Homeodomain protein

Overview
NameHomeodomain protein
Smed IDSMED30015916
Length (bp)680
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Homeodomain protein (SMED30015916) t-SNE clustered cells

Violin plots show distribution of expression levels for Homeodomain protein (SMED30015916) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Homeodomain protein (SMED30015916) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Homeodomain protein (SMED30015916) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30015916

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 6

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
cephalic gangliaSMED30015916SMESG000029666.1 SmedASXL_008435SmedAsxl_ww_GCZZ01PMID:27034770
Currie et al., 2016
whole organism asexual adult colorimetric in situ hybridization evidence
ventral nerve cordSMED30015916SMESG000029666.1 SmedASXL_008435SmedAsxl_ww_GCZZ01PMID:27034770
Currie et al., 2016
whole organism asexual adult colorimetric in situ hybridization evidence
central nervous systemSMED30015916SMESG000029666.1 SmedASXL_008435SmedAsxl_ww_GCZZ01PMID:27034770
Currie et al., 2016
whole organism asexual adult fluorescence in situ hybridization evidence
central nervous systemSMED30015916SMESG000029666.1 SmedASXL_008435SmedAsxl_ww_GCZZ01PMID:27034770
Currie et al., 2016
whole organism asexual adult colorimetric in situ hybridization evidence
central nervous systemSMED30015916SMESG000029666.1 SMED30015916smed_20140614PMID:27034770
Currie et al., 2016
whole organism asexual adult fluorescence in situ hybridization evidence
head regionSMED30015916SMESG000029666.1 dd_Smed_v6_20296_0_1dd_Smed_v6PMID:28171748
Stückemann et al., 2017
whole organism asexual adult RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Homeodomain protein vs. Ensembl Human
Match: HOXA3 (homeobox A3 [Source:HGNC Symbol;Acc:HGNC:5104])

HSP 1 Score: 93.2041 bits (230), Expect = 1.916e-21
Identity = 46/100 (46.00%), Postives = 63/100 (63.00%), Query Frame = 3
Query:  150 IYRWMIDTRTLSSRTAKAKKQDKKNSNESENAYNYKDDACCTVSSTSKRCRSAYTNNQLVELEKEFHYNNYLARGRRTELSKQLLLTERQVKIWFQNRRM 449
            I+ WM ++R          +  K+ ++ S +  +   D      ++SKR R+AYT+ QLVELEKEFH+N YL R RR E++  L LTERQ+KIWFQNRRM
Sbjct:  155 IFPWMKESR----------QNTKQKTSSSSSGESCAGDKSPPGQASSKRARTAYTSAQLVELEKEFHFNRYLCRPRRVEMANLLNLTERQIKIWFQNRRM 244          
BLAST of Homeodomain protein vs. Ensembl Human
Match: HOXA3 (homeobox A3 [Source:HGNC Symbol;Acc:HGNC:5104])

HSP 1 Score: 93.2041 bits (230), Expect = 1.916e-21
Identity = 46/100 (46.00%), Postives = 63/100 (63.00%), Query Frame = 3
Query:  150 IYRWMIDTRTLSSRTAKAKKQDKKNSNESENAYNYKDDACCTVSSTSKRCRSAYTNNQLVELEKEFHYNNYLARGRRTELSKQLLLTERQVKIWFQNRRM 449
            I+ WM ++R          +  K+ ++ S +  +   D      ++SKR R+AYT+ QLVELEKEFH+N YL R RR E++  L LTERQ+KIWFQNRRM
Sbjct:  155 IFPWMKESR----------QNTKQKTSSSSSGESCAGDKSPPGQASSKRARTAYTSAQLVELEKEFHFNRYLCRPRRVEMANLLNLTERQIKIWFQNRRM 244          
BLAST of Homeodomain protein vs. Ensembl Human
Match: HOXA3 (homeobox A3 [Source:HGNC Symbol;Acc:HGNC:5104])

HSP 1 Score: 93.2041 bits (230), Expect = 1.916e-21
Identity = 46/100 (46.00%), Postives = 63/100 (63.00%), Query Frame = 3
Query:  150 IYRWMIDTRTLSSRTAKAKKQDKKNSNESENAYNYKDDACCTVSSTSKRCRSAYTNNQLVELEKEFHYNNYLARGRRTELSKQLLLTERQVKIWFQNRRM 449
            I+ WM ++R          +  K+ ++ S +  +   D      ++SKR R+AYT+ QLVELEKEFH+N YL R RR E++  L LTERQ+KIWFQNRRM
Sbjct:  155 IFPWMKESR----------QNTKQKTSSSSSGESCAGDKSPPGQASSKRARTAYTSAQLVELEKEFHFNRYLCRPRRVEMANLLNLTERQIKIWFQNRRM 244          
BLAST of Homeodomain protein vs. Ensembl Human
Match: HOXD3 (homeobox D3 [Source:HGNC Symbol;Acc:HGNC:5137])

HSP 1 Score: 92.8189 bits (229), Expect = 2.110e-21
Identity = 48/100 (48.00%), Postives = 59/100 (59.00%), Query Frame = 3
Query:  150 IYRWMIDTRTLSSRTAKAKKQDKKNSNESENAYNYKDDACCTVSSTSKRCRSAYTNNQLVELEKEFHYNNYLARGRRTELSKQLLLTERQVKIWFQNRRM 449
            I+ WM ++R           Q+ K  N    A    +D        SKR R+AYT+ QLVELEKEFH+N YL R RR E++  L LTERQ+KIWFQNRRM
Sbjct:  160 IFPWMKESR-----------QNSKQKNSCATAGESCEDKS-PPGPASKRVRTAYTSAQLVELEKEFHFNRYLCRPRRVEMANLLNLTERQIKIWFQNRRM 247          
BLAST of Homeodomain protein vs. Ensembl Human
Match: HOXD3 (homeobox D3 [Source:HGNC Symbol;Acc:HGNC:5137])

