEDAKDVIKEI-EDFDSLEALRLEGNTVGVEAARVIAKALEKKSELKRCHWSDMFTGRLRTEIPPALISLGEGLITAGAQLVELDLSDNAFGPDGVQGFEALLKSSACFTLQELKLNNCGMGIGGGKILAAALTECHRKSSAQGKPLALKVFVAGRNRLENDGATALAEAFRV-IGTLEEVHMPQNGINHPGITA---LAQAFAVNPLLRVINLNDNTFTEKGAVAMAETLKTLRQVEVINFGDCLVRSKGAVAIADAIRGGLPKLKELNLSFCEIKRDAALAVAEAMAD-KAELEKLDLNGNTLGEEGCEQLQEVL 345          
BLAST of Ran GTPase-activating protein 1 vs. Ensembl Human
Match: RANGAP1 (Ran GTPase activating protein 1 [Source:HGNC Symbol;Acc:HGNC:9854])

HSP 1 Score: 194.512 bits (493), Expect = 7.798e-53
Identity = 120/329 (36.47%), Postives = 193/329 (58.66%), Query Frame = 2
Query:  107 LSYTGLQKQWNTEEDIEHVVKDLNENVNCVTTLQLSGNTLGVNAAEKLIEPLSNQTKIQKLIWNDLFTGRLKSEISVALSSLSIGLMRAQVHLVELDLSDNAFGPNGVVGVTELLASSCCYTLKTLNMNNQGLGHQGCRQLVDALKKARINSNYKG--MNLEVFIAGRNRLENAGMEMLTEFFSDGMTSLKKIVLLQNGIGIHGIQGVDNLILSLKNHINLKVLNISDNTIKPEGVKRLSKILPYFEDLEELYLGDCLIKNSGLEHLTKVLNQMSLNLKTVSVSGNEITGHCAIKFISKIVETKHIIESIDLTENEIKKVALNEIKEIL 1087
            LS+ G   + NT ED + V+K++ E+ + +  L+L GNT+GV AA  + + L  ++++++  W+D+FTGRL++EI  AL SL  GL+ A   LVELDLSDNAFGP+GV G   LL SS C+TL+ L +NN G+G  G + L  AL +    S+ +G  + L+VF+AGRNRLEN G   L E F   + +L+++ + QNGI   GI     L  +   +  L+V+N++DNT   +G   +++ L     +E +  GDCL+++ G   +   +      LK +++S  EI    A+     + + K  +E +DL  N + +    +++E+L
Sbjct:   23 LSFKGKSLKLNTAEDAKDVIKEI-EDFDSLEALRLEGNTVGVEAARVIAKALEKKSELKRCHWSDMFTGRLRTEIPPALISLGEGLITAGAQLVELDLSDNAFGPDGVQGFEALLKSSACFTLQELKLNNCGMGIGGGKILAAALTECHRKSSAQGKPLALKVFVAGRNRLENDGATALAEAFRV-IGTLEEVHMPQNGINHPGITA---LAQAFAVNPLLRVINLNDNTFTEKGAVAMAETLKTLRQVEVINFGDCLVRSKGAVAIADAIRGGLPKLKELNLSFCEIKRDAALAVAEAMAD-KAELEKLDLNGNTLGEEGCEQLQEVL 345          
BLAST of Ran GTPase-activating protein 1 vs. Ensembl Human
Match: RANGAP1 (Ran GTPase activating protein 1 [Source:HGNC Symbol;Acc:HGNC:9854])

HSP 1 Score: 117.857 bits (294), Expect = 4.922e-29
Identity = 85/288 (29.51%), Postives = 142/288 (49.31%), Query Frame = 2
Query:  224 LGVNAAEKLIEPLSNQTKIQKLIWNDLFTGRLKSEISVALSSLSIGLMRAQVHLVELDLSDNAFGPNGVVGVTELLASSCCYTLKTLNMNNQGLGHQGCRQLVDALKKARINSNYKGMNLEVFIAGRNRLENAGMEMLTEFFSDGMTSLKKIVLLQNGIGIHGIQGVDNLILSLKNHINLKVLNISDNTIKPEGVKRLSKILPYFEDLEELYLGDCLIKNSGLEHLTKVLNQMSLNLKTVSVSGNEITGHCAIKFISKIVETKHIIESIDLTENEIKKVALNEIKEIL 1087
            +GV AA  + + L  ++++++  W+D+FTGRL++EI  AL SL  GL+ A   LVELDLSDNAFGP+GV G   LL SS C+TL+ L +NN G+G  G + +                                             +L+++ + QNGI   GI     L  +   +  L+V+N++DNT   +G   +++ L     +E +  GDCL+++ G   +   +      LK +++S  EI    A+     + + K  +E +DL  N + +    +++E+L
Sbjct:    2 VGVEAARVIAKALEKKSELKRCHWSDMFTGRLRTEIPPALISLGEGLITAGAQLVELDLSDNAFGPDGVQGFEALLKSSACFTLQELKLNNCGMGIGGGKVI--------------------------------------------GTLEEVHMPQNGINHPGITA---LAQAFAVNPLLRVINLNDNTFTEKGAVAMAETLKTLRQVEVINFGDCLVRSKGAVAIADAIRGGLPKLKELNLSFCEIKRDAALAVAEAMAD-KAELEKLDLNGNTLGEEGCEQLQEVL 241          
BLAST of Ran GTPase-activating protein 1 vs. Ensembl Human
Match: RANGAP1 (Ran GTPase activating protein 1 [Source:HGNC Symbol;Acc:HGNC:9854])

HSP 1 Score: 105.145 bits (261), Expect = 7.044e-26
Identity = 52/110 (47.27%), Postives = 77/110 (70.00%), Query Frame = 2
Query:  107 LSYTGLQKQWNTEEDIEHVVKDLNENVNCVTTLQLSGNTLGVNAAEKLIEPLSNQTKIQKLIWNDLFTGRLKSEISVALSSLSIGLMRAQVHLVELDLSDNAFGPNGVVG 436
            LS+ G   + NT ED + V+K++ E+ + +  L+L GNT+GV AA  + + L  ++++++  W+D+FTGRL++EI  AL SL  GL+ A   LVELDLSDNAFGP+GV G
Sbjct:   23 LSFKGKSLKLNTAEDAKDVIKEI-EDFDSLEALRLEGNTVGVEAARVIAKALEKKSELKRCHWSDMFTGRLRTEIPPALISLGEGLITAGAQLVELDLSDNAFGPDGVQG 131          
BLAST of Ran GTPase-activating protein 1 vs. Ensembl Celegans
Match: ran-2 (Ran GTPase-activating protein 2 [Source:UniProtKB/Swiss-Prot;Acc:P34342])

HSP 1 Score: 181.415 bits (459), Expect = 1.957e-47
Identity = 113/291 (38.83%), Postives = 168/291 (57.73%), Query Frame = 2
Query:  137 NTEEDIEHVVKDLNENVNCVTTLQLSGNTLGVNAAEKLIEPLSNQTKIQKLIWNDLFTGRLKSEISVALSSLSIGLMRAQVHLVELDLSDNAFGPNGVVGVTELLASSCCYTLKTLNMNNQGLGHQG---CRQLVDALKKARINSNYKGMNLEVFIAGRNRLENAGMEMLTEFFSDGMTSLKKIVLLQNGIGIHGIQGVDNLILSLKNHINLKVLNISDNTIKPEGVKRLSKILPYFEDLEELYLGDCLIKNSGLEHLTKVLN-QMSLNLKTVSVSGNEITGHCAIKFISK 997
            +T E  E VVK +    + +  L+L GNTLG+ A   + + L +  ++++ +W+DLFTGRLK+EI   L +L   +M A   + ELDLSDNAFGP G   + +LL S   ++L+ L +NN GLG  G    + L + L+K+        + L+ FIAGRNRLEN G   L   F   + +++   + QNGI   GI+    L+ +LK++ NL+ L + DNT+ P+G K L+K L  +  LE L L DCLI+++G  ++   LN Q   +LK V + GNE+T   A   I K
Sbjct:  423 DTAESAEPVVKVIAA-ASSMKALELRGNTLGIAAGNVIAKALESHPELERCLWSDLFTGRLKNEIPPILEALGKAMMTAGCKIKELDLSDNAFGPIGADALKDLLESPSSFSLEVLKLNNNGLGIGGKQIAKSLTECLRKSIAVGGENRLRLKTFIAGRNRLENPGAHALAATFK-ALETVEWFDVRQNGIHEEGIRA---LVAALKHNRNLRYLWLEDNTVLPKGAKALAKTLESWPKLEVLNLSDCLIRDAGCNYIIDHLNPQHHRHLKNVYLCGNELTPPVAKLLIQK 708          

HSP 2 Score: 152.14 bits (383), Expect = 6.716e-38
Identity = 106/295 (35.93%), Postives = 166/295 (56.27%), Query Frame = 2
Query:  107 LSYTGLQKQWNTEEDIEHVVKDLNENVNCVTTLQLSGNTLGVNAAEKLIEPLSNQTKIQKLIWNDLFTGRLKSEISVALSSLSIGLMRAQVHLVELDLSDNAFGPNGVVGVTELLASSCCYTLKTLNMNNQGLGHQG-------CRQLVDALKKARINSNYKGMNLEVFIAGRNRLENAGMEMLTEFFSDGMTSLKKIVLLQNGIGIHGIQGVDNLILSLKNHINLKVLNISDNTIKPEGVKRLSKILPYFEDLEELYLGDCLIKNSGLEHLTKVLNQMSLN-LKTVSVSGNEIT 967
            LS+ G Q + +TEE+I  V+  + +++N +  L   GNTL V A + + E L  + ++++ IW+D+FTGRLK EI + L +L   L  +   L  LDLSDNAFG      +   L S   Y+L+ L +NN GLG  G       C  L+DA KKA        + L+ F+ GRNRLE      L++ F   + +L++I L QNGI   GI     L  + + +  L++++I+DN   PEG  ++S++L   + +E L LGDC+  + G+  +   L++++ + LK V +SGN IT
Sbjct:    7 LSFFGKQLKLDTEEEISKVIDQIRKHLN-LEVLDFRGNTLSVLAGKLIAESLKTRRELKECIWSDMFTGRLKDEIPLVLDALGEALTASGCRLTTLDLSDNAFGAGLSTSLYNFLQSPALYSLENLILNNNGLGLAGKTVGKALC-SLIDASKKAGTP-----LKLKKFVCGRNRLEVESTIALSDAFIK-LGTLEEIRLPQNGIRDDGIIA---LAEAFRMNKKLRIIDINDNFCCPEGAIQISEVLSDLQFIEVLDLGDCVCDDPGVLAIIAELDKINRDCLKKVVLSGNNIT 290          
BLAST of Ran GTPase-activating protein 1 vs. Ensembl Celegans
Match: ran-2 (Ran GTPase-activating protein 2 [Source:UniProtKB/Swiss-Prot;Acc:P34342])

HSP 1 Score: 181.8 bits (460), Expect = 1.961e-47
Identity = 113/291 (38.83%), Postives = 168/291 (57.73%), Query Frame = 2
Query:  137 NTEEDIEHVVKDLNENVNCVTTLQLSGNTLGVNAAEKLIEPLSNQTKIQKLIWNDLFTGRLKSEISVALSSLSIGLMRAQVHLVELDLSDNAFGPNGVVGVTELLASSCCYTLKTLNMNNQGLGHQG---CRQLVDALKKARINSNYKGMNLEVFIAGRNRLENAGMEMLTEFFSDGMTSLKKIVLLQNGIGIHGIQGVDNLILSLKNHINLKVLNISDNTIKPEGVKRLSKILPYFEDLEELYLGDCLIKNSGLEHLTKVLN-QMSLNLKTVSVSGNEITGHCAIKFISK 997
            +T E  E VVK +    + +  L+L GNTLG+ A   + + L +  ++++ +W+DLFTGRLK+EI   L +L   +M A   + ELDLSDNAFGP G   + +LL S   ++L+ L +NN GLG  G    + L + L+K+        + L+ FIAGRNRLEN G   L   F   + +++   + QNGI   GI+    L+ +LK++ NL+ L + DNT+ P+G K L+K L  +  LE L L DCLI+++G  ++   LN Q   +LK V + GNE+T   A   I K
Sbjct:  460 DTAESAEPVVKVIAA-ASSMKALELRGNTLGIAAGNVIAKALESHPELERCLWSDLFTGRLKNEIPPILEALGKAMMTAGCKIKELDLSDNAFGPIGADALKDLLESPSSFSLEVLKLNNNGLGIGGKQIAKSLTECLRKSIAVGGENRLRLKTFIAGRNRLENPGAHALAATFK-ALETVEWFDVRQNGIHEEGIRA---LVAALKHNRNLRYLWLEDNTVLPKGAKALAKTLESWPKLEVLNLSDCLIRDAGCNYIIDHLNPQHHRHLKNVYLCGNELTPPVAKLLIQK 745          

HSP 2 Score: 152.525 bits (384), Expect = 5.747e-38
Identity = 106/295 (35.93%), Postives = 166/295 (56.27%), Query Frame = 2
Query:  107 LSYTGLQKQWNTEEDIEHVVKDLNENVNCVTTLQLSGNTLGVNAAEKLIEPLSNQTKIQKLIWNDLFTGRLKSEISVALSSLSIGLMRAQVHLVELDLSDNAFGPNGVVGVTELLASSCCYTLKTLNMNNQGLGHQG-------CRQLVDALKKARINSNYKGMNLEVFIAGRNRLENAGMEMLTEFFSDGMTSLKKIVLLQNGIGIHGIQGVDNLILSLKNHINLKVLNISDNTIKPEGVKRLSKILPYFEDLEELYLGDCLIKNSGLEHLTKVLNQMSLN-LKTVSVSGNEIT 967
            LS+ G Q + +TEE+I  V+  + +++N +  L   GNTL V A + + E L  + ++++ IW+D+FTGRLK EI + L +L   L  +   L  LDLSDNAFG      +   L S   Y+L+ L +NN GLG  G       C  L+DA KKA        + L+ F+ GRNRLE      L++ F   + +L++I L QNGI   GI     L  + + +  L++++I+DN   PEG  ++S++L   + +E L LGDC+  + G+  +   L++++ + LK V +SGN IT
Sbjct:   44 LSFFGKQLKLDTEEEISKVIDQIRKHLN-LEVLDFRGNTLSVLAGKLIAESLKTRRELKECIWSDMFTGRLKDEIPLVLDALGEALTASGCRLTTLDLSDNAFGAGLSTSLYNFLQSPALYSLENLILNNNGLGLAGKTVGKALC-SLIDASKKAGTP-----LKLKKFVCGRNRLEVESTIALSDAFIK-LGTLEEIRLPQNGIRDDGIIA---LAEAFRMNKKLRIIDINDNFCCPEGAIQISEVLSDLQFIEVLDLGDCVCDDPGVLAIIAELDKINRDCLKKVVLSGNNIT 327          
BLAST of Ran GTPase-activating protein 1 vs. Ensembl Fly
Match: RanGAP (gene:FBgn0003346 transcript:FBtr0334175)

HSP 1 Score: 206.838 bits (525), Expect = 1.193e-57
Identity = 122/280 (43.57%), Postives = 170/280 (60.71%), Query Frame = 2
Query:  134 WNTEEDIEHVVKDLNENVNCVTTLQLSGNTLGVNAAEKLIEPLSNQTKIQKLIWNDLFTGRLKSEISVALSSLSIGLMRAQVHLVELDLSDNAFGPNGVVGVTELLASSCCYTLKTLNMNNQGLGHQGCRQLVDALKKARINSNYKG--MNLEVFIAGRNRLENAGM-EMLTEFFSDGMTSLKKIVLLQNGIGIHGIQGVDNLILSLKNHINLKVLNISDNTIKPEGVKRLSKILPYFEDLEELYLGDCLIKNSGLEHLTKVLNQMSLNLKTVSVSGNEI 964
            WNT  D++ VV  LN+    V  L L GNTLGV AA+ + E L    + +K +W ++FTGRL SEI  AL  L   L+ A   L  LDLSDNA GPNG+ G+ ELL S  CY+L+ L + N GLG +G   L  AL     N+N  G  + L VFI  RNRLE+AG  EM T F +  + + ++IVL QN I    I+GV+ L  S K++ +L+VLN++DNT+K EG +++++ LP+   L E+  GDCLIK +G  H  + L + +  L+ + +  NEI
Sbjct:   20 WNTAADVQDVVDALNKQTT-VHYLNLDGNTLGVEAAKAIGEGLKRHPEFRKALWKNMFTGRLISEIPEALKHLGAALIVAGAKLTVLDLSDNALGPNGMRGLEELLRSPVCYSLQELLLCNCGLGPEGGSMLSRALIDLHANANKAGFPLQLRVFIGSRNRLEDAGATEMATAFQT--LKTFEEIVLEQNSI---YIEGVEALAESFKHNPHLRVLNMNDNTLKSEGAEKIAEALPFLPLLREMSFGDCLIKTNGAYHFGEALERGNERLEVIDLGFNEI 293          
BLAST of Ran GTPase-activating protein 1 vs. Ensembl Fly
Match: RanGAP (gene:FBgn0003346 transcript:FBtr0081234)

