Gem (nuclear organelle) associated protein 5

Overview
NameGem (nuclear organelle) associated protein 5
Smed IDSMED30015917
Length (bp)3701
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Gem (nuclear organelle) associated protein 5 (SMED30015917) t-SNE clustered cells

Violin plots show distribution of expression levels for Gem (nuclear organelle) associated protein 5 (SMED30015917) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Gem (nuclear organelle) associated protein 5 (SMED30015917) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Gem (nuclear organelle) associated protein 5 (SMED30015917) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30015917

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 2

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
X1 cellSMED30015917 SmedASXL_016337SmedAsxl_ww_GCZZ01PMID:26114597
Zhu et al., 2015
FACS sorted cell population asexual adult RNA-sequencing evidence
X2 cellSMED30015917 SmedASXL_016337SmedAsxl_ww_GCZZ01PMID:26114597
Zhu et al., 2015
FACS sorted cell population asexual adult RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Gem (nuclear organelle) associated protein 5 vs. Ensembl Human
Match: GEMIN5 (gem nuclear organelle associated protein 5 [Source:HGNC Symbol;Acc:HGNC:20043])

HSP 1 Score: 198.364 bits (503), Expect = 1.335e-50
Identity = 174/643 (27.06%), Postives = 280/643 (43.55%), Query Frame = 1
Query:  532 GFDKGSLLTWNFQKDSEYKTFCTKNGDINQITCK---DNRFAIAHKKGFVDIYLLNSYDSITKITQFRAHHSDVCNIEWNPIES------NLETWGD--------------------LATTGKDHQVKLWKIDKNYNVKTLNLPSSWNKQNPKSFIEKD----NAVSHNSQWSSICWSTVNNGTLIASNGYGNIGTWKSLSSTELKY--FSQTNTTKPHCKSVFGIKEFR--NHSGIFLSHSLDRLLNVSRINEQAKDGEYVLSMPCLGGSIMSL--DAVDKNNQLAIGGSDNLIRLWRFETQSNRKSFEVTNIWDGINGKILAISWHPFREGLLAFGTDTGTVGLVNISKDKKLAIASKLLHQNKVFITNWAVDIRKNFNGVTEEELKENLVIYSVG-NGRLYGHDFRQ--NQYFDASHLVXXXXXXXXXXXXDELMVSDFTMHWSLGYFAVGYGNGLVNIYATKLDKSDLVLICQIKTHSKGINCMRWS-PNSNEAAGRYRLAIGSNERFLTVTDLGKVVIDFESSNRQQWTVVTFNETLAKFKGHGDRITGIDWCPFDSNRIVTSSYDHTAFVWSVLDNTPIVSFNHHQGKVFCCKWSTRDPDLIYTGGEDSNLFAW--------RPSQQTLKTELNRRR 2307
            G +KG +  + F ++     F      I  +TC    ++  AI +K G V I  ++    +  I + R H  ++ +I W P+        N E   +                    LAT  KD  +++W   +   V  L LP          F+++     +       W ++ W +     L++S   G +  W    S   KY  FS ++  + H + VF +   +  +   + LS S+DR +    I       E   ++P LGG   SL   +VD  + LAIG  D +IR+W   T S + +++V N W G+  K+ A+ WHP +EG LAFGTD G VGL +   +K   I+S   H+  V+   W   +     G   E  + +L +YS G  G +  H+  +   + FD + L+               + ++ +        A+G  +G + I+       +L LIC I+ H K +N + W   + ++    Y +A GSN   + V +L  V+   ESS     + VT  E      GH  +IT + W P    R+V++SYD TA VW  L   P+ +F  H+G++ C  WS  DPD IY+G +D  +  W        RP Q     EL ++R
Sbjct:  128 GDEKGVVFCYWFNRNDSQHLFIEPR-TIFCLTCSPHHEDLVAIGYKDGIVVIIDISKKGEV--IHRLRGHDDEIHSIAWCPLPGEDCLSINQEETSEEAEITNGNAVAQAPVTKGCYLATGSKDQTIRIWSCSRGRGVMILKLP----------FLKRRGGGIDPTVKERLWLTLHWPSNQPTQLVSSCFGGELLQWDLTQSWRRKYTLFSASSEGQNHSRIVFNLCPLQTEDDKQLLLSTSMDRDVKCWDIATL----ECSWTLPSLGGFAYSLAFSSVDIGS-LAIGVGDGMIRVWN--TLSIKNNYDVKNFWQGVKSKVTALCWHPTKEGCLAFGTDDGKVGLYDTYSNKPPQISSTY-HKKTVYTLAWGPPVPPMSLG--GEGDRPSLALYSCGGEGIVLQHNPWKLSGEAFDINKLIRDTNSIKYKLP----VHTEISWKADGKIMALGNEDGSIEIFQI----PNLKLICTIQQHHKLVNTISWHHEHGSQPELSYLMASGSNNAVIYVHNLKTVI---ESSPE---SPVTITEPYRTLSGHTAKITSVAWSPHHDGRLVSASYDGTAQVWDALREEPLCNFRGHRGRLLCVAWSPLDPDCIYSGADDFCVHKWLTSMQDHSRPPQGKKSIELEKKR 733          
BLAST of Gem (nuclear organelle) associated protein 5 vs. Ensembl Fly
Match: Pex7 (gene:FBgn0035922 transcript:FBtr0076568)

HSP 1 Score: 54.299 bits (129), Expect = 3.683e-7
Identity = 47/187 (25.13%), Postives = 75/187 (40.11%), Query Frame = 1
Query: 1735 MHWSLGYFAVGYGNGLVNIYATKLDKSDLVLICQIKTHS--------KGINCMRWSPNSNEAAGRYRLAIGSNERFLTV-TDLGKVVIDFESSNRQQWTVVTFNETLAKFKGHGDRITGIDWCPFDSNRIVTSSYDHTAFVWSVLD--NTPIVSFNHHQGKVFCCKWSTRDPDLIYTGGEDSNLFAW 2262
            + WS G F V +     +I AT      L + C +   S        + + C++   + NE    Y L  G    + T+ +      +     NRQ         ++  F GH D I G  + P  +N   + S D    +W+ LD    P++S   H  +  CC WS  D +++ TGG D  +  W
Sbjct:   67 LEWSDGLFDVAWCPYAADIAATASGDGSLQIWCGLDGESASNQLTPKQPLICLQ--EHKNEV---YSLDWGEKWNYHTLLSGSWDCTLKLWDCNRQN--------SITTFVGHNDLIYGAKFSPLIANLFASVSTDGHLNLWNSLDFAGKPLMSIEAHASEALCCDWSHFDRNVLVTGGSDGLIRGW 240          
BLAST of Gem (nuclear organelle) associated protein 5 vs. Ensembl Fly
Match: Pex7 (gene:FBgn0035922 transcript:FBtr0273328)

HSP 1 Score: 54.299 bits (129), Expect = 3.683e-7
Identity = 47/187 (25.13%), Postives = 75/187 (40.11%), Query Frame = 1
Query: 1735 MHWSLGYFAVGYGNGLVNIYATKLDKSDLVLICQIKTHS--------KGINCMRWSPNSNEAAGRYRLAIGSNERFLTV-TDLGKVVIDFESSNRQQWTVVTFNETLAKFKGHGDRITGIDWCPFDSNRIVTSSYDHTAFVWSVLD--NTPIVSFNHHQGKVFCCKWSTRDPDLIYTGGEDSNLFAW 2262
            + WS G F V +     +I AT      L + C +   S        + + C++   + NE    Y L  G    + T+ +      +     NRQ         ++  F GH D I G  + P  +N   + S D    +W+ LD    P++S   H  +  CC WS  D +++ TGG D  +  W
Sbjct:   67 LEWSDGLFDVAWCPYAADIAATASGDGSLQIWCGLDGESASNQLTPKQPLICLQ--EHKNEV---YSLDWGEKWNYHTLLSGSWDCTLKLWDCNRQN--------SITTFVGHNDLIYGAKFSPLIANLFASVSTDGHLNLWNSLDFAGKPLMSIEAHASEALCCDWSHFDRNVLVTGGSDGLIRGW 240          
BLAST of Gem (nuclear organelle) associated protein 5 vs. Ensembl Zebrafish
Match: gemin5 (gem (nuclear organelle) associated protein 5 [Source:ZFIN;Acc:ZDB-GENE-031112-9])

HSP 1 Score: 206.068 bits (523), Expect = 2.861e-53
Identity = 182/757 (24.04%), Postives = 325/757 (42.93%), Query Frame = 1
Query:  115 LINSPLWYVSNILDTFDWNYEEKAGVFFYGSRNQIYFIKVHESTNSLKSYFNLKLHYYMKAHHDYITGVSAIINGTSILFNEVRIQPRLVSCGKDKMIRIWSFNEDTGCCCLKEFNISSTDIRSDPTCXXXXXXXXXXCGFDKGSLLTWNFQKDSEYKTFCTKNGDINQITCK---DNRFAIAHKKGFVDIYLLNSYDSITKITQFRAHHSDVCNIEWNPIESNLETWGD--------------------LATTGKDHQVKLWKIDKNYNVKTLNLPSSWNKQNPKSFIEKDNA----VSHNSQWSSICWSTVNNGTLIASNGYGNIGTWKSLSSTELKY--FSQTNTTKPHCKSVFGIKEFR-NHSGIFLSHSLDRLLNVSRINEQAKDGEYVLSMPCLGGSIMSLD-AVDKNNQLAIGGSDNLIRLWRFETQSNRKSFEVTNIWDGINGKILAISWHPFREGLLAFGTDTGTVGLVNISKDKKLAIASKLLHQNKVFITNWAVDIRK-NFNGVTEEELKENLVIYS-VGNGRLYGHDF--RQNQYFDASHLVXXXXXXXXXXXXDELMVSDFTMHWSLGYFAVGYGNGLVNIYATKLDKSDLVLICQIKTHSKGINCMRW-SPNSNEAAGRYRLAIGSNERFLTVTDLGKVVIDFESSNRQQWTVVTFNETLAKFKGHGDRITGIDWCPFDSNRIVTSSYDHTAFVWSVLDNTPIVSFNHHQGKVFCCKWSTRDPDLIYTGGEDSNLFAWRPSQQ 2277
            L  SP WY S   D          GVF +G++N +Y + V  ++ ++                  + G +  ++G +   NE + +    S   DK ++IW   +      LKE N+    I +     +     +++ G +KG ++ + F  + + ++F  +   I  ++C    +N  A+ +K G + +  ++    +  + + R H  ++  + W P       +G                     LA+  +D  +++W   +   V TL LP          F+++  A          W ++ W       +++S   G I  W  + S + K+     ++  + H + VF +  FR     + LS S+DR +    +       E   ++P LGG +  L  +      LA+G  D++IR+W   T S +  +++   W GI  K+ A++WHP +EG LAFGTD G VG+  +  ++   I+S   H+  V+  +W   +   +F G  +   K    +YS  G G ++ HD      +  +   L+                 +D +        A+G  +G + +    +    L L+C ++ H K IN +RW   +S++   +Y LA GS+   + + DL   V   ES +    + V+  E      GH ++IT + W P     +VT  YD TA VW VL   P+ ++  H G++ C +WS   PDLI+TGG+D  L  W  S+Q
Sbjct:    6 LPASPNWYCSRCSDI------NSKGVFGFGAKNTVYLLNVTAASPAVTGE---------------LAGHTERVSGFAFCPNEGQ-EHICCSTSDDKKVKIWDAEQKI---LLKEHNVHQNTITA--VHWSPVQKLLLVTGDEKGIVVCYWFSSN-DTQSFFPEPRTIFCLSCSPHDENLIAVGYKDGMIAVIDISKKGEV--VHRLRGHDDEIHALAWCPRPREEPLYGRSEDNADGSSGVTEGAEAGCYLASGSRDQTMRIWSTARRKGVMTLKLP----------FLKRRGAGVDPTVKERLWLTVHWPKERPSQIVSSCFGGEIVVWDLMKSGKQKWSLLGSSSDGQNHSRIVFNMSSFRCGDRELLLSTSMDREIKCWDLESL----ECCWTLPTLGGFVYCLSFSPVGTGCLALGVGDSMIRVWN--TLSIQNQYDIKTFWQGIKSKVTALAWHPLKEGSLAFGTDDGKVGIYEVYSNRPPQISST-YHRRTVYSLSWGPPLPPMSFGGAGD---KPAYSLYSCAGEGVIFQHDPWKLSGEASNIDKLIRDTNNIKHKMPPH----TDLSWKPDGSILAIGNEDGSIEVLKAPM----LKLLCTVQQHHKIINSLRWHHQHSSQNELQYLLASGSSNATIYIHDLRSAV---ESPSE---SPVSVTEPFRTLSGHTNKITDLAWSPHHDGHLVTVCYDGTAQVWDVLKEEPVCNYRGHSGRLLCVQWSAVHPDLIWTGGDDFTLQEWAVSKQ 698          
BLAST of Gem (nuclear organelle) associated protein 5 vs. Ensembl Zebrafish
Match: coro6 (coronin 6 [Source:ZFIN;Acc:ZDB-GENE-040426-1202])

HSP 1 Score: 54.299 bits (129), Expect = 6.457e-7
Identity = 27/81 (33.33%), Postives = 39/81 (48.15%), Query Frame = 1
Query: 2041 GHGDRITGIDWCPFDSNRIVTSSYDHTAFVWSVLDNT-------PIVSFNHHQGKVFCCKWSTRDPDLIYTGGEDSNLFAW 2262
            GH   +  IDWCP + N + + S D TA VW + D+T       PIV    H  +V   KW     +++ T G D+ +  W
Sbjct:   13 GHSGPVLDIDWCPHNDNILASCSEDTTAMVWQIPDHTPSRPISEPIVVLEGHSKRVGIIKWHPTARNILLTAGSDNLIIIW 93          
BLAST of Gem (nuclear organelle) associated protein 5 vs. Ensembl Zebrafish
Match: coro6 (coronin 6 [Source:ZFIN;Acc:ZDB-GENE-040426-1202])

HSP 1 Score: 54.299 bits (129), Expect = 6.538e-7
Identity = 27/81 (33.33%), Postives = 39/81 (48.15%), Query Frame = 1
Query: 2041 GHGDRITGIDWCPFDSNRIVTSSYDHTAFVWSVLDNT-------PIVSFNHHQGKVFCCKWSTRDPDLIYTGGEDSNLFAW 2262
            GH   +  IDWCP + N + + S D TA VW + D+T       PIV    H  +V   KW     +++ T G D+ +  W
Sbjct:   79 GHSGPVLDIDWCPHNDNILASCSEDTTAMVWQIPDHTPSRPISEPIVVLEGHSKRVGIIKWHPTARNILLTAGSDNLIIIW 159          
BLAST of Gem (nuclear organelle) associated protein 5 vs. Ensembl Xenopus
Match: GEMIN5 (gem nuclear organelle associated protein 5 [Source:NCBI gene;Acc:100493267])

HSP 1 Score: 186.037 bits (471), Expect = 5.915e-47
Identity = 214/919 (23.29%), Postives = 377/919 (41.02%), Query Frame = 1
Query:  118 INSPLWYVSNILDTFDWNYEEKAGVFFYGSRNQIYFIKVHESTNSLKSYFNLKLHYYMKAHHDYITGVSAIINGTSILFNEVRIQPRL-VSCGKDKMIRIWSFNEDTGCCCLKEFNISSTDIRSDPTCXXXXXXXXXXCGFDKGSLLT-WNFQKDSEYKTFCTKNGDINQITC---KDNRFAIAHKKGFVDIYLLNSYDSITKITQFRAHHSDVCNIEWNP------IESNLETWGD-------------LATTGKDHQVKLWKIDKNYNVKTLNLPSSWNKQNPKSFIEKDNAVSHNSQWSSICWSTVNNGTLIASNGYGNIGTWKSLSSTELKY-FSQTNTTKPHCKSVFGIKEFRNHSG--IFLSHSLDRLLNVSRINEQAKDGEYVLSMPCLGGSIMSLD-AVDKNNQLAIGGSDNLIRLWRFETQSNRKSFEVTNIWDGINGKILAISWHPFREGLLAFGTDTGTVGLVNISKDKKLAIASKLLHQNKVFITNWAVDIRKNFNGVTEEELKENLVIYSVG-NGRLYGHDFRQNQYFDASHLVXXXXXXXXXXXXDELMVSDFTMHWSLG--YFAVGYGNGLVNIYATKLDKSDLVLICQIKTHSKGINCMRWS-PNSNEAAGRYRLAIGSNERFLTVTDLGKVVIDFESSNRQQWTVVTFNETLAKFKGHGDRITGIDWCPFDSNRIVTSSYDHTAFVWSVLDNTPIVSFNHHQGKVFCCKWSTRDPDLIYTGGEDSNLFAW--------RPSQQTLKTELNRRRQF-------------VPALPGVTTINKITGETPESVPVTDPKESIKNAIPTKEIAIK-----TGFMKKRS-SLFPLTIFSVHHPLETYQNSIIDFISGNESY----LPCLSILDSRSIIINQIEVELIHHREEKNFDNYFILLIWMGKI 2685
            + SP WY S   D          G+F + +RN +Y + +    N  +  F     Y +  H D ++G +         F+    Q  L  S   D  +++W          + E ++  + I +     +    ++++ G +KG L+  W  + DS+   F  +   I  ++C   K++  AI +K G + +  ++    +  + + R H  ++  +EW+P      ++  LE   +             LA+  KD  V++W       V  L LP  + K+        D A+     W ++ W   ++  +++S   G +  W    S + K+    T+  + H + VF +       G  + LS S+DR +    +   +       S+  LGG + SL  +      LA+G  D++IR+W   T S   +++V  +W GI  K+ A+SWHP +EG LAFGT+ G VG+  +   K   I S   H+  V+  +W   +     G   E  +    +YS G  G +Y H    N +               +      + +   + W     Y A+G  +G + ++ T+     L LIC I+ H K +N +RW   +S +    + LA GSN   + V +L   + +   S       VT  E      GH  +IT + W P    R+V++SYD TA VW VL   P+ ++  H+G++   +WS  +PD ++TG +D  L +W        RP +    TEL ++R                P       + +   E+P +   T  +E      P  E A +         KK+S SL P++    H   E      +   +    +       L +   R+ + + +E E   H E  + +    +++W G +
Sbjct:    7 LASPNWYCSRSSDA-------AGGLFGFAARNSVYLLNI----NLQEPGF-----YELVGHTDRVSGFA---------FSHFSGQSHLCASSSDDGTVKVWDTQTKN---TVTEHHLHRSTIAA--LHWSPLVKDLLVSGDEKGVLVCFWCNRNDSQ--QFFPEPRTIFCLSCSPHKEDIVAIGYKDGMIVLVDISRRGDV--LHRLRGHEEEIHCLEWSPHALECDLQQKLEETANGELLPETENRRCYLASGSKDQTVRIWSASTG-KVTVLKLP--YLKRRGGGV---DPAIKER-LWLTLHWPPGHSTQILSSCFGGELLLWDLTKSGKQKWTLLGTSDGQNHSRIVFNLCSVVTEEGKELLLSTSMDRDVKCWDLGSLS----CCWSLTSLGGFVYSLAFSPVAAGSLAVGVGDSMIRVWN--TMSVVNAYDVKTLWQGIRSKVTALSWHPTKEGSLAFGTEDGKVGIFEVYISKPPQI-SATYHKKTVYSLSWGPLLPPFSFGA--EGDRPTYTLYSCGGEGVIYQH----NPWKLTDEASNINKLIRDTNDIKHKLPAHTELSWRPDGQYLAIGNEDGTIEVFHTQ----RLQLICTIQQHHKLVNAVRWHHGHSQDPDLNFLLASGSNNATVYVHNLKGPLENPTDSP------VTITEPFRTLPGHTAKITSLSWSPHHDARLVSASYDGTAQVWDVLQEEPLSNYRGHKGRLLSVQWSPVEPDQVWTGADDFCLHSWSVSKQEHSRPPKGKKATELEKKRTLQPKPKAKKKKKLDTPKEEAGREVQRGEKESPLTQNGTSDQEE-GQGTPEPEAADRGLHEDLQIRKKKSRSLLPISTSKDHRSKEEQHRDCVKLATVKSHFHSEDTMHLGLYSDRAALYHLMEEEGKAHLENGHPELQHQIMLWKGDL 860          
BLAST of Gem (nuclear organelle) associated protein 5 vs. Ensembl Xenopus
Match: GEMIN5 (gem nuclear organelle associated protein 5 [Source:NCBI gene;Acc:100493267])