HSP 1 Score: 92.8189 bits (229), Expect = 2.110e-21
Identity = 48/100 (48.00%), Postives = 59/100 (59.00%), Query Frame = 3
Query:  150 IYRWMIDTRTLSSRTAKAKKQDKKNSNESENAYNYKDDACCTVSSTSKRCRSAYTNNQLVELEKEFHYNNYLARGRRTELSKQLLLTERQVKIWFQNRRM 449
            I+ WM ++R           Q+ K  N    A    +D        SKR R+AYT+ QLVELEKEFH+N YL R RR E++  L LTERQ+KIWFQNRRM
Sbjct:  160 IFPWMKESR-----------QNSKQKNSCATAGESCEDKS-PPGPASKRVRTAYTSAQLVELEKEFHFNRYLCRPRRVEMANLLNLTERQIKIWFQNRRM 247          
BLAST of Homeodomain protein vs. Ensembl Celegans
Match: lin-39 (Homeobox protein lin-39 [Source:UniProtKB/Swiss-Prot;Acc:P34684])

HSP 1 Score: 85.1149 bits (209), Expect = 8.347e-20
Identity = 41/77 (53.25%), Postives = 52/77 (67.53%), Query Frame = 3
Query:  219 KNSNESENAYNYKDDACCTVSSTSKRCRSAYTNNQLVELEKEFHYNNYLARGRRTELSKQLLLTERQVKIWFQNRRM 449
            KNS  +   +  +  +    S   KR R+AYT NQ++ELEKEFH + YL R RR E++  L+LTERQVKIWFQNRRM
Sbjct:  142 KNSGGAVYPWMTRVHSTTGGSRGEKRQRTAYTRNQVLELEKEFHTHKYLTRKRRIEVAHSLMLTERQVKIWFQNRRM 218          
BLAST of Homeodomain protein vs. Ensembl Celegans
Match: lin-39 (Homeobox protein lin-39 [Source:UniProtKB/Swiss-Prot;Acc:P34684])

HSP 1 Score: 85.1149 bits (209), Expect = 8.347e-20
Identity = 41/77 (53.25%), Postives = 52/77 (67.53%), Query Frame = 3
Query:  219 KNSNESENAYNYKDDACCTVSSTSKRCRSAYTNNQLVELEKEFHYNNYLARGRRTELSKQLLLTERQVKIWFQNRRM 449
            KNS  +   +  +  +    S   KR R+AYT NQ++ELEKEFH + YL R RR E++  L+LTERQVKIWFQNRRM
Sbjct:  142 KNSGGAVYPWMTRVHSTTGGSRGEKRQRTAYTRNQVLELEKEFHTHKYLTRKRRIEVAHSLMLTERQVKIWFQNRRM 218          
BLAST of Homeodomain protein vs. Ensembl Celegans
Match: mab-5 (Homeobox protein mab-5 [Source:UniProtKB/Swiss-Prot;Acc:P10038])

HSP 1 Score: 80.8777 bits (198), Expect = 1.112e-18
Identity = 37/54 (68.52%), Postives = 43/54 (79.63%), Query Frame = 3
Query:  288 SKRCRSAYTNNQLVELEKEFHYNNYLARGRRTELSKQLLLTERQVKIWFQNRRM 449
            SKR R  Y+ +Q +ELEKEFHY+ YL R RR E+S+ L LTERQVKIWFQNRRM
Sbjct:  117 SKRTRQTYSRSQTLELEKEFHYHKYLTRKRRQEISETLHLTERQVKIWFQNRRM 170          
BLAST of Homeodomain protein vs. Ensembl Celegans
Match: ceh-12 (Homeobox protein ceh-12 [Source:UniProtKB/Swiss-Prot;Acc:P17487])

HSP 1 Score: 70.8626 bits (172), Expect = 3.799e-16
Identity = 31/53 (58.49%), Postives = 44/53 (83.02%), Query Frame = 3
Query:  291 KRCRSAYTNNQLVELEKEFHYNNYLARGRRTELSKQLLLTERQVKIWFQNRRM 449
            +R R+A+++ QLV+LEK+F  N YL+R RR +L++QL L+E Q+KIWFQNRRM
Sbjct:    2 RRPRTAFSSEQLVQLEKQFSDNRYLSRPRRYQLAQQLSLSETQIKIWFQNRRM 54          
BLAST of Homeodomain protein vs. Ensembl Celegans
Match: ceh-12 (Homeobox protein ceh-12 [Source:UniProtKB/Swiss-Prot;Acc:P17487])

HSP 1 Score: 72.0182 bits (175), Expect = 1.683e-15
Identity = 31/53 (58.49%), Postives = 44/53 (83.02%), Query Frame = 3
Query:  291 KRCRSAYTNNQLVELEKEFHYNNYLARGRRTELSKQLLLTERQVKIWFQNRRM 449
            +R R+A+++ QLV+LEK+F  N YL+R RR +L++QL L+E Q+KIWFQNRRM
Sbjct:  111 RRPRTAFSSEQLVQLEKQFSDNRYLSRPRRYQLAQQLSLSETQIKIWFQNRRM 163          
BLAST of Homeodomain protein vs. Ensembl Fly
Match: pb (gene:FBgn0051481 transcript:FBtr0089278)

HSP 1 Score: 94.7449 bits (234), Expect = 4.512e-22
Identity = 49/107 (45.79%), Postives = 64/107 (59.81%), Query Frame = 3
Query:  129 NGIHAYPIYRWMIDTRTLSSRTAKAKKQDKKNSNESENAYNYKDDACCTVSSTSKRCRSAYTNNQLVELEKEFHYNNYLARGRRTELSKQLLLTERQVKIWFQNRRM 449
            +G+ + P Y WM           K KK  +K+SN +  A    ++         +R R+AYTN QL+ELEKEFH+N YL R RR E++  L LTERQVK+WFQNRRM
Sbjct:  157 DGMDSVPEYPWM-----------KEKKTSRKSSNNNNQAEFVPENGL------PRRLRTAYTNTQLLELEKEFHFNKYLCRPRRIEIAASLDLTERQVKVWFQNRRM 246          
BLAST of Homeodomain protein vs. Ensembl Fly
Match: pb (gene:FBgn0051481 transcript:FBtr0089277)