HSP 1 Score: 206.838 bits (525), Expect = 1.452e-57
Identity = 122/280 (43.57%), Postives = 169/280 (60.36%), Query Frame = 2
Query:  134 WNTEEDIEHVVKDLNENVNCVTTLQLSGNTLGVNAAEKLIEPLSNQTKIQKLIWNDLFTGRLKSEISVALSSLSIGLMRAQVHLVELDLSDNAFGPNGVVGVTELLASSCCYTLKTLNMNNQGLGHQGCRQLVDALKKARINSNYKG--MNLEVFIAGRNRLENAGM-EMLTEFFSDGMTSLKKIVLLQNGIGIHGIQGVDNLILSLKNHINLKVLNISDNTIKPEGVKRLSKILPYFEDLEELYLGDCLIKNSGLEHLTKVLNQMSLNLKTVSVSGNEI 964
            WNT  D++ VV  LN+    V  L L GNTLGV AA+ + E L    + +K +W ++FTGRL SEI  AL  L   L+ A   L  LDLSDNA GPNG+ G+ ELL S  CY+L+ L + N GLG +G   L  AL     N+N  G  + L VFI  RNRLE+AG  EM T F    + + ++IVL QN I    I+GV+ L  S K++ +L+VLN++DNT+K EG +++++ LP+   L E+  GDCLIK +G  H  + L + +  L+ + +  NEI
Sbjct:   28 WNTAADVQDVVDALNKQTT-VHYLNLDGNTLGVEAAKAIGEGLKRHPEFRKALWKNMFTGRLISEIPEALKHLGAALIVAGAKLTVLDLSDNALGPNGMRGLEELLRSPVCYSLQELLLCNCGLGPEGGSMLSRALIDLHANANKAGFPLQLRVFIGSRNRLEDAGATEMATAF--QTLKTFEEIVLEQNSI---YIEGVEALAESFKHNPHLRVLNMNDNTLKSEGAEKIAEALPFLPLLREMSFGDCLIKTNGAYHFGEALERGNERLEVIDLGFNEI 301          
BLAST of Ran GTPase-activating protein 1 vs. Ensembl Fly
Match: RanGAP (gene:FBgn0003346 transcript:FBtr0334174)

HSP 1 Score: 206.838 bits (525), Expect = 1.452e-57
Identity = 122/280 (43.57%), Postives = 169/280 (60.36%), Query Frame = 2
Query:  134 WNTEEDIEHVVKDLNENVNCVTTLQLSGNTLGVNAAEKLIEPLSNQTKIQKLIWNDLFTGRLKSEISVALSSLSIGLMRAQVHLVELDLSDNAFGPNGVVGVTELLASSCCYTLKTLNMNNQGLGHQGCRQLVDALKKARINSNYKG--MNLEVFIAGRNRLENAGM-EMLTEFFSDGMTSLKKIVLLQNGIGIHGIQGVDNLILSLKNHINLKVLNISDNTIKPEGVKRLSKILPYFEDLEELYLGDCLIKNSGLEHLTKVLNQMSLNLKTVSVSGNEI 964
            WNT  D++ VV  LN+    V  L L GNTLGV AA+ + E L    + +K +W ++FTGRL SEI  AL  L   L+ A   L  LDLSDNA GPNG+ G+ ELL S  CY+L+ L + N GLG +G   L  AL     N+N  G  + L VFI  RNRLE+AG  EM T F    + + ++IVL QN I    I+GV+ L  S K++ +L+VLN++DNT+K EG +++++ LP+   L E+  GDCLIK +G  H  + L + +  L+ + +  NEI
Sbjct:   28 WNTAADVQDVVDALNKQTT-VHYLNLDGNTLGVEAAKAIGEGLKRHPEFRKALWKNMFTGRLISEIPEALKHLGAALIVAGAKLTVLDLSDNALGPNGMRGLEELLRSPVCYSLQELLLCNCGLGPEGGSMLSRALIDLHANANKAGFPLQLRVFIGSRNRLEDAGATEMATAF--QTLKTFEEIVLEQNSI---YIEGVEALAESFKHNPHLRVLNMNDNTLKSEGAEKIAEALPFLPLLREMSFGDCLIKTNGAYHFGEALERGNERLEVIDLGFNEI 301          
BLAST of Ran GTPase-activating protein 1 vs. Ensembl Zebrafish
Match: rangap1a (RAN GTPase activating protein 1a [Source:ZFIN;Acc:ZDB-GENE-060929-492])

HSP 1 Score: 199.904 bits (507), Expect = 3.406e-55
Identity = 122/341 (35.78%), Postives = 201/341 (58.94%), Query Frame = 2
Query:  107 LSYTGLQKQWNTEEDIEHVVKDLNENVNCVTTLQLSGNTLGVNAAEKLIEPLSNQTKIQKLIWNDLFTGRLKSEISVALSSLSIGLMRAQVHLVELDLSDNAFGPNGVVGVTELLASSCCYTLKTLNMNNQGLGHQGCRQLVDALKKARINSNYKG--MNLEVFIAGRNRLENAGMEMLTEFFSDGMTSLKKIVLLQNGIGIHGIQGVDNLILSLKNHINLKVLNISDNTIKPEGVKRLSKILPYFEDLEELYLGDCLIKNSGLEHLTKVLNQMSLNLKTVSVSGNEITGHCAIKFISKIVETKHIIESIDLTENEIKKVALNEIKEILAE---HDKLDAL 1114
            LSY G   + +  + +E +VK++ E    +  L+L GNT+GV AA+ + + L N++ +Q   W+D+FTGRL++EI  AL SL   L+ A   L  LDLSDNAFGP+GV G+ +LL S+ C+TL+ L +NN G+G  G + L  AL +    S+  G    L+VFIAGRNRLEN G   L + F   M SL+++ + QNGI   G+     L  +++++  L+VLN++DNT   +G   +++ L +  +++ +  GDCL+++ G   L + + +    LK +++S  EI    A++ +++ V+ K   E +DL  N + +     +K+++      DKL +L
Sbjct:   23 LSYKGKGLKLDNAQSVEQMVKEIGE-FEGLRALRLEGNTIGVEAAQTIAKALENKSDLQCCHWSDMFTGRLRAEIPPALVSLGDALILAGARLKVLDLSDNAFGPDGVKGIEKLLKSAACHTLQELRLNNCGMGIGGGKILAAALSECHQQSSALGAPFKLKVFIAGRNRLENDGATALAQAFQL-MGSLEEVHMPQNGINYPGVTA---LATAMQHNPQLRVLNLNDNTFTKKGAMAMAQALKHLRNVQVINFGDCLVRSEGASALAETVREGLPILKELNLSFGEIMEEAALE-VAQSVQHKDQFEKLDLNGNSLGEDGCKSLKQLMESINMADKLGSL 357          
BLAST of Ran GTPase-activating protein 1 vs. Ensembl Zebrafish
Match: rangap1b (Ran GTPase activating protein 1b [Source:ZFIN;Acc:ZDB-GENE-040426-1921])

HSP 1 Score: 195.282 bits (495), Expect = 1.956e-53
Identity = 126/338 (37.28%), Postives = 198/338 (58.58%), Query Frame = 2
Query:  107 LSYTGLQKQWNTEEDIEHVVKDLNENVNCVTTLQLSGNTLGVNAAEKLIEPLSNQTKIQKLIWNDLFTGRLKSEISVALSSLSIGLMRAQVHLVELDLSDNAFGPNGVVGVTELLASSCCYTLKTLNMNNQGLGHQGCRQLVDALKKARINSNYKG--MNLEVFIAGRNRLENAGMEMLTEFFSDGMTSLKKIVLLQNGIGIHGIQGVDNLILSLKNHINLKVLNISDNTIKPEGVKRLSKILPYFEDLEELYLGDCLIKNSGLEHLTKVLNQMSLNLKTVSVSGNEITGHCAIKFISKIVETKHIIESIDLTENEIKKVALNEIKEILAEHDKLDAL 1114
            LSY G   + +  E ++ +V+D+ E    + +L+L GNTLGV AA+ + + L  + ++++  W+D+FTGRL+SEI  AL SL   LM +   L +LDLSDNAFGP+GV G+  LL SS CYTL+ L +NN G+G  G   L  AL +    S+     + L+VFIAGRNRLEN G   L + F   + SL+++ + QNGI   GI     L  +LK++ NL+VLN++DNT   +G K +++ + + + L+ +  GDCL+++ G   +   L +    L+ +++S  EI    A   ++K V+ K  +E +DL  N   +     +KE + + +  D L
Sbjct:   23 LSYKGRGLKLDNAESVKEIVEDI-ERCQGLQSLRLEGNTLGVEAADAIAKSLEAKRELEQCHWSDMFTGRLRSEIPPALKSLGNALMTSGARLTQLDLSDNAFGPDGVKGIENLLKSSACYTLQELRLNNCGMGSGGGVVLASALTECHKQSSAAASPLRLKVFIAGRNRLENDGATALAKAFKL-LGSLEEVHMPQNGINHPGITA---LAAALKHNPNLQVLNLNDNTFTTKGSKAMAEAIRHLQCLKAINFGDCLVRSEGAIAIAGALREGLHLLRELNLSFGEIC-EAAAMVVAKAVQGKADLEKLDLNGNCFGEDGCEALKEAMEKMNMEDLL 354          
BLAST of Ran GTPase-activating protein 1 vs. Ensembl Zebrafish
Match: rangap1b (Ran GTPase activating protein 1b [Source:ZFIN;Acc:ZDB-GENE-040426-1921])

HSP 1 Score: 195.282 bits (495), Expect = 2.129e-53
Identity = 126/338 (37.28%), Postives = 198/338 (58.58%), Query Frame = 2
Query:  107 LSYTGLQKQWNTEEDIEHVVKDLNENVNCVTTLQLSGNTLGVNAAEKLIEPLSNQTKIQKLIWNDLFTGRLKSEISVALSSLSIGLMRAQVHLVELDLSDNAFGPNGVVGVTELLASSCCYTLKTLNMNNQGLGHQGCRQLVDALKKARINSNYKG--MNLEVFIAGRNRLENAGMEMLTEFFSDGMTSLKKIVLLQNGIGIHGIQGVDNLILSLKNHINLKVLNISDNTIKPEGVKRLSKILPYFEDLEELYLGDCLIKNSGLEHLTKVLNQMSLNLKTVSVSGNEITGHCAIKFISKIVETKHIIESIDLTENEIKKVALNEIKEILAEHDKLDAL 1114
            LSY G   + +  E ++ +V+D+ E    + +L+L GNTLGV AA+ + + L  + ++++  W+D+FTGRL+SEI  AL SL   LM +   L +LDLSDNAFGP+GV G+  LL SS CYTL+ L +NN G+G  G   L  AL +    S+     + L+VFIAGRNRLEN G   L + F   + SL+++ + QNGI   GI     L  +LK++ NL+VLN++DNT   +G K +++ + + + L+ +  GDCL+++ G   +   L +    L+ +++S  EI    A   ++K V+ K  +E +DL  N   +     +KE + + +  D L
Sbjct:   23 LSYKGRGLKLDNAESVKEIVEDI-ERCQGLQSLRLEGNTLGVEAADAIAKSLEAKRELEQCHWSDMFTGRLRSEIPPALKSLGNALMTSGARLTQLDLSDNAFGPDGVKGIENLLKSSACYTLQELRLNNCGMGSGGGVVLASALTECHKQSSAAASPLRLKVFIAGRNRLENDGATALAKAFKL-LGSLEEVHMPQNGINHPGITA---LAAALKHNPNLQVLNLNDNTFTTKGSKAMAEAIRHLQCLKAINFGDCLVRSEGAIAIAGALREGLHLLRELNLSFGEIC-EAAAMVVAKAVQGKADLEKLDLNGNCFGEDGCEALKEAMEKMNMEDLL 354          
BLAST of Ran GTPase-activating protein 1 vs. Ensembl Zebrafish
Match: rangap1b (Ran GTPase activating protein 1b [Source:ZFIN;Acc:ZDB-GENE-040426-1921])

HSP 1 Score: 159.073 bits (401), Expect = 6.459e-44
Identity = 94/220 (42.73%), Postives = 135/220 (61.36%), Query Frame = 2
Query:  107 LSYTGLQKQWNTEEDIEHVVKDLNENVNCVTTLQLSGNTLGVNAAEKLIEPLSNQTKIQKLIWNDLFTGRLKSEISVALSSLSIGLMRAQVHLVELDLSDNAFGPNGVVGVTELLASSCCYTLKTLNMNNQGLGHQGCRQLVDALKKARINSNYKG--MNLEVFIAGRNRLENAGMEMLTEFFSDGMTSLKKIVLLQNGIGIHGIQGVDNLILSLKNHIN 760
            LSY G   + +  E ++ +V+D+ E    + +L+L GNTLGV AA+ + + L  + ++++  W+D+FTGRL+SEI  AL SL   LM +   L +LDLSDNAFGP+GV G+  LL SS CYTL+ L +NN G+G  G   L  AL +    S+     + L+VFIAGRNRLEN G   L + F   + SL+++ + QNGI   GI     L  +LK++ N
Sbjct:   23 LSYKGRGLKLDNAESVKEIVEDI-ERCQGLQSLRLEGNTLGVEAADAIAKSLEAKRELEQCHWSDMFTGRLRSEIPPALKSLGNALMTSGARLTQLDLSDNAFGPDGVKGIENLLKSSACYTLQELRLNNCGMGSGGGVVLASALTECHKQSSAAASPLRLKVFIAGRNRLENDGATALAKAFKL-LGSLEEVHMPQNGINHPGITA---LAAALKHNPN 237          
BLAST of Ran GTPase-activating protein 1 vs. Ensembl Zebrafish
Match: si:ch211-156p11.1 (si:ch211-156p11.1 [Source:ZFIN;Acc:ZDB-GENE-070912-120])

HSP 1 Score: 78.9518 bits (193), Expect = 1.675e-14
Identity = 94/358 (26.26%), Postives = 170/358 (47.49%), Query Frame = 2
Query:  140 TEEDIEHVVKDLNENVNCVTTLQLSGNTLGVNAAEKLIEPLSNQTKIQKLIWNDLFTGRLKSEISVA---LSSLSIGLMRAQVHLVELDLSDNAFGPNGVVGVTELLASSCCYTLKTLNMNNQGLGHQGCRQLVDALKKARINSNYKGMNLEVFIAGRNRLENAGMEMLTEFFSDGMTSLKKIVLLQNGIGIHGIQGVDNLILSLKNHINLKVLNISDNTIKPEGVKRLSKILPYFEDLEELYLGDCLIKNSGLEHLTKVLNQMSLNLKTVSVSGN--------EITG-----HCAIK--------------FISKIV-ETKHIIESIDLTENEIKKVALNEIKEILAE-HDKLDALV 1117
            TEE    +   L  + + +  L LS N L  +  ++L + L  ++K++KL +         SE S++     +L+  L     HL+ELDL  N  G +GV  +T+LL    C TLKTL+++N  +  +    L  ALK     S+ + +NL       N++ N G+ ++ +   D    LK++ L +  +       + +++ S  +  +LK L++S+N ++  GVK LS  L   + LE+L L DC I   G + L   L     +L  + + GN        E+T      HC +K              F++ +V E   +++ ++L+E E+    +N++  +L + H +L+ L+
Sbjct:  883 TEESCSALALVLRSDSSSLKDLDLSNNNLQDSGVKRLSDVLK-ESKLEKLGF---------SECSISEEGYKALASALRSNPSHLIELDLRGNDPGQSGVKELTDLLQDPHC-TLKTLSLHNCSITEEHGENLTSALKSNP--SHLRELNL-----SGNQIRNTGVNLVCDVLKDSGCRLKRLRLSKCDLTEESCSALASVLRS--DSSSLKDLDLSNNNLQDSGVKLLSDELKDSK-LEKLSLSDCSISEEGYKALASALRSNPSHLIELDLRGNDPGQSGVKELTDLLQDPHCTLKTLRFLSPAADEFCQFVTGVVGENPLLLKELNLSERELGDTRVNQLSALLQDKHCRLNTLM 1219          