HSP 1 Score: 184.111 bits (466), Expect = 2.410e-46
Identity = 214/924 (23.16%), Postives = 378/924 (40.91%), Query Frame = 1
Query:  115 LINSPLWYVSNILDTFDWNYEEKAGVFFYGSRNQIYFIKVHESTNSLKSYFNLKLHYYMKAHHDYITGVSAIINGTSILFNEVRIQPRL-VSCGKDKMIRIWSFNEDTGCCCLKEFNISSTDIRSDPTCXXXXXXXXXXCGFDKGSLLT-WNFQKDSEYKTFCTKNGDINQITC---KDNRFAIAHKKGFVDIYLLNSYDSITKITQFRAHHSDVCNIEWNP--IESNLETWGD---------------------LATTGKDHQVKLWKIDKNYNVKTLNLPSSWNKQNPKSFIEKDNAVSHNSQWSSICWSTVNNGTLIASNGYGNIGTWKSLSSTELKY-FSQTNTTKPHCKSVFGIKEFRNHSG--IFLSHSLDRLLNVSRINEQAKDGEYVLSMPCLGGSIMSLD-AVDKNNQLAIGGSDNLIRLWRFETQSNRKSFEVTNIWDGINGKILAISWHPFREGLLAFGTDTGTVGLVNISKDKKLAIASKLLHQNKVFITNWAVDIRKNFNGVTEEELKENLVIYSVG-NGRLYGHDFRQNQYFDASHLVXXXXXXXXXXXXDELMVSDFTMHWSLG--YFAVGYGNGLVNIYATKLDKSDLVLICQIKTHSKGINCMRWS-PNSNEAAGRYRLAIGSNERFLTVTDLGKVVIDFESSNRQQWTVVTFNETLAKFKGHGDRITGIDWCPFDSNRIVTSSYDHTAFVWSVLDNTPIVSFNHHQGKVFCCKWSTRDPDLIYTGGEDSNLFAW--------RPSQQTLKTELNRRRQF-------------VPALPGVTTINKITGETPESVPVTDPKESIKNAIPTKEIAIK-----TGFMKKRS-SLFPLTIFSVHHPLETYQNSIIDFISGNESY----LPCLSILDSRSIIINQIEVELIHHREEKNFDNYFILLIWMGKI 2685
            L  SP WY S   D          G+F + +RN +Y + +    N  +  F    +  +  H D ++G +         F+    Q  L  S   D  +++W          + E ++  + I +     +    ++++ G +KG L+  W  + DS+   F  +   I  ++C   K++  AI +K G + +  ++    +  + + R H  ++  +EW+P  +E +L+   +                     LA+  KD  V++W       V  L LP  + K+        D A+     W ++ W   ++  +++S   G +  W    S + K+    T+  + H + VF +       G  + LS S+DR +    +   +       S+  LGG + SL  +      LA+G  D++IR+W   T S   +++V  +W GI  K+ A+SWHP +EG LAFGT+ G VG+  +   K   I S   H+  V+  +W   +     G   E  +    +YS G  G +Y H    N +               +      + +   + W     Y A+G  +G + ++ T+     L LIC I+ H K +N +RW   +S +    + LA GSN   + V +L   + +   S       VT  E      GH  +IT + W P    R+V++SYD TA VW VL   P+ ++  H+G++   +WS  +PD ++TG +D  L +W        RP +    TEL ++R                P       + +   E+P +   T  +E      P  E A +         KK+S SL P++    H   E      +   +    +       L +   R+ + + +E E   H E  + +    +++W G +
Sbjct:    8 LSASPNWYCSRSSDA-------AGGLFGFAARNSVYLLNI----NLQEPGF----YGELVGHTDRVSGFA---------FSHFSGQSHLCASSSDDGTVKVWDTQTKN---TVTEHHLHRSTIAA--LHWSPLVKDLLVSGDEKGVLVCFWCNRNDSQ--QFFPEPRTIFCLSCSPHKEDIVAIGYKDGMIVLVDISRRGDV--LHRLRGHEEEIHCLEWSPHALECDLQQKLEETEINTANGELLPETENRRCYLASGSKDQTVRIWSASTGKAVTVLKLP--YLKRRGGGV---DPAIKER-LWLTLHWPPGHSTQILSSCFGGELLLWDLTKSGKQKWTLLGTSDGQNHSRIVFNLCSVVTEEGKELLLSTSMDRDVKCWDLGSLS----CCWSLTSLGGFVYSLAFSPVAAGSLAVGVGDSMIRVWN--TMSVVNAYDVKTLWQGIRSKVTALSWHPTKEGSLAFGTEDGKVGIFEVYISKPPQI-SATYHKKTVYSLSWGPLLPPFSFGA--EGDRPTYTLYSCGGEGVIYQH----NPWKLTDEASNINKLIRDTNDIKHKLPAHTELSWRPDGQYLAIGNEDGTIEVFHTQ----RLQLICTIQQHHKLVNAVRWHHGHSQDPDLNFLLASGSNNATVYVHNLKGPLENPTDSP------VTITEPFRTLPGHTAKITSLSWSPHHDARLVSASYDGTAQVWDVLQEEPLSNYRGHKGRLLSVQWSPVEPDQVWTGADDFCLHSWSVSKQEHSRPPKGKKATELEKKRTLQPKPKAKKKKKLDTPKEEAGREVQRGEKESPLTQNGTSDQEE-GQGTPEPEAADRGLHEDLQIRKKKSRSLLPISTSKDHRSKEEQHRDCVKLATVKSHFHSEDTMHLGLYSDRAALYHLMEEEGKAHLENGHPELQHQIMLWKGDL 868          
BLAST of Gem (nuclear organelle) associated protein 5 vs. Ensembl Xenopus
Match: GEMIN5 (gem nuclear organelle associated protein 5 [Source:NCBI gene;Acc:100493267])

HSP 1 Score: 182.956 bits (463), Expect = 4.924e-46
Identity = 216/926 (23.33%), Postives = 375/926 (40.50%), Query Frame = 1
Query:  115 LINSPLWYVSNILDTFDWNYEEKAGVFFYGSRNQIYFIKVHESTNSLKSYFNLK---LHYYMKAHHDYITGVSAIINGTSILFNEVRIQPRL-VSCGKDKMIRIWSFNEDTGCCCLKEFNISSTDIRS---DPTCXXXXXXXXXXCGFDKGSLLT-WNFQKDSEYKTFCTKNGDINQITC---KDNRFAIAHKKGFVDIYLLNSYDSITKITQFRAHHSDVCNIEWNP------IESNLETWGD-------------LATTGKDHQVKLWKIDKNYNVKTLNLPSSWNKQNPKSFIEKDNAVSHNSQWSSICWSTVNNGTLIASNGYGNIGTWKSLSSTELKY-FSQTNTTKPHCKSVFGIKEFRNHSG--IFLSHSLDRLLNVSRINEQAKDGEYVLSMPCLGGSIMSLD-AVDKNNQLAIGGSDNLIRLWRFETQSNRKSFEVTNIWDGINGKILAISWHPFREGLLAFGTDTGTVGLVNISKDKKLAIASKLLHQNKVFITNWAVDIRKNFNGVTEEELKENLVIYSVG-NGRLYGHDFRQNQYFDASHLVXXXXXXXXXXXXDELMVSDFTMHWSLG--YFAVGYGNGLVNIYATKLDKSDLVLICQIKTHSKGINCMRWS-PNSNEAAGRYRLAIGSNERFLTVTDLGKVVIDFESSNRQQWTVVTFNETLAKFKGHGDRITGIDWCPFDSNRIVTSSYDHTAFVWSVLDNTPIVSFNHHQGKVFCCKWSTRDPDLIYTGGEDSNLFAW--------RPSQQTLKTELNRRRQF-------------VPALPGVTTINKITGETPESVPVTDPKESIKNAIPTKEIAIK-----TGFMKKRS-SLFPLTIFSVHHPLETYQNSIIDFISGNESY----LPCLSILDSRSIIINQIEVELIHHREEKNFDNYFILLIWMGKI 2685
            L  SP WY S   D          G+F + +RN +Y + +           NL+    +  +  H D ++G +         F+    Q  L  S   D  +++W          + E ++  + I +    P    +  S     G +KG L+  W  + DS+   F  +   I  ++C   K++  AI +K G + +  ++    +  + + R H  ++  +EW+P      ++  LE   +             LA+  KD  V++W       V  L LP  + K+        D A+     W ++ W   ++  +++S   G +  W    S + K+    T+  + H + VF +       G  + LS S+DR +    +   +       S+  LGG + SL  +      LA+G  D++IR+W   T S   +++V  +W GI  K+ A+SWHP +EG LAFGT+ G VG+  +   K   I S   H+  V+  +W   +     G   E  +    +YS G  G +Y H    N +               +      + +   + W     Y A+G  +G + ++ T+     L LIC I+ H K +N +RW   +S +    + LA GSN   + V +L   + +   S       VT  E      GH  +IT + W P    R+V++SYD TA VW VL   P+ ++  H+G++   +WS  +PD ++TG +D  L +W        RP +    TEL ++R                P       + +   E+P +   T  +E      P  E A +         KK+S SL P++    H   E      +   +    +       L +   R+ + + +E E   H E  + +    +++W G +
Sbjct:    8 LSASPNWYCSRSSDA-------AGGLFGFAARNSVYLLNI-----------NLQEPGFYGELVGHTDRVSGFA---------FSHFSGQSHLCASSSDDGTVKVWDTQTKN---TVTEHHLHRSTIAALHWSPLVKDLLVS-----GDEKGVLVCFWCNRNDSQ--QFFPEPRTIFCLSCSPHKEDIVAIGYKDGMIVLVDISRRGDV--LHRLRGHEEEIHCLEWSPHALECDLQQKLEETANGELLPETENRRCYLASGSKDQTVRIWSASTG-KVTVLKLP--YLKRRGGGV---DPAIKER-LWLTLHWPPGHSTQILSSCFGGELLLWDLTKSGKQKWTLLGTSDGQNHSRIVFNLCSVVTEEGKELLLSTSMDRDVKCWDLGSLS----CCWSLTSLGGFVYSLAFSPVAAGSLAVGVGDSMIRVWN--TMSVVNAYDVKTLWQGIRSKVTALSWHPTKEGSLAFGTEDGKVGIFEVYISKPPQI-SATYHKKTVYSLSWGPLLPPFSFGA--EGDRPTYTLYSCGGEGVIYQH----NPWKLTDEASNINKLIRDTNDIKHKLPAHTELSWRPDGQYLAIGNEDGTIEVFHTQ----RLQLICTIQQHHKLVNAVRWHHGHSQDPDLNFLLASGSNNATVYVHNLKGPLENPTDSP------VTITEPFRTLPGHTAKITSLSWSPHHDARLVSASYDGTAQVWDVLQEEPLSNYRGHKGRLLSVQWSPVEPDQVWTGADDFCLHSWSVSKQEHSRPPKGKKATELEKKRTLQPKPKAKKKKKLDTPKEEAGREVQRGEKESPLTQNGTSDQEE-GQGTPEPEAADRGLHEDLQIRKKKSRSLLPISTSKDHRSKEEQHRDCVKLATVKSHFHSEDTMHLGLYSDRAALYHLMEEEGKAHLENGHPELQHQIMLWKGDL 863          
BLAST of Gem (nuclear organelle) associated protein 5 vs. Ensembl Xenopus
Match: GEMIN5 (gem nuclear organelle associated protein 5 [Source:NCBI gene;Acc:100493267])

HSP 1 Score: 182.956 bits (463), Expect = 6.550e-46
Identity = 191/773 (24.71%), Postives = 329/773 (42.56%), Query Frame = 1
Query:  115 LINSPLWYVSNILDTFDWNYEEKAGVFFYGSRNQIYFIKVHESTNSLKSYFNLKLHYYMKAHHDYITGVSAIINGTSILFNEVRIQPRL-VSCGKDKMIRIWSFNEDTGCCCLKEFNISSTDIRSDPTCXXXXXXXXXXCGFDKGSLLT-WNFQKDSEYKTFCTKNGDINQITC---KDNRFAIAHKKGFVDIYLLNSYDSITKITQFRAHHSDVCNIEWNP---------IESNLETWGD------------LATTGKDHQVKLWKIDKNYNVKTLNLPSSWNKQNPKSFIEKDNAVSHNSQWSSICWSTVNNGTLIASNGYGNIGTWKSLSSTELKY-FSQTNTTKPHCKSVFGIKEFRNHSG--IFLSHSLDRLLNVSRINEQAKDGEYVLSMPCLGGSIMSLD-AVDKNNQLAIGGSDNLIRLWRFETQSNRKSFEVTNIWDGINGKILAISWHPFREGLLAFGTDTGTVGLVNISKDKKLAIASKLLHQNKVFITNWAVDIRKNFNGVTEEELKENLVIYSVG-NGRLYGHDFRQNQYFDASHLVXXXXXXXXXXXXDELMVSDFTMHWSLG--YFAVGYGNGLVNIYATKLDKSDLVLICQIKTHSKGINCMRWS-PNSNEAAGRYRLAIGSNERFLTVTDLGKVVIDFESSNRQQWTVVTFNETLAKFKGHGDRITGIDWCPFDSNRIVTSSYDHTAFVWSVLDNTPIVSFNHHQGKVFCCKWSTRDPDLIYTGGEDSNLFAW--------RPSQQTLKTELNRRR 2307
            L  SP WY S   D          G+F + +RN +Y + +    N  +  F  +L      H D ++G +         F+    Q  L  S   D  +++W          + E ++  + I +     +    ++++ G +KG L+  W  + DS+   F  +   I  ++C   K++  AI +K G + +  ++    +  + + R H  ++  +EW+P         +E  + T               LA+  KD  V++W       V  L LP  + K+        D A+     W ++ W   ++  +++S   G +  W    S + K+    T+  + H + VF +       G  + LS S+DR +    +   +       S+  LGG + SL  +      LA+G  D++IR+W   T S   +++V  +W GI  K+ A+SWHP +EG LAFGT+ G VG+  +   K   I S   H+  V+  +W   +     G   E  +    +YS G  G +Y H    N +               +      + +   + W     Y A+G  +G + ++ T+     L LIC I+ H K +N +RW   +S +    + LA GSN   + V +L   + +   S       VT  E      GH  +IT + W P    R+V++SYD TA VW VL   P+ ++  H+G++   +WS  +PD ++TG +D  L +W        RP +    TEL ++R
Sbjct:    8 LSASPNWYCSRSSDA-------AGGLFGFAARNSVYLLNI----NLQEPGFYGEL----VGHTDRVSGFA---------FSHFSGQSHLCASSSDDGTVKVWDTQTKN---TVTEHHLHRSTIAA--LHWSPLVKDLLVSGDEKGVLVCFWCNRNDSQ--QFFPEPRTIFCLSCSPHKEDIVAIGYKDGMIVLVDISRRGDV--LHRLRGHEEEIHCLEWSPHALEYQKESVEHKINTANGELLPETENRRCYLASGSKDQTVRIWSASTGKAVTVLKLP--YLKRRGGGV---DPAIKER-LWLTLHWPPGHSTQILSSCFGGELLLWDLTKSGKQKWTLLGTSDGQNHSRIVFNLCSVVTEEGKELLLSTSMDRDVKCWDLGSLS----CCWSLTSLGGFVYSLAFSPVAAGSLAVGVGDSMIRVWN--TMSVVNAYDVKTLWQGIRSKVTALSWHPTKEGSLAFGTEDGKVGIFEVYISKPPQI-SATYHKKTVYSLSWGPLLPPFSFGA--EGDRPTYTLYSCGGEGVIYQH----NPWKLTDEASNINKLIRDTNDIKHKLPAHTELSWRPDGQYLAIGNEDGTIEVFHTQ----RLQLICTIQQHHKLVNAVRWHHGHSQDPDLNFLLASGSNNATVYVHNLKGPLENPTDSP------VTITEPFRTLPGHTAKITSLSWSPHHDARLVSASYDGTAQVWDVLQEEPLSNYRGHKGRLLSVQWSPVEPDQVWTGADDFCLHSWSVSKQEHSRPPKGKKATELEKKR 718          
BLAST of Gem (nuclear organelle) associated protein 5 vs. Ensembl Xenopus
Match: GEMIN5 (gem nuclear organelle associated protein 5 [Source:NCBI gene;Acc:100493267])

HSP 1 Score: 182.956 bits (463), Expect = 6.714e-46
Identity = 190/775 (24.52%), Postives = 331/775 (42.71%), Query Frame = 1
Query:  115 LINSPLWYVSNILDTFDWNYEEKAGVFFYGSRNQIYFIKVHESTNSLKSYFNLKLHYYMKAHHDYITGVSAIINGTSILFNEVRIQPRL-VSCGKDKMIRIWSFNEDTGCCCLKEFNISSTDIRSDPTCXXXXXXXXXXCGFDKGSLLT-WNFQKDSEYKTFCTKNGDINQITC---KDNRFAIAHKKGFVDIYLLNSYDSITKITQFRAHHSDVCNIEWNP--IESNLETWGD---------------------LATTGKDHQVKLWKIDKNYNVKTLNLPSSWNKQNPKSFIEKDNAVSHNSQWSSICWSTVNNGTLIASNGYGNIGTWKSLSSTELKY-FSQTNTTKPHCKSVFGIKEFRNHSG--IFLSHSLDRLLNVSRINEQAKDGEYVLSMPCLGGSIMSLD-AVDKNNQLAIGGSDNLIRLWRFETQSNRKSFEVTNIWDGINGKILAISWHPFREGLLAFGTDTGTVGLVNISKDKKLAIASKLLHQNKVFITNWAVDIRKNFNGVTEEELKENLVIYSVG-NGRLYGHDFRQNQYFDASHLVXXXXXXXXXXXXDELMVSDFTMHWSLG--YFAVGYGNGLVNIYATKLDKSDLVLICQIKTHSKGINCMRWS-PNSNEAAGRYRLAIGSNERFLTVTDLGKVVIDFESSNRQQWTVVTFNETLAKFKGHGDRITGIDWCPFDSNRIVTSSYDHTAFVWSVLDNTPIVSFNHHQGKVFCCKWSTRDPDLIYTGGEDSNLFAW--------RPSQQTLKTELNRRR 2307
            L  SP WY S   D          G+F + +RN +Y + +    N  +  F    +  +  H D ++G +         F+    Q  L  S   D  +++W          + E ++  + I +     +    ++++ G +KG L+  W  + DS+   F  +   I  ++C   K++  AI +K G + +  ++    +  + + R H  ++  +EW+P  +E +L+   +                     LA+  KD  V++W       V  L LP  + K+        D A+     W ++ W   ++  +++S   G +  W    S + K+    T+  + H + VF +       G  + LS S+DR +    +   +       S+  LGG + SL  +      LA+G  D++IR+W   T S   +++V  +W GI  K+ A+SWHP +EG LAFGT+ G VG+  +   K   I S   H+  V+  +W   +     G   E  +    +YS G  G +Y H    N +               +      + +   + W     Y A+G  +G + ++ T+     L LIC I+ H K +N +RW   +S +    + LA GSN   + V +L   + +   S       VT  E      GH  +IT + W P    R+V++SYD TA VW VL   P+ ++  H+G++   +WS  +PD ++TG +D  L +W        RP +    TEL ++R
Sbjct:    8 LSASPNWYCSRSSDA-------AGGLFGFAARNSVYLLNI----NLQEPGF----YGELVGHTDRVSGFA---------FSHFSGQSHLCASSSDDGTVKVWDTQTKN---TVTEHHLHRSTIAA--LHWSPLVKDLLVSGDEKGVLVCFWCNRNDSQ--QFFPEPRTIFCLSCSPHKEDIVAIGYKDGMIVLVDISRRGDV--LHRLRGHEEEIHCLEWSPHALECDLQQKLEETEINTANGELLPETENRRCYLASGSKDQTVRIWSASTGKAVTVLKLP--YLKRRGGGV---DPAIKER-LWLTLHWPPGHSTQILSSCFGGELLLWDLTKSGKQKWTLLGTSDGQNHSRIVFNLCSVVTEEGKELLLSTSMDRDVKCWDLGSLS----CCWSLTSLGGFVYSLAFSPVAAGSLAVGVGDSMIRVWN--TMSVVNAYDVKTLWQGIRSKVTALSWHPTKEGSLAFGTEDGKVGIFEVYISKPPQI-SATYHKKTVYSLSWGPLLPPFSFGA--EGDRPTYTLYSCGGEGVIYQH----NPWKLTDEASNINKLIRDTNDIKHKLPAHTELSWRPDGQYLAIGNEDGTIEVFHTQ----RLQLICTIQQHHKLVNAVRWHHGHSQDPDLNFLLASGSNNATVYVHNLKGPLENPTDSP------VTITEPFRTLPGHTAKITSLSWSPHHDARLVSASYDGTAQVWDVLQEEPLSNYRGHKGRLLSVQWSPVEPDQVWTGADDFCLHSWSVSKQEHSRPPKGKKATELEKKR 720          
BLAST of Gem (nuclear organelle) associated protein 5 vs. Ensembl Mouse
Match: Gemin5 (gem nuclear organelle associated protein 5 [Source:MGI Symbol;Acc:MGI:2449311])