HSP 1 Score: 94.3597 bits (233), Expect = 6.364e-22
Identity = 49/107 (45.79%), Postives = 65/107 (60.75%), Query Frame = 3
Query:  129 NGIHAYPIYRWMIDTRTLSSRTAKAKKQDKKNSNESENAYNYKDDACCTVSSTSKRCRSAYTNNQLVELEKEFHYNNYLARGRRTELSKQLLLTERQVKIWFQNRRM 449
            +G+ + P Y WM               ++KK S +S N  N  D++    +   +R R+AYTN QL+ELEKEFH+N YL R RR E++  L LTERQVK+WFQNRRM
Sbjct:  157 DGMDSVPEYPWM---------------KEKKTSRKSSNNNNQGDNSI--KNGLPRRLRTAYTNTQLLELEKEFHFNKYLCRPRRIEIAASLDLTERQVKVWFQNRRM 246          
BLAST of Homeodomain protein vs. Ensembl Fly
Match: pb (gene:FBgn0051481 transcript:FBtr0089276)

HSP 1 Score: 93.9745 bits (232), Expect = 7.217e-22
Identity = 49/110 (44.55%), Postives = 65/110 (59.09%), Query Frame = 3
Query:  129 NGIHAYPIYRWMIDTRTLSSRTAKAKKQDKKNSNESENAYNYKDDACCTV---SSTSKRCRSAYTNNQLVELEKEFHYNNYLARGRRTELSKQLLLTERQVKIWFQNRRM 449
            +G+ + P Y WM               ++KK S +S N  N  D++       +   +R R+AYTN QL+ELEKEFH+N YL R RR E++  L LTERQVK+WFQNRRM
Sbjct:  157 DGMDSVPEYPWM---------------KEKKTSRKSSNNNNQGDNSITEFVPENGLPRRLRTAYTNTQLLELEKEFHFNKYLCRPRRIEIAASLDLTERQVKVWFQNRRM 251          
BLAST of Homeodomain protein vs. Ensembl Fly
Match: pb (gene:FBgn0051481 transcript:FBtr0089279)

HSP 1 Score: 92.0485 bits (227), Expect = 3.477e-21
Identity = 50/109 (45.87%), Postives = 62/109 (56.88%), Query Frame = 3
Query:  129 NGIHAYPIYRWMIDTRTLSSRTAKAKKQDKK--NSNESENAYNYKDDACCTVSSTSKRCRSAYTNNQLVELEKEFHYNNYLARGRRTELSKQLLLTERQVKIWFQNRRM 449
            +G+ + P Y WM           K KK  +K  N+N  EN                +R R+AYTN QL+ELEKEFH+N YL R RR E++  L LTERQVK+WFQNRRM
Sbjct:  157 DGMDSVPEYPWM-----------KEKKTSRKSSNNNNQENGL-------------PRRLRTAYTNTQLLELEKEFHFNKYLCRPRRIEIAASLDLTERQVKVWFQNRRM 241          
BLAST of Homeodomain protein vs. Ensembl Fly
Match: zen2 (gene:FBgn0004054 transcript:FBtr0290296)

HSP 1 Score: 85.8853 bits (211), Expect = 3.334e-20
Identity = 40/62 (64.52%), Postives = 49/62 (79.03%), Query Frame = 3
Query:  264 ACCTVSSTSKRCRSAYTNNQLVELEKEFHYNNYLARGRRTELSKQLLLTERQVKIWFQNRRM 449
            A    S  SKR R+A+++ QL+ELE+EFH N YLAR RR E+S++L LTERQVKIWFQNRRM
Sbjct:   15 ATTRSSEKSKRSRTAFSSLQLIELEREFHLNKYLARTRRIEISQRLALTERQVKIWFQNRRM 76          
BLAST of Homeodomain protein vs. Ensembl Zebrafish
Match: hoxd3a (homeobox D3a [Source:NCBI gene;Acc:30349])

HSP 1 Score: 92.8189 bits (229), Expect = 1.280e-21
Identity = 50/100 (50.00%), Postives = 62/100 (62.00%), Query Frame = 3
Query:  150 IYRWMIDTRTLSSRTAKAKKQDKKNSNESENAYNYKDDACCTVSSTSKRCRSAYTNNQLVELEKEFHYNNYLARGRRTELSKQLLLTERQVKIWFQNRRM 449
            I+ WM +TR    + AK K  +   + E+       DD        SKR R+AYT+ QLVELEKEFH+N YL R RR E++  L LTERQ+KIWFQNRRM
Sbjct:  126 IFPWMKETR----QNAKQKSTNCPAAGET------CDDKS-PPGPASKRVRTAYTSAQLVELEKEFHFNRYLCRPRRVEMANLLNLTERQIKIWFQNRRM 214          
BLAST of Homeodomain protein vs. Ensembl Zebrafish
Match: hoxd3a (homeobox D3a [Source:NCBI gene;Acc:30349])

HSP 1 Score: 92.8189 bits (229), Expect = 1.280e-21
Identity = 50/100 (50.00%), Postives = 62/100 (62.00%), Query Frame = 3
Query:  150 IYRWMIDTRTLSSRTAKAKKQDKKNSNESENAYNYKDDACCTVSSTSKRCRSAYTNNQLVELEKEFHYNNYLARGRRTELSKQLLLTERQVKIWFQNRRM 449
            I+ WM +TR    + AK K  +   + E+       DD        SKR R+AYT+ QLVELEKEFH+N YL R RR E++  L LTERQ+KIWFQNRRM
Sbjct:  126 IFPWMKETR----QNAKQKSTNCPAAGET------CDDKS-PPGPASKRVRTAYTSAQLVELEKEFHFNRYLCRPRRVEMANLLNLTERQIKIWFQNRRM 214          
BLAST of Homeodomain protein vs. Ensembl Zebrafish
Match: hoxd3a (homeobox D3a [Source:NCBI gene;Acc:30349])

HSP 1 Score: 92.8189 bits (229), Expect = 1.280e-21
Identity = 50/100 (50.00%), Postives = 62/100 (62.00%), Query Frame = 3
Query:  150 IYRWMIDTRTLSSRTAKAKKQDKKNSNESENAYNYKDDACCTVSSTSKRCRSAYTNNQLVELEKEFHYNNYLARGRRTELSKQLLLTERQVKIWFQNRRM 449
            I+ WM +TR    + AK K  +   + E+       DD        SKR R+AYT+ QLVELEKEFH+N YL R RR E++  L LTERQ+KIWFQNRRM
Sbjct:  126 IFPWMKETR----QNAKQKSTNCPAAGET------CDDKS-PPGPASKRVRTAYTSAQLVELEKEFHFNRYLCRPRRVEMANLLNLTERQIKIWFQNRRM 214          
BLAST of Homeodomain protein vs. Ensembl Zebrafish
Match: hoxa4a (homeobox A4a [Source:NCBI gene;Acc:58050])