HSP 2 Score: 60.8474 bits (146), Expect = 6.859e-9
Identity = 89/305 (29.18%), Postives = 141/305 (46.23%), Query Frame = 2
Query:  140 TEEDIEHVVKDLNENVNCVTTLQLSGNTLGVNAAEKLIEPLSNQTKIQKLIWNDLFTGRLKSEISVALSSLSIGLMRAQVHLVELDLSDNAFGPNGVVGVTELLASSCCYTLKTLNMNNQGLGHQGCRQLVDALKKARINSN---YKGMNLEVFIAGRNRLENAGMEMLTEFFSDGMTSLKKIVLLQNGIGIHGIQGVDNLILSLKNHINLKVLNISDNTIKPEGVKRLSKIL--PYFEDLEELYLGDCLIKNSGLEHLTKVLNQMSLNLKTVSVSGNEITGHCAIKFISK-IVETKHIIESIDL 1036
            TEE    +   L  + + +  L LS N L  +  + L + L + +K++KL  +D     +  E   AL+S    L     HL+ELDL  N  GP+GV  +T+LL    C TL TL   +     +GC Q V  +    +  N    K +NL     G  R     +  L+    D   +L  ++L    I   G   V + + S  +H  L+ LN+ +N +   GVK LS +L  P F+ L+ L L +C I     E LT  L     NL+ +++S N + G   +K ++  ++ET+  +E + L
Sbjct: 1397 TEESCSALASVLRSDSSSLKNLDLSNNNLQDSGVKLLSDGLKD-SKLEKLSLSDC---SISEEGYKALAS---ALRSNPSHLIELDLRGNDPGPSGVKELTDLLQDPHC-TLNTLRFLSPA-ADEGC-QFVTGI----VGENPLLLKELNLSDRELGDTR-----VNQLSALLQDKHCTLNTLMLSSCKITDEGYSAVTSALKSNPSH--LRELNLRENKLGGFGVKNLSDLLMKPQFK-LKILDLYNCSITEEQCEILTSALKSNPTNLRELNLSWNNL-GDSGVKNLNNLLMETQFKLEKLHL 1678          
BLAST of Ran GTPase-activating protein 1 vs. Ensembl Xenopus
Match: tcf7l1 (transcription factor 7 like 1 [Source:Xenbase;Acc:XB-GENE-1031985])

HSP 1 Score: 195.282 bits (495), Expect = 3.107e-53
Identity = 121/329 (36.78%), Postives = 195/329 (59.27%), Query Frame = 2
Query:  107 LSYTGLQKQWNTEEDIEHVVKDLNENVNCVTTLQLSGNTLGVNAAEKLIEPLSNQTKIQKLIWNDLFTGRLKSEISVALSSLSIGLMRAQVHLVELDLSDNAFGPNGVVGVTELLASSCCYTLKTLNMNNQGLGHQGCRQLVDALKKA--RINSNYKGMNLEVFIAGRNRLENAGMEMLTEFFSDGMTSLKKIVLLQNGIGIHGIQGVDNLILSLKNHINLKVLNISDNTIKPEGVKRLSKILPYFEDLEELYLGDCLIKNSGLEHLTKVLNQMSLNLKTVSVSGNEITGHCAIKFISKIVETKHIIESIDLTENEIKKVALNEIKEIL 1087
            LS+ G   + NT +D E V++++ E+   +  L+L GNT+G+ AA+ + + L  +  +++  W+D+FTGRL+SEI  +L SL   L+ A   L ELDLSDNAFGP+GV G   LL S  C+TL+ L +NN G+G  G + L  AL +   + +S+ K + L+VFIAGRNRLEN G   L E F   + +L+++ + QNGI   GI     L  S K +  LKV+N++DNT   +G   +++ L     +E +  GDCL+++ G + +   L +    LK +++S  EI    A+  +++ VE +  ++ +DL  N + +    +++EIL
Sbjct:   40 LSFKGKSLKLNTAQDAEEVIREI-EDFEGLHALRLEGNTVGLEAAKAIAKVLEKKPDLKRCHWSDMFTGRLRSEIPPSLISLGDALITAGAQLTELDLSDNAFGPDGVRGFEALLKSPACFTLQELKLNNCGMGIGGGKILAAALTECYKKSSSHGKPLALKVFIAGRNRLENDGATALAEAFRL-IGTLEEVHMPQNGINHAGITA---LAESFKANSLLKVINLNDNTFTEKGGIAMAEALKTLRQVEVINFGDCLVRSKGAQAIATALKEGLHKLKELNLSFCEIKRDAAV-VLAESVEDRSELQKLDLNGNCLGEGGCEQVQEIL 362          
BLAST of Ran GTPase-activating protein 1 vs. Ensembl Xenopus
Match: tcf7l1 (transcription factor 7 like 1 [Source:Xenbase;Acc:XB-GENE-1031985])

HSP 1 Score: 194.897 bits (494), Expect = 4.373e-53
Identity = 121/329 (36.78%), Postives = 195/329 (59.27%), Query Frame = 2
Query:  107 LSYTGLQKQWNTEEDIEHVVKDLNENVNCVTTLQLSGNTLGVNAAEKLIEPLSNQTKIQKLIWNDLFTGRLKSEISVALSSLSIGLMRAQVHLVELDLSDNAFGPNGVVGVTELLASSCCYTLKTLNMNNQGLGHQGCRQLVDALKKA--RINSNYKGMNLEVFIAGRNRLENAGMEMLTEFFSDGMTSLKKIVLLQNGIGIHGIQGVDNLILSLKNHINLKVLNISDNTIKPEGVKRLSKILPYFEDLEELYLGDCLIKNSGLEHLTKVLNQMSLNLKTVSVSGNEITGHCAIKFISKIVETKHIIESIDLTENEIKKVALNEIKEIL 1087
            LS+ G   + NT +D E V++++ E+   +  L+L GNT+G+ AA+ + + L  +  +++  W+D+FTGRL+SEI  +L SL   L+ A   L ELDLSDNAFGP+GV G   LL S  C+TL+ L +NN G+G  G + L  AL +   + +S+ K + L+VFIAGRNRLEN G   L E F   + +L+++ + QNGI   GI     L  S K +  LKV+N++DNT   +G   +++ L     +E +  GDCL+++ G + +   L +    LK +++S  EI    A+  +++ VE +  ++ +DL  N + +    +++EIL
Sbjct:   24 LSFKGKSLKLNTAQDAEEVIREI-EDFEGLHALRLEGNTVGLEAAKAIAKVLEKKPDLKRCHWSDMFTGRLRSEIPPSLISLGDALITAGAQLTELDLSDNAFGPDGVRGFEALLKSPACFTLQELKLNNCGMGIGGGKILAAALTECYKKSSSHGKPLALKVFIAGRNRLENDGATALAEAFRL-IGTLEEVHMPQNGINHAGITA---LAESFKANSLLKVINLNDNTFTEKGGIAMAEALKTLRQVEVINFGDCLVRSKGAQAIATALKEGLHKLKELNLSFCEIKRDAAV-VLAESVEDRSELQKLDLNGNCLGEGGCEQVQEIL 346          
BLAST of Ran GTPase-activating protein 1 vs. Ensembl Xenopus
Match: tcf7l1 (transcription factor 7 like 1 [Source:Xenbase;Acc:XB-GENE-1031985])

HSP 1 Score: 194.126 bits (492), Expect = 4.963e-53
Identity = 121/329 (36.78%), Postives = 195/329 (59.27%), Query Frame = 2
Query:  107 LSYTGLQKQWNTEEDIEHVVKDLNENVNCVTTLQLSGNTLGVNAAEKLIEPLSNQTKIQKLIWNDLFTGRLKSEISVALSSLSIGLMRAQVHLVELDLSDNAFGPNGVVGVTELLASSCCYTLKTLNMNNQGLGHQGCRQLVDALKKA--RINSNYKGMNLEVFIAGRNRLENAGMEMLTEFFSDGMTSLKKIVLLQNGIGIHGIQGVDNLILSLKNHINLKVLNISDNTIKPEGVKRLSKILPYFEDLEELYLGDCLIKNSGLEHLTKVLNQMSLNLKTVSVSGNEITGHCAIKFISKIVETKHIIESIDLTENEIKKVALNEIKEIL 1087
            LS+ G   + NT +D E V++++ E+   +  L+L GNT+G+ AA+ + + L  +  +++  W+D+FTGRL+SEI  +L SL   L+ A   L ELDLSDNAFGP+GV G   LL S  C+TL+ L +NN G+G  G + L  AL +   + +S+ K + L+VFIAGRNRLEN G   L E F   + +L+++ + QNGI   GI     L  S K +  LKV+N++DNT   +G   +++ L     +E +  GDCL+++ G + +   L +    LK +++S  EI    A+  +++ VE +  ++ +DL  N + +    +++EIL
Sbjct:   24 LSFKGKSLKLNTAQDAEEVIREI-EDFEGLHALRLEGNTVGLEAAKAIAKVLEKKPDLKRCHWSDMFTGRLRSEIPPSLISLGDALITAGAQLTELDLSDNAFGPDGVRGFEALLKSPACFTLQELKLNNCGMGIGGGKILAAALTECYKKSSSHGKPLALKVFIAGRNRLENDGATALAEAFRL-IGTLEEVHMPQNGINHAGITA---LAESFKANSLLKVINLNDNTFTEKGGIAMAEALKTLRQVEVINFGDCLVRSKGAQAIATALKEGLHKLKELNLSFCEIKRDAAV-VLAESVEDRSELQKLDLNGNCLGEGGCEQVQEIL 346          
BLAST of Ran GTPase-activating protein 1 vs. Ensembl Xenopus
Match: tcf7l1 (transcription factor 7 like 1 [Source:Xenbase;Acc:XB-GENE-1031985])

HSP 1 Score: 189.504 bits (480), Expect = 1.835e-51
Identity = 117/312 (37.50%), Postives = 186/312 (59.62%), Query Frame = 2
Query:  107 LSYTGLQKQWNTEEDIEHVVKDLNENVNCVTTLQLSGNTLGVNAAEKLIEPLSNQTKIQKLIWNDLFTGRLKSEISVALSSLSIGLMRAQVHLVELDLSDNAFGPNGVVGVTELLASSCCYTLKTLNMNNQGLGHQGCRQLVDALKKA--RINSNYKGMNLEVFIAGRNRLENAGMEMLTEFFSDGMTSLKKIVLLQNGIGIHGIQGVDNLILSLKNHINLKVLNISDNTIKPEGVKRLSKILPYFEDLEELYLGDCLIKNSGLEHLTKVLNQMSLNLKTVSVSGNEITGHCAIKFISKIVETKHIIESIDL 1036
            LS+ G   + NT +D E V++++ E+   +  L+L GNT+G+ AA+ + + L  +  +++  W+D+FTGRL+SEI  +L SL   L+ A   L ELDLSDNAFGP+GV G   LL S  C+TL+ L +NN G+G  G + L  AL +   + +S+ K + L+VFIAGRNRLEN G   L E F   + +L+++ + QNGI   GI     L  S K +  LKV+N++DNT   +G   +++ L     +E +  GDCL+++ G + +   L +    LK +++S  EI    A+  +++ VE +  ++ +DL
Sbjct:   24 LSFKGKSLKLNTAQDAEEVIREI-EDFEGLHALRLEGNTVGLEAAKAIAKVLEKKPDLKRCHWSDMFTGRLRSEIPPSLISLGDALITAGAQLTELDLSDNAFGPDGVRGFEALLKSPACFTLQELKLNNCGMGIGGGKILAAALTECYKKSSSHGKPLALKVFIAGRNRLENDGATALAEAFRL-IGTLEEVHMPQNGINHAGITA---LAESFKANSLLKVINLNDNTFTEKGGIAMAEALKTLRQVEVINFGDCLVRSKGAQAIATALKEGLHKLKELNLSFCEIKRDAAV-VLAESVEDRSELQKLDL 329          
BLAST of Ran GTPase-activating protein 1 vs. Ensembl Xenopus
Match: tcf7l1 (transcription factor 7 like 1 [Source:Xenbase;Acc:XB-GENE-1031985])

HSP 1 Score: 107.842 bits (268), Expect = 3.704e-24
Identity = 66/193 (34.20%), Postives = 106/193 (54.92%), Query Frame = 2
Query:  107 LSYTGLQKQWNTEEDIEHVVKDLNENVNCVTTLQLSGNTLGVNAAEKLIEPLSNQTKIQKLIWNDLFTGRLKSEISVALSSLSIGLMRAQVHLVELDLSDNAFGPNGVVGVTELLASSCCYTLKTLNMNNQGLGHQGCRQLVDALKKARINSNYKGMNLEVFIAGRNRLENAGMEMLTEFFSDGMTSLKKIVL 685
            LS+ G   + NT +D E V++++ E+   +  L+L GNT+G+ AA+ + + L  +  +++  W+D+FTGRL+SEI  +L SL   L+ A   L ELDLSDNAFGP+GV G   LL S        +N+N+     +G   + +ALK  R         +EV   G   + + G + +     +G+  LK++ L
Sbjct:   24 LSFKGKSLKLNTAQDAEEVIREI-EDFEGLHALRLEGNTVGLEAAKAIAKVLEKKPDLKRCHWSDMFTGRLRSEIPPSLISLGDALITAGAQLTELDLSDNAFGPDGVRGFEALLKSPAL-----INLNDNTFTEKGGIAMAEALKTLR--------QVEVINFGDCLVRSKGAQAIATALKEGLHKLKELNL 202          
BLAST of Ran GTPase-activating protein 1 vs. Ensembl Mouse
Match: Rangap1 (RAN GTPase activating protein 1 [Source:MGI Symbol;Acc:MGI:103071])

HSP 1 Score: 189.504 bits (480), Expect = 3.363e-51
Identity = 120/329 (36.47%), Postives = 192/329 (58.36%), Query Frame = 2
Query:  107 LSYTGLQKQWNTEEDIEHVVKDLNENVNCVTTLQLSGNTLGVNAAEKLIEPLSNQTKIQKLIWNDLFTGRLKSEISVALSSLSIGLMRAQVHLVELDLSDNAFGPNGVVGVTELLASSCCYTLKTLNMNNQGLGHQGCRQLVDALKKARINSNYKG--MNLEVFIAGRNRLENAGMEMLTEFFSDGMTSLKKIVLLQNGIGIHGIQGVDNLILSLKNHINLKVLNISDNTIKPEGVKRLSKILPYFEDLEELYLGDCLIKNSGLEHLTKVLNQMSLNLKTVSVSGNEITGHCAIKFISKIVETKHIIESIDLTENEIKKVALNEIKEIL 1087
            LS+ G   + NT ED + V+K++ E  + +  L+L GNT+GV AA  + + L  ++++++  W+D+FTGRL+SEI  AL SL  GL+ A   LVELDLSDNAFGP+GV G   LL S  C+TL+ L +NN G+G  G + L  AL +    S+ +G  + L+VF+AGRNRLEN G   L E F   + +L+++ + QNGI  H   GV  L  +   +  L+V+N++DNT   +G   +++ L     +E +  GDCL+++ G   +   +      LK +++S  EI    A+     + + K  +E +DL  N + +    +++E++
Sbjct:   23 LSFKGKGLKLNTAEDAKDVIKEIEE-FDGLEALRLEGNTVGVEAARVIAKALEKKSELKRCHWSDMFTGRLRSEIPPALISLGEGLITAGAQLVELDLSDNAFGPDGVRGFEALLKSPACFTLQELKLNNCGMGIGGGKILAAALTECHRKSSAQGKPLALKVFVAGRNRLENDGATALAEAFGI-IGTLEEVHMPQNGIN-H--PGVTALAQAFAINPLLRVINLNDNTFTEKGGVAMAETLKTLRQVEVINFGDCLVRSKGAVAIADAVRGGLPKLKELNLSFCEIKRDAALVVAEAVAD-KAELEKLDLNGNALGEEGCEQLQEVM 345          
BLAST of Ran GTPase-activating protein 1 vs. Ensembl Mouse
Match: Rangap1 (RAN GTPase activating protein 1 [Source:MGI Symbol;Acc:MGI:103071])