HSP 1 Score: 220.705 bits (561), Expect = 9.437e-58
Identity = 238/1012 (23.52%), Postives = 401/1012 (39.62%), Query Frame = 1
Query:  532 GFDKGSLLTWNFQKDSEYKTFCTKNGDINQITCK---DNRFAIAHKKGFVDIYLLNSYDSITKITQFRAHHSDVCNIEWNPI--------------------------ESNLETWGDLATTGKDHQVKLWKIDKNYNVKTLNLPSSWNKQNPKSFIEKD----NAVSHNSQWSSICWSTVNNGTLIASNGYGNIGTWKSLSSTELKY--FSQTNTTKPHCKSVFGIKEFRNHSG--IFLSHSLDRLLNVSRINEQAKDGEYVLSMPCLGGSIMSL--DAVDKNNQLAIGGSDNLIRLWRFETQSNRKSFEVTNIWDGINGKILAISWHPFREGLLAFGTDTGTVGLVNISKDKKLAIASKLLHQNKVFITNWAVDIRKNFNGVTEEELKENLVIYSVGN-GRLYGHDFRQ--NQYFDASHLVXXXXXXXXXXXXDELMVSDFTMHWSLGYFAVGYGNGLVNIYATKLDKSDLVLICQIKTHSKGINCMRWSPNSNEAAGRYRL----AIGSNERFLTVTDLGKVVIDFESSNRQQWTVVTFNETLAKFKGHGDRITGIDWCPFDSNRIVTSSYDHTAFVWSVLDNTPIVSFNHHQGKVFCCKWSTRDPDLIYTGGEDSNLFAW--------RPSQQTLKTELNRRR--QF-------------VP-----------------ALPGVTTINKITGETPESVPVTDPK-----------------ESIKNAIPTKEIAIK--------TGFMKKRS--SLFPLTIFSVHHPLE------------TYQNSIIDFISGNESYLPCLSILDSRSIIINQIEVELIHHREEKNFDNYFILLIWMGKIGKVATDCLAMNYSPDWLMAV--ILGFTSGQVPGELIRMHVSNTVAMRKDPILGATFWVAVGETRLAIDTLVKNDCIREALILAKLRLPPRDPIIDELMPKLRENYFKNGCYELSAVCSMQMNKFPDVIESMNRRTSELANWVTIQILIKHEQHELMLECAFGFVNRILL 3186
            G +KG +  +   ++     F T+   I  +TC    +N  AI +K G V I  ++    +  I + R H  ++ +I W P+                          E+ +     LAT  KD  +++W   +   V  L LP          F+++     +       W ++ W       L++S   G +  W    S   KY  FS +     H + VF +   +   G  + LS S+DR +    +       E   ++P LGG   SL    VD  + LAIG  D +IR+W   T S + +++V N W G+  K+ A+ WHP +EG LAFGTD G VGL +   +K   I+S   H+  V+   W   +     G   E  + +L +YS G  G +  H+  +   + FD + LV               + ++ +        A+G  +G + I+       +L L+C I+ H K +N + W    +E   R  L    A GSN   + V +L  V+     SN +  + +T  E      GH  +IT + W P    R+V++ YD TA VW  L   P+ +F  H+G++ C  WS  DP+ IY+G +D  ++ W        RP Q     EL ++R  QF             +P                 + P    ++   GE     P   P                  E  K  + +K  ++K           +KKR   S+ PL+    H   E            T+   + + +S +      L +   R+ +   +E E   H E  + + +  L++W G +  V           D L+AV  + G++      E      +  +  +   +  A++ +++ +   A++ L  N   REA+ +AK RL P DP++ EL         ++G Y ++A C +      D  + + R+    +     ++     +HEL    A      +LL
Sbjct:  128 GDEKGVVFCYWLNRNDSQHLF-TEPRTIFCLTCSPHHENLVAIGYKDGIVVIIDISKKGEV--IHRLRGHDDEIHSIAWCPLSGEDCLSISQEENSEEPDIPNGKLIAETPITKGCYLATGSKDQTIRIWSCSRGRGVMVLKLP----------FLKRRSGGVDPTVKERLWLTLHWPKNQPTQLVSSCFGGELLLWDLTQSWRRKYTLFSTSAEGHNHSRIVFNLCSLKTEDGKQLLLSTSMDRDVKCWDMATL----ECCWTLPSLGGFAYSLAFSPVDVGS-LAIGVGDGMIRVWN--TLSIKNNYDVKNFWQGVKSKVTALCWHPNKEGCLAFGTDDGKVGLYDTCSNKPPQISSTY-HKKTVYRLAWGPPVPPMSLG--GEGDRPSLTLYSCGGEGVVLQHNPWKLSGEAFDINKLVRDTNSIRYKLP----VHTEISWKGDGKVLALGNEDGSIEIFQVP----NLRLLCTIQQHHKLVNAIVWH---HEHGSRPELSCLLASGSNNAVIYVHNLKAVL----ESNPE--SPITITEPYRTLSGHTAKITSLAWSPHHDGRLVSACYDGTAQVWDALREEPLFNFRGHRGRLLCVAWSPVDPECIYSGADDFCVYRWLTSMQDHSRPPQGKKCIELEKKRLSQFKPKLKKKKKPTLRLPVKQDSSVGNEDESVKENSGPAENGLSDQDGEEEAQEPELPPSPVVCVEPVSCTDICSGFEKSKVTVSSKATSLKKEPAKEKPEALLKKRKARSMLPLSTSLDHRSKEELHRDCLVLATATHAKELNEDVSADLEERFHLGLFTDRATLYRMMETEGKGHLESGHPELFHQLMLWKGDLKGVLQAAAERGELTDSLVAVAPVAGYSVWLWAVEAF----AKQLCFQDQYVKAASYLLSIHKVYEAVELLKSNHLYREAIAVAKARLRPEDPVLKELYLSWGSILERDGHYAIAAKCYLGATSAYDAAKVLARKGDAASLRTAAELAAIAGEHELAASLALRCAQELLL 1095          
BLAST of Gem (nuclear organelle) associated protein 5 vs. Ensembl Mouse
Match: Gemin5 (gem nuclear organelle associated protein 5 [Source:MGI Symbol;Acc:MGI:2449311])

HSP 1 Score: 193.356 bits (490), Expect = 2.746e-49
Identity = 172/646 (26.63%), Postives = 276/646 (42.72%), Query Frame = 1
Query:  532 GFDKGSLLTWNFQKDSEYKTFCTKNGDINQITCK---DNRFAIAHKKGFVDIYLLNSYDSITKITQFRAHHSDVCNIEWNPI--------------------------ESNLETWGDLATTGKDHQVKLWKIDKNYNVKTLNLPSSWNKQNPKSFIEKD----NAVSHNSQWSSICWSTVNNGTLIASNGYGNIGTWKSLSSTELKY--FSQTNTTKPHCKSVFGIKEFRNHSG--IFLSHSLDRLLNVSRINEQAKDGEYVLSMPCLGGSIMSL--DAVDKNNQLAIGGSDNLIRLWRFETQSNRKSFEVTNIWDGINGKILAISWHPFREGLLAFGTDTGTVGLVNISKDKKLAIASKLLHQNKVFITNWAVDIRKNFNGVTEEELKENLVIYSVGN-GRLYGHDFRQ--NQYFDASHLVXXXXXXXXXXXXDELMVSDFTMHWSLGYFAVGYGNGLVNIYATKLDKSDLVLICQIKTHSKGINCMRWSPNSNEAAGRYRL----AIGSNERFLTVTDLGKVVIDFESSNRQQWTVVTFNETLAKFKGHGDRITGIDWCPFDSNRIVTSSYDHTAFVWSVLDNTPIVSFNHHQGKVFCCKWSTRDPDLIYTGGEDSNLFAW--------RPSQQTLKTELNRRR 2307
            G +KG +  +   ++     F T+   I  +TC    +N  AI +K G V I  ++    +  I + R H  ++ +I W P+                          E+ +     LAT  KD  +++W   +   V  L LP          F+++     +       W ++ W       L++S   G +  W    S   KY  FS +     H + VF +   +   G  + LS S+DR +    +       E   ++P LGG   SL    VD  + LAIG  D +IR+W   T S + +++V N W G+  K+ A+ WHP +EG LAFGTD G VGL +   +K   I+S   H+  V+   W   +     G   E  + +L +YS G  G +  H+  +   + FD + LV               + ++ +        A+G  +G + I+       +L L+C I+ H K +N + W    +E   R  L    A GSN   + V +L  V+     SN +  + +T  E      GH  +IT + W P    R+V++ YD TA VW  L   P+ +F  H+G++ C  WS  DP+ IY+G +D  ++ W        RP Q     EL ++R
Sbjct:  128 GDEKGVVFCYWLNRNDSQHLF-TEPRTIFCLTCSPHHENLVAIGYKDGIVVIIDISKKGEV--IHRLRGHDDEIHSIAWCPLSGEDCLSISQEENSEEPDIPNGKLIAETPITKGCYLATGSKDQTIRIWSCSRGRGVMVLKLP----------FLKRRSGGVDPTVKERLWLTLHWPKNQPTQLVSSCFGGELLLWDLTQSWRRKYTLFSTSAEGHNHSRIVFNLCSLKTEDGKQLLLSTSMDRDVKCWDMATL----ECCWTLPSLGGFAYSLAFSPVDVGS-LAIGVGDGMIRVWN--TLSIKNNYDVKNFWQGVKSKVTALCWHPNKEGCLAFGTDDGKVGLYDTCSNKPPQISSTY-HKKTVYRLAWGPPVPPMSLG--GEGDRPSLTLYSCGGEGVVLQHNPWKLSGEAFDINKLVRDTNSIRYKLP----VHTEISWKGDGKVLALGNEDGSIEIFQVP----NLRLLCTIQQHHKLVNAIVWH---HEHGSRPELSCLLASGSNNAVIYVHNLKAVL----ESNPE--SPITITEPYRTLSGHTAKITSLAWSPHHDGRLVSACYDGTAQVWDALREEPLFNFRGHRGRLLCVAWSPVDPECIYSGADDFCVYRWLTSMQDHSRPPQGKKCIELEKKR 733          
BLAST of Gem (nuclear organelle) associated protein 5 vs. Ensembl Mouse
Match: Gemin5 (gem nuclear organelle associated protein 5 [Source:MGI Symbol;Acc:MGI:2449311])

HSP 1 Score: 193.356 bits (490), Expect = 2.815e-49
Identity = 172/646 (26.63%), Postives = 276/646 (42.72%), Query Frame = 1
Query:  532 GFDKGSLLTWNFQKDSEYKTFCTKNGDINQITCK---DNRFAIAHKKGFVDIYLLNSYDSITKITQFRAHHSDVCNIEWNPI--------------------------ESNLETWGDLATTGKDHQVKLWKIDKNYNVKTLNLPSSWNKQNPKSFIEKD----NAVSHNSQWSSICWSTVNNGTLIASNGYGNIGTWKSLSSTELKY--FSQTNTTKPHCKSVFGIKEFRNHSG--IFLSHSLDRLLNVSRINEQAKDGEYVLSMPCLGGSIMSL--DAVDKNNQLAIGGSDNLIRLWRFETQSNRKSFEVTNIWDGINGKILAISWHPFREGLLAFGTDTGTVGLVNISKDKKLAIASKLLHQNKVFITNWAVDIRKNFNGVTEEELKENLVIYSVGN-GRLYGHDFRQ--NQYFDASHLVXXXXXXXXXXXXDELMVSDFTMHWSLGYFAVGYGNGLVNIYATKLDKSDLVLICQIKTHSKGINCMRWSPNSNEAAGRYRL----AIGSNERFLTVTDLGKVVIDFESSNRQQWTVVTFNETLAKFKGHGDRITGIDWCPFDSNRIVTSSYDHTAFVWSVLDNTPIVSFNHHQGKVFCCKWSTRDPDLIYTGGEDSNLFAW--------RPSQQTLKTELNRRR 2307
            G +KG +  +   ++     F T+   I  +TC    +N  AI +K G V I  ++    +  I + R H  ++ +I W P+                          E+ +     LAT  KD  +++W   +   V  L LP          F+++     +       W ++ W       L++S   G +  W    S   KY  FS +     H + VF +   +   G  + LS S+DR +    +       E   ++P LGG   SL    VD  + LAIG  D +IR+W   T S + +++V N W G+  K+ A+ WHP +EG LAFGTD G VGL +   +K   I+S   H+  V+   W   +     G   E  + +L +YS G  G +  H+  +   + FD + LV               + ++ +        A+G  +G + I+       +L L+C I+ H K +N + W    +E   R  L    A GSN   + V +L  V+     SN +  + +T  E      GH  +IT + W P    R+V++ YD TA VW  L   P+ +F  H+G++ C  WS  DP+ IY+G +D  ++ W        RP Q     EL ++R
Sbjct:  128 GDEKGVVFCYWLNRNDSQHLF-TEPRTIFCLTCSPHHENLVAIGYKDGIVVIIDISKKGEV--IHRLRGHDDEIHSIAWCPLSGEDCLSISQEENSEEPDIPNGKLIAETPITKGCYLATGSKDQTIRIWSCSRGRGVMVLKLP----------FLKRRSGGVDPTVKERLWLTLHWPKNQPTQLVSSCFGGELLLWDLTQSWRRKYTLFSTSAEGHNHSRIVFNLCSLKTEDGKQLLLSTSMDRDVKCWDMATL----ECCWTLPSLGGFAYSLAFSPVDVGS-LAIGVGDGMIRVWN--TLSIKNNYDVKNFWQGVKSKVTALCWHPNKEGCLAFGTDDGKVGLYDTCSNKPPQISSTY-HKKTVYRLAWGPPVPPMSLG--GEGDRPSLTLYSCGGEGVVLQHNPWKLSGEAFDINKLVRDTNSIRYKLP----VHTEISWKGDGKVLALGNEDGSIEIFQVP----NLRLLCTIQQHHKLVNAIVWH---HEHGSRPELSCLLASGSNNAVIYVHNLKAVL----ESNPE--SPITITEPYRTLSGHTAKITSLAWSPHHDGRLVSACYDGTAQVWDALREEPLFNFRGHRGRLLCVAWSPVDPECIYSGADDFCVYRWLTSMQDHSRPPQGKKCIELEKKR 733          
BLAST of Gem (nuclear organelle) associated protein 5 vs. Ensembl Mouse
Match: Gemin5 (gem nuclear organelle associated protein 5 [Source:MGI Symbol;Acc:MGI:2449311])

HSP 1 Score: 84.3445 bits (207), Expect = 3.774e-18
Identity = 61/182 (33.52%), Postives = 89/182 (48.90%), Query Frame = 1
Query:  946 WSSICWSTVNNGTLIASNGYGNIGTWKSLSSTELKY--FSQTNTTKPHCKSVFGIKEFRNHSG--IFLSHSLDRLLNVSRINEQAKDGEYVLSMPCLGGSIMSL--DAVDKNNQLAIGGSDNLIRLWRFETQSNRKSFEVTNIWDGINGKILAISWHPFREGLLAFGTDTGTVGLVNISKDK 1473
            W ++ W       L++S   G +  W    S   KY  FS +     H + VF +   +   G  + LS S+DR +    +       E   ++P LGG   SL    VD  + LAIG  D +IR+W   T S + +++V N W G+  K+ A+ WHP +EG LAFGTD G VGL +   +K
Sbjct:    3 WLTLHWPKNQPTQLVSSCFGGELLLWDLTQSWRRKYTLFSTSAEGHNHSRIVFNLCSLKTEDGKQLLLSTSMDRDVKCWDMATL----ECCWTLPSLGGFAYSLAFSPVDVGS-LAIGVGDGMIRVW--NTLSIKNNYDVKNFWQGVKSKVTALCWHPNKEGCLAFGTDDGKVGLYDTCSNK 177          
BLAST of Gem (nuclear organelle) associated protein 5 vs. Ensembl Mouse
Match: Hira (histone cell cycle regulator [Source:MGI Symbol;Acc:MGI:99430])

HSP 1 Score: 50.8322 bits (120), Expect = 9.502e-6
Identity = 45/170 (26.47%), Postives = 77/170 (45.29%), Query Frame = 1
Query: 1825 LICQIKTHSKGINCMRWSPNSNEAAGRYRLAIGSNERFLTV----TDLGKVVIDFESS----NRQQWTVVTFNETLAKFKGHGDRITGIDWCPFDSNRIVTSSYDHTAFVWSVLDNTPIVS-FNHHQGKVFCCKWSTRDP--DLIYTGGEDSNLFAWRPSQQTLKTELNR 2301
            ++CQ+  H   +NC+RWS      +G Y LA G +++ + V    T +G   + F SS    N +QW  V+        + H   +  + W P D+  + + S D+T  +W+ +    I++    H G V    W   DP    I +  +D +L  WR     L+T + +
Sbjct:   18 MLCQMDNHLACVNCVRWS-----NSGMY-LASGGDDKLIMVWKRATYIGPSTV-FGSSGKLANVEQWRCVSI------LRSHSGDVMDVAWSPHDA-WLASCSVDNTVVIWNAVKFPEILATLRGHSGLVKGLTW---DPVGKYIASQADDRSLKVWRTLDWQLETSITK 170          
BLAST of Gem (nuclear organelle) associated protein 5 vs. UniProt/SwissProt
Match: sp|Q8TEQ6|GEMI5_HUMAN (Gem-associated protein 5 OS=Homo sapiens OX=9606 GN=GEMIN5 PE=1 SV=3)

HSP 1 Score: 198.364 bits (503), Expect = 6.413e-50
Identity = 174/643 (27.06%), Postives = 280/643 (43.55%), Query Frame = 1
Query:  532 GFDKGSLLTWNFQKDSEYKTFCTKNGDINQITCK---DNRFAIAHKKGFVDIYLLNSYDSITKITQFRAHHSDVCNIEWNPIES------NLETWGD--------------------LATTGKDHQVKLWKIDKNYNVKTLNLPSSWNKQNPKSFIEKD----NAVSHNSQWSSICWSTVNNGTLIASNGYGNIGTWKSLSSTELKY--FSQTNTTKPHCKSVFGIKEFR--NHSGIFLSHSLDRLLNVSRINEQAKDGEYVLSMPCLGGSIMSL--DAVDKNNQLAIGGSDNLIRLWRFETQSNRKSFEVTNIWDGINGKILAISWHPFREGLLAFGTDTGTVGLVNISKDKKLAIASKLLHQNKVFITNWAVDIRKNFNGVTEEELKENLVIYSVG-NGRLYGHDFRQ--NQYFDASHLVXXXXXXXXXXXXDELMVSDFTMHWSLGYFAVGYGNGLVNIYATKLDKSDLVLICQIKTHSKGINCMRWS-PNSNEAAGRYRLAIGSNERFLTVTDLGKVVIDFESSNRQQWTVVTFNETLAKFKGHGDRITGIDWCPFDSNRIVTSSYDHTAFVWSVLDNTPIVSFNHHQGKVFCCKWSTRDPDLIYTGGEDSNLFAW--------RPSQQTLKTELNRRR 2307
            G +KG +  + F ++     F      I  +TC    ++  AI +K G V I  ++    +  I + R H  ++ +I W P+        N E   +                    LAT  KD  +++W   +   V  L LP          F+++     +       W ++ W +     L++S   G +  W    S   KY  FS ++  + H + VF +   +  +   + LS S+DR +    I       E   ++P LGG   SL   +VD  + LAIG  D +IR+W   T S + +++V N W G+  K+ A+ WHP +EG LAFGTD G VGL +   +K   I+S   H+  V+   W   +     G   E  + +L +YS G  G +  H+  +   + FD + L+               + ++ +        A+G  +G + I+       +L LIC I+ H K +N + W   + ++    Y +A GSN   + V +L  V+   ESS     + VT  E      GH  +IT + W P    R+V++SYD TA VW  L   P+ +F  H+G++ C  WS  DPD IY+G +D  +  W        RP Q     EL ++R
Sbjct:  128 GDEKGVVFCYWFNRNDSQHLFIEPR-TIFCLTCSPHHEDLVAIGYKDGIVVIIDISKKGEV--IHRLRGHDDEIHSIAWCPLPGEDCLSINQEETSEEAEITNGNAVAQAPVTKGCYLATGSKDQTIRIWSCSRGRGVMILKLP----------FLKRRGGGIDPTVKERLWLTLHWPSNQPTQLVSSCFGGELLQWDLTQSWRRKYTLFSASSEGQNHSRIVFNLCPLQTEDDKQLLLSTSMDRDVKCWDIATL----ECSWTLPSLGGFAYSLAFSSVDIGS-LAIGVGDGMIRVWN--TLSIKNNYDVKNFWQGVKSKVTALCWHPTKEGCLAFGTDDGKVGLYDTYSNKPPQISSTY-HKKTVYTLAWGPPVPPMSLG--GEGDRPSLALYSCGGEGIVLQHNPWKLSGEAFDINKLIRDTNSIKYKLP----VHTEISWKADGKIMALGNEDGSIEIFQI----PNLKLICTIQQHHKLVNTISWHHEHGSQPELSYLMASGSNNAVIYVHNLKTVI---ESSPE---SPVTITEPYRTLSGHTAKITSVAWSPHHDGRLVSASYDGTAQVWDALREEPLCNFRGHRGRLLCVAWSPLDPDCIYSGADDFCVHKWLTSMQDHSRPPQGKKSIELEKKR 733          
BLAST of Gem (nuclear organelle) associated protein 5 vs. UniProt/SwissProt
Match: sp|Q8BX17|GEMI5_MOUSE (Gem-associated protein 5 OS=Mus musculus OX=10090 GN=Gemin5 PE=1 SV=2)