HSP 1 Score: 90.5077 bits (223), Expect = 8.029e-21
Identity = 50/114 (43.86%), Postives = 65/114 (57.02%), Query Frame = 3
Query:  129 NGIHAYP-------IYRWMIDTRTLSSRTAKAKKQDKKNSNESENAYNYKDDACCTVSSTSKRCRSAYTNNQLVELEKEFHYNNYLARGRRTELSKQLLLTERQVKIWFQNRRM 449
            N +H  P       I+ WM ++R          +  K+ S    +  +   D     S+ SKR R+AYT+ QLVELEKEFH+N YL R RR E++  L LTERQ+KIWFQNRRM
Sbjct:  113 NPVHVSPTPSTRKHIFPWMKESR----------QNTKQKSCSIISVESCAGDKSPPGSAASKRARTAYTSAQLVELEKEFHFNRYLCRPRRVEMANLLNLTERQIKIWFQNRRM 216          
BLAST of Homeodomain protein vs. Ensembl Zebrafish
Match: hoxa4a (homeobox A4a [Source:NCBI gene;Acc:58050])

HSP 1 Score: 90.5077 bits (223), Expect = 8.029e-21
Identity = 50/114 (43.86%), Postives = 65/114 (57.02%), Query Frame = 3
Query:  129 NGIHAYP-------IYRWMIDTRTLSSRTAKAKKQDKKNSNESENAYNYKDDACCTVSSTSKRCRSAYTNNQLVELEKEFHYNNYLARGRRTELSKQLLLTERQVKIWFQNRRM 449
            N +H  P       I+ WM ++R          +  K+ S    +  +   D     S+ SKR R+AYT+ QLVELEKEFH+N YL R RR E++  L LTERQ+KIWFQNRRM
Sbjct:  113 NPVHVSPTPSTRKHIFPWMKESR----------QNTKQKSCSIISVESCAGDKSPPGSAASKRARTAYTSAQLVELEKEFHFNRYLCRPRRVEMANLLNLTERQIKIWFQNRRM 216          
BLAST of Homeodomain protein vs. Ensembl Xenopus
Match: rab18 (RAB18, member RAS oncogene family [Source:Xenbase;Acc:XB-GENE-489852])

HSP 1 Score: 97.0561 bits (240), Expect = 4.660e-23
Identity = 51/100 (51.00%), Postives = 67/100 (67.00%), Query Frame = 3
Query:  150 IYRWMIDTRTLSSRTAKAKKQDKKNSNESENAYNYKDDACCTVSSTSKRCRSAYTNNQLVELEKEFHYNNYLARGRRTELSKQLLLTERQVKIWFQNRRM 449
            I+ WM +TR    + +K KKQ    ++++             +SS SKR R+AYTN+QLVELEKEFH+N YL R RR E++K L L+ERQ+KIWFQNRRM
Sbjct:  127 IFPWMKETR----QNSKQKKQAPPPADDAPAV------DSSFLSSASKRARTAYTNSQLVELEKEFHFNRYLCRPRRLEMAKLLNLSERQIKIWFQNRRM 216          
BLAST of Homeodomain protein vs. Ensembl Xenopus
Match: pbx2 (pre-B-cell leukemia homeobox 2 [Source:Xenbase;Acc:XB-GENE-484669])

HSP 1 Score: 96.2857 bits (238), Expect = 1.096e-22
Identity = 50/100 (50.00%), Postives = 63/100 (63.00%), Query Frame = 3
Query:  150 IYRWMIDTRTLSSRTAKAKKQDKKNSNESENAYNYKDDACCTVSSTSKRCRSAYTNNQLVELEKEFHYNNYLARGRRTELSKQLLLTERQVKIWFQNRRM 449
            I+ WM ++R    +  K +K    +S ES        D      S+SKR R+AYT+ QLVELEKEFH+N YL R RR E++  L LTERQ+KIWFQNRRM
Sbjct:  127 IFPWMKESR----QNTKQQKAGSSSSGES-----CAGDKSPPGQSSSKRARTAYTSAQLVELEKEFHFNRYLCRPRRVEMANLLNLTERQIKIWFQNRRM 217          
BLAST of Homeodomain protein vs. Ensembl Xenopus
Match: hoxb3 (homeobox B3 [Source:NCBI gene;Acc:548725])

HSP 1 Score: 95.5153 bits (236), Expect = 1.401e-22
Identity = 48/100 (48.00%), Postives = 63/100 (63.00%), Query Frame = 3
Query:  150 IYRWMIDTRTLSSRTAKAKKQDKKNSNESENAYNYKDDACCTVSSTSKRCRSAYTNNQLVELEKEFHYNNYLARGRRTELSKQLLLTERQVKIWFQNRRM 449
            I+ WM ++R         +   +K+S  +  A +   D     SS SKR R+AYT+ QLVELEKEFH+N YL R RR E++  L L+ERQ+KIWFQNRRM
Sbjct:  119 IFPWMKESR---------QNSKQKSSPPAPAAESCGGDRSPPGSSASKRARTAYTSAQLVELEKEFHFNRYLCRPRRVEMANLLNLSERQIKIWFQNRRM 209          
BLAST of Homeodomain protein vs. Ensembl Xenopus
Match: castor2 (cytosolic arginine sensor for mTORC1 subunit 2 [Source:Xenbase;Acc:XB-GENE-949506])

HSP 1 Score: 91.6633 bits (226), Expect = 4.904e-21
Identity = 50/103 (48.54%), Postives = 63/103 (61.17%), Query Frame = 3
Query:  150 IYRWMIDTRTLSSRTAKAKKQDKKNSNESENAYNYKDDACCTVSST---SKRCRSAYTNNQLVELEKEFHYNNYLARGRRTELSKQLLLTERQVKIWFQNRRM 449
            I+ WM ++R           Q+ K  N S ++     + C   S T   SKR R+AYT+ QLVELEKEFH+N YL R RR E++  L LTERQ+KIWFQNRRM
Sbjct:  142 IFPWMKESR-----------QNAKQKNTSSSSSTPPGENCEEKSPTGPSSKRVRTAYTSAQLVELEKEFHFNRYLCRPRRVEMANLLNLTERQIKIWFQNRRM 233          
BLAST of Homeodomain protein vs. Ensembl Xenopus
Match: mvk (mevalonate kinase [Source:Xenbase;Acc:XB-GENE-998892])