HSP 1 Score: 189.504 bits (480), Expect = 3.363e-51
Identity = 120/329 (36.47%), Postives = 192/329 (58.36%), Query Frame = 2
Query:  107 LSYTGLQKQWNTEEDIEHVVKDLNENVNCVTTLQLSGNTLGVNAAEKLIEPLSNQTKIQKLIWNDLFTGRLKSEISVALSSLSIGLMRAQVHLVELDLSDNAFGPNGVVGVTELLASSCCYTLKTLNMNNQGLGHQGCRQLVDALKKARINSNYKG--MNLEVFIAGRNRLENAGMEMLTEFFSDGMTSLKKIVLLQNGIGIHGIQGVDNLILSLKNHINLKVLNISDNTIKPEGVKRLSKILPYFEDLEELYLGDCLIKNSGLEHLTKVLNQMSLNLKTVSVSGNEITGHCAIKFISKIVETKHIIESIDLTENEIKKVALNEIKEIL 1087
            LS+ G   + NT ED + V+K++ E  + +  L+L GNT+GV AA  + + L  ++++++  W+D+FTGRL+SEI  AL SL  GL+ A   LVELDLSDNAFGP+GV G   LL S  C+TL+ L +NN G+G  G + L  AL +    S+ +G  + L+VF+AGRNRLEN G   L E F   + +L+++ + QNGI  H   GV  L  +   +  L+V+N++DNT   +G   +++ L     +E +  GDCL+++ G   +   +      LK +++S  EI    A+     + + K  +E +DL  N + +    +++E++
Sbjct:   23 LSFKGKGLKLNTAEDAKDVIKEIEE-FDGLEALRLEGNTVGVEAARVIAKALEKKSELKRCHWSDMFTGRLRSEIPPALISLGEGLITAGAQLVELDLSDNAFGPDGVRGFEALLKSPACFTLQELKLNNCGMGIGGGKILAAALTECHRKSSAQGKPLALKVFVAGRNRLENDGATALAEAFGI-IGTLEEVHMPQNGIN-H--PGVTALAQAFAINPLLRVINLNDNTFTEKGGVAMAETLKTLRQVEVINFGDCLVRSKGAVAIADAVRGGLPKLKELNLSFCEIKRDAALVVAEAVAD-KAELEKLDLNGNALGEEGCEQLQEVM 345          
BLAST of Ran GTPase-activating protein 1 vs. Ensembl Mouse
Match: Rangap1 (RAN GTPase activating protein 1 [Source:MGI Symbol;Acc:MGI:103071])

HSP 1 Score: 189.504 bits (480), Expect = 3.363e-51
Identity = 120/329 (36.47%), Postives = 192/329 (58.36%), Query Frame = 2
Query:  107 LSYTGLQKQWNTEEDIEHVVKDLNENVNCVTTLQLSGNTLGVNAAEKLIEPLSNQTKIQKLIWNDLFTGRLKSEISVALSSLSIGLMRAQVHLVELDLSDNAFGPNGVVGVTELLASSCCYTLKTLNMNNQGLGHQGCRQLVDALKKARINSNYKG--MNLEVFIAGRNRLENAGMEMLTEFFSDGMTSLKKIVLLQNGIGIHGIQGVDNLILSLKNHINLKVLNISDNTIKPEGVKRLSKILPYFEDLEELYLGDCLIKNSGLEHLTKVLNQMSLNLKTVSVSGNEITGHCAIKFISKIVETKHIIESIDLTENEIKKVALNEIKEIL 1087
            LS+ G   + NT ED + V+K++ E  + +  L+L GNT+GV AA  + + L  ++++++  W+D+FTGRL+SEI  AL SL  GL+ A   LVELDLSDNAFGP+GV G   LL S  C+TL+ L +NN G+G  G + L  AL +    S+ +G  + L+VF+AGRNRLEN G   L E F   + +L+++ + QNGI  H   GV  L  +   +  L+V+N++DNT   +G   +++ L     +E +  GDCL+++ G   +   +      LK +++S  EI    A+     + + K  +E +DL  N + +    +++E++
Sbjct:   23 LSFKGKGLKLNTAEDAKDVIKEIEE-FDGLEALRLEGNTVGVEAARVIAKALEKKSELKRCHWSDMFTGRLRSEIPPALISLGEGLITAGAQLVELDLSDNAFGPDGVRGFEALLKSPACFTLQELKLNNCGMGIGGGKILAAALTECHRKSSAQGKPLALKVFVAGRNRLENDGATALAEAFGI-IGTLEEVHMPQNGIN-H--PGVTALAQAFAINPLLRVINLNDNTFTEKGGVAMAETLKTLRQVEVINFGDCLVRSKGAVAIADAVRGGLPKLKELNLSFCEIKRDAALVVAEAVAD-KAELEKLDLNGNALGEEGCEQLQEVM 345          
BLAST of Ran GTPase-activating protein 1 vs. Ensembl Mouse
Match: Rangap1 (RAN GTPase activating protein 1 [Source:MGI Symbol;Acc:MGI:103071])

HSP 1 Score: 170.244 bits (430), Expect = 1.233e-47
Identity = 101/235 (42.98%), Postives = 148/235 (62.98%), Query Frame = 2
Query:  107 LSYTGLQKQWNTEEDIEHVVKDLNENVNCVTTLQLSGNTLGVNAAEKLIEPLSNQTKIQKLIWNDLFTGRLKSEISVALSSLSIGLMRAQVHLVELDLSDNAFGPNGVVGVTELLASSCCYTLKTLNMNNQGLGHQGCRQLVDALKKARINSNYKG--MNLEVFIAGRNRLENAGMEMLTEFFSDGMTSLKKIVLLQNGIGIHGIQGVDNLILSLKNHINLKVLNISDNTIKPEG 805
            LS+ G   + NT ED + V+K++ E  + +  L+L GNT+GV AA  + + L  ++++++  W+D+FTGRL+SEI  AL SL  GL+ A   LVELDLSDNAFGP+GV G   LL S  C+TL+ L +NN G+G  G + L  AL +    S+ +G  + L+VF+AGRNRLEN G   L E F   + +L+++ + QNGI  H   GV  L  +   +  L+V+N++DNT   +G
Sbjct:   23 LSFKGKGLKLNTAEDAKDVIKEIEE-FDGLEALRLEGNTVGVEAARVIAKALEKKSELKRCHWSDMFTGRLRSEIPPALISLGEGLITAGAQLVELDLSDNAFGPDGVRGFEALLKSPACFTLQELKLNNCGMGIGGGKILAAALTECHRKSSAQGKPLALKVFVAGRNRLENDGATALAEAFGI-IGTLEEVHMPQNGIN-H--PGVTALAQAFAINPLLRVINLNDNTFTEKG 252          
BLAST of Ran GTPase-activating protein 1 vs. Ensembl Mouse
Match: Rangap1 (RAN GTPase activating protein 1 [Source:MGI Symbol;Acc:MGI:103071])

HSP 1 Score: 117.087 bits (292), Expect = 4.066e-30
Identity = 59/123 (47.97%), Postives = 83/123 (67.48%), Query Frame = 2
Query:  107 LSYTGLQKQWNTEEDIEHVVKDLNENVNCVTTLQLSGNTLGVNAAEKLIEPLSNQTKIQKLIWNDLFTGRLKSEISVALSSLSIGLMRAQVHLVELDLSDNAFGPNGVVGVTELLASSCCYTL 475
            LS+ G   + NT ED + V+K++ E  + +  L+L GNT+GV AA  + + L  ++++++  W+D+FTGRL+SEI  AL SL  GL+ A   LVELDLSDNAFGP+GV G   LL S  C+TL
Sbjct:   23 LSFKGKGLKLNTAEDAKDVIKEIEE-FDGLEALRLEGNTVGVEAARVIAKALEKKSELKRCHWSDMFTGRLRSEIPPALISLGEGLITAGAQLVELDLSDNAFGPDGVRGFEALLKSPACFTL 144          
BLAST of Ran GTPase-activating protein 1 vs. UniProt/SwissProt
Match: sp|Q9VIW3|RAGP1_DROME (Ran GTPase-activating protein OS=Drosophila melanogaster OX=7227 GN=RanGAP PE=1 SV=1)

HSP 1 Score: 206.838 bits (525), Expect = 1.455e-56
Identity = 122/280 (43.57%), Postives = 169/280 (60.36%), Query Frame = 2
Query:  134 WNTEEDIEHVVKDLNENVNCVTTLQLSGNTLGVNAAEKLIEPLSNQTKIQKLIWNDLFTGRLKSEISVALSSLSIGLMRAQVHLVELDLSDNAFGPNGVVGVTELLASSCCYTLKTLNMNNQGLGHQGCRQLVDALKKARINSNYKG--MNLEVFIAGRNRLENAGM-EMLTEFFSDGMTSLKKIVLLQNGIGIHGIQGVDNLILSLKNHINLKVLNISDNTIKPEGVKRLSKILPYFEDLEELYLGDCLIKNSGLEHLTKVLNQMSLNLKTVSVSGNEI 964
            WNT  D++ VV  LN+    V  L L GNTLGV AA+ + E L    + +K +W ++FTGRL SEI  AL  L   L+ A   L  LDLSDNA GPNG+ G+ ELL S  CY+L+ L + N GLG +G   L  AL     N+N  G  + L VFI  RNRLE+AG  EM T F    + + ++IVL QN I    I+GV+ L  S K++ +L+VLN++DNT+K EG +++++ LP+   L E+  GDCLIK +G  H  + L + +  L+ + +  NEI
Sbjct:   28 WNTAADVQDVVDALNKQTT-VHYLNLDGNTLGVEAAKAIGEGLKRHPEFRKALWKNMFTGRLISEIPEALKHLGAALIVAGAKLTVLDLSDNALGPNGMRGLEELLRSPVCYSLQELLLCNCGLGPEGGSMLSRALIDLHANANKAGFPLQLRVFIGSRNRLEDAGATEMATAF--QTLKTFEEIVLEQNSI---YIEGVEALAESFKHNPHLRVLNMNDNTLKSEGAEKIAEALPFLPLLREMSFGDCLIKTNGAYHFGEALERGNERLEVIDLGFNEI 301          
BLAST of Ran GTPase-activating protein 1 vs. UniProt/SwissProt
Match: sp|O13066|RAGP1_XENLA (Ran GTPase-activating protein 1 OS=Xenopus laevis OX=8355 GN=rangap1 PE=1 SV=1)

HSP 1 Score: 203.371 bits (516), Expect = 2.285e-55
Identity = 125/329 (37.99%), Postives = 192/329 (58.36%), Query Frame = 2
Query:  107 LSYTGLQKQWNTEEDIEHVVKDLNENVNCVTTLQLSGNTLGVNAAEKLIEPLSNQTKIQKLIWNDLFTGRLKSEISVALSSLSIGLMRAQVHLVELDLSDNAFGPNGVVGVTELLASSCCYTLKTLNMNNQGLGHQGCRQLVDALKKARINSNYKG--MNLEVFIAGRNRLENAGMEMLTEFFSDGMTSLKKIVLLQNGIGIHGIQGVDNLILSLKNHINLKVLNISDNTIKPEGVKRLSKILPYFEDLEELYLGDCLIKNSGLEHLTKVLNQMSLNLKTVSVSGNEITGHCAIKFISKIVETKHIIESIDLTENEIKKVALNEIKEIL 1087
            LS+ G   + NT +D E V++++ E    +  L+L GNT+GV AA+ + E L  +  +++  W+D+FTGRL+ EI  AL SL   L+ A   L ELDLSDNAFGP+GV G   LL S  C+TL+ L +NN G+G  G + L  AL +    S+  G  + L+VFIAGRNRLEN G   L+E F   + +L+++ + QNGI   GI     L  S K +  LKV+N++DNT   +G   +++ L     +E +  GDCL+++ G + +   L +    LK +++S  EI    A+  +++ VE K  +E +DL  N + +    +++EIL
Sbjct:   23 LSFKGKTLKLNTAQDAEEVIREIEE-YEGLQALRLEGNTVGVEAAKAIAEVLQRKPDLKRCHWSDMFTGRLRPEIPTALRSLGDALITAGAQLTELDLSDNAFGPDGVRGFEALLKSPTCFTLQELKLNNCGMGIGGGKILAAALTECHKKSSAHGKPLALKVFIAGRNRLENDGATALSEAFRL-IGTLEEVHMPQNGINHAGITA---LAESFKANSLLKVINLNDNTFTEKGGVAMAEALKTLRQVEVINFGDCLVRSKGAQAIASALKEGLHKLKDLNLSYCEIKADAAVS-LAESVEDKSDLEKLDLNGNCLGEEGCEQVQEIL 345          
BLAST of Ran GTPase-activating protein 1 vs. UniProt/SwissProt
Match: sp|P46060|RAGP1_HUMAN (Ran GTPase-activating protein 1 OS=Homo sapiens OX=9606 GN=RANGAP1 PE=1 SV=1)

HSP 1 Score: 194.512 bits (493), Expect = 3.745e-52
Identity = 120/329 (36.47%), Postives = 193/329 (58.66%), Query Frame = 2
Query:  107 LSYTGLQKQWNTEEDIEHVVKDLNENVNCVTTLQLSGNTLGVNAAEKLIEPLSNQTKIQKLIWNDLFTGRLKSEISVALSSLSIGLMRAQVHLVELDLSDNAFGPNGVVGVTELLASSCCYTLKTLNMNNQGLGHQGCRQLVDALKKARINSNYKG--MNLEVFIAGRNRLENAGMEMLTEFFSDGMTSLKKIVLLQNGIGIHGIQGVDNLILSLKNHINLKVLNISDNTIKPEGVKRLSKILPYFEDLEELYLGDCLIKNSGLEHLTKVLNQMSLNLKTVSVSGNEITGHCAIKFISKIVETKHIIESIDLTENEIKKVALNEIKEIL 1087
            LS+ G   + NT ED + V+K++ E+ + +  L+L GNT+GV AA  + + L  ++++++  W+D+FTGRL++EI  AL SL  GL+ A   LVELDLSDNAFGP+GV G   LL SS C+TL+ L +NN G+G  G + L  AL +    S+ +G  + L+VF+AGRNRLEN G   L E F   + +L+++ + QNGI   GI     L  +   +  L+V+N++DNT   +G   +++ L     +E +  GDCL+++ G   +   +      LK +++S  EI    A+     + + K  +E +DL  N + +    +++E+L
Sbjct:   23 LSFKGKSLKLNTAEDAKDVIKEI-EDFDSLEALRLEGNTVGVEAARVIAKALEKKSELKRCHWSDMFTGRLRTEIPPALISLGEGLITAGAQLVELDLSDNAFGPDGVQGFEALLKSSACFTLQELKLNNCGMGIGGGKILAAALTECHRKSSAQGKPLALKVFVAGRNRLENDGATALAEAFRV-IGTLEEVHMPQNGINHPGITA---LAQAFAVNPLLRVINLNDNTFTEKGAVAMAETLKTLRQVEVINFGDCLVRSKGAVAIADAIRGGLPKLKELNLSFCEIKRDAALAVAEAMAD-KAELEKLDLNGNTLGEEGCEQLQEVL 345          
BLAST of Ran GTPase-activating protein 1 vs. UniProt/SwissProt
Match: sp|P46061|RAGP1_MOUSE (Ran GTPase-activating protein 1 OS=Mus musculus OX=10090 GN=Rangap1 PE=1 SV=2)

HSP 1 Score: 189.504 bits (480), Expect = 2.352e-50
Identity = 120/329 (36.47%), Postives = 192/329 (58.36%), Query Frame = 2
Query:  107 LSYTGLQKQWNTEEDIEHVVKDLNENVNCVTTLQLSGNTLGVNAAEKLIEPLSNQTKIQKLIWNDLFTGRLKSEISVALSSLSIGLMRAQVHLVELDLSDNAFGPNGVVGVTELLASSCCYTLKTLNMNNQGLGHQGCRQLVDALKKARINSNYKG--MNLEVFIAGRNRLENAGMEMLTEFFSDGMTSLKKIVLLQNGIGIHGIQGVDNLILSLKNHINLKVLNISDNTIKPEGVKRLSKILPYFEDLEELYLGDCLIKNSGLEHLTKVLNQMSLNLKTVSVSGNEITGHCAIKFISKIVETKHIIESIDLTENEIKKVALNEIKEIL 1087
            LS+ G   + NT ED + V+K++ E  + +  L+L GNT+GV AA  + + L  ++++++  W+D+FTGRL+SEI  AL SL  GL+ A   LVELDLSDNAFGP+GV G   LL S  C+TL+ L +NN G+G  G + L  AL +    S+ +G  + L+VF+AGRNRLEN G   L E F   + +L+++ + QNGI  H   GV  L  +   +  L+V+N++DNT   +G   +++ L     +E +  GDCL+++ G   +   +      LK +++S  EI    A+     + + K  +E +DL  N + +    +++E++
Sbjct:   23 LSFKGKGLKLNTAEDAKDVIKEIEE-FDGLEALRLEGNTVGVEAARVIAKALEKKSELKRCHWSDMFTGRLRSEIPPALISLGEGLITAGAQLVELDLSDNAFGPDGVRGFEALLKSPACFTLQELKLNNCGMGIGGGKILAAALTECHRKSSAQGKPLALKVFVAGRNRLENDGATALAEAFGI-IGTLEEVHMPQNGIN-H--PGVTALAQAFAINPLLRVINLNDNTFTEKGGVAMAETLKTLRQVEVINFGDCLVRSKGAVAIADAVRGGLPKLKELNLSFCEIKRDAALVVAEAVAD-KAELEKLDLNGNALGEEGCEQLQEVM 345          
BLAST of Ran GTPase-activating protein 1 vs. UniProt/SwissProt
Match: sp|P34342|RGP2_CAEEL (Ran GTPase-activating protein 2 OS=Caenorhabditis elegans OX=6239 GN=ran-2 PE=4 SV=3)