HSP 1 Score: 193.356 bits (490), Expect = 1.969e-48
Identity = 172/646 (26.63%), Postives = 276/646 (42.72%), Query Frame = 1
Query:  532 GFDKGSLLTWNFQKDSEYKTFCTKNGDINQITCK---DNRFAIAHKKGFVDIYLLNSYDSITKITQFRAHHSDVCNIEWNPI--------------------------ESNLETWGDLATTGKDHQVKLWKIDKNYNVKTLNLPSSWNKQNPKSFIEKD----NAVSHNSQWSSICWSTVNNGTLIASNGYGNIGTWKSLSSTELKY--FSQTNTTKPHCKSVFGIKEFRNHSG--IFLSHSLDRLLNVSRINEQAKDGEYVLSMPCLGGSIMSL--DAVDKNNQLAIGGSDNLIRLWRFETQSNRKSFEVTNIWDGINGKILAISWHPFREGLLAFGTDTGTVGLVNISKDKKLAIASKLLHQNKVFITNWAVDIRKNFNGVTEEELKENLVIYSVGN-GRLYGHDFRQ--NQYFDASHLVXXXXXXXXXXXXDELMVSDFTMHWSLGYFAVGYGNGLVNIYATKLDKSDLVLICQIKTHSKGINCMRWSPNSNEAAGRYRL----AIGSNERFLTVTDLGKVVIDFESSNRQQWTVVTFNETLAKFKGHGDRITGIDWCPFDSNRIVTSSYDHTAFVWSVLDNTPIVSFNHHQGKVFCCKWSTRDPDLIYTGGEDSNLFAW--------RPSQQTLKTELNRRR 2307
            G +KG +  +   ++     F T+   I  +TC    +N  AI +K G V I  ++    +  I + R H  ++ +I W P+                          E+ +     LAT  KD  +++W   +   V  L LP          F+++     +       W ++ W       L++S   G +  W    S   KY  FS +     H + VF +   +   G  + LS S+DR +    +       E   ++P LGG   SL    VD  + LAIG  D +IR+W   T S + +++V N W G+  K+ A+ WHP +EG LAFGTD G VGL +   +K   I+S   H+  V+   W   +     G   E  + +L +YS G  G +  H+  +   + FD + LV               + ++ +        A+G  +G + I+       +L L+C I+ H K +N + W    +E   R  L    A GSN   + V +L  V+     SN +  + +T  E      GH  +IT + W P    R+V++ YD TA VW  L   P+ +F  H+G++ C  WS  DP+ IY+G +D  ++ W        RP Q     EL ++R
Sbjct:  128 GDEKGVVFCYWLNRNDSQHLF-TEPRTIFCLTCSPHHENLVAIGYKDGIVVIIDISKKGEV--IHRLRGHDDEIHSIAWCPLSGEDCLSISQEENSEEPDIPNGKLIAETPITKGCYLATGSKDQTIRIWSCSRGRGVMVLKLP----------FLKRRSGGVDPTVKERLWLTLHWPKNQPTQLVSSCFGGELLLWDLTQSWRRKYTLFSTSAEGHNHSRIVFNLCSLKTEDGKQLLLSTSMDRDVKCWDMATL----ECCWTLPSLGGFAYSLAFSPVDVGS-LAIGVGDGMIRVWN--TLSIKNNYDVKNFWQGVKSKVTALCWHPNKEGCLAFGTDDGKVGLYDTCSNKPPQISSTY-HKKTVYRLAWGPPVPPMSLG--GEGDRPSLTLYSCGGEGVVLQHNPWKLSGEAFDINKLVRDTNSIRYKLP----VHTEISWKGDGKVLALGNEDGSIEIFQVP----NLRLLCTIQQHHKLVNAIVWH---HEHGSRPELSCLLASGSNNAVIYVHNLKAVL----ESNPE--SPITITEPYRTLSGHTAKITSLAWSPHHDGRLVSACYDGTAQVWDALREEPLFNFRGHRGRLLCVAWSPVDPECIYSGADDFCVYRWLTSMQDHSRPPQGKKCIELEKKR 733          
BLAST of Gem (nuclear organelle) associated protein 5 vs. UniProt/SwissProt
Match: sp|Q54IY5|GEMI5_DICDI (Component of gems protein 5 OS=Dictyostelium discoideum OX=44689 GN=gemin5 PE=3 SV=1)

HSP 1 Score: 68.9366 bits (167), Expect = 3.255e-10
Identity = 36/114 (31.58%), Postives = 55/114 (48.25%), Query Frame = 1
Query: 2020 ETLAKFKGHGDRITGIDWCPFDSNRIVTSSYDHTAFVWSVLDNTPIVSFNHHQGKVFCCKWSTRDPDLIYTGGEDSNLFAWRPSQQTLKTELNRRRQFVPALPGVTTINKITGE 2361
            E L +F GH + +  + W   D N + ++S D T  VW++     I +   H G+VF   WS  DP+L+ +GGED  +  W  S Q  KT    + +  P      ++NK   E
Sbjct:  856 EILHQFIGHKNNVCSVSWSNVDPNLLGSASADGTVQVWNIKSKEAISNMRGHDGRVFTVCWSLLDPNLLVSGGEDQTVRLWNYSTQPFKTVTESQIKKSPQPELSISLNKKITE 969          

HSP 2 Score: 56.6102 bits (135), Expect = 1.619e-6
Identity = 73/293 (24.91%), Postives = 126/293 (43.00%), Query Frame = 1
Query:  796 LATTGKDHQVKLWK-----IDKNY-NVKTLNLPSSWNKQNPKSFIEKD-NAVSHNSQWSSICWSTVNNGTLIASNGYGNIGTWK--SLSSTELKYFSQTNTTKPHCKSVFGIKEFRNHSGIF-------------------------------LSHSLDRLLNVSRINEQAKDGEYVLSMPCLGGSIMSLDAVDKN-NQLAIGGSDNLIRLWRFETQSNRKSFEVTNIWDGINGKILAIS----WHPFREGLLAFGTDTGTVGLVNISKDKKLAIASKLL---HQNKVFITNW 1530
            LAT  KD  +K+WK     I+  + N+   N PS ++ Q+  S      N       W ++ WS  +   L++++   ++  W   +  S   K+ S       H + +F I +  N  G                                 ++ SLDR + +   N +AK     + +  LGG + S+D    + N  AIG  DN IRLW   T++++ ++E   +W GI  K+ ++S    +      L+AFG D G VG+ NI+ ++     SK+    H+N+++   W
Sbjct:  314 LATCSKDKAIKIWKQVGEKIESGFTNIYQFN-PSKYSIQHSSSSGGGGINQNDKQRVWLTLSWSPESPQYLLSNSLTADVLIWDLINFKSPPEKFQSS------HQRLIFNITQIPNSDGSLAKTTATTETTTKNKIKNKDKKQSQIKLNNKVITVSLDRQIIIWE-NLKAK-----IKIQGLGGFVYSIDTCSYSPNTFAIGCGDNTIRLWS-PTENSKDAYESKTLWKGIQSKVTSLSICKDYGFSNSNLIAFGMDDGRVGVYNINTNQ-----SKIFPGGHKNEIYEIIW 587          
BLAST of Gem (nuclear organelle) associated protein 5 vs. UniProt/SwissProt
Match: sp|Q652L2|HIRA_ORYSJ (Protein HIRA OS=Oryza sativa subsp. japonica OX=39947 GN=Os09g0567700 PE=2 SV=1)

HSP 1 Score: 57.7658 bits (138), Expect = 6.641e-7
Identity = 50/190 (26.32%), Postives = 83/190 (43.68%), Query Frame = 1
Query: 1756 FAVGYGNGLVNIYATKL-------DKSDLVLICQIKTHSKGINCMRWSPNSNEAAGRYRLAIGSNERFLTVTD--LGKVVIDF---ESSNRQQWTVVTFNETLAKFKGHGDRITGIDWCPFDSNRIVTSSYDHTAFVWSVLDNTPIVSFNHHQGKVFCCKWSTRDP--DLIYTGGEDSNLFAWRPSQQTL 2283
            FA G G+  + I++ K        D S   L+  I+ H   +NC+RW+ +     GRY LA GS+++ + + +   G    +F   E  + + W VV         +GH   +  ++W P DS  + + S D+T  +WS+ +         H   V    W   DP    I +  +D  +  WR S  +L
Sbjct:   28 FATGGGDQKIRIWSMKSVAKDNDSDDSSQRLLATIRDHFGTVNCVRWAHH-----GRY-LASGSDDQVIQIHERKAGTGTSEFGSGEPPDVENWKVVM------TLRGHTADVVDLNWSPDDST-LASGSLDNTVHIWSMANGICTAVLRGHSSLVKGVTW---DPIGSFIASQSDDKTVIIWRTSDWSL 201          
BLAST of Gem (nuclear organelle) associated protein 5 vs. UniProt/SwissProt
Match: sp|Q9FLX9|NLE1_ARATH (Notchless protein homolog OS=Arabidopsis thaliana OX=3702 GN=NLE1 PE=2 SV=1)

HSP 1 Score: 55.4546 bits (132), Expect = 2.779e-6
Identity = 53/222 (23.87%), Postives = 82/222 (36.94%), Query Frame = 1
Query: 1837 IKTHSKGINCMRWSPNSNEAAGRYRLAIGSNERFLTVTDLGKVVIDFESSNRQQWT--------------------VVTFNETLAKFKG-----HGDRITGIDWCPFD----SNRIVTSSYDHTAFVWSVLDNTPIVSFNHHQGKVFCCKWSTRDPDLIYTGGEDSNLFAWRPSQQTLKTELNRRRQFVPALPGVTTINKITGETPESVPVTDPKESIKNAI 2415
            I  H++ + C+ +SP+  +      LA GS +  + + DL      F     + W                     +  +N    + +G     H   ITGI W P        R VTSS D  A +W +     I+  + H   V C KW      +IYTG +D  +  W  +Q  L  EL     ++ +L   T     TG    +     P E  + A+
Sbjct:  105 IAGHAEAVLCVSFSPDGKQ------LASGSGDTTVRLWDLYTETPLFTCKGHKNWVLTVAWSPDGKHLVSGSKSGEICCWNPKKGELEGSPLTGHKKWITGISWEPVHLSSPCRRFVTSSKDGDARIWDITLKKSIICLSGHTLAVTCVKWG--GDGIIYTGSQDCTIKMWETTQGKLIRELKGHGHWINSLALSTEYVLRTGAFDHTGRQYPPNEEKQKAL 318          
BLAST of Gem (nuclear organelle) associated protein 5 vs. TrEMBL
Match: D5JG49 (Gemin 5 (Fragment) OS=Dugesia japonica OX=6161 GN=GEMIN-5 PE=2 SV=1)

HSP 1 Score: 710.679 bits (1833), Expect = 0.000e+0
Identity = 375/596 (62.92%), Postives = 459/596 (77.01%), Query Frame = 1
Query: 1936 FLTVTDLGKVVIDFE--SSNRQQWTVVTFNETLAKFKGHGDRITGIDWCPFDSNRIVTSSYDHTAFVWSVLDNTPIVSFNHHQGKVFCCKWSTRDPDLIYTGGEDSNLFAWRPSQQTLKTELNRRRQFVPALPGVTTI---NKITGETPESVPVTDPKESIKNAIPTKEIAI--KTG---FMKKRSSLFPLTIFSVHHPLETYQNSIIDFISGNE------SYLPCLSILDSRSIIINQIEVELIHHREEKNFDNYFILLIWMGKIGKVATDCLAMNYSPDWLMAVILGFTSGQVPGELIRMHVSNTVAMRKDPILGATFWVAVGETRLAIDTLVKNDCIREALILAKLRLPPRDP-IIDELMPKLRENYFKNGCYELSAVCSMQMNKFPDVIESMNRRTSELANWVTIQILIKHEQHELMLECAFGFVNRILLEQQSKQIDVNQWNAKIKSIHQIDFYSTLIDLHRFIWIEKKSLKEIWLQIKDARSRFGIEKSIILCNQIKLKLITKQINQSENQXXXXXXXXXXXXXXGSSDVESNIEPIGFDQLNDLIVQYHHINSLGNDLVAQLIHGVXXXXXXXXXXLITNNLFSLKL*D 3672
            FLTVTDL KV+ DF+     +   T V FNETLAKFKGHGDRITGIDWCPFD+N++VTSSYDHTAFVW++  N+PIVSFN+HQGKVFCCKWS RD DLIYTGGEDSNLFAWRPS+Q LKTE NRRRQF+PALPGVTT    N+I  +  +       ++     +   +  I  +TG     KKRSSLFP+TIFS+HH L+ YQN+ + F+  N+      SYLPC +I DSRSIII QIE+EL HH+EEKNFDNYFILLIW+GKIG+V +D LAMNYS DWLM+VI G+T+  +P ELIRMHV+N +  RKDPILGAT+W+A+ ET+ AID LVKNDCIREA+ILAKLRLPP D  II+EL+PKLRE Y+KNGC+ELS  CSM M  + DVI+S+NRR SELANWVTIQILIKH Q EL+LECAF FVN ILLE   K I+++ W  KI   ++I FYS LIDLHR IWI+ KSLK+IW  +K+   +   +KS+ILCNQIK KLITKQINQS NQL++YLTYEIL++II + + + +   + F+QLNDLI QY HI+++GN+L+ QLI G E EE E ++++ITNNL +L L D
Sbjct:    1 FLTVTDLRKVIEDFQIIDGEKSGRTAVVFNETLAKFKGHGDRITGIDWCPFDTNQLVTSSYDHTAFVWNISQNSPIVSFNNHQGKVFCCKWSPRDRDLIYTGGEDSNLFAWRPSEQILKTEFNRRRQFIPALPGVTTTTFPNRIDKDEEKEKTEDKEEKEKIEEVKEVKEVIVNRTGHSYVAKKRSSLFPITIFSLHHSLDEYQNAFLRFLQANKEGEEIISYLPCFAIFDSRSIIIKQIEIELSHHKEEKNFDNYFILLIWLGKIGRVVSDSLAMNYSADWLMSVIFGYTARDIPEELIRMHVNNVIGSRKDPILGATYWLAMSETKRAIDVLVKNDCIREAVILAKLRLPPTDRLIIEELLPKLRETYYKNGCFELSGACSMLMKNYKDVIQSLNRRKSELANWVTIQILIKHNQQELLLECAFNFVNHILLESLEKTIEIDNWREKIHLSNEIGFYSILIDLHRLIWIDLKSLKDIWSLLKENCKQIKSDKSLILCNQIKSKLITKQINQSANQLAVYLTYEILIIIIENINNKKS--TLEFNQLNDLINQYIHISNMGNNLINQLI-GSEYEENEFVVKMITNNLINLNLQD 593          
BLAST of Gem (nuclear organelle) associated protein 5 vs. TrEMBL
Match: A0A5J4NSB6 (Gem associated protein 5 OS=Paragonimus westermani OX=34504 GN=DEA37_0007528 PE=4 SV=1)

HSP 1 Score: 275.404 bits (703), Expect = 7.084e-72
Identity = 285/1128 (25.27%), Postives = 475/1128 (42.11%), Query Frame = 1
Query:  112 GLINSPLWYVSNILDTFDWNYEEKAGVFF---YGSRNQIYFIKVHESTNSLKSYFNLKLHYYMKAHHDYITGVSAIINGTSILFNEVRIQPRLVSCGKDKMIRIWSFNEDTGCCCLKEFNISSTDIRSDPT---CXXXXXXXXXXCGFDKGSLLTWNFQKDSEYKTFCTKNGDINQ-ITCK---------DNRFAIAHKKGFVDIYLLN-----SYDSITKITQFRAHHSDVCNIEWNPI----ESNLETWGDLATTGKDHQVKLWKIDKNYNVKTLNLPSSWNKQNPKSFIEKDNAVSHNS--QWSSICW----STVNNGTLIASNGYGNIGTWKSLSSTELKYFSQTNTTKPHCKSVFGIKEFRNHSGIFLSHSLDRLLNVSRINEQAKDGE--YVLSMPCLGGSIMSLDAVDKNN-QLAIGGSDNLIRLWRFE------TQSNRKSFEVTNIWDGINGK-ILAISWHPF--REGLLAFGTDTGTVGLVN---ISKDKKLAIASKLLHQNKVFITNWA----VDIRKNF--NGVTEEEL---------------------------KENLVIYSVGNGRLYGH-----------------------DFRQNQYFDASHLVXXXXXXXXXXXXDELMVSDFTMHWSLGYFAVGYGNGLVNIYAT-----KLDKSDLVLICQIKTHSKGINCMRWSPNSNEAAGRYRLAIGSNERFLTVTDLGKVV---IDFESSNRQQWTVVTFNETLAKFKGHGDRITGIDWCPFDSNRIVTSSYDHTAFVWSVLDN--TPIVSFNHHQGKVFCCKWSTRDPDLIYTGGEDSNLFAWRPSQQTLKTELNRRRQFVPAL-----------------------------PGVTTINKI-TGETPE---SVPVTDPKESIKNAIPTKEIAIKTGFMKKRSSLFP-----LTI------FSVHHPLETYQN-----SIIDFISGNESYLPCLSILD------------SRSIIINQIEVELIHHREE----------KNFDNYFILLIWMGKIGKVATDCLAMNYSPDWLM-AVILGF-TSGQVPG-----ELIRMHVSNTVAMRKDPILGATFWVAVGETRLAIDTLVKNDCIREALIL 2925
             ++  P W++     T  W  E  AG F    + S+  I+  +             L     ++ HHD I+ +S        L + +  +  L SCG D ++R W++  D      +E NI   +    PT   CI+     + + G +KG+L+ W     S    F +K  +    ITC            R A+ +KKG V IY+ N     S  S+T++++F AH  D+C++ W+      E   +   +L TTG+D  V+LW +  ++   +L +P S  +Q  K      NA+ ++    W S CW    +  ++  +I S   G + +W       +++    +T   H   +F I       G F++   DR   V     +  DGE  YV  +P +   + +L   D  +  LA+G +D  + LWR        ++   K   +T    G+NG  + A++WHP    E LLA+GT+ G V L+    +SK+ + + +   +  + V+  +W     VD R+    NG +                               + +  +YS   G+++ H                       D++ ++  D S +              +++   FT        AVG+ +G V++Y         + + L  IC+IK H+KGINC+ WSP        YRLAIGSNE F+TVTDL  V+   +D + S   Q      +  LA+ +GH +RIT +DW P D N ++++S+D TA VW V ++  + + +F  H+ ++F C WS ++PDL ++GGE  +LF WRPS+   K   N RR   P +                               V  ++ + T ++PE   +  +    + +K   PT +        +KR SLFP     +T+       S H PL           ++D+I        CL+  D            +R  ++  +  E  HH              + D Y I+ +W+G+    A+   + ++ P WL+ AV L   T+  V G     +L+   V        D ++ AT  V  G +R A+D L+ +D  +EALIL
Sbjct:   10 AIVGGPDWFLPGAAATTGW-METAAGGFALIAFSSKPYIHIFRFGAQHEFDNVEHTLSYVGQLQGHHDRISSISF----CDFLVSSIS-RCSLFSCGLDGLVRQWTY-VDHDWILDRELNIRELNDTLLPTSLDCISHQLLPVTLIGTNKGTLIVWISSGQSCEPVFISKKFESEPVITCAWDTHSGAAGSIRAAVGYKKGIVGIYMYNVSCVTSGSSLTQLSRFYAHEKDICHVVWHSHNCENEGTPDNSAELLTTGRDQLVRLWTVATSWCSASLKVPGS-ARQAAKGKERSANAIDNSVGLPWISGCWFPSETQSSHLKIIVSGLRGELYSWSGSEQQPVRFQLGAHT---HSMLIFAIIPIIRSPGFFVTIGQDR--QVLIWQRKGTDGELSYVYRIPTIAAGVSALAQSDHGHGPLAVGTADGAVLLWRRNRPLVGLSEPKLKDNFITFWPRGLNGSNVTALAWHPSPRNESLLAYGTEAGCVDLIETAKVSKNTQKSKSQPYVFGSTVYRVSWGPCLFVDPREKAVTNGSSSTAFVSEETVGETTETLDILEKPESKSSTSNRFSFYVYSACKGKIFCHIGFQRPPLDVTLLFPIPFGVDEEDWKSDKRSDVSFVFLDKARSIEDKDTADIVCECFTC-----LVAVGFRSGQVDVYGCVKQNHSSEVAKLHPICRIKNHTKGINCLAWSPF------YYRLAIGSNESFITVTDLSDVLRKAVDLDVSCFTQ-----LSTCLARLEGHCNRITCLDWSPHDPNLLLSASFDGTANVWKVTNDVSSSVANFRAHRLRLFACIWSRQEPDLAFSGGELCHLFGWRPSRLLHKEPPNCRRYRPPPIKHPQNDFSAAGDPLIVKANLDAFDLSRSSAAVDDVSSVDTKQSPEVTGNTKIQSSDQPLKQ--PTAKKPSSASEKRKRPSLFPHFLHRITVEHSSVDLSFHPPLRLGSKFVQVLKVLDWIRNKV----CLTEPDHDLLFLLPENSKTRISLVQFLNHEADHHLATYRSTQRPNGLAHLDAYCIVQLWLGRAPLAASMLCSESHLPFWLLWAVQLALSTAPSVSGLPFGVDLLDEKVKEMGLNNPDILVAATLLVCGGRSREAVDYLLSHDRAKEALIL 1102          
BLAST of Gem (nuclear organelle) associated protein 5 vs. TrEMBL
Match: A0A419QHL4 (Gem-associated protein 5 OS=Clonorchis sinensis OX=79923 GN=Gemin5 PE=4 SV=1)