HSP 1 Score: 88.1965 bits (217), Expect = 4.668e-20
Identity = 38/54 (70.37%), Postives = 45/54 (83.33%), Query Frame = 3
Query:  288 SKRCRSAYTNNQLVELEKEFHYNNYLARGRRTELSKQLLLTERQVKIWFQNRRM 449
            S+R R+AYTN QL+ELEKEFH+N YL R RR E++  L LTERQVK+WFQNRRM
Sbjct:  133 SRRLRTAYTNTQLLELEKEFHFNKYLCRPRRVEIAALLDLTERQVKVWFQNRRM 186          
BLAST of Homeodomain protein vs. Ensembl Mouse
Match: Hoxa3 (homeobox A3 [Source:MGI Symbol;Acc:MGI:96175])

HSP 1 Score: 95.9005 bits (237), Expect = 1.339e-22
Identity = 48/100 (48.00%), Postives = 62/100 (62.00%), Query Frame = 3
Query:  150 IYRWMIDTRTLSSRTAKAKKQDKKNSNESENAYNYKDDACCTVSSTSKRCRSAYTNNQLVELEKEFHYNNYLARGRRTELSKQLLLTERQVKIWFQNRRM 449
            I+ WM ++R       +  KQ    S+  E+      D      ++SKR R+AYT+ QLVELEKEFH+N YL R RR E++  L LTERQ+KIWFQNRRM
Sbjct:  156 IFPWMKESR-------QNTKQKTSGSSSGESC---AGDKSPPGQASSKRARTAYTSAQLVELEKEFHFNRYLCRPRRVEMANLLNLTERQIKIWFQNRRM 245          
BLAST of Homeodomain protein vs. Ensembl Mouse
Match: Hoxd3 (homeobox D3 [Source:MGI Symbol;Acc:MGI:96207])

HSP 1 Score: 85.8853 bits (211), Expect = 2.851e-21
Identity = 39/56 (69.64%), Postives = 45/56 (80.36%), Query Frame = 3
Query:  282 STSKRCRSAYTNNQLVELEKEFHYNNYLARGRRTELSKQLLLTERQVKIWFQNRRM 449
              SKR R+AYT+ QLVELEKEFH+N YL R RR E++  L LTERQ+KIWFQNRRM
Sbjct:   33 PASKRVRTAYTSAQLVELEKEFHFNRYLCRPRRVEMANLLNLTERQIKIWFQNRRM 88          
BLAST of Homeodomain protein vs. Ensembl Mouse
Match: Hoxd3 (homeobox D3 [Source:MGI Symbol;Acc:MGI:96207])

HSP 1 Score: 91.2781 bits (225), Expect = 5.184e-21
Identity = 48/100 (48.00%), Postives = 59/100 (59.00%), Query Frame = 3
Query:  150 IYRWMIDTRTLSSRTAKAKKQDKKNSNESENAYNYKDDACCTVSSTSKRCRSAYTNNQLVELEKEFHYNNYLARGRRTELSKQLLLTERQVKIWFQNRRM 449
            I+ WM ++R  S       KQ    +   EN  +            SKR R+AYT+ QLVELEKEFH+N YL R RR E++  L LTERQ+KIWFQNRRM
Sbjct:  161 IFPWMKESRQNS-------KQKNSCATSGENCEDKSPPG-----PASKRVRTAYTSAQLVELEKEFHFNRYLCRPRRVEMANLLNLTERQIKIWFQNRRM 248          
BLAST of Homeodomain protein vs. Ensembl Mouse
Match: Hoxd3 (homeobox D3 [Source:MGI Symbol;Acc:MGI:96207])

HSP 1 Score: 91.2781 bits (225), Expect = 5.184e-21
Identity = 48/100 (48.00%), Postives = 59/100 (59.00%), Query Frame = 3
Query:  150 IYRWMIDTRTLSSRTAKAKKQDKKNSNESENAYNYKDDACCTVSSTSKRCRSAYTNNQLVELEKEFHYNNYLARGRRTELSKQLLLTERQVKIWFQNRRM 449
            I+ WM ++R  S       KQ    +   EN  +            SKR R+AYT+ QLVELEKEFH+N YL R RR E++  L LTERQ+KIWFQNRRM
Sbjct:  161 IFPWMKESRQNS-------KQKNSCATSGENCEDKSPPG-----PASKRVRTAYTSAQLVELEKEFHFNRYLCRPRRVEMANLLNLTERQIKIWFQNRRM 248          
BLAST of Homeodomain protein vs. Ensembl Mouse
Match: Hoxd3 (homeobox D3 [Source:MGI Symbol;Acc:MGI:96207])

HSP 1 Score: 91.2781 bits (225), Expect = 5.184e-21
Identity = 48/100 (48.00%), Postives = 59/100 (59.00%), Query Frame = 3
Query:  150 IYRWMIDTRTLSSRTAKAKKQDKKNSNESENAYNYKDDACCTVSSTSKRCRSAYTNNQLVELEKEFHYNNYLARGRRTELSKQLLLTERQVKIWFQNRRM 449
            I+ WM ++R  S       KQ    +   EN  +            SKR R+AYT+ QLVELEKEFH+N YL R RR E++  L LTERQ+KIWFQNRRM
Sbjct:  161 IFPWMKESRQNS-------KQKNSCATSGENCEDKSPPG-----PASKRVRTAYTSAQLVELEKEFHFNRYLCRPRRVEMANLLNLTERQIKIWFQNRRM 248          
BLAST of Homeodomain protein vs. UniProt/SwissProt
Match: sp|Q1KKX7|HXB3A_TAKRU (Homeobox protein Hox-B3a OS=Takifugu rubripes OX=31033 GN=hoxb3a PE=3 SV=1)