HSP 1 Score: 181.8 bits (460), Expect = 2.495e-46
Identity = 113/291 (38.83%), Postives = 168/291 (57.73%), Query Frame = 2
Query:  137 NTEEDIEHVVKDLNENVNCVTTLQLSGNTLGVNAAEKLIEPLSNQTKIQKLIWNDLFTGRLKSEISVALSSLSIGLMRAQVHLVELDLSDNAFGPNGVVGVTELLASSCCYTLKTLNMNNQGLGHQG---CRQLVDALKKARINSNYKGMNLEVFIAGRNRLENAGMEMLTEFFSDGMTSLKKIVLLQNGIGIHGIQGVDNLILSLKNHINLKVLNISDNTIKPEGVKRLSKILPYFEDLEELYLGDCLIKNSGLEHLTKVLN-QMSLNLKTVSVSGNEITGHCAIKFISK 997
            +T E  E VVK +    + +  L+L GNTLG+ A   + + L +  ++++ +W+DLFTGRLK+EI   L +L   +M A   + ELDLSDNAFGP G   + +LL S   ++L+ L +NN GLG  G    + L + L+K+        + L+ FIAGRNRLEN G   L   F   + +++   + QNGI   GI+    L+ +LK++ NL+ L + DNT+ P+G K L+K L  +  LE L L DCLI+++G  ++   LN Q   +LK V + GNE+T   A   I K
Sbjct:  460 DTAESAEPVVKVIAA-ASSMKALELRGNTLGIAAGNVIAKALESHPELERCLWSDLFTGRLKNEIPPILEALGKAMMTAGCKIKELDLSDNAFGPIGADALKDLLESPSSFSLEVLKLNNNGLGIGGKQIAKSLTECLRKSIAVGGENRLRLKTFIAGRNRLENPGAHALAATFK-ALETVEWFDVRQNGIHEEGIRA---LVAALKHNRNLRYLWLEDNTVLPKGAKALAKTLESWPKLEVLNLSDCLIRDAGCNYIIDHLNPQHHRHLKNVYLCGNELTPPVAKLLIQK 745          

HSP 2 Score: 152.525 bits (384), Expect = 7.311e-37
Identity = 106/295 (35.93%), Postives = 166/295 (56.27%), Query Frame = 2
Query:  107 LSYTGLQKQWNTEEDIEHVVKDLNENVNCVTTLQLSGNTLGVNAAEKLIEPLSNQTKIQKLIWNDLFTGRLKSEISVALSSLSIGLMRAQVHLVELDLSDNAFGPNGVVGVTELLASSCCYTLKTLNMNNQGLGHQG-------CRQLVDALKKARINSNYKGMNLEVFIAGRNRLENAGMEMLTEFFSDGMTSLKKIVLLQNGIGIHGIQGVDNLILSLKNHINLKVLNISDNTIKPEGVKRLSKILPYFEDLEELYLGDCLIKNSGLEHLTKVLNQMSLN-LKTVSVSGNEIT 967
            LS+ G Q + +TEE+I  V+  + +++N +  L   GNTL V A + + E L  + ++++ IW+D+FTGRLK EI + L +L   L  +   L  LDLSDNAFG      +   L S   Y+L+ L +NN GLG  G       C  L+DA KKA        + L+ F+ GRNRLE      L++ F   + +L++I L QNGI   GI     L  + + +  L++++I+DN   PEG  ++S++L   + +E L LGDC+  + G+  +   L++++ + LK V +SGN IT
Sbjct:   44 LSFFGKQLKLDTEEEISKVIDQIRKHLN-LEVLDFRGNTLSVLAGKLIAESLKTRRELKECIWSDMFTGRLKDEIPLVLDALGEALTASGCRLTTLDLSDNAFGAGLSTSLYNFLQSPALYSLENLILNNNGLGLAGKTVGKALC-SLIDASKKAGTP-----LKLKKFVCGRNRLEVESTIALSDAFIK-LGTLEEIRLPQNGIRDDGIIA---LAEAFRMNKKLRIIDINDNFCCPEGAIQISEVLSDLQFIEVLDLGDCVCDDPGVLAIIAELDKINRDCLKKVVLSGNNIT 327          
BLAST of Ran GTPase-activating protein 1 vs. TrEMBL
Match: A0A183A5Z9 (Uncharacterized protein OS=Echinostoma caproni OX=27848 PE=4 SV=1)

HSP 1 Score: 293.893 bits (751), Expect = 4.120e-85
Identity = 152/310 (49.03%), Postives = 213/310 (68.71%), Query Frame = 2
Query:  209 LSGNTLGVNAAEKLIEPLSNQTKIQKLIWNDLFTGRLKSEISVALSSLSIGLMRAQVHLVELDLSDNAFGPNGVVGVTELLASSCCYTLKTLNMNNQGLGHQGCRQLVDALKKARINSNYKGMNLEVFIAGRNRLENAGMEMLTEFFSDGMTSLKKIVLLQNGIGIHGIQGVDNLILSLKNHINLKVLNISDNTIKPEGVKRLSKILPYFEDLEELYLGDCLIKNSGLEHLTKVLNQMSL--NLKTVSVSGNEITGHCAIKFISKIVETKHIIESIDLTENEIKKVALNEIKEILAEHDKLDALVEDEAN 1132
            LSGNTLG+ AAE +   L N  K+Q+ +W+DLFTGRLKSEI+ AL  LS G++ +   LVELDLSDNAFGPNGVVGV +L+AS  C TL+ L MNNQGLGH+GCR L +AL+K R +S  +G+ L+VF AGRNRLEN G ++L++ F D M SL+++ L QNGIGIHGI+GVD L+  +K++ NL+VLN+SDN++  +G K ++K L   E+LEEL+L DC+++ SG+  + + L       N++ ++++GNEIT    I  I  +  +K  +E +DL  NE  K  +  I   LA    L  L  ++A+
Sbjct:    1 LSGNTLGITAAEPIGIALENNPKLQRCLWSDLFTGRLKSEIAPALRHLSSGIIASGARLVELDLSDNAFGPNGVVGVVDLIASPACSTLQILRMNNQGLGHEGCRHLTEALQKGRKSSGGRGLLLKVFCAGRNRLENYGAQLLSDVFCD-MGSLEEVALYQNGIGIHGIEGVDALVRMMKHNPNLRVLNLSDNSLTQKGGKAIAKALSSLENLEELHLSDCILRPSGVTAIARALEDPDTLPNIRVLNLTGNEITRSTGISLILSL-GSKSRLEFLDLNANEFGKSGIRAIIRTLASVGLLHVLPVNQAD 308          
BLAST of Ran GTPase-activating protein 1 vs. TrEMBL
Match: A0A3P8G2K2 (Uncharacterized protein OS=Echinostoma caproni OX=27848 GN=ECPE_LOCUS2384 PE=4 SV=1)

HSP 1 Score: 293.123 bits (749), Expect = 7.290e-85
Identity = 151/310 (48.71%), Postives = 213/310 (68.71%), Query Frame = 2
Query:  209 LSGNTLGVNAAEKLIEPLSNQTKIQKLIWNDLFTGRLKSEISVALSSLSIGLMRAQVHLVELDLSDNAFGPNGVVGVTELLASSCCYTLKTLNMNNQGLGHQGCRQLVDALKKARINSNYKGMNLEVFIAGRNRLENAGMEMLTEFFSDGMTSLKKIVLLQNGIGIHGIQGVDNLILSLKNHINLKVLNISDNTIKPEGVKRLSKILPYFEDLEELYLGDCLIKNSGLEHLTKVLNQMSL--NLKTVSVSGNEITGHCAIKFISKIVETKHIIESIDLTENEIKKVALNEIKEILAEHDKLDALVEDEAN 1132
            +SGNTLG+ AAE +   L N  K+Q+ +W+DLFTGRLKSEI+ AL  LS G++ +   LVELDLSDNAFGPNGVVGV +L+AS  C TL+ L MNNQGLGH+GCR L +AL+K R +S  +G+ L+VF AGRNRLEN G ++L++ F D M SL+++ L QNGIGIHGI+GVD L+  +K++ NL+VLN+SDN++  +G K ++K L   E+LEEL+L DC+++ SG+  + + L       N++ ++++GNEIT    I  I  +  +K  +E +DL  NE  K  +  I   LA    L  L  ++A+
Sbjct:    1 MSGNTLGITAAEPIGIALENNPKLQRCLWSDLFTGRLKSEIAPALRHLSSGIIASGARLVELDLSDNAFGPNGVVGVVDLIASPACSTLQILRMNNQGLGHEGCRHLTEALQKGRKSSGGRGLLLKVFCAGRNRLENYGAQLLSDVFCD-MGSLEEVALYQNGIGIHGIEGVDALVRMMKHNPNLRVLNLSDNSLTQKGGKAIAKALSSLENLEELHLSDCILRPSGVTAIARALEDPDTLPNIRVLNLTGNEITRSTGISLILSL-GSKSRLEFLDLNANEFGKSGIRAIIRTLASVGLLHVLPVNQAD 308          
BLAST of Ran GTPase-activating protein 1 vs. TrEMBL
Match: A0A4E0RKC2 (Ran GTPase-activating protein 1 OS=Fasciola hepatica OX=6192 GN=D915_002760 PE=4 SV=1)

HSP 1 Score: 294.664 bits (753), Expect = 9.051e-85
Identity = 155/329 (47.11%), Postives = 223/329 (67.78%), Query Frame = 2
Query:  107 LSYTGLQKQWNTEEDIEHVVKDLNENVNCVTTLQLSGNTLGVNAAEKLIEPLSNQTKIQKLIWNDLFTGRLKSEISVALSSLSIGLMRAQVHLVELDLSDNAFGPNGVVGVTELLASSCCYTLKTLNMNNQGLGHQGCRQLVDALKKARINSNYKGMNLEVFIAGRNRLENAGMEMLTEFFSDGMTSLKKIVLLQNGIGIHGIQGVDNLILSLKNHINLKVLNISDNTIKPEGVKRLSKILPYFEDLEELYLGDCLIKNSGLEHLTKVLNQMSL--NLKTVSVSGNEITGHCAIKFISKIVETKHIIESIDLTENEIKKVALNEIKEIL 1087
            + ++GL  + +  +D+E +V+ L EN +  +   LSG+TLG+ AAE +   L + TK+Q+ +W+DLFTGRLKSEI+ AL  LS G+M +   LVELDLSDNAFGPNGVVGV +L+AS  C TL+ L MNNQGLGH+GCR LV+AL+K R  S  +G+ L+VF AGRNRLEN G ++L++ FSD M SL+++ L QNGIGIHGI+GV++L+  ++ +  L++LN+SDNT+  +G K ++K L    DLEEL+L DCL++ SG+  L + L    L  N++ ++++GNEI     I  I  +   K  ++ +DL  NE     +  I   L
Sbjct:    6 VDFSGLALKLDEPKDVEKIVEALVENPD-ASCFNLSGSTLGIAAAEPIGIALEHNTKLQRCLWSDLFTGRLKSEIAPALRHLSTGVMASGACLVELDLSDNAFGPNGVVGVVDLIASPACATLQILRMNNQGLGHEGCRHLVEALQKGRKASGGQGLRLKVFSAGRNRLENYGAQLLSDVFSD-MGSLEEVSLYQNGIGIHGIEGVNSLVKMMEKNAGLRILNLSDNTLTEKGGKAIAKALCSLPDLEELHLSDCLLRASGVAALARALEDPELVPNIRVLNLTGNEINRSIGISLILSL-GNKSKLQLLDLNANEFGTSGIQAIIRTL 331          
BLAST of Ran GTPase-activating protein 1 vs. TrEMBL
Match: A0A504YLS8 (Ran GTPase-activating protein 1 OS=Fasciola gigantica OX=46835 GN=FGIG_04561 PE=4 SV=1)

HSP 1 Score: 293.123 bits (749), Expect = 3.191e-84
Identity = 154/329 (46.81%), Postives = 221/329 (67.17%), Query Frame = 2
Query:  107 LSYTGLQKQWNTEEDIEHVVKDLNENVNCVTTLQLSGNTLGVNAAEKLIEPLSNQTKIQKLIWNDLFTGRLKSEISVALSSLSIGLMRAQVHLVELDLSDNAFGPNGVVGVTELLASSCCYTLKTLNMNNQGLGHQGCRQLVDALKKARINSNYKGMNLEVFIAGRNRLENAGMEMLTEFFSDGMTSLKKIVLLQNGIGIHGIQGVDNLILSLKNHINLKVLNISDNTIKPEGVKRLSKILPYFEDLEELYLGDCLIKNSGLEHLTKVLNQMSL--NLKTVSVSGNEITGHCAIKFISKIVETKHIIESIDLTENEIKKVALNEIKEIL 1087
            + ++GL  + +  +D+E +V+ L  N +      LSG+TLG+ AAE +   L + TK+Q+ +W+DLFTGRLKSEI+ AL  LS G+M +   LVELDLSDNAFGPNGV+GV +L+AS  C TL+ L MNNQGLGH+GCR LV+AL+K R  S  +G+ L+VF AGRNRLEN G  +L++  SD M SL+++ L QNGIGIHGI+GV++L+  ++ +  L++LN+SDNT+  +G K ++K L    DLEEL+LGDCL++ SG+  L + L    L  N++ ++++GNEI     I  I  + E K  ++ +DL  NE     +  I   L
Sbjct:    6 VDFSGLALKLDEPKDVEKIVEALVGNPDAFC-FNLSGSTLGIAAAEPIGIALEHNTKLQRCLWSDLFTGRLKSEIAPALRHLSTGVMASGACLVELDLSDNAFGPNGVIGVVDLIASPACATLQILRMNNQGLGHEGCRHLVEALQKGRKASGGRGLRLKVFSAGRNRLENYGARLLSDVLSD-MGSLEEVSLYQNGIGIHGIEGVNSLVKMMEKNAGLRILNLSDNTLTEKGGKAIAKALCSLPDLEELHLGDCLLRASGVAALARALEDPELVPNIRVLNLTGNEINRSVGISLILSL-ENKSKLQLLDLNANEFGTSGIQAIIRTL 331          
BLAST of Ran GTPase-activating protein 1 vs. TrEMBL
Match: A0A4S2MDX3 (Uncharacterized protein OS=Opisthorchis felineus OX=147828 GN=CRM22_000693 PE=4 SV=1)