HSP 1 Score: 273.478 bits (698), Expect = 2.912e-71
Identity = 285/1120 (25.45%), Postives = 480/1120 (42.86%), Query Frame = 1
Query:  109 SGLINSPLWYVSNILDTFDWNYEE--KAGVFFYGSRNQIYFIKVHESTNSLKSYFNLKLHYYMKAHHDYITGVSAIINGTSILFNEVRIQPRLVSCGKDKMIRIWSFNEDTGCCCLKEFNISSTDIRSDPTC---XXXXXXXXXXCGFDKGSLLTWNFQKDSEYKTFCTKNGDINQIT------CKDN---RFAIAHKKGFVDIYL-----LNSYDSITKITQFRAHHSDVCNIEWNPIESNLE----TWGDLATTGKDHQVKLWKIDKNYNVKTLNLPSSWN---KQNPKSFIEKDNAVSHNSQWSSICW---STVNNGTLIASNGY-GNIGTWKSLSSTELKYFSQTNTTKPHCKSVFGIKEFRNHSGIFLSHSLDRLLNVSRINEQAKDGEYVLSMPCLGGSIMSLDAVDK-NNQLAIGGSDNLIRLWRFETQSNRKSFE---VTNIWD-GINGK-ILAISWHPF--REGLLAFGTDTGTVGLVNISKDKKLAI----ASKLLHQNKVFITNWAVDI---------------RKNFNGVTE---------------EELKENLVIYSVGNGRLYGH-----------------------DFRQNQYFDASHLVXXXXXXXXXXXXDELMVSD-FTMHWSLGYFAVGYGNGLVNIYATKLDK----SDLVL-ICQIKTHSKGINCMRWSPNSNEAAGRYRLAIGSNERFLTVTDLGKVVIDFESSNRQQWTVVTFNETLAKFKGHGDRITGIDWCPFDSNRIVTSSYDHTAFVWSVLDN------TPIVSFNHHQGKVFCCKWSTRDPDLIYTGGEDSNLFAWRPSQQTLKTELNRRRQFVPALPGVTTINK---------------ITGE-------TPE-----------SVPVTDPKESIKNAIP-----TKEIAIKTGFMKKRSSLFPLT--------------IFSVHHPLETYQNSIIDFISGNESYLPCLSILD-SRSIIINQIEVELIHHREE----------KNFDNYFILLIWMGKIGKVATDCLAMNYSPDWLM-AVILGFTSGQVPG--------------ELIRMHVSNTVAMRKDPILGATFWVAVGETRLAIDTLVKNDCIRE 2913
            S ++ +P W++S  + T + +  E  ++ +  + S+  ++   V   +       ++     ++AHH+ I+G+S      S+  +   IQ  L SCG+D ++R WS++        KE NI +      PTC     ++   + + G +KG+LL W     S      TK  + + +T      C  +   R AI +KKG + +YL     + +  S+T++++F AH  D+C++ WNP          +  +L +TG+D  VK+W I  ++   ++ +P S     K+   S + K+   S  + W S CW    T N G  I  +G  G + TW    S++L      N    H   VF I+   +  G+F +   DR + +  I     D  ++L +P +   I +L   D  +  +A G +D  I LWR  +    +S     VT+ W  G++G  + A++WHP    E LLA+GT++G V L++ SK  K A         +  + V+   W   +                ++ NG T+                  K +  IYSV  G+++ H                       D+  ++  D + L             +E  + + F+         VGY +G V++Y     K    +DL+  +C+I  H+KG+NC+ WS +      RY LAIG+NE F+TV D+G V+      N   +  ++ +  LA  +GHG+RIT +DW P ++  ++++S+D TA VW V  N      T + +F  H+ ++F C WS ++ DL ++GGE  +LF+WRPS+   K   N RR   P +  V   +K               +T +        PE           SVP+  P  S+    P      K  ++   F+  RSSL P T                 V H L   +N  +D    +   L  L   + +R  ++  +  E  HH              + D Y I+L+W+G+   VA    +  + P WL+ AV L  T+  VP               +L    V +  +   D ++ +T  V  G  + A+D L   D ++E
Sbjct:   75 SAIVGAPDWFLSGAITTSNSHLRENVRSALVAFSSKPYVHIFLVKLRSAEQHDVSSVVYVGQIQAHHERISGLSFC---ESVNSSPSDIQ--LFSCGQDGLVRHWSYHSHEWLL-TKELNIRAFHESLLPTCLDTTVLADQVLTLVGTNKGTLLVWCVFALSTEPVCLTKKFENDSVTTCAWEPCNLSGCIRLAIGYKKGIIGVYLYQHSSVTAASSLTQLSRFYAHERDICHVIWNPSAHGYSEVAASEPELLSTGRDQMVKIWNIASSWCCDSVRVPGSARSIPKEADSSNLTKNQ--STGAPWISACWLPAKTDNPGRNIVVSGLRGELYTWS--DSSQLVRLHTEN--HGHSMLVFAIRSIPDTDGLFFTIGQDRQV-ILWIYHCPTDLTFMLRVPTIAAGISALAQSDHGHGPVAAGVADGSILLWRHCSSLQEESSSMNPVTSYWPRGVHGSCVTALAWHPSVRHESLLAYGTESGCVELIDTSKIPKSATQRSKTQPYIFGSTVYRVAWGPPLFTDSGKDQVVETAVSEQDANGSTDSTDTVEQKDPTNKPSSAPKFSSYIYSVCKGKIFCHVGFQRPPLDVTLKFPSVPGISTEDWVNDKRTDIAFLYLENSTRSVDSPSEENEIRECFSC-----LITVGYRSGSVDVYGLVKSKERASADLIQPLCRISCHTKGVNCLAWSFD------RYWLAIGTNESFITVIDVGHVLKQATKPNTSSFRQISTH--LAHLEGHGNRITCLDWSPHENGLLLSASFDGTANVWRVAHNDTDSGSTSVANFRAHRLRLFACLWSRQEADLAFSGGELCHLFSWRPSKLAHKEPPNSRRYRPPPVKRVPIDSKDLSVPSVILEPSAIVVTSQEVNRTEYVPEPTYHTDTSIGTSVPLEPPVRSVTTKKPGSGDKRKRPSLCPHFL-HRSSLEPSTTDLGFCPPFRLGSRFLQVSHVLNLLKND-VDLPESDCDLLFLLPETNKTRPALVRFLTSEATHHLSAYRATQRSNGLMHLDAYCIILLWLGRTPLVAQTMCSEKHMPFWLLWAVQLAQTT--VPAFSASRKSSGDHAEIDLAGEKVKDMTSNSPDVLVSSTLLVCAGRHQEAVDYLFAQDRVKE 1164          
BLAST of Gem (nuclear organelle) associated protein 5 vs. TrEMBL
Match: A0A074ZSR2 (Uncharacterized protein (Fragment) OS=Opisthorchis viverrini OX=6198 GN=T265_13485 PE=4 SV=1)

HSP 1 Score: 273.092 bits (697), Expect = 9.208e-71
Identity = 293/1138 (25.75%), Postives = 497/1138 (43.67%), Query Frame = 1
Query:   97 LPIY-SGLINSPLWYVSNILDTFDWNY--EEKAGVFFYGSRNQIYFIKVHESTNSLKSYFNLKLHYYMKAHHDYITGVSAIINGTSILFNEVR-IQPRLVSCGKDKMIRIWSFNEDTGCCCLKEFNISSTDIRSDPTCXXX---XXXXXXXCGFDKGSLLTWN-FQKDSEYKTFCTKNGDINQITCKDN--------RFAIAHKKGFVDIYL-----LNSYDSITKITQFRAHHSDVCNIEWNPIESNLETWG----DLATTGKDHQVKLWKIDKNYNVKTLNLPSSWN---KQNPKSFIEKDNAVSHNSQWSSICW---STVNNGTLIASNGY-GNIGTWKSLSSTELKYFSQTNTTKPHCKSVFGIKEFRNHSGIFLSHSLDRLLNVSRINEQAKDGEYVLSMPCLGGSIMSLDAVDK-NNQLAIGGSDNLIRLWRFETQSNRKSFE---VTNIWD-GINGK-ILAISWHPF--REGLLAFGTDTGTVGLVNISKDKKLAI----ASKLLHQNKVFITNWAVDI---------------RKNFNGVTEE----ELKENL-----------VIYSVGNGRLYGH-----------------------DFRQNQYFDASHLVXXXXXXXXXXXXDELMVSD-FTMHWSLGYFAVGYGNGLVNIYATKLDKS----DLVL-ICQIKTHSKGINCMRWSPNSNEAAGRYRLAIGSNERFLTVTDLGKVVIDFESSNRQQWTVVTFNETLAKFKGHGDRITGIDWCPFDSNRIVTSSYDHTAFVWSVLD------NTPIVSFNHHQGKVFCCKWSTRDPDLIYTGGEDSNLFAWRPSQQTLKTELNRRRQFVPALPGVTTINK---------------ITGE-------TPESVPVTDPK--ESIKNAIPTKEIAIK---TGFMKKRSSLFPLTI------------------------FSVHHPLETYQNSIIDFISGNESYLPCLSILD-SRSIIINQIEVELIHHREE----------KNFDNYFILLIWMGKIGKVATDCLAMNYSPDWLM-AVILGFTSGQVPG--------------ELIRMHVSNTVAMRKDPILGATFWVAVGETRLAIDTLVKNDCIREALILAKLRLPPRD 2952
            +PI  S ++ +P W++S  + T + +   + ++ +  + S+  ++   V   +       ++     ++AHH+ I+G+S      S+ F+    IQ  + SCG+D ++R WS++        KE NI S +    PTC+     +   + + G +KG+LL W  F   +E      K  + +  TC           R AI +KKG + +YL     + +  S+T++++F AH  D+C++ WNP             +L +TG+D  VK+W I  ++   ++ +P S     K++  S + K+   S  + W S CW    T N G  I  +G  G + +W    S++L      N    H   VF I+   +  G+F +   DR + +        D  ++L +P +   I +L   D  +  +A G +D  I LWR  +    +S     VT+ W  G++G  + A++WHP    E LLA+GT++G V L++ SK  K A         +  + V+   W   +                 + NG T+     E K++             IYSV  G+++ H                       D+  ++  D + L             +E  + + F+         VGY +G V++Y     K     DL+  +C+I  H+KG+NC+ WS +      RY LA+G+NE F+TVTD+G ++      N   +  ++    LA  +GHG+RIT +DW P ++  ++++S+D TA VW V        +T + +F  H+ ++F C WS ++ DL ++GGE  +LF+WRPS+   K   N RR   P++  V T +K               +T +        PE +  TD     S+   +P K +  K   +G  +KR SL P  +                          V H L   +N  +D    +   L  L   + +RS ++  +  E  HH              + D Y I+L+W+G+   VA    +  + P WL+ AV L  T+  VP               +L    V +  +   D ++ +T  V  G  + A+D L   D ++EAL+LA+LRL P D
Sbjct:  137 VPIAESAIVGAPDWFLSGAITTSNSHLRGDVRSALVAFSSKPYVHIFLVKVRSAEQHDVSSVVYVGQIQAHHERISGLSFC---ESVNFSSSSDIQ--MFSCGQDGLVRHWSYHSHEWLLT-KELNIRSFNESLLPTCLDTIVIADQILALVGTNKGTLLVWAVFALSTEPVCLTKKFENDSATTCAWEPCNLSGCIRLAIGYKKGIIGVYLYQHSSVTAASSLTQLSRFYAHERDICHVVWNPSAHGYSEVAASEPELLSTGRDQMVKIWNIASSWCCGSVRVPGSARSMPKESDSSNLTKNQ--STGAPWISACWFPEKTDNPGRNIVVSGLRGELYSWS--DSSQLVRLHTEN--HGHSMLVFAIRSIPDMDGLFFTIGQDRQV-ILWTYRCPTDLTFMLRVPTIAAGISALAQSDHGHGPIAAGVADGSILLWRHCSSLQEESSSTNPVTSYWPRGVHGSCVTALAWHPSVRHESLLAYGTESGCVELIDTSKIPKSATQRSKTQPYIFGSTVYRVAWGPPLFTDSGKDQVVETAVSEHDANGSTDSTDTVEQKDSTNKSSSTPKFSSYIYSVCKGKIFCHVGFQRPPLDVTLKFPSVPGISTEDWVNDKRTDIAFLYLENSTRSVDSPSEENEIRECFSC-----LITVGYRSGSVDVYGLVKSKEHVSVDLIRPLCRISCHTKGVNCLAWSFD------RYWLAVGTNESFITVTDVGHILKQATKPNNPSFRQIS--TYLAHLEGHGNRITCLDWSPHENGLLLSASFDGTANVWKVTHSDTESGSTSVANFRAHRLRLFACLWSRQEADLAFSGGELCHLFSWRPSKLAHKEPPNSRRYRPPSVKRVPTDSKDPLMPSGILEPSAIVVTSQEVNHTECVPEPIHHTDTSVGTSVPLELPVKSVTTKKPGSGDKRKRPSLCPHFLHRGSLEPSTTDLGFCPPFRLGSRFLQVSHVLNLLKND-VDLPESDCDLLFLLPETNKTRSALVRFLTSEATHHLSAYRATQRSNGLMHLDAYCIILLWLGRTPLVAQTMCSEKHMPFWLLWAVQLAQTT--VPAFSAPRNSSGDHADIDLAGEKVKDMTSNSPDVLVSSTLLVCAGRHQEAVDYLFAQDRVKEALLLARLRLSPMD 1245          
BLAST of Gem (nuclear organelle) associated protein 5 vs. TrEMBL
Match: A0A5K4EX41 (Putative gem-associated protein 5 (Gemin5) OS=Schistosoma mansoni OX=6183 PE=4 SV=1)

HSP 1 Score: 268.47 bits (685), Expect = 1.025e-69
Identity = 287/1134 (25.31%), Postives = 483/1134 (42.59%), Query Frame = 1
Query:  115 LINSPLWYVSNILDTFDWNYEEKAG--VFFYGSRNQIYFIKVHESTNSL-KSYFNLKLHYYMKAHHDYITGVSAIINGTSILFNEVRIQPRLVSCGKDKMIRIWSFNEDTGCCCLKEFNISSTDIRSDPTCXXXXXXXXXX----CGFDKGSLLTWNFQKDSEYKTFCTKNGDINQI-TCKDN---------RFAIAHKKGFVDIYL-----LNSYDSITKITQFRAHHSDVCNIEWNPIESNL-ETWGDLATTGKDHQVKLWKIDKNYNVKTLNLP--SSWNKQNPKSFIEKDNAVSHNSQWSSICWSTVNNGT--LIASNGYGNIGTWK-SLSSTELKYFSQTNTTKPHCKSVFGIKEFRNHSGIFLSHSLDRLLNVSRINEQAKDGEYVLSMPCLGGSIMSLDAVD-KNNQLAIGGSDNLIRLWR------------FETQSNRKSFEVTNIWDGINGKILAISWHPFR--EGLLAFGTDTGTVGLVNISK------------------------------------DKKLAIASKLLHQNKVFITNWAVDIRKNFNGVTEEELKENLVIYSVGNGRLYGHDFRQNQYFDASHLVXXXXXXXXXXXXDELMVSDFTMHW--------------SLGYF-AVGYGNGLVNIYATKLDK--SDLVLICQIKTHSKGINCMRWSPNSNEAAGRYRLAIGSNERFLTVTDLGKVVIDFESSNRQQWTVVTFNETLAKFKGHGDRITGIDWCPFDSNRIVTSSYDHTAFVWSVL------DNTPIVSFNHHQGKVFCCKWSTRDPDLIYTGGEDSNLFAWRPSQQTLKTELNRRRQFVPALPGVTTINK-------ITGETPESVPVTDPKESIKNAIPTKEIAIK----------------------------TGFMKKRSSLFP-LTIFSV---------HHP---LETYQNSII---DFISG--NESYLPC-LSIL-----DSRSIIINQIEVELIHHREEKNF----------DNYFILLIWMGKIGKVATDCLAMNYSPDWLM-AVILGFTSGQVPGELIRMHVS----------------NTVAMRKDPILGATFWVAVGETRLAIDTLVKNDCIREALILAKLRLPPRD 2952
            L  SP W++SN+L    W   +  G  +  + SR  ++   +    +S  K  ++      ++ HH+           TS +  +V +   LVSCG D ++R W ++         EFN+ S     +PT ++  S +        G DKG L+ W    +     + +K  + + +  C            R A+ +KKG V +Y+     ++S  ++T+I +F AH  DVC++ W P  S   +   +L T G+D  VK+W +  +       +P  S ++  +      + N VS  + W S C++T  N    ++ S   G +  W  S + T +     T   + H   +F +    N  G+ ++ S DR+L V  + E++     VL +P L   + SL      N+ L  G SD  I  W+            F+ +S  KS  ++      +  I A++WHP    E +LA+GT++G V +V+I+K                                    ++++   S L   N   ++N  V+  +N    TE E K    +YSV  G+++ H F   +      +        +      L+ SD                   +  Y   VGY +G V++Y     K  ++L  IC+I +HSK +NC+ WS +       Y LAI SNE F+TVTDL K+ +    +  Q    V  +  LA+ +GH +RIT +DW P D   +++SS+D TA VW V       +N  I +F  H+ ++F C WS ++PDL ++GGE   LF WRPS+Q      + RR   P +  + + ++       I+GE+ +S   +            KEI +K                            T   +KR +LFP L  FS+         H P   + T+ + I+   DFI+   ++  LP  L IL      +R+ ++  +++E  HH +  +F          D Y I+L+W+G I  +        + P WL+ A+ L  ++   PG   ++ VS                +      D ++  T  V     + A++ L+  D ++EAL+LA+LRL P +
Sbjct:   11 LPGSPDWFMSNVLAATSWGNLDDGGNVLVAFSSRPYVHIFSIKNEVHSGDKHKYSWSYVGQLQPHHE----------KTSAITFDVCLSLSLVSCGFDGLVRRWIYSLPDWVL-ESEFNVHSVRENVNPTALSSFSHSPNQSYNFVGTDKGLLIVWIVDGEKNKTHYLSKKYENDSVLVCALEKSGFDYSILRVAVGYKKGLVGVYMFKPSDISSASNLTQIARFYAHERDVCHVVWKPCASGYTDNPTELLTCGRDQMVKVWNVSTSECCFCTKVPGQSRYHANDSGKRSNQKNNVS-GAPWISACYTTGKNSMVNILFSGLRGELFRWSCSDAPTNI-----TPENQGHSMLIFSMLFVPNSPGLVITVSQDRVLIVWELVEESLP-LVVLRLPTLSAGVFSLAQSSFSNSPLVAGLSDGSILFWKVYSPNMNDGNNSFDNRSKDKSISISPR-GSQSSPITALAWHPLPQYENILAYGTESGCVEIVDINKLQKIQNRKPKPQLHAFGSTVYRVAWGPIIFTGSHHKNEQIETKSHLKPDNSALLSNTTVE--ENVRCNTESEAKFPFYVYSVSKGKIHCH-FGGGRPPVEVSMKFPSPPNTTEEDWKTLIRSDIAFRPVSKTKQSSADPVPDTFDYLIGVGYRSGQVDVYGLSNSKLSNNLSFICRIVSHSKCVNCLAWSRD------YYWLAIASNESFITVTDL-KIHLFNALNQEQHLKPVQLSTCLARLEGHFNRITCLDWSPHDPFLLLSSSFDGTANVWRVHANNIENNNLSISNFRAHRLRLFTCLWSRQEPDLAFSGGELCLLFGWRPSEQIHSQPPHSRRHRPPTIKRLVSSDQEELCNGGISGESLQSETNSFVSSEALKEKSNKEITLKNDDKVTRASHKEQSVLSQNSSRKINSAGTAEKRKRPALFPNLFQFSINKQCELNLYHSPPFNMGTFLSHILSVSDFITEKVDDERLPTDLLILLPEVSVTRTCLLKYLKMEASHHLKLFHFGQRPNSLVHLDAYCIILLWIGCISSIPPVMSTEGHMPFWLLYAIQLAQSTLAYPGNYDKLTVSKENPVVEVDLLGEKIKDMQTASPDILVSVTLLVCAHRVQEAVELLLSYDRVKEALVLARLRLNPSE 1115          
BLAST of Gem (nuclear organelle) associated protein 5 vs. Ensembl Cavefish
Match: gemin5 (gem nuclear organelle associated protein 5 [Source:NCBI gene;Acc:103038650])