HSP 1 Score: 96.2857 bits (238), Expect = 8.947e-22
Identity = 49/102 (48.04%), Postives = 65/102 (63.73%), Query Frame = 3
Query:  150 IYRWMIDTRTLSSRTAKAKKQDKKN--SNESENAYNYKDDACCTVSSTSKRCRSAYTNNQLVELEKEFHYNNYLARGRRTELSKQLLLTERQVKIWFQNRRM 449
            I+ WM + R    +T K K     N   N +E+  + +       S++SKR R+AYT+ QLVELEKEFH+N YL R RR E++  L L+ERQ+KIWFQNRRM
Sbjct:  168 IFPWMKECR----QTTKQKTCSPSNNSGNGAESGSSGEKSPTGGSSASSKRARTAYTSAQLVELEKEFHFNRYLCRPRRVEMANLLNLSERQIKIWFQNRRM 265          
BLAST of Homeodomain protein vs. UniProt/SwissProt
Match: sp|Q1KL12|HXA3A_TAKRU (Homeobox protein Hox-A3a OS=Takifugu rubripes OX=31033 GN=hoxa3a PE=3 SV=1)

HSP 1 Score: 95.9005 bits (237), Expect = 9.324e-22
Identity = 49/100 (49.00%), Postives = 66/100 (66.00%), Query Frame = 3
Query:  150 IYRWMIDTRTLSSRTAKAKKQDKKNSNESENAYNYKDDACCTVSSTSKRCRSAYTNNQLVELEKEFHYNNYLARGRRTELSKQLLLTERQVKIWFQNRRM 449
            I+ WM ++R       +A KQ  K+++ + +  +   D     S+ SKR R+AYT+ QLVELEKEFH+N YL R RR E++  L LTERQ+KIWFQNRRM
Sbjct:  133 IFPWMKESR-------QATKQ--KSTSNTSSVESCPGDKSPPGSAASKRARTAYTSAQLVELEKEFHFNRYLCRPRRVEMANLLNLTERQIKIWFQNRRM 223          
BLAST of Homeodomain protein vs. UniProt/SwissProt
Match: sp|P02831|HXA3_MOUSE (Homeobox protein Hox-A3 OS=Mus musculus OX=10090 GN=Hoxa3 PE=1 SV=2)

HSP 1 Score: 95.9005 bits (237), Expect = 9.364e-22
Identity = 48/100 (48.00%), Postives = 62/100 (62.00%), Query Frame = 3
Query:  150 IYRWMIDTRTLSSRTAKAKKQDKKNSNESENAYNYKDDACCTVSSTSKRCRSAYTNNQLVELEKEFHYNNYLARGRRTELSKQLLLTERQVKIWFQNRRM 449
            I+ WM ++R       +  KQ    S+  E+      D      ++SKR R+AYT+ QLVELEKEFH+N YL R RR E++  L LTERQ+KIWFQNRRM
Sbjct:  156 IFPWMKESR-------QNTKQKTSGSSSGESC---AGDKSPPGQASSKRARTAYTSAQLVELEKEFHFNRYLCRPRRVEMANLLNLTERQIKIWFQNRRM 245          
BLAST of Homeodomain protein vs. UniProt/SwissProt
Match: sp|Q08DG7|HXA3_BOVIN (Homeobox protein Hox-A3 OS=Bos taurus OX=9913 GN=HOXA3 PE=2 SV=1)

HSP 1 Score: 95.5153 bits (236), Expect = 1.180e-21
Identity = 48/100 (48.00%), Postives = 62/100 (62.00%), Query Frame = 3
Query:  150 IYRWMIDTRTLSSRTAKAKKQDKKNSNESENAYNYKDDACCTVSSTSKRCRSAYTNNQLVELEKEFHYNNYLARGRRTELSKQLLLTERQVKIWFQNRRM 449
            I+ WM ++R       +  KQ    S+  E+      D      ++SKR R+AYT+ QLVELEKEFH+N YL R RR E++  L LTERQ+KIWFQNRRM
Sbjct:  155 IFPWMKESR-------QNTKQKTSGSSSGESC---AGDKSPPGQASSKRARTAYTSAQLVELEKEFHFNRYLCRPRRVEMANLLNLTERQIKIWFQNRRM 244          
BLAST of Homeodomain protein vs. UniProt/SwissProt
Match: sp|Q3V5Z9|HXD3_ORYLA (Homeobox protein Hox-D3 OS=Oryzias latipes OX=8090 GN=hoxd3a PE=3 SV=1)

HSP 1 Score: 93.9745 bits (232), Expect = 3.500e-21
Identity = 48/100 (48.00%), Postives = 58/100 (58.00%), Query Frame = 3
Query:  150 IYRWMIDTRTLSSRTAKAKKQDKKNSNESENAYNYKDDACCTVSSTSKRCRSAYTNNQLVELEKEFHYNNYLARGRRTELSKQLLLTERQVKIWFQNRRM 449
            I+ WM +TR              +NS +  N      D        SKR R+AYT+ QLVELEKEFH+N YL R RR E++  L LTERQ+KIWFQNRRM
Sbjct:  128 IFPWMKETR--------------QNSKQKSNNCGEVSDEKSPPGPASKRVRTAYTSAQLVELEKEFHFNRYLCRPRRVEMANLLNLTERQIKIWFQNRRM 213          
BLAST of Homeodomain protein vs. TrEMBL
Match: P91715 (Homeodomain protein (Fragment) OS=Girardia tigrina OX=6162 GN=DthoxG PE=2 SV=2)