HSP 1 Score: 292.352 bits (747), Expect = 4.897e-84
Identity = 159/338 (47.04%), Postives = 224/338 (66.27%), Query Frame = 2
Query:  107 LSYTGLQKQWNTEEDIEHVVKDLNENVNCVTTLQLSGNTLGVNAAEKLIEPLSNQTKIQKLIWNDLFTGRLKSEISVALSSLSIGLMRAQVHLVELDLSDNAFGPNGVVGVTELLASSCCYTLKTLNMNNQGLGHQGCRQLVDALKKARINSNYKGMNLEVFIAGRNRLENAGMEMLTEFFSDGMTSLKKIVLLQNGIGIHGIQGVDNLILSLKNHINLKVLNISDNTIKPEGVKRLSKILPYFEDLEELYLGDCLIKNSGLEHLTKVLN--QMSLNLKTVSVSGNEITGHCAIKFISKIVETKHIIESIDLTENEIKKVALNEIKEILAEHDKLDAL 1114
            +++ GL  + +T ED+  +V +L  N   VT L L+GNTLG+ A+E L   L N  K+++ I++DLFTGRLK+EI+ AL  L  G++ +  HLVELDLSDNAFGPNGVVGV ELL+S  C+TL+ L MNNQGLGH+GCR L  AL+K R   N  G+ L+VF A RNRLEN G +ML +  +D M SL+++ L QNGIGIHG  G+ +L   L  +  L++LN+SDNT+  EG K ++K L   E LEEL+LGDC++++SG + L  VL+  +++ +L+ +++SGNEIT    +  +  +  +K  +ES+DL  NE  K  +  I   L   D L  L
Sbjct:   16 VTFAGLGLKLDTVEDVGFIVSELRSNTE-VTCLNLTGNTLGIVASEPLGAALENNKKLRRCIFSDLFTGRLKTEIAPALRHLCSGIISSGAHLVELDLSDNAFGPNGVVGVVELLSSPACFTLEVLRMNNQGLGHEGCRYLTQALEKGREACNRNGLALKVFSASRNRLENVGAQMLAKVLAD-MGSLEELSLCQNGIGIHGKDGMQSLSKILMANTKLRLLNLSDNTLTAEGGKIIAKALRSLEKLEELHLGDCILRSSGAQALAAVLDDPKVAPDLRVLNLSGNEITRQAGVSLVLSL-GSKSNLESLDLNANEFGKSGIQAIIRSLESIDLLHTL 350          
BLAST of Ran GTPase-activating protein 1 vs. Ensembl Cavefish
Match: rangap1b (ran GTPase-activating protein 1-like [Source:NCBI gene;Acc:103043879])

HSP 1 Score: 185.267 bits (469), Expect = 4.997e-50
Identity = 122/340 (35.88%), Postives = 194/340 (57.06%), Query Frame = 2
Query:  101 EYLSYTGLQKQWNTEEDIEHVVKDLNENVNCVTTLQLSGNTLGVNAAEKLIEPLSNQTKIQKLIWNDLFTGRLKSEISVALSSLSIGLMRAQVHLVELDLSDNAFGPNGVVGVTELLASSCCYTLKTLNMNNQGLGHQGCRQLVDALKKARINSNYKG--MNLEVFIAGRNRLENAGMEMLTEFFSDGMTSLKKIVLLQNGIGIHGIQGVDNLILSLKNHINLKVLNISDNTIKPEGVKRLSKILPYFEDLEELYLGDCLIKNSGLEHLTKVLNQMSLNLKTVSVSGNEITGHCAIKFISKIVETKHIIESIDLTENEIKKVALNEIKEILAEHDKLDAL 1114
            E LSY G   + + E+ +E +V+++++    +  L+L GNT+GV AA  + + L    +++   W+D+FTGRL+SEI  AL SL   L+ +   L ELDLSDNAFGP+GV G+  LL S  C+TLK L +NN G+G  G   L  AL +    S+  G  + L+VFIAGRNRLEN G   L   F   + SL+++ + QNGI   GI     L  +++++ NL+VLN++DNT    G   +++ L +   ++ +  GDCL++  G   +   L +    +K +++S  EIT   A   +++ ++ K  ++ +DL  N + +     +KE +   DK D L
Sbjct:   20 EELSYKGQGLKLDDEQSVEKIVREIDQ-FRGLRALRLEGNTIGVEAAHAIAKALETHNELECCHWSDMFTGRLRSEIPPALKSLGSALITSGARLTELDLSDNAFGPDGVKGIETLLKSPVCHTLKELRLNNCGMGIGGGIILASALTECYKQSSAMGSPLKLKVFIAGRNRLENDGATALARAFQ-MIGSLEEVHMPQNGINHPGITA---LATAMQHNPNLRVLNLNDNTFTKRGAVAMAQALKHLRSIQVVNFGDCLVRTEGAIAIAAALREGLTVIKELNLSFGEIT-EAAALVLARALKDKPDLKKLDLNGNCLGEYGCEALKEAMESVDKSDVL 353          
BLAST of Ran GTPase-activating protein 1 vs. Ensembl Cavefish
Match: rangap1a (RAN GTPase activating protein 1a [Source:ZFIN;Acc:ZDB-GENE-060929-492])

HSP 1 Score: 180.259 bits (456), Expect = 2.760e-48
Identity = 115/329 (34.95%), Postives = 186/329 (56.53%), Query Frame = 2
Query:  107 LSYTGLQKQWNTEEDIEHVVKDLNENVNCVTTLQLSGNTLGVNAAEKLIEPLSNQTKIQKLIWNDLFTGRLKSEISVALSSLSIGLMRAQVHLVELDLSDNAFGPNGVVGVTELLASSCCYTLKTLNMNNQGLGHQGCRQLVDALKKARINSNYKG--MNLEVFIAGRNRLENAGMEMLTEFFSDGMTSLKKIVLLQNGIGIHGIQGVDNLILSLKNHINLKVLNISDNTIKPEGVKRLSKILPYFEDLEELYLGDCLIKNSGLEHLTKVLNQMSLNLKTVSVSGNEITGHCAIKFISKIVETKHIIESIDLTENEIKKVALNEIKEIL 1087
            LSY G   + +  +  E +VK + E    +  L+L GNT+GV AA+ + + L +++  Q   W+D+FTGRL         SL   LM A   L  LDLSDNAFGP+GV G+  LL S+ C+TL+ L +NN G+G  G + L  AL +    S+  G  ++L+VFIAGRNRLEN G   L + F   + +L++I + QNGI   G+  + N   +++ +  L+VLN++DNT   +G   +++ L     ++ +  GDCL+++ G   + + L +    LK +++S  EIT   A+  ++K VE K  +E +DL  N   +     +++++
Sbjct:   23 LSYKGQGLKLDNAQTAEEIVKAIRE-FQGLQALRLEGNTIGVEAAQAIAKALEDKSDFQCCYWSDMFTGRL--------FSLGAALMSAGARLKVLDLSDNAFGPDGVKGIENLLKSATCHTLQELRLNNCGMGIGGGKILAAALTECHKKSSKLGAPLSLKVFIAGRNRLENDGATALAQAFQL-IGTLEEIHMPQNGINHPGVTALAN---AVQQNPQLRVLNLNDNTFTKKGAIAMAQALKNLRSVQVINFGDCLVRSEGAVAIAEALKEGLPILKELNLSFGEITEEAALA-VAKAVEHKDQLEKLDLNGNCFGEDGCQNLRDLM 337          
BLAST of Ran GTPase-activating protein 1 vs. Ensembl Cavefish
Match: ENSAMXT00000050645.1 (NLR family CARD domain-containing protein 3-like [Source:NCBI gene;Acc:103035935])

HSP 1 Score: 58.5362 bits (140), Expect = 2.227e-8
Identity = 90/347 (25.94%), Postives = 147/347 (42.36%), Query Frame = 2
Query:  149 DIEHVVKDLNENVNC----VTTLQLSGNTLGVNAAEKLIEPLSN-QTKIQKLIWNDLFTGRLKSEISVALSSLSIGLMRAQVHLVELDLSDNAFGPNGVVGVTELLASSCCYTLKTLNMNNQGLGHQGCRQLVDALKKARINSNYKGMNLEVFIAGRNRLENAGMEMLTEFFSDGMTSLKKIVLLQNGIG--------------------------IHGIQGVDNLILSLKN-HINLKVLNISDNTIKPEGVKRLSKIL---PYF---EDLEELYLGDCLIKNSGLEHLTKVLNQMSLNLKTVSVSGNEITGHCAIKFISKIVETKHIIESIDLTENEIKKVALNEI 1075
            D E V   L E++      ++ L LSG   G +  +KL   L +   + +KL  N+     +  E   ALSS    L     HL+ELDL +N  G +GV+ + ELL ++ C  L+ L   +  +  +G   L  ALK     SN     +E+ + G N   + G+++LT+   +  + LK + LL++                             I G  G+  L   LK+ H  +++L +S++ I  EG   LS  L   P      DL E  LG     N G++ L   LN     L+   +    I        +S +      I  +DL++N++  + LN++
Sbjct:  764 DAEEVCASLTESLGTDPLLLSELDLSGKIQGDSEMKKLSHLLEDSHCRTKKLKLNN---SSVTEEGCAALSS---ALCLNPSHLIELDLGENKLGNSGVMKLCELLNNNFC-KLQRLGFADCCITEKGYAALASALK-----SNPSSTLMELDLRG-NDPGDEGVQLLTDLTKNENSKLKTLRLLKSPAAEKAHATLTKQLGANPLRLREMVLKGKIQGDSGLKQLSDLLKDSHCRIEILGLSNSNITEEGCAALSSSLCSNPSHLIGLDLCENKLG-----NLGVQQLCSFLNNTHCKLQQFRLKNCSIKEKGCADLVSALCSNPTHINVLDLSKNKVGDLGLNQL 1092          
BLAST of Ran GTPase-activating protein 1 vs. Ensembl Cavefish
Match: ENSAMXT00000035222.1 (ribonuclease inhibitor-like [Source:NCBI gene;Acc:103031476])

HSP 1 Score: 54.299 bits (129), Expect = 3.684e-7
Identity = 65/217 (29.95%), Postives = 103/217 (47.47%), Query Frame = 2
Query:  338 ALSSLSIGLMRAQVHLVELDLSDNAFGPNGVVGVTELLASSCCYTLKTLNMNNQGLGHQGCRQLVDALKKARINSNYKGMNLEVFIAGRNRLENAGMEMLTEFFSDGMTSLKKIVLLQNGIGIHGI----QGVDNLILSL-KNHINLKVLNISDNTIKPEGVKRLSKIL--PYFE--DLEELYLGDCLIKNSGLEHLTKVLNQMSLNLKTVSVSGNE 961
            A   L+  L  A  HL+E+DLS+N  G  GV  +   L S  C  L+ L+++   L    C  L   L     +S +    LE+   G N L ++G+++L     D    LK+       +G+ G     +G  +L L+L  NH  LK L+IS N  +  G+K LS IL  P+ +   L   Y G C IK    ++  ++    +   +T+S++GN+
Sbjct:  272 ACEPLASVLESANPHLIEMDLSNNYIGDKGVKLLCSGLRSPNC-KLQKLSLDWCSLTDSCCSDLASVL-----SSQFCLRELEL---GDNDLLDSGVKLLCVGLQDPKCKLKR-------LGLSGCCVTKEGCSSLGLALSSNHSQLKDLDISYNHPEEHGLKELSTILDNPHCKLMKLSTEYGGKCRIKPGLQKYACEITLDPNTAHRTLSLNGNK 472          
BLAST of Ran GTPase-activating protein 1 vs. Ensembl Cavefish
Match: ENSAMXT00000055168.1 (pep primary_assembly:Astyanax_mexicanus-2.0:APWO02000774.1:21:36365:-1 gene:ENSAMXG00000031550.1 transcript:ENSAMXT00000055168.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 52.373 bits (124), Expect = 5.462e-7
Identity = 65/241 (26.97%), Postives = 114/241 (47.30%), Query Frame = 2
Query:  104 YLSYTGLQKQWNTEEDIEHVVKDLNENVNCVTTLQLSGNTLGVNAAEKLIEPL-SNQTKIQKL-IWNDLFTGRLKSEISVALSSLSIGLMRAQVHLVELDLSDNAFGPNGVVGVTELLASSCCYTLKTLNMNNQGLGHQGCRQLVDALKKARINSNYKGMNLEVFIAGRNRLENAGMEMLTEFFSDGMTSLKKIVLLQNGIGIHGIQGVDNLILSLKNHINLKVLNISDNTIKPEGVKRLS 820
            +    G    W+   ++  V+K +N ++     L LS N L     + L E L S+  K++KL +    FT    S++S  L S++  L        ELDLS+N    +GV  ++E L SS C  L+ L +         C  L   L+   +NS+ K ++L       N L + G++ L++        L+K+ L+          G+ +++ S+ +  +LK L++S+N ++  GVK+LS
Sbjct:   20 FCRLVGCNFTWSVCNELASVLKSVNSSLK---ELDLSENELWDGGVKLLSEGLKSSHCKLEKLRLVGCNFTSYSCSDVSSVLESVNSSLK-------ELDLSENELQDDGVKDLSEGLKSSHC-KLEKLRLVGCNFTGYSCSDLSSVLES--VNSSLKELDL-----SENELRDDGVKKLSKGLKSSHCKLEKLRLVGCNFTSFSCSGLSSVLESVNS--SLKELDLSENKLRDYGVKKLS 240          
BLAST of Ran GTPase-activating protein 1 vs. Ensembl Sea Lamprey
Match: rangap1a (RAN GTPase activating protein 1a [Source:ZFIN;Acc:ZDB-GENE-060929-492])

HSP 1 Score: 182.956 bits (463), Expect = 2.111e-49
Identity = 112/312 (35.90%), Postives = 182/312 (58.33%), Query Frame = 2
Query:  107 LSYTGLQKQWNTEEDIEHVVKDLNENVNCVTTLQLSGNTLGVNAAEKLIEPLSNQTKIQKLIWNDLFTGRLKSEISVALSSLSIGLMRAQVHLVELDLSDNAFGPNGVVGVTELLASSCCYTLKTLNMNNQGLGHQGCRQLVDALKKARINSNYKG--MNLEVFIAGRNRLENAGMEMLTEFFSDGMTSLKKIVLLQNGIGIHGIQGVDNLILSLKNHINLKVLNISDNTIKPEGVKRLSKILPYFEDLEELYLGDCLIKNSGLEHLTKVLNQMSLNLKTVSVSGNEITGHCAIKFISKIVETKHIIESIDL 1036
            +S+ G   + NT ED   VV  + +    +  L L GNT+GV AA+ +   L+ +   Q+ +W+D+FTGRL++EI  AL++L   ++ +   LVELDLSDNAFGP+GV     LL S  C++L+TL +NN G+G  G + L +AL +    S  +G  + L VF+AGRNRLEN G   L + F   M SL+++ + QNGI   GI     L  +   +  L+VLN++DNT    G   +++ L   + +E +  GDCL+++ G + +   L     ++K ++++  EI    A++ +++ +ETK   +++DL
Sbjct:   73 VSFKGECLKLNTAEDAGVVVTAI-QKCEHMEALSLEGNTIGVEAAKAIATALAEKPHFQRALWSDMFTGRLRTEIPPALTALGNAMVTSGARLVELDLSDNAFGPDGVRACDTLLRSRACFSLRTLRLNNCGMGIGGGKILAEALSECHRASAAEGKPLALRVFVAGRNRLENEGASALAKAFM-AMGSLEEVHVPQNGINHAGITA---LAKAFAKNPELRVLNLNDNTFTERGALSMAEALKVLKKVEVINFGDCLVRSVGAKAIAVALKDGLPHIKELNLAFGEINMDAAMQ-VAEALETKSFFKTLDL 378          
BLAST of Ran GTPase-activating protein 1 vs. Ensembl Yeast
Match: RNA1 (GTPase activating protein (GAP) for Gsp1p; involved in nuclear transport [Source:SGD;Acc:S000004848])

HSP 1 Score: 109.768 bits (273), Expect = 3.406e-26
Identity = 97/296 (32.77%), Postives = 153/296 (51.69%), Query Frame = 2
Query:  110 SYTGLQKQWNTEEDIEHVVKDLNENVNCVTTLQLSGNTLGVNAAEKLIEPLSNQTKIQKLI----WNDLFTGRLKSEISVALSSLSIGLMRAQVHLVELDLSDNAFGPNGVVGVTELLASSCCYTLKTLNMNNQGLGHQGCRQLVDALKKARINSNYKGMN---LEVFIAGRNRLENAGMEMLTEFFSDGMTSLKKIVLLQNGIGIHGIQGVDNLI-LSLKNHINLKVLNISDNTIKPEGVKRLSKILPYFED-LEELYLGDCLIKNSGLEHLTKVLNQMSL-NLKTVSVSGNEIT 967
            S +G   +  T +DI+  +++L     C T L LSGNT+G  A+E L + ++  T++++ +    + DL+T RL  E+  +L  L   L++   HL  ++LSDNAFG   +  + + +A +    +K L ++N G+G     ++  AL    +  N K  +   LE FI GRNRLEN     L          LK + L QNGI     +GV  LI   L+   NL++L++ DNT        L+K LP ++D L EL L DCL+K +G + + KV  ++   NL  +    NE+ 
Sbjct:   17 SISGKALKLTTSDDIKPYLEELAALKTC-TKLDLSGNTIGTEASEALAKCIAENTQVRESLVEVNFADLYTSRLVDEVVDSLKFLLPVLLKCP-HLEIVNLSDNAFGLRTIELLEDYIAHAV--NIKHLILSNNGMGPFAGERIGKAL--FHLAQNKKAASKPFLETFICGRNRLENGSAVYLALGLKSHSEGLKVVKLYQNGI---RPKGVATLIHYGLQYLKNLEILDLQDNTFTKHASLILAKALPTWKDSLFELNLNDCLLKTAGSDEVFKVFTEVKFPNLHVLKFEYNEMA 303          
BLAST of Ran GTPase-activating protein 1 vs. Ensembl Nematostella
Match: EDO31643 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SXB3])