HSP 1 Score: 189.889 bits (481), Expect = 3.014e-48
Identity = 187/773 (24.19%), Postives = 322/773 (41.66%), Query Frame = 1
Query:  115 LINSPLWYVSNILDTFDWNYEEKAGVFFYGSRNQIYFIKVHESTNSLKSYFNLKLHYYMKAHHDYITGVSAIINGTSILFNEVRIQPRL-VSCGKDKMIRIWSFNEDTGCCCLKEFNISSTDIRS---DPTCXXXXXXXXXXCGFDKGSLLTWNFQKDSEYKTFCTKNGDINQITCK---DNRFAIAHKKGFVDIYLLNSYDSITKITQFRAHHSDVCNIEW--NPIESNL------------------ETWGDLATTGKDHQVKLWKIDKNYNVKTLNLPSSWNKQNPKSFIEKDNAVS----HNSQWSSICWSTVNNGTLIASNGYGNIGTWKSLSSTELKY--FSQTNTTKPHCKSVFGIKEFR-NHSGIFLSHSLDRLLNVSRINEQAKDGEYVLSMPCLGGSI--MSLDAVDKNNQLAIGGSDNLIRLWRFETQSNRKSFEVTNIWDGINGKILAISWHPFREGLLAFGTDTGTVGLVNISKDKKLAIASKLLHQNKVFITNWAVDIRK-NFNGVTEEELKENLVIYSV-GNGRLYGHDF--RQNQYFDASHLVXXXXXXXXXXXXDELMVSDFTMHWSLGYFAVGYGNGLVNIYATKLDKSDLVLICQIKTHSKGINCMRW-SPNSNEAAGRYRLAIGSNERFLTVTDLGKVVIDFESSNRQQWTVVTFNETLAKFKGHGDRITGIDWCPFDSNRIVTSSYDHTAFVWSVLDNTPIVSFNHHQGKVFCCKWSTRDPDLIYTGGEDSNLFAWRPSQQTLKTELNRRRQ 2310
            L  SP WY S   D         +GV  +G+++ +Y +KV   + ++    +         H + ++G +         F +   Q  +  S   DK +++W   +      L E +     I S    P         +++ G +KG ++ + + ++ +  +F  +   I  + C    +N  A+ +K G   I L++       I + R H  ++  + W   P E +L                  E  G LA+  +D  V++W   +   V TL LP          F+++  A          W ++ W       +++S   G +  W    S + K+     ++  + H + VF +         + +S S+DR +    +       E   ++P LGG +  MS   V     LA+G  DN+IR+W   T S    ++    W  I  K+ A++WHP +EG LAFGTD G VG+     +K   I+S   H+  V+  +W   I   +F G  +   K +  +YS  G+G ++ HD      +  +   L+                 +D          A+G  +G + +Y        L L+C ++ H K IN +RW   +S++      LA GS+   + + DL +  I+  S N      V   E      GH ++IT + W P    R+VT  YD TA VW VL   P+ ++  H G++ C +WS  +PDLI+TGG+D  +  W  S+Q   +    +R+
Sbjct:    6 LPASPNWYCSRCSDV------NSSGVLGFGAKSTVYLLKVTADSAAVLGELS--------GHTERVSGFA---------FCQHEGQEHICASSSDDKSVKVWDTEQKA---VLAEHSAHQNIITSLHWSPV-----EKGLVVSGDEKGIVVCFWYSRN-DIHSFFPEPRTIFCLACSPHNENHVAVGYKDGM--IVLIDISKKGEVIHRLRGHDEEIHALAWCPEPKEEDLYCFRPADSTDASNGLTEIEGGGYLASGSRDQTVRIWSTARGKGVMTLKLP----------FLKRRGAGVDLGVKERLWLAVHWPKGRPSQVVSSCFGGELVAWDLTKSGKQKWTLLGSSSDGQNHSRIVFNMSSVSVGDRDLLISTSMDREIKCWDLASL----ECCWTLPTLGGFVYSMSFSPVG-TGCLALGVGDNMIRVWN--TMSIHNPYDTRTYWQSIKSKVSALAWHPVKEGSLAFGTDDGKVGIYEAYSNKPPQISST-YHRRTVYSLDWGPPIPPLSFGGSAD---KPSYSLYSCGGDGIIFQHDPWKLSGEASNIDKLIRDTNNITHKLSPH----TDLCWKPDGKVLALGNEDGSIEVYGAP----SLKLLCTVQQHHKIINTLRWHHQHSDQPELHCLLASGSSNALVYIHDL-RSAIENPSENP-----VLVTEAFRSLSGHTNKITSLAWSPHHDARLVTVCYDSTAQVWDVLKEEPVCNYRGHSGRLLCVQWSPVNPDLIWTGGDDFTVQEWAVSKQEHVSPPKSKRR 709          
BLAST of Gem (nuclear organelle) associated protein 5 vs. Ensembl Cavefish
Match: coro6 (coronin 6 [Source:NCBI gene;Acc:103030088])

HSP 1 Score: 54.299 bits (129), Expect = 6.020e-7
Identity = 26/81 (32.10%), Postives = 39/81 (48.15%), Query Frame = 1
Query: 2041 GHGDRITGIDWCPFDSNRIVTSSYDHTAFVWSVLDNT-------PIVSFNHHQGKVFCCKWSTRDPDLIYTGGEDSNLFAW 2262
            GH   +  IDWCP + N + + S D TA VW + D+T       PIV    H  +V   KW     +++ + G D+ +  W
Sbjct:   79 GHSGPVLDIDWCPHNDNILASGSEDTTAMVWQIPDHTPSRPISEPIVVLEGHSKRVGIVKWHPTARNILLSAGSDNLIIVW 159          
BLAST of Gem (nuclear organelle) associated protein 5 vs. Ensembl Cavefish
Match: coro6 (coronin 6 [Source:NCBI gene;Acc:103030088])

HSP 1 Score: 53.5286 bits (127), Expect = 8.811e-7
Identity = 26/81 (32.10%), Postives = 39/81 (48.15%), Query Frame = 1
Query: 2041 GHGDRITGIDWCPFDSNRIVTSSYDHTAFVWSVLDNT-------PIVSFNHHQGKVFCCKWSTRDPDLIYTGGEDSNLFAW 2262
            GH   +  IDWCP + N + + S D TA VW + D+T       PIV    H  +V   KW     +++ + G D+ +  W
Sbjct:   79 GHSGPVLDIDWCPHNDNILASGSEDTTAMVWQIPDHTPSRPISEPIVVLEGHSKRVGIVKWHPTARNILLSAGSDNLIIVW 159          
BLAST of Gem (nuclear organelle) associated protein 5 vs. Ensembl Cavefish
Match: zgc:86896 (actin-related protein 2/3 complex subunit 1A-like [Source:NCBI gene;Acc:103021341])

HSP 1 Score: 50.447 bits (119), Expect = 7.055e-6
Identity = 27/71 (38.03%), Postives = 36/71 (50.70%), Query Frame = 1
Query: 2032 KFKGHGDRITGIDWCPFDSNRIVTSSYDHTAFVWSVLDNT--PIVSFNHHQGKVFCCKWSTRDPDLIYTGG 2238
            + K H  RITGIDW P +SNRIVT + D  A+VW++ D    P +          C KWS ++       G
Sbjct:   47 ELKEHSGRITGIDWAP-ESNRIVTCASDRNAYVWTLKDGVWKPTLVLVRINRAATCVKWSPQENKFALGSG 116          
BLAST of Gem (nuclear organelle) associated protein 5 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000004060.1 (pep scaffold:Pmarinus_7.0:GL488661:1025:7652:-1 gene:ENSPMAG00000003705.1 transcript:ENSPMAT00000004060.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 103.605 bits (257), Expect = 1.990e-23
Identity = 66/194 (34.02%), Postives = 96/194 (49.48%), Query Frame = 1
Query: 1756 FAVGYGNGLVNIYATKLDKSDLVLICQIKTHSKGINCMRW--SPNSNEAAGRYRLAIGSNERFLTVTDLGKVVIDFESSNRQQWTVVTFNETLAKFKGHGDRITGIDWCPFDSNRIVTSSYDHTAFVWSVLDNTPIVSFNHHQGKVFCCKWSTRDPDLIYTGGEDSNLFAWRPSQQTLK--------TELNRRR 2307
             A+G  +G + IY++ L    L  +C + +H K +NC+RW   P SN++A    LA GSN   + V DL  V           +T       LA   GH  R+T +DW P     +V++SYD T  VW      P+ ++  H G+V    W   D D++++GG DS++  WRPSQQ  K         EL R+R
Sbjct:   54 LALGNDDGSMEIYSSPL----LHHVCTLNSHHKTVNCLRWLLEP-SNQSALGLLLASGSNNAPIFVHDLQGVQGGQTQG----YTGTRHTRALA---GHTARVTALDWSPHCPGLLVSASYDGTVQVWRADTGEPLNNYRGHGGRVLSVAWCPSDTDVVWSGGNDSSVHKWRPSQQPHKQPPRGKKSVELERKR 235          
BLAST of Gem (nuclear organelle) associated protein 5 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000004067.1 (pep scaffold:Pmarinus_7.0:GL488661:1028:7673:-1 gene:ENSPMAG00000003705.1 transcript:ENSPMAT00000004067.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 103.605 bits (257), Expect = 2.833e-23
Identity = 66/194 (34.02%), Postives = 96/194 (49.48%), Query Frame = 1
Query: 1756 FAVGYGNGLVNIYATKLDKSDLVLICQIKTHSKGINCMRW--SPNSNEAAGRYRLAIGSNERFLTVTDLGKVVIDFESSNRQQWTVVTFNETLAKFKGHGDRITGIDWCPFDSNRIVTSSYDHTAFVWSVLDNTPIVSFNHHQGKVFCCKWSTRDPDLIYTGGEDSNLFAWRPSQQTLK--------TELNRRR 2307
             A+G  +G + IY++ L    L  +C + +H K +NC+RW   P SN++A    LA GSN   + V DL  V           +T       LA   GH  R+T +DW P     +V++SYD T  VW      P+ ++  H G+V    W   D D++++GG DS++  WRPSQQ  K         EL R+R
Sbjct:   61 LALGNDDGSMEIYSSPL----LHHVCTLNSHHKTVNCLRWLLEP-SNQSALGLLLASGSNNAPIFVHDLQGVQGGQTQG----YTGTRHTRALA---GHTARVTALDWSPHCPGLLVSASYDGTVQVWRADTGEPLNNYRGHGGRVLSVAWCPSDTDVVWSGGNDSSVHKWRPSQQPHKQPPRGKKSVELERKR 242          
BLAST of Gem (nuclear organelle) associated protein 5 vs. Ensembl Sea Lamprey
Match: thoc3 (THO complex 3 [Source:ZFIN;Acc:ZDB-GENE-040808-14])

HSP 1 Score: 51.2174 bits (121), Expect = 7.017e-7
Identity = 71/313 (22.68%), Postives = 117/313 (37.38%), Query Frame = 1
Query:  562 NFQKDSEYKTFCTKNGDINQI--TCKDNRFAIAHKKGFVDIYLLNSYDSITKITQFRAHHSDVCNIEWNPIESNLETWGDLATTGKDHQVKLWKIDKN-----YNVKTLNLPSSW----------NKQNPKSFIEKDNAVSHNSQW-----SSICWSTVNNGTLIASNGYGNIGTWKSLSSTELKYFSQTNTTKPHCKSVFGIKEFRNHSGIFLSHSLDRLLNVSRINEQAKDGEYVLSMPCLGGSIMSLDAVDKNNQLAIGGSDNLIRLWRFETQSNRKSFEVTNIWDGINGKILAISWHPFREGLLAFGTD 1434
            +F+  S  K F      ++ +  +C   R A         ++LL+  D + K   +R H   V  + W+P+   L       T   D  V++W +  N      N K  N+   W          NK++  +FI+  N  +   +      + I W+  +N     +NG G I     +S  ELK     N    +C  +    +F      F + S D L+++   NE       V  +  L   + +L        LA    D+ I +   +T    K +EV       +     ++WHP R  LLAF  D
Sbjct:   12 HFRAHSRVKEFTAHGAKVHSVAWSCDGRRLASGSFDKTASVFLLDK-DRMVKENNYRGHGDSVDQLCWHPLNPEL-----FVTASGDKTVRIWDVRSNKCAATVNTKGENINICWSPDGQTIAVGNKEDVVTFIDAKNYKTKAEEQFKFEVNEISWNN-DNDLFFLTNGNGCISI---MSYPELKPIQSINAHPSNCICI----KFDPTGKYFATGSADALVSLWDANELT----CVRCLSRLDWPVRTLSFSHDGKMLASASEDHFIDIADVDT--GEKLWEVH-----CDSPTFTVAWHPKRP-LLAFACD 298          
BLAST of Gem (nuclear organelle) associated protein 5 vs. Ensembl Yeast
Match: RSA4 (WD-repeat protein involved in ribosome biogenesis; may interact with ribosomes; required for maturation and efficient intra-nuclear transport or pre-60S ribosomal subunits, localizes to the nucleolus [Source:SGD;Acc:S000000668])

HSP 1 Score: 53.9138 bits (128), Expect = 1.131e-7
Identity = 34/113 (30.09%), Postives = 53/113 (46.90%), Query Frame = 1
Query: 1990 RQQWTVVTFNETLAKFKGHGDRITGIDWCPFDSNRIVTSSYDHTAFVWSVLDNTPIVSFNHHQGKVFCCKWSTRDPDLIYTGGEDSNLFAWRP-SQQTLKTELNRRRQFVPAL 2325
            R  + V     + +   GHG  I    + P  S+R+VT + D+TA +W     TP+ +   H   V C  WS  D ++I TG  D+ +  W P S Q L   L    +++ +L
Sbjct:  124 RAVFKVKPVTRSSSAIAGHGSTILCSAFAPHTSSRMVTGAGDNTARIWDCDTQTPMHTLKGHYNWVLCVSWSP-DGEVIATGSMDNTIRLWDPKSGQCLGDALRGHSKWITSL 235          
BLAST of Gem (nuclear organelle) associated protein 5 vs. Ensembl Nematostella
Match: EDO37187 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SGH2])

HSP 1 Score: 207.223 bits (526), Expect = 5.613e-56
Identity = 195/758 (25.73%), Postives = 319/758 (42.08%), Query Frame = 1
Query:  115 LINSPLWYVSNILDTFDWNYEEKAGVFFYGSRNQIYFIKVHESTNSLKSYFNLKLHYYMKAHHDYITGVSAIINGTSILFNEVRIQPRLVSCGKD-KMIRIWSFNEDTGCCCLKEFNISSTDIRSDPTCXXXXXXXXXXCGFDKGSLLTWNFQKDSEYKT-------FCTKNGDINQITCKDNRFAIAHKKGFVDIYLLNSYDSITKITQFRAHHSDVCNIEWNPI----------ESNLETWGDLATTGKDHQVKLWKIDKNYNVKTLNLPSSWNKQNPKSFIEKDNAVSHNSQWSSICWSTVNNGTLIASNGYGNIGTWKSLSSTELKYFSQTNTTKPHCKSVFGIKEFRNHSGIFLSHSLDR---LLNVSRINEQAKDGEYVLSMPCLGGSI--MSLDAVDKNNQLAIGGSDNLIRLWRFETQSNRKSFEVTNIWDGINGKILAISWHPFREGLLAFGTDTGTVGLVN-ISKDKKLAIASKLLHQNKVFITNWAVDIRKNFNGVTEEELKENLVIYSVGNGRLYGHDFRQNQYFDASHLVXXXXXXXXXXXXDELMVSDFTMHWSLGYFAVGYGN--GLVNIYATKLDKSDLVLICQIKTHSKGINCMRWSPNSNEAAGRYR----------LAIGSNERFLTVTDLGKVVIDFESSNRQQWTVVTFNETLAKFKGHGDRITGIDWCPFDSNRIVTSSYDHTAFVWSVLDNTPIVSFNHHQGKVFCCKWSTRDPDLIYTGGEDSNLFAWRPSQQT 2280
            L  SP WY S   D          G++ + ++  +Y + V+    + +  F          H D ++         S+ F    + P L + G D K +R+W                  T I   P    +  S       +KG+++ W + K++ + T       FC     +   +    + A+ +K G + I  ++S   +  + + R H SDV ++ W P+          ++N      L +  +D  ++LW       +   NLP    +   K   ++ +  S +  W S+CW       +I S+  G +  W  LS+   K       +  H + VF +      + + ++ S+DR   L +V+R  +       + ++  LGG +  M++  +D    LA+G  DN+IR+W   T S    ++  ++W GI  K++ + WHP +EGLLAFGTD G VG+ N I K K    A  + H+  V+  +W             E  KE L +YS G     G   +       S  V       S+      +VS   + WS    A+  GN  G + I+        L  +C I  H K I C+ W    +   G Y           LA GSNE  + + DL K +   E ++    + +T   +  +  GH  R+T + W P   +R+VTSSYD +A VW V  N PI ++  H G+V    WS  DPD++++GGED  +  WR S QT
Sbjct:   12 LPASPNWYYSTGTDF------SITGLYGFAAKKCVYLLDVNGPVPAFRGQFT--------EHTDRVS---------SVRFCPHALHPGLCASGADDKTVRLWDVETKGVLANHTTHTAKVTSISWSPQVKDLILSAD-----EKGTVIAWYYNKNTVHSTCPIQEYIFC-----VESSSVSSQQAAVGYKNGLIVILQVDS-QGMLPLHRLRGHESDVHSLAWCPLAHLDFGPLQNKANDAQGSLLISGSRDLTIRLWDTLSGKLITLWNLP---KRSTQKWRDKQQDWHSKDRMWVSVCWPQNLGNKIITSSHGGELLLWD-LSTPSPKDKVHVFGSG-HSRIVFNVSCTPCGTKL-MTTSMDRQVILWDVARCQQ-------ICTIATLGGYVYAMAISPLDPGT-LALGVGDNMIRVW--HTTSESAPYDAISLWQGIKSKVMMVCWHPQKEGLLAFGTDDGQVGIYNTIGKSKPEVFA--MYHKKTVYSVSWGPSCPDE-----GECCKEGLHVYSCGG---EGTVLQHRPGHTLSDAVDVNTLIKSTNDIKRKLVSRTDVSWSPDGAAMALGNDDGSIEIFV----PPSLRQVCIIAVHKKAITCLAW----HHGYGEYHILCDNDRAWWLASGSNESTVHIHDLSKAI---ECASHDAPSTIT--ASYRQLVGHCGRVTALSWSPHHPDRLVTSSYDGSAQVWDVETNQPIANYRGHVGRVMSVCWSYLDPDVVFSGGEDGTVRPWRVSLQT 696          
BLAST of Gem (nuclear organelle) associated protein 5 vs. Ensembl Nematostella
Match: EDO34582 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SNY6])