HSP 1 Score: 306.22 bits (783), Expect = 2.552e-103
Identity = 155/186 (83.33%), Postives = 172/186 (92.47%), Query Frame = 3
Query:   90 VEAGDGTFLCSNNNGIHAYPIYRWMIDTRTLSSRTAKAKKQDKKNSNESENAYNYKDDACCTVSSTSKRCRSAYTNNQLVELEKEFHYNNYLARGRRTELSKQLLLTERQVKIWFQNRRMXXXXXXXXXXXSRIQFSVSNRVPGHESYQKIFGSGIFPLSSLDADNPANCSVYSRPEFCYQFSGVN 647
            ++ GD TFLCS+NNGI+ YPIYRWMIDTRT++ RT+K+KKQD+K  +ESEN YNY DDACCTVSSTSKRCRSAYTNNQLVELEKEFHYNNYLARGRRTELSKQLLLTERQVKIWFQNRRMKQKKEKKEIEKSR Q+S+ NRV G E+YQKIFG+GIFPL+ LD+DNP NCSVYSRPEFCYQFSG+N
Sbjct:    7 IDTGDRTFLCSSNNGINTYPIYRWMIDTRTVACRTSKSKKQDRKVVSESENVYNYNDDACCTVSSTSKRCRSAYTNNQLVELEKEFHYNNYLARGRRTELSKQLLLTERQVKIWFQNRRMKQKKEKKEIEKSRNQYSILNRVSGSENYQKIFGAGIFPLNPLDSDNPNNCSVYSRPEFCYQFSGIN 192          
BLAST of Homeodomain protein vs. TrEMBL
Match: Q9XXZ9 (PLOX2-Dj (Fragment) OS=Dugesia japonica OX=6161 GN=Plox2-Dj PE=2 SV=1)

HSP 1 Score: 279.641 bits (714), Expect = 3.305e-93
Identity = 142/167 (85.03%), Postives = 158/167 (94.61%), Query Frame = 3
Query:  147 PIYRWMIDTRTLSSRTAKAKKQDKKNSNESENAYNYKDDACCTVSSTSKRCRSAYTNNQLVELEKEFHYNNYLARGRRTELSKQLLLTERQVKIWFQNRRMXXXXXXXXXXXSRIQFSVSNRVPGHESYQKIFGSGIFPLSSLDADNPANCSVYSRPEFCYQFSGVN 647
            PIYRWMIDTRT+S RT+K KKQDKK++N+SEN+YNY D+ACCTVSSTSKRCRSAYTNNQLVELEKEFHYNNYLARGRRTELSKQLLLTERQVKIWFQNRRMKQKKEKKEIEKSR QF +SNRV G E+YQKIF SG+FPL++LD++N ANCSVYSRPEFCYQF+G+N
Sbjct:    4 PIYRWMIDTRTVSCRTSKTKKQDKKHANDSENSYNYNDEACCTVSSTSKRCRSAYTNNQLVELEKEFHYNNYLARGRRTELSKQLLLTERQVKIWFQNRRMKQKKEKKEIEKSRNQFPISNRVTGQENYQKIFASGLFPLNTLDSENTANCSVYSRPEFCYQFTGIN 170          
BLAST of Homeodomain protein vs. TrEMBL
Match: Q24680 (DNA-binding protein (Fragment) OS=Girardia tigrina OX=6162 GN=homeobox PE=2 SV=1)

HSP 1 Score: 189.504 bits (480), Expect = 2.992e-58
Identity = 101/114 (88.60%), Postives = 108/114 (94.74%), Query Frame = 3
Query:  306 AYTNNQLVELEKEFHYNNYLARGRRTELSKQLLLTERQVKIWFQNRRMXXXXXXXXXXXSRIQFSVSNRVPGHESYQKIFGSGIFPLSSLDADNPANCSVYSRPEFCYQFSGVN 647
            AYTNNQLVELEKEFHYNNYLARGRRTELSKQLLLTERQVKIWFQNRRMKQKKEKKEIEKSR Q+S+ NRV G E+YQKIFG+GIFPL+ LD+DNP NCSVYSRPEFCYQFSG+N
Sbjct:    8 AYTNNQLVELEKEFHYNNYLARGRRTELSKQLLLTERQVKIWFQNRRMKQKKEKKEIEKSRNQYSILNRVSGSENYQKIFGAGIFPLNPLDSDNPNNCSVYSRPEFCYQFSGIN 121          
BLAST of Homeodomain protein vs. TrEMBL
Match: Q26086 (Homeodomain protein (Fragment) OS=Polycelis nigra OX=39786 GN=Pnox4 PE=4 SV=1)

HSP 1 Score: 121.324 bits (303), Expect = 4.449e-32
Identity = 57/60 (95.00%), Postives = 58/60 (96.67%), Query Frame = 3
Query:  270 CTVSSTSKRCRSAYTNNQLVELEKEFHYNNYLARGRRTELSKQLLLTERQVKIWFQNRRM 449
            C VSSTSKRCRSAYTNNQLVELEKEFH+NNYLARGRR ELSKQLLLTERQVKIWFQNRRM
Sbjct:    5 CAVSSTSKRCRSAYTNNQLVELEKEFHFNNYLARGRRAELSKQLLLTERQVKIWFQNRRM 64          
BLAST of Homeodomain protein vs. TrEMBL
Match: A0A5J4NS57 (Homeobox domain-containing protein OS=Paragonimus westermani OX=34504 GN=DEA37_0010875 PE=4 SV=1)

HSP 1 Score: 108.612 bits (270), Expect = 1.361e-25
Identity = 60/82 (73.17%), Postives = 70/82 (85.37%), Query Frame = 3
Query:  258 DDACCTVSSTSKRCRSAYTNNQLVELEKEFHYNNYLARGRRTELSKQLLLTERQVKIWFQNRRMXXXXXXXXXXXSRIQFSV 503
            D +C TVSSTSKR RSAYTN QLVELEKEFHY+NYLA+ RR EL+ QL LTERQ+KIWFQNRRMKQKKE ++ EK R +++V
Sbjct:   73 DGSCATVSSTSKRPRSAYTNYQLVELEKEFHYSNYLAQPRRLELAAQLGLTERQIKIWFQNRRMKQKKECRDAEKPRFRWAV 154          
BLAST of Homeodomain protein vs. Ensembl Cavefish
Match: hoxd3a (homeobox D3 [Source:NCBI gene;Acc:103034417])

HSP 1 Score: 93.5893 bits (231), Expect = 4.952e-22
Identity = 55/116 (47.41%), Postives = 67/116 (57.76%), Query Frame = 3
Query:  120 SNNNGIH-AYP-----IYRWMIDTRTLSSRTAKAKKQDKKNSNESENAYNYKDDACCTVSSTSKRCRSAYTNNQLVELEKEFHYNNYLARGRRTELSKQLLLTERQVKIWFQNRRM 449
            +NNNG + A P     I+ WM +TR           Q+ K  N +  A     D        SKR R+AYT+ QLVELEKEFH+N YL R RR E++  L LTERQ+KIWFQNRRM
Sbjct:  108 ANNNGSNTATPVITKQIFPWMKETR-----------QNAKQKNTNCTAPGDTCDDKSPPGPASKRVRTAYTSAQLVELEKEFHFNRYLCRPRRVEMANLLNLTERQIKIWFQNRRM 212          
BLAST of Homeodomain protein vs. Ensembl Cavefish
Match: hoxd3a (homeobox D3 [Source:NCBI gene;Acc:103034417])