HSP 1 Score: 185.267 bits (469), Expect = 2.261e-52
Identity = 119/312 (38.14%), Postives = 185/312 (59.29%), Query Frame = 2
Query:  107 LSYTGLQKQWNTEEDIEHVVKDLNENVNCVTTLQLSGNTLGVNAAEKLIEPLSNQTKIQKLIWNDLFTGRLKSEISVALSSLSIGLMRAQVHLVELDLSDNAFGPNGVVGVTELLASSCCYTLKTLNMNNQGLGHQGCRQLVDALKKARINSNYKG--MNLEVFIAGRNRLENAGMEMLTEFFSDGMTSLKKIVLLQNGIGIHGIQGVDNLILSLKNHINLKVLNISDNTIKPEGVKRLSKILPYFEDLEELYLGDCLIKNSGLEHLTKVLNQMSLNLKTVSVSGNEITGHCAIKFISKIVETKHIIESIDL 1036
            +S+ G   + N+ ED   + + + +N   +  L L GNT+GV AA+ + E LS + + ++ +W+D+FTGR+++EI  A+ +LS  ++ A   LVELDLSDNAFGP+GV    +LL S  CY+LK L  NN GLG  G + L  AL     +S   G  + LEVFI+GRNRLEN G + L E F   + +L ++ + QNGI   GI     L  S +++ NLK++N++DN    +G   ++K+LP   ++E +  GDCL+K++G   L +       NLK + +S +EI    A+  ++K V+ K   + +DL
Sbjct:   26 ISFKGESLKLNSAEDAAKICEAI-KNCKDMQALCLEGNTIGVEAAKAIAEALSKRPEFERALWSDMFTGRVRAEIPPAMEALSDAVISAGTRLVELDLSDNAFGPDGVKACVKLLTSPACYSLKILRFNNNGLGVGGGKLLSGALLDNHKSSTAAGTPLKLEVFISGRNRLENPGSKCLAEAFKT-IGTLVEVQMPQNGIQHEGITA---LAESFRSNPNLKIINLNDNIFTEKGATSMAKVLPTLNNVEVINFGDCLVKSAGAVALAEACCTSLPNLKELILSFDEIKKDAALT-VAKSVQNKADFKKLDL 331          
BLAST of Ran GTPase-activating protein 1 vs. Ensembl Nematostella
Match: EDO35050 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SML2])

HSP 1 Score: 55.0694 bits (131), Expect = 6.303e-8
Identity = 52/174 (29.89%), Postives = 84/174 (48.28%), Query Frame = 2
Query:  194 VTTLQLSGNTLGVNAAEKLIEPLSNQTKIQ--KLIWNDLFTGRLKSEISVALSSLSIGLMRAQVHLVELDLSDNAFGPNGVVGVTELLASSCCYTLKTLNMNNQGLGHQGCRQLVDALKKARINSNYKGMNLEVFIAGRNRLENAGMEMLTEFFS-DGMTSLKKIVLLQNGIGI 706
            + +L    N L    +  L E L++ T ++   L WND+  G        A+++L+ GL R    + ELDLS N F   GV+ V   L  S   +L+TL+++N G+   G   +   L+  R        NL+V   GRN  +NAG+  + E    +  +SL+++    +GIG 
Sbjct:  134 LKSLIFHSNNLSDQGSRLLSEALASNTALETLDLSWNDIRPG--------AMATLAKGL-RLNHTIQELDLSWNTFQSRGVIAVQWFLTHST--SLQTLDISNCGIHLDGAEVIAKVLRANR--------NLQVLKLGRNPFQNAGVPCILEAVRLNARSSLRELTF--DGIGF 286          
BLAST of Ran GTPase-activating protein 1 vs. Ensembl Medaka
Match: rangap1b (ran GTPase-activating protein 1-like [Source:NCBI gene;Acc:101160693])

HSP 1 Score: 204.142 bits (518), Expect = 9.591e-57
Identity = 126/339 (37.17%), Postives = 199/339 (58.70%), Query Frame = 2
Query:  107 LSYTGLQKQWNTEEDIEHVVKDLNENVNCVTTLQLSGNTLGVNAAEKLIEPLSNQTKIQKLIWNDLFTGRLKSEISVALSSLSIGLMRAQVHLVELDLSDNAFGPNGVVGVTELLASSCCYTLKTLNMNNQGLGHQGCRQLVDALKKARINSNYKG--MNLEVFIAGRNRLENAGMEMLTEFFSDGMTSLKKIVLLQNGIGIHGIQGVDNLILSLKNHINLKVLNISDNTIKPEGVKRLSKILPYFEDLEELYLGDCLIKNSGLEHLTKVLNQMSLNLKTVSVSGNEITGHCAIKFISKIVETKHIIESIDLTENEIKKVALNEIKEILAEHDKLDALV 1117
            LSY GL  + +  E +  +V+D+  + + +  L+L GNT+GV AA+ + + L N+  +Q+  W+D+FTGRL+SEI  AL SL   +M A   L ELDLSDNAFGP+GV G+ +LL S+ C++LK L +NN G+G  G + L +AL +    S+  G  + L VF+AGRNRLEN G   L + F   + SL+++ L QNGI  H   GV  L  +++ +  L+V+N++DNT    G   ++  L    +++ +  GDCL+++ G   L  VL +    L+ V++S  EIT   A   +++ V  K  +E +DL  N + +     +++++   DK D L 
Sbjct:   23 LSYKGLGLKLDDAESVAELVRDIRRSSD-LRALRLEGNTVGVEAAQTIAKALENKEMLQRCYWSDMFTGRLRSEIPTALMSLGGAIMGAGARLTELDLSDNAFGPDGVKGIEQLLKSASCHSLKELRLNNCGMGIGGGKILAEALTEGHRRSSALGAPLRLRVFMAGRNRLENEGASALAKAFKL-IGSLEEVHLPQNGIN-HA--GVTALAAAMRQNPELRVVNLNDNTFTRRGALAMAHALRPLRNVQVINFGDCLVRSEGAVALAAVLREGLPTLREVNLSFGEIT-EAAAMAVAQAVADKPSMEKVDLNGNCLGEDGCEALRDLMENADKGDLLA 355          
BLAST of Ran GTPase-activating protein 1 vs. Ensembl Medaka
Match: rangap1a (Ran GTPase activating protein 1 [Source:NCBI gene;Acc:101170844])

HSP 1 Score: 179.874 bits (455), Expect = 3.552e-48
Identity = 112/329 (34.04%), Postives = 197/329 (59.88%), Query Frame = 2
Query:  107 LSYTGLQKQWNTEEDIEHVVKDLNENVNCVTTLQLSGNTLGVNAAEKLIEPLSNQTKIQKLIWNDLFTGRLKSEISVALSSLSIGLMRAQVHLVELDLSDNAFGPNGVVGVTELLASSCCYTLKTLNMNNQGLGHQGCRQLVDALKKARINSNYKG--MNLEVFIAGRNRLENAGMEMLTEFFSDGMTSLKKIVLLQNGIGIHGIQGVDNLILSLKNHINLKVLNISDNTIKPEGVKRLSKILPYFEDLEELYLGDCLIKNSGLEHLTKVLNQMSLNLKTVSVSGNEITGHCAIKFISKIVETKHIIESIDLTENEIKKVALNEIKEIL 1087
            LSY G  ++ +  + +E +VK++ ++   +  L+L GNT+GV AA+ + + L  + +++   W+D+FTGR++SEI  AL+SL   LM A   L  LDLSDNAFGP+GV G+ +LL S+ CYTL+ L +NN G+G  G + L  +L      S+ +   ++L+VF+AGRNRLEN G   L + F   + +L+++ + QNGI  H   GV  L  +++ +  L++LN++DNT   +G   +++ L +   ++ +  GDCL++ +G + + + + +    L  +++S  EIT   A   ++  V+ K  ++ +DL  N + +     +KE++
Sbjct:   23 LSYKGQGRKLDDAKSVEEIVKNI-QDFEGLEALRLEGNTVGVEAAQAIAKALETKNELKCCYWSDMFTGRVRSEIPPALNSLGDALMLAGARLTVLDLSDNAFGPDGVKGIEKLLKSTSCYTLQELRLNNCGMGIGGGKILAASLMHCHQKSSAEKTPLSLKVFVAGRNRLENDGAAALAQAFQL-IGTLEEVHMPQNGIN-H--PGVTALASAMQQNPQLRILNLNDNTFTEKGALAMAQALKHLHSIQVINFGDCLVRPAGAKAIAEAVTEGLPALMELNLSFGEIT-EEAALALAHAVKDKEQLQRLDLNGNCLGEDGCKALKEVM 345          
BLAST of Ran GTPase-activating protein 1 vs. Ensembl Medaka
Match: nlrc3 (NLR family CARD domain containing 3 [Source:NCBI gene;Acc:101165263])

HSP 1 Score: 51.2174 bits (121), Expect = 4.090e-6
Identity = 67/242 (27.69%), Postives = 115/242 (47.52%), Query Frame = 2
Query:  194 VTTLQLSGNTLGVNAAEKLIEPLSNQTKIQKLIWNDLFTGRLKSEISVALSSLSIGLMRAQVHLVELDLSDNAFGPNGVVGVTELLASSCCYTLKTLNMNNQGLGHQGCRQLVDALKKARINSNYKGMNLEVFIAGRNRLENAGMEMLTEF--FSDGMTSLKKIVLLQNGIGIHGIQGVDNLILSLKNHINLKVLNISDNTIKPEGVKRLSKILPYFEDLEELYLGDCLIKNSGLEHLTKVL 913
            +T L L  N +G   A+ L E L      Q L   +     ++ E + AL+ +    ++    LV L++  N  G +G   + + L  +   TL  L + +  LG +G   L +ALK   +N     + L+      N + N GM  LT+   F+ G+ +L    L +N IGI   +G  N+  +LK + +L+ L+++ N +  EGV+ +S  + + + L  L+L    IK++     TKVL
Sbjct:  764 LTYLNLRNNNIGSKGAKFLAEALKMN---QVLTSINFQNNSIEEEGAQALAEV----LQCNRKLVSLNVRKNKIGADGAKRIADALKMN--QTLTKLILCSNQLGDKGTVALAEALK---LNQTLLSLQLQ-----SNSISNRGMTALTKALRFNHGLVTLN---LRENSIGI---EGAKNMAQALKENNSLQNLDLTANLLHDEGVQAISAAIKFNQGLTSLHLQWNFIKSTA----TKVL 978          
BLAST of Ran GTPase-activating protein 1 vs. Ensembl Medaka
Match: nlrc3 (NLR family CARD domain containing 3 [Source:NCBI gene;Acc:101165263])

HSP 1 Score: 51.2174 bits (121), Expect = 4.090e-6
Identity = 67/242 (27.69%), Postives = 115/242 (47.52%), Query Frame = 2
Query:  194 VTTLQLSGNTLGVNAAEKLIEPLSNQTKIQKLIWNDLFTGRLKSEISVALSSLSIGLMRAQVHLVELDLSDNAFGPNGVVGVTELLASSCCYTLKTLNMNNQGLGHQGCRQLVDALKKARINSNYKGMNLEVFIAGRNRLENAGMEMLTEF--FSDGMTSLKKIVLLQNGIGIHGIQGVDNLILSLKNHINLKVLNISDNTIKPEGVKRLSKILPYFEDLEELYLGDCLIKNSGLEHLTKVL 913
            +T L L  N +G   A+ L E L      Q L   +     ++ E + AL+ +    ++    LV L++  N  G +G   + + L  +   TL  L + +  LG +G   L +ALK   +N     + L+      N + N GM  LT+   F+ G+ +L    L +N IGI   +G  N+  +LK + +L+ L+++ N +  EGV+ +S  + + + L  L+L    IK++     TKVL
Sbjct:  764 LTYLNLRNNNIGSKGAKFLAEALKMN---QVLTSINFQNNSIEEEGAQALAEV----LQCNRKLVSLNVRKNKIGADGAKRIADALKMN--QTLTKLILCSNQLGDKGTVALAEALK---LNQTLLSLQLQ-----SNSISNRGMTALTKALRFNHGLVTLN---LRENSIGI---EGAKNMAQALKENNSLQNLDLTANLLHDEGVQAISAAIKFNQGLTSLHLQWNFIKSTA----TKVL 978          
BLAST of Ran GTPase-activating protein 1 vs. Planmine SMEST
Match: SMESG000061064.1 (SMESG000061064.1)