HSP 1 Score: 53.5286 bits (127), Expect = 4.315e-7
Identity = 31/110 (28.18%), Postives = 54/110 (49.09%), Query Frame = 1
Query: 2080 FDSNRIVTSSYDHTAFVWSVLDNTPIVSFNHHQGKVFCCKWSTRDPDLIYTGGEDSNLFAWR-PSQQTLKTELNRRRQFVPALPGVTTINKITGETPESVPVTDPKESIK 2406
            FD+  ++T+S+D+T  +W       +  ++ H G VFC  W  R  DLI +G  D+ + +W   S   L T        +  +   + +N +T +  E V ++  K+SIK
Sbjct:  197 FDNAHVLTASFDNTVGLWEWQTGQQLQCYHGHTGAVFCVDWCER-LDLIVSGSADTTIKSWGWSSGACLMTRYGHSDWVIKVMLMSSAVNSLTHDKGEVVLLSMDKKSIK 305          
BLAST of Gem (nuclear organelle) associated protein 5 vs. Ensembl Medaka
Match: gemin5 (gem nuclear organelle associated protein 5 [Source:NCBI gene;Acc:101167417])

HSP 1 Score: 201.83 bits (512), Expect = 4.733e-52
Identity = 220/945 (23.28%), Postives = 378/945 (40.00%), Query Frame = 1
Query:  115 LINSPLWYVSNILDTFDWNYEEKAGVFFYGSRNQIYFIKVHESTNSLKSYFNLKLHYYMKAHHDYITGVSAIINGTSILFNEVRIQPRLVSCGKDKMIRIWSFNEDTGCCCLKEFNISSTDIRS---DPTCXXXXXXXXXXCGFDKGSLLTWNFQKDSEYKTFCTKNGDINQITCKDNRF---AIAHKKGFVDIYLLNSYDSITKITQFRAHHSDVCNIEWNPI--ESNLETWGD----------------LATTGKDHQVKLWKIDKNYNVKTLNLPSSWNKQNPKSFIEKD-NAVSHNSQ---WSSICWSTVNNGTLIASNGYGNIGTWKSLSSTELKY--FSQTNTTKPHCKSVFGIKEFRNHSG--IFLSHSLDRLLNVSRINEQAKDGEYVLSMPCLGGSIMSLD-AVDKNNQLAIGGSDNLIRLWRFETQSNRKSFEVTNIWDGINGKILAISWHPFREGLLAFGTDTGTVGLVNISKDKKLAIASKLLHQNKVFITNWAVDIRKNFNGVTEEELKENLVIYS-VGNGRLYGHDFRQ--NQYFDASHLVXXXXXXXXXXXXDELMVSDFTMHWSLGYFAVGYGNGLVNIYATKLDKSDLVLICQIKTHSKGINCMRWSPNSNEAAGRYR-LAIGSNERFLTVTDLGKVVIDFESSNRQQWTVVTFNETLAKFKGHGDRITGIDWCPFDSNRIVTSSYDHTAFVWSVLDNTPIVSFNHHQGKVFCCKWSTRDPDLIYTGGEDSNLFAWRPSQQTLKTELNRRRQ------------------FVPALPGVTTINKITGETPESV------------PVTDPKESI---------KNAIPTKEIAIKTGFMKKRSSLFPLTIFSVHHPLETYQNSIIDFISGNESYLP---C---------LSILDSRSIIINQIEVELIHHREEKNFDNYFILLIWMGKI 2685
            L  SP WY S   D         +G+   G+RN +Y I V  S          ++   +  H D ++G S   +      N V       S   D  +R W  N  T    ++E     T + +    P        ++++ G +KG ++   F    +  +F  +   I  +TC  + +   AI +K G   I L++       + + R H +++ ++ W+P+  ES L +  +                LA+  KD  V++W   +   V TL LP          F+++  +AV    +   W S+ W       L++S   G +  W      + ++  F  ++  + H + VF     R   G  +  S S+DR +    +    K      ++  LGG + SL  +      LA+G  DN+IR+W   T S++  +++   W G+  K+ A++WHP +EG L+FGT+ G VG+  +   +   I+S   H+  V+   W   +     G      K++  +YS  G G +  HD  +  ++  D   L+                 +D +        A+G  +G ++++       +L  +C ++ H K IN +RW      A+  +  LA GS+   + V DL  V+ +         T V   E   +  GH  +ITG+ W P  S R+VT+SYD TA VW VL+  PI ++  H G +    WS  DPD+I+TGG+D  +  W+ SQQ        R+                     P L G   + K+ G+  + +             +  P  S+             P  ++++     KK  S+ PL+    H P E      +   +   +  P   C         L +   R  +   +E E   H +  +FD+   L +W G +
Sbjct:   15 LPASPNWYCSRCSDV------SSSGLLGVGARNVVYLIDVSASA--------CRVTGQLVGHADLVSGFSFCQHAGQ---NHV-----CASSSTDGSVRFWDSNSRT---LVREQVAHQTPVSALHWSPV-----DKDLVVSGDEKGVVVCHWFHT-GDTASFFPEPRTIVCLTCSPHTWSSVAIGYKDGM--IVLVDVSKKGEVMHRLRGHDNEIHSLAWSPVSGESALFSRAEDDEAANGGSAGEHGCYLASGSKDQTVRVWSTSRGKGVMTLKLP----------FLKRRASAVDPGVKERIWLSVLWPPGRPTELVSSCFSGELLLWDLTKGGKQRWTLFGSSSEGQNHSRIVFNTSSLRLQDGGELLFSTSMDREIKCWDL----KTLSCCWTLFSLGGVVYSLTFSPVGAGCLAVGAGDNMIRVW--NTLSSQNKYDIRTFWQGVKSKVTALAWHPQKEGTLSFGTEDGKVGIYEVFSSRPPQISSS-YHRKTVYTLAWGPPVPPLSFGTAG---KQSFGLYSCAGEGVILQHDPAKLSSEATDIDRLIKDTNDIKHKLSPH----TDLSWKPDGKVVAIGNEDGCIDVF----QAPNLKQLCSVQQHHKIINSLRWHHQHGSASELHTLLASGSSNAIVYVHDLRSVIENPPE------TPVVLTEPYRRLCGHTAKITGMAWSPHHSARLVTASYDGTAQVWDVLEEAPISNYRGHVGYLLSVDWSPVDPDVIWTGGKDFTVQEWKVSQQEFTKPPKGRKMSTLQEKKKSGSKQKKKSKSAPGLGG-DVVPKMNGDGEKDLSEEEEEEVGSTSSMHPPGASLEKKSSSVSRSKEKPPADLSLLK--KKKPRSMLPLSTSMDHRPREELLQDCVTLAAVRHASAPPAGCSPGHGDHVHLGLFADRRALRLMLEAEEEGHVQAGHFDSVVYLRLWSGDL 889          
BLAST of Gem (nuclear organelle) associated protein 5 vs. Ensembl Medaka
Match: gemin5 (gem nuclear organelle associated protein 5 [Source:NCBI gene;Acc:101167417])

HSP 1 Score: 199.519 bits (506), Expect = 2.317e-51
Identity = 192/768 (25.00%), Postives = 326/768 (42.45%), Query Frame = 1
Query:  115 LINSPLWYVSNILDTFDWNYEEKAGVFFYGSRNQIYFIKVHESTNSLKSYFNLKLHYYMKAHHDYITGVSAIINGTSILFNEVRIQPRLVSCGKDKMIRIWSFNEDTGCCCLKEFNISSTDIRS---DPTCXXXXXXXXXXCGFDKGSLLTWNFQKDSEYKTFCTKNGDINQITCKDNRF---AIAHKKGFVDIYLLNSYDSITKITQFRAHHSDVCNIEWNPI--ESNLETWGD----------------LATTGKDHQVKLWKIDKNYNVKTLNLPSSWNKQNPKSFIEKD-NAVSHNSQ---WSSICWSTVNNGTLIASNGYGNIGTWKSLSSTELKY--FSQTNTTKPHCKSVFGIKEFRNHSG--IFLSHSLDRLLNVSRINEQAKDGEYVLSMPCLGGSIMSLD-AVDKNNQLAIGGSDNLIRLWRFETQSNRKSFEVTNIWDGINGKILAISWHPFREGLLAFGTDTGTVGLVNISKDKKLAIASKLLHQNKVFITNWAVDIRKNFNGVTEEELKENLVIYS-VGNGRLYGHDFRQ--NQYFDASHLVXXXXXXXXXXXXDELMVSDFTMHWSLGYFAVGYGNGLVNIYATKLDKSDLVLICQIKTHSKGINCMRWSPNSNEAAGRYR-LAIGSNERFLTVTDLGKVVIDFESSNRQQWTVVTFNETLAKFKGHGDRITGIDWCPFDSNRIVTSSYDHTAFVWSVLDNTPIVSFNHHQGKVFCCKWSTRDPDLIYTGGEDSNLFAWRPSQQTLKTELNRRR 2307
            L  SP WY S   D         +G+   G+RN +Y I V  S          ++   +  H D ++G S   +      N V       S   D  +R W  N  T    ++E     T + +    P        ++++ G +KG ++   F    +  +F  +   I  +TC  + +   AI +K G   I L++       + + R H +++ ++ W+P+  ES L +  +                LA+  KD  V++W   +   V TL LP          F+++  +AV    +   W S+ W       L++S   G +  W      + ++  F  ++  + H + VF     R   G  +  S S+DR +    +    K      ++  LGG + SL  +      LA+G  DN+IR+W   T S++  +++   W G+  K+ A++WHP +EG L+FGT+ G VG+  +   +   I+S   H+  V+   W   +     G      K++  +YS  G G +  HD  +  ++  D   L+                 +D +        A+G  +G ++++       +L  +C ++ H K IN +RW      A+  +  LA GS+   + V DL  V+ +         T V   E   +  GH  +ITG+ W P  S R+VT+SYD TA VW VL+  PI ++  H G +    WS  DPD+I+TGG+D  +  W+ SQQ        R+
Sbjct:    6 LPASPNWYCSRCSDV------SSSGLLGVGARNVVYLIDVSASA--------CRVTGQLVGHADLVSGFSFCQHAGQ---NHV-----CASSSTDGSVRFWDSNSRT---LVREQVAHQTPVSALHWSPV-----DKDLVVSGDEKGVVVCHWFHT-GDTASFFPEPRTIVCLTCSPHTWSSVAIGYKDGM--IVLVDVSKKGEVMHRLRGHDNEIHSLAWSPVSGESALFSRAEDDEAANGGSAGEHGCYLASGSKDQTVRVWSTSRGKGVMTLKLP----------FLKRRASAVDPGVKERIWLSVLWPPGRPTELVSSCFSGELLLWDLTKGGKQRWTLFGSSSEGQNHSRIVFNTSSLRLQDGGELLFSTSMDREIKCWDL----KTLSCCWTLFSLGGVVYSLTFSPVGAGCLAVGAGDNMIRVW--NTLSSQNKYDIRTFWQGVKSKVTALAWHPQKEGTLSFGTEDGKVGIYEVFSSRPPQISSS-YHRKTVYTLAWGPPVPPLSFGTAG---KQSFGLYSCAGEGVILQHDPAKLSSEATDIDRLIKDTNDIKHKLSPH----TDLSWKPDGKVVAIGNEDGCIDVF----QAPNLKQLCSVQQHHKIINSLRWHHQHGSASELHTLLASGSSNAIVYVHDLRSVIENPPE------TPVVLTEPYRRLCGHTAKITGMAWSPHHSARLVTASYDGTAQVWDVLEEAPISNYRGHVGYLLSVDWSPVDPDVIWTGGKDFTVQEWKVSQQEFTKPPKGRK 706          
BLAST of Gem (nuclear organelle) associated protein 5 vs. Ensembl Medaka
Match: ENSORLT00000003955.2 (coronin 6 [Source:NCBI gene;Acc:101163755])

HSP 1 Score: 53.9138 bits (128), Expect = 8.267e-7
Identity = 27/81 (33.33%), Postives = 38/81 (46.91%), Query Frame = 1
Query: 2041 GHGDRITGIDWCPFDSNRIVTSSYDHTAFVWSVLDNT-------PIVSFNHHQGKVFCCKWSTRDPDLIYTGGEDSNLFAW 2262
            GH   +  IDWCP D N I + S D TA VW + D+T       P+V    H  +V    W     +++ T G D+ +  W
Sbjct:   79 GHSGPVLDIDWCPHDDNIIASCSEDCTAMVWQIPDHTLTRPLSDPVVVLEGHSKRVGIVTWHPTARNILLTAGSDNLIIIW 159          
BLAST of Gem (nuclear organelle) associated protein 5 vs. Ensembl Medaka
Match: wdr12 (WD repeat domain 12 [Source:NCBI gene;Acc:101160390])

HSP 1 Score: 50.447 bits (119), Expect = 8.705e-6
Identity = 38/148 (25.68%), Postives = 64/148 (43.24%), Query Frame = 1
Query: 1843 THSKGINCMRWSPNSNEAAGRYRLAIGSNERFLTVTDL----GKVVIDFESSNRQQWTVVTFNETLAKFKGHGDRITGIDWCPFDSNRIVTSSYDHTAFVWSVLD-NTPIVSFNHHQGKVFCCKWSTRDPDLIYTGGEDSNLFAWRPS 2271
            T SK  NC+ +SP         RLA GS +R + + D     G +V                   L     H   +T + W P   +++V+ S D+   +W +     P+     H+ KVFC  W+  +  L+ +GG D+ L++++ S
Sbjct:  295 TGSKVFNCISYSPLCR------RLASGSTDRHIRLWDPRTKDGALV-------------------LLSLTSHTGWVTAVKWAPTHEHQLVSGSLDNLVKLWDIRSCKAPLYDLAAHEDKVFCVDWT--ESGLMLSGGADNKLYSYKYS 415          
BLAST of Gem (nuclear organelle) associated protein 5 vs. Planmine SMEST
Match: SMESG000028728.1 (SMESG000028728.1)