HSP 1 Score: 1327.77 bits (3435), Expect = 0.000e+0
Identity = 701/705 (99.43%), Postives = 703/705 (99.72%), Query Frame = 2
Query:   95 MLEYLSYTGLQKQWNTEEDIEHVVKDLNENVNCVTTLQLSGNTLGVNAAEKLIEPLSNQTKIQKLIWNDLFTGRLKSEISVALSSLSIGLMRAQVHLVELDLSDNAFGPNGVVGVTELLASSCCYTLKTLNMNNQGLGHQGCRQLVDALKKARINSNYKGMNLEVFIAGRNRLENAGMEMLTEFFSDGMTSLKKIVLLQNGIGIHGIQGVDNLILSLKNHINLKVLNISDNTIKPEGVKRLSKILPYFEDLEELYLGDCLIKNSGLEHLTKVLNQMSLNLKTVSVSGNEITGHCAIKFISKIVETKHIIESIDLTENEIKKVALNEIKEILAEHDKLDALVEDEANXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXKADEKEETKLQITPTVTQSALFPNKIDCCKPSLTNGTAQSNLFAQSNQINPLNTARNIFGSQSAKPFSFLDAAKPSAFPVTGSLFATSQKQQFTFTNSDSSKPSLFSATAQSNLFSQSPQTNFLKPVNIFGTTSAKPFSFIEASATPNALEKELIEYVISNLHSDSLMSIKEFNSTINQTLGKFSFDANIYKTAEDFPENAVRVGLMLCKNTSTCDAGVELISHLLLSKSAWNRATNAILVEMDCIKCEEKKFVPFSEDNPKMPVKVLTNVLERNSSLPNEVKTNLTVVLKNLSKKSNDATDELLKKLECCVDNLRI 2209
            MLEYLSYTGLQKQWNTEEDIEHVVKDLNENVNCVTTLQLSGNTLGVNAAEKLIEPLSNQTKIQKLIWNDLFTGRLKSEISVALSSLSIGLMRAQVHLVELDLSDNAFGPNGVVGVTELLASSCCYTLKTLNMNNQGLGHQGCRQLVDALKKARINSNYKGMNLEVFIAGRNRLENAGMEMLTEFFSDGMTSLKKIVLLQNGIGIHGIQGVDNLILSLKNHINLKVLNISDNTIKPEGVKRLSKILPYFEDLEELYLGDCLIKNSGLEHLTKVLNQMSLNLKTVSVSGNEITGH AIKFISKIVETKHIIESIDLTENEIKKVALNEIKEILAEHDKLDALVEDEANSDGELSEDESD+YEGSGDDDDSSKSSTGEEEYSDEYSENDSYKADEKEETKLQITPTVTQSALFPNKIDCCKPSLTNGTAQSNLFAQSNQINPLNTARNIFGSQS+KPFSFLDAAKPSAFPVTGSLFATSQKQQFTFTNSDSSKPSLFSATAQSNLFSQSPQTNFLKPVNIFGTTSAKPFSFIEASATPNALEKELIEYVISNLHSDSLMSIKEFNS INQTLGKFSFDANIYKTAEDFPENAVRVGLMLCKNTSTCDAGVELISHLLLSKSAWNRATNAILVEMDCIKCEEKKFVPFSEDNPKMPVKVLTNVLERNSSLPNEVKTNLTVVLKNLSKKSNDATDELLKKLECCVDNLRI
Sbjct:    1 MLEYLSYTGLQKQWNTEEDIEHVVKDLNENVNCVTTLQLSGNTLGVNAAEKLIEPLSNQTKIQKLIWNDLFTGRLKSEISVALSSLSIGLMRAQVHLVELDLSDNAFGPNGVVGVTELLASSCCYTLKTLNMNNQGLGHQGCRQLVDALKKARINSNYKGMNLEVFIAGRNRLENAGMEMLTEFFSDGMTSLKKIVLLQNGIGIHGIQGVDNLILSLKNHINLKVLNISDNTIKPEGVKRLSKILPYFEDLEELYLGDCLIKNSGLEHLTKVLNQMSLNLKTVSVSGNEITGHSAIKFISKIVETKHIIESIDLTENEIKKVALNEIKEILAEHDKLDALVEDEANSDGELSEDESDNYEGSGDDDDSSKSSTGEEEYSDEYSENDSYKADEKEETKLQITPTVTQSALFPNKIDCCKPSLTNGTAQSNLFAQSNQINPLNTARNIFGSQSSKPFSFLDAAKPSAFPVTGSLFATSQKQQFTFTNSDSSKPSLFSATAQSNLFSQSPQTNFLKPVNIFGTTSAKPFSFIEASATPNALEKELIEYVISNLHSDSLMSIKEFNSNINQTLGKFSFDANIYKTAEDFPENAVRVGLMLCKNTSTCDAGVELISHLLLSKSAWNRATNAILVEMDCIKCEEKKFVPFSEDNPKMPVKVLTNVLERNSSLPNEVKTNLTVVLKNLSKKSNDATDELLKKLECCVDNLRI 705          
The following BLAST results are available for this feature:
BLAST of Ran GTPase-activating protein 1 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
RANGAP17.798e-5336.47Ran GTPase activating protein 1 [Source:HGNC Symbo... [more]
RANGAP17.798e-5336.47Ran GTPase activating protein 1 [Source:HGNC Symbo... [more]
RANGAP17.798e-5336.47Ran GTPase activating protein 1 [Source:HGNC Symbo... [more]
RANGAP14.922e-2929.51Ran GTPase activating protein 1 [Source:HGNC Symbo... [more]
RANGAP17.044e-2647.27Ran GTPase activating protein 1 [Source:HGNC Symbo... [more]
back to top
BLAST of Ran GTPase-activating protein 1 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 2
Match NameE-valueIdentityDescription
ran-21.957e-4738.83Ran GTPase-activating protein 2 [Source:UniProtKB... [more]
ran-21.961e-4738.83Ran GTPase-activating protein 2 [Source:UniProtKB... [more]
back to top
BLAST of Ran GTPase-activating protein 1 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 3
Match NameE-valueIdentityDescription
RanGAP1.193e-5743.57gene:FBgn0003346 transcript:FBtr0334175[more]
RanGAP1.452e-5743.57gene:FBgn0003346 transcript:FBtr0081234[more]
RanGAP1.452e-5743.57gene:FBgn0003346 transcript:FBtr0334174[more]
back to top
BLAST of Ran GTPase-activating protein 1 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
rangap1a3.406e-5535.78RAN GTPase activating protein 1a [Source:ZFIN;Acc:... [more]
rangap1b1.956e-5337.28Ran GTPase activating protein 1b [Source:ZFIN;Acc:... [more]
rangap1b2.129e-5337.28Ran GTPase activating protein 1b [Source:ZFIN;Acc:... [more]
rangap1b6.459e-4442.73Ran GTPase activating protein 1b [Source:ZFIN;Acc:... [more]
si:ch211-156p11.11.675e-1426.26si:ch211-156p11.1 [Source:ZFIN;Acc:ZDB-GENE-070912... [more]
back to top
BLAST of Ran GTPase-activating protein 1 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
tcf7l13.107e-5336.78transcription factor 7 like 1 [Source:Xenbase;Acc:... [more]
tcf7l14.373e-5336.78transcription factor 7 like 1 [Source:Xenbase;Acc:... [more]
tcf7l14.963e-5336.78transcription factor 7 like 1 [Source:Xenbase;Acc:... [more]
tcf7l11.835e-5137.50transcription factor 7 like 1 [Source:Xenbase;Acc:... [more]
tcf7l13.704e-2434.20transcription factor 7 like 1 [Source:Xenbase;Acc:... [more]
back to top
BLAST of Ran GTPase-activating protein 1 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Rangap13.363e-5136.47RAN GTPase activating protein 1 [Source:MGI Symbol... [more]
Rangap13.363e-5136.47RAN GTPase activating protein 1 [Source:MGI Symbol... [more]
Rangap13.363e-5136.47RAN GTPase activating protein 1 [Source:MGI Symbol... [more]
Rangap11.233e-4742.98RAN GTPase activating protein 1 [Source:MGI Symbol... [more]
Rangap14.066e-3047.97RAN GTPase activating protein 1 [Source:MGI Symbol... [more]
back to top
BLAST of Ran GTPase-activating protein 1 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q9VIW3|RAGP1_DROME1.455e-5643.57Ran GTPase-activating protein OS=Drosophila melano... [more]
sp|O13066|RAGP1_XENLA2.285e-5537.99Ran GTPase-activating protein 1 OS=Xenopus laevis ... [more]
sp|P46060|RAGP1_HUMAN3.745e-5236.47Ran GTPase-activating protein 1 OS=Homo sapiens OX... [more]
sp|P46061|RAGP1_MOUSE2.352e-5036.47Ran GTPase-activating protein 1 OS=Mus musculus OX... [more]
sp|P34342|RGP2_CAEEL2.495e-4638.83Ran GTPase-activating protein 2 OS=Caenorhabditis ... [more]
back to top
BLAST of Ran GTPase-activating protein 1 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A183A5Z94.120e-8549.03Uncharacterized protein OS=Echinostoma caproni OX=... [more]
A0A3P8G2K27.290e-8548.71Uncharacterized protein OS=Echinostoma caproni OX=... [more]
A0A4E0RKC29.051e-8547.11Ran GTPase-activating protein 1 OS=Fasciola hepati... [more]
A0A504YLS83.191e-8446.81Ran GTPase-activating protein 1 OS=Fasciola gigant... [more]
A0A4S2MDX34.897e-8447.04Uncharacterized protein OS=Opisthorchis felineus O... [more]
back to top
BLAST of Ran GTPase-activating protein 1 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
rangap1b4.997e-5035.88ran GTPase-activating protein 1-like [Source:NCBI ... [more]
rangap1a2.760e-4834.95RAN GTPase activating protein 1a [Source:ZFIN;Acc:... [more]
ENSAMXT00000050645.12.227e-825.94NLR family CARD domain-containing protein 3-like [... [more]
ENSAMXT00000035222.13.684e-729.95ribonuclease inhibitor-like [Source:NCBI gene;Acc:... [more]
ENSAMXT00000055168.15.462e-726.97pep primary_assembly:Astyanax_mexicanus-2.0:APWO02... [more]
back to top
BLAST of Ran GTPase-activating protein 1 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 1
Match NameE-valueIdentityDescription
rangap1a2.111e-4935.90RAN GTPase activating protein 1a [Source:ZFIN;Acc:... [more]
back to top
BLAST of Ran GTPase-activating protein 1 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 1
Match NameE-valueIdentityDescription
RNA13.406e-2632.77GTPase activating protein (GAP) for Gsp1p; involve... [more]
back to top
BLAST of Ran GTPase-activating protein 1 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 2
Match NameE-valueIdentityDescription
EDO316432.261e-5238.14Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO350506.303e-829.89Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Ran GTPase-activating protein 1 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 4
Match NameE-valueIdentityDescription
rangap1b9.591e-5737.17ran GTPase-activating protein 1-like [Source:NCBI ... [more]
rangap1a3.552e-4834.04Ran GTPase activating protein 1 [Source:NCBI gene;... [more]
nlrc34.090e-627.69NLR family CARD domain containing 3 [Source:NCBI g... [more]
nlrc34.090e-627.69NLR family CARD domain containing 3 [Source:NCBI g... [more]
back to top
BLAST of Ran GTPase-activating protein 1 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 1
Match NameE-valueIdentityDescription
SMESG000061064.10.000e+099.43SMESG000061064.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30015929 ID=SMED30015929|Name=Ran GTPase-activating protein 1|organism=Schmidtea mediterranea sexual|type=transcript|length=2215bp
TTCCGATCTGAAATATTTGTTTGTTTAATAGTTTTTTTTTAAAATAGTTA
TAGAGAAATTTGATATTTAATTTTTACTATTTTGTGATTTTTAAATGTTA
GAATACTTATCTTATACTGGATTGCAAAAGCAGTGGAATACGGAAGAGGA
TATAGAACACGTTGTTAAGGACTTAAATGAAAATGTAAATTGTGTCACCA
CTCTTCAACTTAGTGGAAATACTCTTGGAGTTAATGCAGCGGAAAAGTTA
ATTGAACCTTTATCTAATCAAACAAAAATACAAAAATTGATTTGGAATGA
TTTATTTACTGGTCGATTAAAATCAGAAATAAGTGTTGCTCTTTCTTCTC
TTTCTATTGGCTTAATGAGAGCACAAGTTCATTTAGTAGAATTAGATTTA
AGTGATAATGCATTCGGACCAAATGGTGTTGTTGGTGTTACAGAACTTCT
TGCAAGTTCTTGTTGCTATACTTTAAAAACTCTTAATATGAACAATCAAG
GTTTAGGTCATCAAGGCTGCAGACAACTTGTCGATGCACTTAAAAAAGCT
CGAATTAACAGTAACTACAAAGGAATGAATTTAGAAGTTTTCATAGCAGG
GAGAAATCGACTAGAAAACGCTGGAATGGAAATGTTGACTGAATTCTTTT
CGGATGGAATGACAAGTCTTAAAAAAATTGTTTTGTTACAAAATGGAATC
GGTATTCATGGTATCCAAGGCGTTGACAACCTAATTTTGTCTCTTAAAAA
TCACATAAATTTGAAGGTGCTCAATATCTCCGATAATACTATTAAACCAG
AAGGTGTTAAACGACTGTCGAAAATTCTACCATATTTTGAAGACTTAGAA
GAACTGTATTTGGGCGATTGTTTGATTAAAAACAGTGGCTTGGAACACCT
GACTAAGGTTCTTAATCAAATGAGTTTAAATTTGAAGACAGTCTCAGTGT
CTGGAAATGAAATTACTGGTCACTGTGCAATTAAATTTATTTCCAAAATT
GTGGAAACTAAACACATAATTGAGAGTATTGATTTGACGGAAAACGAAAT
TAAAAAGGTCGCTTTAAATGAAATTAAAGAAATTCTCGCTGAACATGATA
AATTGGATGCTCTGGTAGAAGATGAGGCAAACAGTGATGGCGAATTAAGT
GAAGATGAAAGTGATGATTATGAAGGCAGTGGAGATGATGATGATAGTTC
CAAAAGTTCTACTGGTGAGGAGGAATATAGCGATGAATATAGCGAAAATG
ATTCATATAAAGCTGATGAAAAAGAAGAAACCAAATTGCAAATTACTCCG
ACAGTCACACAGTCGGCTTTATTTCCAAATAAAATTGATTGCTGTAAGCC
GTCCTTGACTAATGGAACTGCCCAATCAAATCTATTTGCGCAATCCAATC
AAATAAATCCTCTAAATACTGCTAGGAATATTTTCGGATCTCAATCTGCA
AAGCCATTTTCATTTCTCGATGCTGCAAAACCATCGGCATTTCCCGTTAC
CGGTAGCCTATTTGCTACCTCACAGAAGCAACAGTTTACATTCACAAATA
GCGATTCTAGCAAGCCATCTCTCTTCAGTGCAACTGCCCAGTCGAATTTA
TTCAGTCAGTCTCCCCAAACCAACTTTTTAAAGCCCGTCAACATCTTTGG
AACGACCTCAGCAAAACCATTCTCATTTATAGAGGCGTCGGCCACTCCTA
ATGCCTTGGAGAAGGAGCTTATCGAATATGTGATATCAAATCTCCACTCG
GATTCATTGATGTCTATTAAAGAATTCAATTCTACTATTAATCAAACACT
TGGAAAATTTTCTTTTGATGCAAACATTTATAAAACTGCAGAAGATTTCC
CGGAAAATGCTGTTCGAGTCGGTTTGATGTTATGCAAGAATACCTCAACT
TGCGATGCCGGTGTGGAATTGATCAGTCACTTGTTGTTGTCTAAATCTGC
CTGGAATAGAGCGACAAATGCGATCCTTGTCGAAATGGATTGTATAAAGT
GCGAGGAGAAAAAATTTGTCCCATTCTCTGAGGATAATCCCAAAATGCCA
GTGAAAGTGTTGACAAATGTACTAGAAAGGAATTCTAGTTTACCCAATGA
AGTCAAAACCAATTTGACTGTCGTTCTGAAGAATTTATCCAAAAAGTCCA
ACGATGCTACAGATGAATTATTAAAGAAATTGGAATGTTGTGTTGACAAT
TTAAGAATTTGATGT
back to top

protein sequence of SMED30015929-orf-1

>SMED30015929-orf-1 ID=SMED30015929-orf-1|Name=SMED30015929-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=706bp
MLEYLSYTGLQKQWNTEEDIEHVVKDLNENVNCVTTLQLSGNTLGVNAAE
KLIEPLSNQTKIQKLIWNDLFTGRLKSEISVALSSLSIGLMRAQVHLVEL
DLSDNAFGPNGVVGVTELLASSCCYTLKTLNMNNQGLGHQGCRQLVDALK
KARINSNYKGMNLEVFIAGRNRLENAGMEMLTEFFSDGMTSLKKIVLLQN
GIGIHGIQGVDNLILSLKNHINLKVLNISDNTIKPEGVKRLSKILPYFED
LEELYLGDCLIKNSGLEHLTKVLNQMSLNLKTVSVSGNEITGHCAIKFIS
KIVETKHIIESIDLTENEIKKVALNEIKEILAEHDKLDALVEDEANSDGE
LSEDESDDYEGSGDDDDSSKSSTGEEEYSDEYSENDSYKADEKEETKLQI
TPTVTQSALFPNKIDCCKPSLTNGTAQSNLFAQSNQINPLNTARNIFGSQ
SAKPFSFLDAAKPSAFPVTGSLFATSQKQQFTFTNSDSSKPSLFSATAQS
NLFSQSPQTNFLKPVNIFGTTSAKPFSFIEASATPNALEKELIEYVISNL
HSDSLMSIKEFNSTINQTLGKFSFDANIYKTAEDFPENAVRVGLMLCKNT
STCDAGVELISHLLLSKSAWNRATNAILVEMDCIKCEEKKFVPFSEDNPK
MPVKVLTNVLERNSSLPNEVKTNLTVVLKNLSKKSNDATDELLKKLECCV
DNLRI*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: cellular component
TermDefinition
GO:0000775chromosome, centromeric region
GO:0000776kinetochore
GO:0000777condensed chromosome kinetochore
GO:0005634nucleus
GO:0005635nuclear envelope
GO:0005654nucleoplasm
GO:0005694chromosome
GO:0005737cytoplasm
GO:0005819spindle
GO:0005856cytoskeleton
Vocabulary: biological process
TermDefinition
GO:0007165signal transduction
GO:0043547positive regulation of GTPase activity
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000204ovary
PLANA:0000208testis
PLANA:0000429neoblast
PLANA:0002109X1 cell
Vocabulary: INTERPRO
TermDefinition
IPR032675LRR_dom_sf
IPR001611Leu-rich_rpt
Vocabulary: molecular function
TermDefinition
GO:0005515protein binding
GO:0005096GTPase activator activity
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
NoneNo IPR availableSMARTSM00368LRR_RI_2coord: 189..216
e-value: 31.0
score: 6.7
coord: 220..247
e-value: 0.65
score: 18.5
coord: 94..121
e-value: 0.22
score: 20.6
coord: 31..58
e-value: 110.0
score: 2.6
coord: 248..275
e-value: 1.5
score: 16.0
coord: 124..151
e-value: 2.7
score: 14.1
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 345..362
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 345..399
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 363..398
NoneNo IPR availablePANTHERPTHR24113FAMILY NOT NAMEDcoord: 9..400
NoneNo IPR availablePANTHERPTHR24113:SF5RAN GTPASE-ACTIVATING PROTEINcoord: 9..400
NoneNo IPR availableSUPERFAMILYSSF52047RNI-likecoord: 16..335
IPR001611Leucine-rich repeatPFAMPF13516LRR_6coord: 96..113
e-value: 0.078
score: 13.1
coord: 221..242
e-value: 0.0035
score: 17.3
IPR032675Leucine-rich repeat domain superfamilyGENE3DG3DSA:3.80.10.10coord: 5..348
e-value: 1.6E-63
score: 216.6