HSP 1 Score: 2345.85 bits (6078), Expect = 0.000e+0
Identity = 1187/1192 (99.58%), Postives = 1189/1192 (99.75%), Query Frame = 1
Query:   91 MALPIYSGLINSPLWYVSNILDTFDWNYEEKAGVFFYGSRNQIYFIKVHESTNSLKSYFNLKLHYYMKAHHDYITGVSAIINGTSILFNEVRIQPRLVSCGKDKMIRIWSFNEDTGCCCLKEFNISSTDIRSDPTCXXXXXXXXXXCGFDKGSLLTWNFQKDSEYKTFCTKNGDINQITCKDNRFAIAHKKGFVDIYLLNSYDSITKITQFRAHHSDVCNIEWNPIESNLETWGDLATTGKDHQVKLWKIDKNYNVKTLNLPSSWNKQNPKSFIEKDNAVSHNSQWSSICWSTVNNGTLIASNGYGNIGTWKSLSSTELKYFSQTNTTKPHCKSVFGIKEFRNHSGIFLSHSLDRLLNVSRINEQAKDGEYVLSMPCLGGSIMSLDAVDKNNQLAIGGSDNLIRLWRFETQSNRKSFEVTNIWDGINGKILAISWHPFREGLLAFGTDTGTVGLVNISKDKKLAIASKLLHQNKVFITNWAVDIRKNFNGVTEEELKENLVIYSVGNGRLYGHDFRQNQYFDASHLVXXXXXXXXXXXXDELMVSDFTMHWSLGYFAVGYGNGLVNIYATKLDKSDLVLICQIKTHSKGINCMRWSPNSNEAAGRYRLAIGSNERFLTVTDLGKVVIDFESSNRQQWTVVTFNETLAKFKGHGDRITGIDWCPFDSNRIVTSSYDHTAFVWSVLDNTPIVSFNHHQGKVFCCKWSTRDPDLIYTGGEDSNLFAWRPSQQTLKTELNRRRQFVPALPGVTTINKITGETPESVPVTDPKESIKNAIPTKEIAIKTGFMKKRSSLFPLTIFSVHHPLETYQNSIIDFISGNESYLPCLSILDSRSIIINQIEVELIHHREEKNFDNYFILLIWMGKIGKVATDCLAMNYSPDWLMAVILGFTSGQVPGELIRMHVSNTVAMRKDPILGATFWVAVGETRLAIDTLVKNDCIREALILAKLRLPPRDPIIDELMPKLRENYFKNGCYELSAVCSMQMNKFPDVIESMNRRTSELANWVTIQILIKHEQHELMLECAFGFVNRILLEQQSKQIDVNQWNAKIKSIHQIDFYSTLIDLHRFIWIEKKSLKEIWLQIKDARSRFGIEKSIILCNQIKLKLITKQINQSENQXXXXXXXXXXXXXXGSSDVESNIEPIGFDQLNDLIVQYHHINSLGNDLVAQLIHGVXXXXXXXXXXLITNNLFSLKL 3666
            MALPIYSGLINSPLWYVSNILDTFDWNYEEKAGVFFYGSRNQIYFIKVHESTNSLKSYFNLKLHYYMKAHHDYITGVSAIINGTSILFNEVRIQPRLVSCGKDKMIRIWSFNEDTGCCCLKEFNISSTDIRSDPTCIAISSSNIIICGFDKGSLLTWNFQKDSEYKTFCTKNGDINQITCKDNRFAIAHKKGFVDIYLLNSYDSITKITQFRAHHSDVCNIEWNPIESNLETWGDLATTGKDHQVKLWKIDKNYNVKTLNLPSSWNKQNPKSFIEKDNAVSHNSQWSSICWSTVNNGTLIASNGYGNIGTWKSLSSTELKYFSQTNTTKPHCKSVFGIKEFRNHSGIFLSHSLDRLLNVSRINEQAKDGEYVLSMPCLGGSIMSLDAVDKNNQLAIGGSDNLIRLWRFETQSNRKSFEVTNIWDGINGKILAISWHPFREGLLAFGTDTGTVGLVNISKDKKLAIASKLLHQNKVFITNWAVDIRKNFNGVTEEELKENLVIYSVGNGRLYGHDFRQNQYFDASHLVGGGGGGGSSCGGDELMVSDFTMHWSLGYFAVGYGNGLVNIYATKLDKSDLVLICQIKTHSKGINCMRWSPNSNE AGRYRLAIGSNERFLTVTDLGKVVIDFESSNRQQWTVVTFNETLAKFKGHGDRITGIDWCPFDSNRIVTSSYDHTAFVWSVLDNTPIVSFNHHQGKVFCCKWSTRDPDLIYTGGEDSNLFAWRPSQQTLKTELNRRRQFVPALPGVTT NKITGETPESVPVTDPKESIKNAIPTKEIAIKTGFMKKRSSLFPLTIFSVHHPLETYQNSIIDFISGN+SYLPCLSILDSRSIIINQIEVELIHHREEKNFDNYFILLIWMGKIGKVATDCLAMNYSPDWLMAVILGFTSGQVPGELIRMHVSNTVAMRKDPILGATFWVAVGETRLAIDTLVKNDCIREALILAKLRLPPRDPIIDELMPKLRENYFKNGCYELSAVCSMQMNKFPDVIESMNRRTSELANWVTIQILIKHEQHELMLECAFGFVNRILLEQQSKQIDVNQWNAKIKSIHQIDFYSTLIDLHRFIWI+KKSLKEIWLQIKDARSRFGIEKSIILCNQIK KLITKQINQSENQLSLYLTYEILLLIIGSSDVESNIEPIGFDQLNDLIVQYHHINSLGNDLVAQLIHGVEQEEKEKIIELITNNLFSLKL
Sbjct:    1 MALPIYSGLINSPLWYVSNILDTFDWNYEEKAGVFFYGSRNQIYFIKVHESTNSLKSYFNLKLHYYMKAHHDYITGVSAIINGTSILFNEVRIQPRLVSCGKDKMIRIWSFNEDTGCCCLKEFNISSTDIRSDPTCIAISSSNIIICGFDKGSLLTWNFQKDSEYKTFCTKNGDINQITCKDNRFAIAHKKGFVDIYLLNSYDSITKITQFRAHHSDVCNIEWNPIESNLETWGDLATTGKDHQVKLWKIDKNYNVKTLNLPSSWNKQNPKSFIEKDNAVSHNSQWSSICWSTVNNGTLIASNGYGNIGTWKSLSSTELKYFSQTNTTKPHCKSVFGIKEFRNHSGIFLSHSLDRLLNVSRINEQAKDGEYVLSMPCLGGSIMSLDAVDKNNQLAIGGSDNLIRLWRFETQSNRKSFEVTNIWDGINGKILAISWHPFREGLLAFGTDTGTVGLVNISKDKKLAIASKLLHQNKVFITNWAVDIRKNFNGVTEEELKENLVIYSVGNGRLYGHDFRQNQYFDASHLVGGGGGGGSSCGGDELMVSDFTMHWSLGYFAVGYGNGLVNIYATKLDKSDLVLICQIKTHSKGINCMRWSPNSNEVAGRYRLAIGSNERFLTVTDLGKVVIDFESSNRQQWTVVTFNETLAKFKGHGDRITGIDWCPFDSNRIVTSSYDHTAFVWSVLDNTPIVSFNHHQGKVFCCKWSTRDPDLIYTGGEDSNLFAWRPSQQTLKTELNRRRQFVPALPGVTTTNKITGETPESVPVTDPKESIKNAIPTKEIAIKTGFMKKRSSLFPLTIFSVHHPLETYQNSIIDFISGNKSYLPCLSILDSRSIIINQIEVELIHHREEKNFDNYFILLIWMGKIGKVATDCLAMNYSPDWLMAVILGFTSGQVPGELIRMHVSNTVAMRKDPILGATFWVAVGETRLAIDTLVKNDCIREALILAKLRLPPRDPIIDELMPKLRENYFKNGCYELSAVCSMQMNKFPDVIESMNRRTSELANWVTIQILIKHEQHELMLECAFGFVNRILLEQQSKQIDVNQWNAKIKSIHQIDFYSTLIDLHRFIWIKKKSLKEIWLQIKDARSRFGIEKSIILCNQIKSKLITKQINQSENQLSLYLTYEILLLIIGSSDVESNIEPIGFDQLNDLIVQYHHINSLGNDLVAQLIHGVEQEEKEKIIELITNNLFSLKL 1192          
The following BLAST results are available for this feature:
BLAST of Gem (nuclear organelle) associated protein 5 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 1
Match NameE-valueIdentityDescription
GEMIN51.335e-5027.06gem nuclear organelle associated protein 5 [Source... [more]
back to top
BLAST of Gem (nuclear organelle) associated protein 5 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Gem (nuclear organelle) associated protein 5 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 2
Match NameE-valueIdentityDescription
Pex73.683e-725.13gene:FBgn0035922 transcript:FBtr0076568[more]
Pex73.683e-725.13gene:FBgn0035922 transcript:FBtr0273328[more]
back to top
BLAST of Gem (nuclear organelle) associated protein 5 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 3
Match NameE-valueIdentityDescription
gemin52.861e-5324.04gem (nuclear organelle) associated protein 5 [Sour... [more]
coro66.457e-733.33coronin 6 [Source:ZFIN;Acc:ZDB-GENE-040426-1202][more]
coro66.538e-733.33coronin 6 [Source:ZFIN;Acc:ZDB-GENE-040426-1202][more]
back to top
BLAST of Gem (nuclear organelle) associated protein 5 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
GEMIN55.915e-4723.29gem nuclear organelle associated protein 5 [Source... [more]
GEMIN52.410e-4623.16gem nuclear organelle associated protein 5 [Source... [more]
GEMIN54.924e-4623.33gem nuclear organelle associated protein 5 [Source... [more]
GEMIN56.550e-4624.71gem nuclear organelle associated protein 5 [Source... [more]
GEMIN56.714e-4624.52gem nuclear organelle associated protein 5 [Source... [more]
back to top
BLAST of Gem (nuclear organelle) associated protein 5 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Gemin59.437e-5823.52gem nuclear organelle associated protein 5 [Source... [more]
Gemin52.746e-4926.63gem nuclear organelle associated protein 5 [Source... [more]
Gemin52.815e-4926.63gem nuclear organelle associated protein 5 [Source... [more]
Gemin53.774e-1833.52gem nuclear organelle associated protein 5 [Source... [more]
Hira9.502e-626.47histone cell cycle regulator [Source:MGI Symbol;Ac... [more]
back to top
BLAST of Gem (nuclear organelle) associated protein 5 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q8TEQ6|GEMI5_HUMAN6.413e-5027.06Gem-associated protein 5 OS=Homo sapiens OX=9606 G... [more]
sp|Q8BX17|GEMI5_MOUSE1.969e-4826.63Gem-associated protein 5 OS=Mus musculus OX=10090 ... [more]
sp|Q54IY5|GEMI5_DICDI3.255e-1031.58Component of gems protein 5 OS=Dictyostelium disco... [more]
sp|Q652L2|HIRA_ORYSJ6.641e-726.32Protein HIRA OS=Oryza sativa subsp. japonica OX=39... [more]
sp|Q9FLX9|NLE1_ARATH2.779e-623.87Notchless protein homolog OS=Arabidopsis thaliana ... [more]
back to top
BLAST of Gem (nuclear organelle) associated protein 5 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
D5JG490.000e+062.92Gemin 5 (Fragment) OS=Dugesia japonica OX=6161 GN=... [more]
A0A5J4NSB67.084e-7225.27Gem associated protein 5 OS=Paragonimus westermani... [more]
A0A419QHL42.912e-7125.45Gem-associated protein 5 OS=Clonorchis sinensis OX... [more]
A0A074ZSR29.208e-7125.75Uncharacterized protein (Fragment) OS=Opisthorchis... [more]
A0A5K4EX411.025e-6925.31Putative gem-associated protein 5 (Gemin5) OS=Schi... [more]
back to top
BLAST of Gem (nuclear organelle) associated protein 5 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 4
Match NameE-valueIdentityDescription
gemin53.014e-4824.19gem nuclear organelle associated protein 5 [Source... [more]
coro66.020e-732.10coronin 6 [Source:NCBI gene;Acc:103030088][more]
coro68.811e-732.10coronin 6 [Source:NCBI gene;Acc:103030088][more]
zgc:868967.055e-638.03actin-related protein 2/3 complex subunit 1A-like ... [more]
back to top
BLAST of Gem (nuclear organelle) associated protein 5 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 3
Match NameE-valueIdentityDescription
ENSPMAT00000004060.11.990e-2334.02pep scaffold:Pmarinus_7.0:GL488661:1025:7652:-1 ge... [more]
ENSPMAT00000004067.12.833e-2334.02pep scaffold:Pmarinus_7.0:GL488661:1028:7673:-1 ge... [more]
thoc37.017e-722.68THO complex 3 [Source:ZFIN;Acc:ZDB-GENE-040808-14][more]
back to top
BLAST of Gem (nuclear organelle) associated protein 5 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 1
Match NameE-valueIdentityDescription
RSA41.131e-730.09WD-repeat protein involved in ribosome biogenesis;... [more]
back to top
BLAST of Gem (nuclear organelle) associated protein 5 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 2
Match NameE-valueIdentityDescription
EDO371875.613e-5625.73Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO345824.315e-728.18Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Gem (nuclear organelle) associated protein 5 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 4
Match NameE-valueIdentityDescription
gemin54.733e-5223.28gem nuclear organelle associated protein 5 [Source... [more]
gemin52.317e-5125.00gem nuclear organelle associated protein 5 [Source... [more]
ENSORLT00000003955.28.267e-733.33coronin 6 [Source:NCBI gene;Acc:101163755][more]
wdr128.705e-625.68WD repeat domain 12 [Source:NCBI gene;Acc:10116039... [more]
back to top
BLAST of Gem (nuclear organelle) associated protein 5 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 1
Match NameE-valueIdentityDescription
SMESG000028728.10.000e+099.58SMESG000028728.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30015917 ID=SMED30015917|Name=Gem (nuclear organelle) associated protein 5|organism=Schmidtea mediterranea sexual|type=transcript|length=3701bp
TTTAAATTAAAAATAATAATTGTGTTTTTATTGTAATTGTTTTAGGATAT
AAAATTTTAAATATCCAAGTTTTGTGGCATTAGTAAATAAATGGCTCTTC
CAATTTATTCAGGATTAATAAATTCACCTCTTTGGTATGTGTCTAATATA
TTGGATACTTTTGATTGGAATTACGAAGAAAAAGCAGGAGTATTCTTTTA
CGGTTCAAGAAATCAAATATACTTTATAAAAGTACATGAAAGTACCAATT
CGTTGAAAAGCTACTTTAATCTAAAGTTGCATTATTATATGAAAGCTCAT
CATGACTATATTACAGGCGTATCTGCAATTATCAATGGAACTTCTATATT
GTTTAATGAAGTAAGAATACAACCTCGCTTAGTTTCATGTGGGAAAGATA
AAATGATTCGCATATGGTCTTTTAATGAAGATACTGGTTGTTGTTGTTTA
AAAGAATTTAACATAAGTTCAACTGATATTCGTTCTGATCCAACTTGTAT
TGCTATTAGCTCTAGTAATATTATAATATGTGGATTTGATAAAGGTTCTC
TATTAACATGGAATTTCCAAAAAGATTCTGAGTATAAAACATTTTGCACT
AAAAATGGAGATATTAATCAAATTACTTGTAAAGATAATAGATTTGCGAT
CGCTCATAAGAAAGGATTTGTAGATATTTATTTACTAAATAGCTATGATT
CTATCACGAAAATAACTCAGTTTCGAGCTCATCATTCTGATGTTTGCAAC
ATAGAATGGAATCCAATTGAAAGTAATTTAGAAACCTGGGGAGACCTTGC
AACCACTGGAAAAGATCATCAAGTTAAACTCTGGAAAATCGATAAAAATT
ACAACGTTAAAACTCTAAACCTTCCTTCTTCATGGAATAAGCAAAATCCG
AAAAGTTTCATTGAAAAAGACAATGCCGTGAGCCACAATTCTCAGTGGTC
ATCGATCTGTTGGTCGACTGTTAATAACGGAACTTTGATTGCTTCAAACG
GCTATGGAAATATCGGAACATGGAAATCGCTATCGTCTACGGAACTGAAA
TATTTCTCCCAGACTAACACGACAAAACCTCACTGTAAATCGGTTTTTGG
AATTAAAGAATTTCGTAACCACAGCGGAATTTTCCTGTCTCACAGTTTGG
ATCGACTGCTGAATGTTTCCCGGATCAACGAGCAAGCAAAAGATGGAGAA
TACGTTCTATCGATGCCTTGTTTGGGAGGATCGATAATGAGCCTGGACGC
CGTCGACAAGAACAACCAACTAGCAATCGGAGGCTCGGATAATCTAATTC
GTCTCTGGAGATTCGAGACTCAATCGAATAGGAAATCGTTCGAGGTAACC
AACATCTGGGACGGAATCAACGGGAAAATCCTCGCCATCAGTTGGCATCC
ATTCCGTGAAGGATTGCTAGCGTTCGGAACCGACACGGGAACCGTTGGAT
TGGTAAACATTTCCAAAGACAAGAAATTGGCAATTGCCTCGAAACTTCTT
CACCAAAATAAGGTTTTCATCACCAATTGGGCAGTCGATATTAGAAAGAA
TTTCAATGGAGTTACTGAAGAGGAACTTAAGGAAAATCTTGTGATTTACA
GCGTTGGAAACGGTCGATTGTACGGGCACGATTTCCGACAGAATCAATAT
TTTGATGCCTCGCATTTGGTGGGCGGTGGCGGCGGCGGCGGCAGCAGCTG
TGGGGGAGATGAATTGATGGTTTCCGATTTCACTATGCACTGGTCGCTGG
GGTATTTTGCTGTTGGATACGGTAACGGACTGGTGAACATTTACGCAACG
AAGCTCGATAAATCGGATTTGGTTTTAATTTGTCAGATTAAAACCCACTC
AAAAGGCATCAATTGTATGCGATGGAGTCCGAATTCCAACGAAGCGGCTG
GTCGATATCGATTGGCTATTGGATCAAATGAGCGCTTTCTCACCGTAACG
GATCTCGGTAAAGTCGTTATCGATTTCGAATCGTCCAATCGACAGCAATG
GACCGTTGTAACATTCAATGAGACGCTGGCAAAGTTCAAAGGCCACGGTG
ATCGGATTACCGGAATCGATTGGTGCCCGTTTGATAGTAACCGAATCGTC
ACGTCGTCCTACGATCACACGGCGTTCGTTTGGAGCGTGCTTGACAACAC
TCCGATTGTCAGCTTTAACCACCACCAAGGAAAGGTATTCTGTTGCAAAT
GGAGCACGAGAGATCCAGATTTAATTTACACAGGTGGCGAGGACTCAAAT
CTGTTTGCTTGGCGACCGTCCCAGCAAACATTGAAAACCGAACTCAACCG
GAGACGGCAATTTGTGCCGGCATTGCCGGGAGTCACGACGATCAATAAGA
TTACCGGTGAGACTCCAGAAAGTGTTCCCGTTACCGATCCCAAAGAATCG
ATAAAAAACGCGATCCCTACAAAAGAAATCGCCATCAAAACGGGATTCAT
GAAGAAACGATCGAGTCTGTTTCCATTGACGATATTTTCCGTCCATCACC
CGCTGGAAACCTATCAGAACTCGATTATCGATTTTATCAGCGGAAACGAA
TCCTATTTGCCGTGTTTATCGATTTTGGACTCGAGGTCAATCATTATTAA
TCAAATCGAAGTTGAGCTAATCCATCACAGAGAGGAAAAAAATTTCGACA
ATTATTTCATATTATTGATTTGGATGGGGAAAATCGGAAAAGTCGCTACC
GATTGTCTGGCAATGAATTACAGTCCGGATTGGTTGATGGCGGTAATTCT
CGGTTTTACCTCCGGGCAGGTGCCGGGGGAGCTCATTCGGATGCACGTCA
GTAACACGGTTGCCATGAGGAAAGATCCAATTTTAGGGGCGACATTTTGG
GTCGCTGTCGGTGAAACGAGACTTGCTATCGATACCCTGGTGAAAAACGA
TTGCATTCGAGAGGCACTAATTCTAGCCAAGTTGCGATTACCCCCCCGTG
ATCCAATTATCGACGAGTTGATGCCAAAATTGCGAGAGAACTATTTCAAA
AACGGCTGCTATGAATTGTCGGCGGTTTGTAGCATGCAAATGAACAAATT
CCCCGATGTCATTGAATCCATGAACAGGAGAACATCGGAACTCGCCAATT
GGGTGACGATTCAAATCCTTATCAAACATGAGCAACATGAATTGATGTTG
GAGTGCGCATTCGGTTTTGTCAATAGAATTCTTTTGGAACAGCAGAGCAA
GCAAATCGATGTAAATCAATGGAACGCGAAAATCAAATCAATTCATCAAA
TTGATTTCTATTCGACTCTCATTGATCTGCATCGATTTATTTGGATTGAA
AAGAAAAGCCTGAAAGAGATTTGGCTGCAAATTAAAGACGCTCGTAGTCG
GTTTGGTATTGAAAAATCAATAATTCTTTGTAATCAAATTAAATTGAAAC
TCATTACGAAGCAAATTAATCAATCGGAAAATCAATTATCACTATATTTG
ACTTATGAAATCCTTTTATTGATTATTGGAAGTTCAGATGTGGAATCTAA
TATCGAGCCAATAGGATTCGATCAATTGAACGATTTGATTGTTCAATATC
ATCACATCAATTCCCTGGGAAACGATTTGGTCGCGCAATTAATTCACGGT
GTGGAACAAGAGGAAAAAGAAAAAATCATTGAATTAATTACAAACAATTT
ATTTAGTTTAAAACTATGAGATCCGATGCATTTATTGATCGTGTTACAAA
T
back to top

protein sequence of SMED30015917-orf-1

>SMED30015917-orf-1 ID=SMED30015917-orf-1|Name=SMED30015917-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=1193bp
MALPIYSGLINSPLWYVSNILDTFDWNYEEKAGVFFYGSRNQIYFIKVHE
STNSLKSYFNLKLHYYMKAHHDYITGVSAIINGTSILFNEVRIQPRLVSC
GKDKMIRIWSFNEDTGCCCLKEFNISSTDIRSDPTCIAISSSNIIICGFD
KGSLLTWNFQKDSEYKTFCTKNGDINQITCKDNRFAIAHKKGFVDIYLLN
SYDSITKITQFRAHHSDVCNIEWNPIESNLETWGDLATTGKDHQVKLWKI
DKNYNVKTLNLPSSWNKQNPKSFIEKDNAVSHNSQWSSICWSTVNNGTLI
ASNGYGNIGTWKSLSSTELKYFSQTNTTKPHCKSVFGIKEFRNHSGIFLS
HSLDRLLNVSRINEQAKDGEYVLSMPCLGGSIMSLDAVDKNNQLAIGGSD
NLIRLWRFETQSNRKSFEVTNIWDGINGKILAISWHPFREGLLAFGTDTG
TVGLVNISKDKKLAIASKLLHQNKVFITNWAVDIRKNFNGVTEEELKENL
VIYSVGNGRLYGHDFRQNQYFDASHLVGGGGGGGSSCGGDELMVSDFTMH
WSLGYFAVGYGNGLVNIYATKLDKSDLVLICQIKTHSKGINCMRWSPNSN
EAAGRYRLAIGSNERFLTVTDLGKVVIDFESSNRQQWTVVTFNETLAKFK
GHGDRITGIDWCPFDSNRIVTSSYDHTAFVWSVLDNTPIVSFNHHQGKVF
CCKWSTRDPDLIYTGGEDSNLFAWRPSQQTLKTELNRRRQFVPALPGVTT
INKITGETPESVPVTDPKESIKNAIPTKEIAIKTGFMKKRSSLFPLTIFS
VHHPLETYQNSIIDFISGNESYLPCLSILDSRSIIINQIEVELIHHREEK
NFDNYFILLIWMGKIGKVATDCLAMNYSPDWLMAVILGFTSGQVPGELIR
MHVSNTVAMRKDPILGATFWVAVGETRLAIDTLVKNDCIREALILAKLRL
PPRDPIIDELMPKLRENYFKNGCYELSAVCSMQMNKFPDVIESMNRRTSE
LANWVTIQILIKHEQHELMLECAFGFVNRILLEQQSKQIDVNQWNAKIKS
IHQIDFYSTLIDLHRFIWIEKKSLKEIWLQIKDARSRFGIEKSIILCNQI
KLKLITKQINQSENQLSLYLTYEILLLIIGSSDVESNIEPIGFDQLNDLI
VQYHHINSLGNDLVAQLIHGVEQEEKEKIIELITNNLFSLKL*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: biological process
TermDefinition
GO:0030217T cell differentiation
GO:0000387spliceosomal snRNP assembly
GO:0006397mRNA processing
GO:0006412translation
GO:0006417regulation of translation
GO:0008380RNA splicing
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0002109X1 cell
PLANA:0002111X2 cell
Vocabulary: INTERPRO
TermDefinition
IPR001680WD40_repeat
IPR015943WD40/YVTN_repeat-like_dom_sf
IPR017986WD40_repeat_dom
IPR011047Quinoprotein_ADH-like_supfam
Vocabulary: molecular function
TermDefinition
GO:0005515protein binding
GO:0017069snRNA binding
GO:0030619U1 snRNA binding
GO:0030621U4 snRNA binding
GO:0030622U4atac snRNA binding
GO:0043022ribosome binding
GO:0000340RNA 7-methylguanosine cap binding
GO:0003723RNA binding
GO:0003730mRNA 3'-UTR binding
Vocabulary: cellular component
TermDefinition
GO:0016604nuclear body
GO:0032797SMN complex
GO:0034718SMN-Gemin2 complex
GO:0034719SMN-Sm protein complex
GO:0097504Gemini of coiled bodies
GO:0005634nucleus
GO:0005654nucleoplasm
GO:0005737cytoplasm
GO:0005829cytosol
GO:0016020membrane