HSP 1 Score: 93.5893 bits (231), Expect = 4.952e-22
Identity = 55/116 (47.41%), Postives = 67/116 (57.76%), Query Frame = 3
Query:  120 SNNNGIH-AYP-----IYRWMIDTRTLSSRTAKAKKQDKKNSNESENAYNYKDDACCTVSSTSKRCRSAYTNNQLVELEKEFHYNNYLARGRRTELSKQLLLTERQVKIWFQNRRM 449
            +NNNG + A P     I+ WM +TR           Q+ K  N +  A     D        SKR R+AYT+ QLVELEKEFH+N YL R RR E++  L LTERQ+KIWFQNRRM
Sbjct:  108 ANNNGSNTATPVITKQIFPWMKETR-----------QNAKQKNTNCTAPGDTCDDKSPPGPASKRVRTAYTSAQLVELEKEFHFNRYLCRPRRVEMANLLNLTERQIKIWFQNRRM 212          
BLAST of Homeodomain protein vs. Ensembl Cavefish
Match: hoxa4a (homeobox A3 [Source:NCBI gene;Acc:103023252])

HSP 1 Score: 93.2041 bits (230), Expect = 7.953e-22
Identity = 48/100 (48.00%), Postives = 63/100 (63.00%), Query Frame = 3
Query:  150 IYRWMIDTRTLSSRTAKAKKQDKKNSNESENAYNYKDDACCTVSSTSKRCRSAYTNNQLVELEKEFHYNNYLARGRRTELSKQLLLTERQVKIWFQNRRM 449
            I+ WM ++R          +  K+ S+ + +  +   D     SS SKR R+AYT+ QLVELEKEFH+N YL R RR E++  L LTERQ+KIWFQNRRM
Sbjct:  126 IFPWMKESR----------QNTKQKSSSTSSVESCSGDKSPPNSSASKRARTAYTSAQLVELEKEFHFNRYLCRPRRVEMANLLNLTERQIKIWFQNRRM 215          
BLAST of Homeodomain protein vs. Ensembl Cavefish
Match: hoxa4a (homeobox A3 [Source:NCBI gene;Acc:103023252])

HSP 1 Score: 93.2041 bits (230), Expect = 7.953e-22
Identity = 48/100 (48.00%), Postives = 63/100 (63.00%), Query Frame = 3
Query:  150 IYRWMIDTRTLSSRTAKAKKQDKKNSNESENAYNYKDDACCTVSSTSKRCRSAYTNNQLVELEKEFHYNNYLARGRRTELSKQLLLTERQVKIWFQNRRM 449
            I+ WM ++R          +  K+ S+ + +  +   D     SS SKR R+AYT+ QLVELEKEFH+N YL R RR E++  L LTERQ+KIWFQNRRM
Sbjct:  126 IFPWMKESR----------QNTKQKSSSTSSVESCSGDKSPPNSSASKRARTAYTSAQLVELEKEFHFNRYLCRPRRVEMANLLNLTERQIKIWFQNRRM 215          
BLAST of Homeodomain protein vs. Ensembl Cavefish
Match: hoxb2a (homeobox B2 [Source:NCBI gene;Acc:103047202])

HSP 1 Score: 89.7373 bits (221), Expect = 1.182e-20
Identity = 51/104 (49.04%), Postives = 62/104 (59.62%), Query Frame = 3
Query:  279 SSTSKRCRSAYTNNQLVELEKEFHYNNYLARGRRTELSKQLLLTERQVKIWFQNRRMXXXXXXXXXXXSRIQFSVSNRVPGHESYQKIFGSGIFPLSSLDADNP 590
            SS S+R R+AYTN QL+ELEKEFH+N YL R RR E++  L LTERQVK+WFQNRRMK K++                   H   Q+   SG  PL   DA +P
Sbjct:  161 SSGSRRLRTAYTNTQLLELEKEFHFNKYLCRPRRVEIAALLDLTERQVKVWFQNRRMKHKRQTTH----------------HRDGQEGEPSGFEPLDGTDAASP 248          
BLAST of Homeodomain protein vs. Ensembl Sea Lamprey
Match: hoxd4a (homeobox D4a [Source:NCBI gene;Acc:30329])

HSP 1 Score: 80.4925 bits (197), Expect = 2.703e-20
Identity = 36/54 (66.67%), Postives = 44/54 (81.48%), Query Frame = 3
Query:  288 SKRCRSAYTNNQLVELEKEFHYNNYLARGRRTELSKQLLLTERQVKIWFQNRRM 449
            SKR R+AYT  Q++ELEKEFH+N YL R RR E++  L L+ERQ+KIWFQNRRM
Sbjct:    2 SKRSRTAYTRQQVLELEKEFHFNRYLTRRRRIEIAHSLCLSERQIKIWFQNRRM 55          
BLAST of Homeodomain protein vs. Ensembl Sea Lamprey
Match: hoxb7a (homeobox B7a [Source:NCBI gene;Acc:58044])

HSP 1 Score: 73.9442 bits (180), Expect = 7.196e-18
Identity = 34/54 (62.96%), Postives = 40/54 (74.07%), Query Frame = 3
Query:  288 SKRCRSAYTNNQLVELEKEFHYNNYLARGRRTELSKQLLLTERQVKIWFQNRRM 449
             KR R  Y+  Q +ELEKEFH+N YL R RR E++  L LTERQ+KIWFQNRRM
Sbjct:    4 GKRGRQTYSRYQTLELEKEFHFNRYLTRRRRVEIAHSLCLTERQIKIWFQNRRM 57          
BLAST of Homeodomain protein vs. Ensembl Sea Lamprey
Match: ENSPMAT00000011116.1 (pep scaffold:Pmarinus_7.0:GL482944:7995:8174:-1 gene:ENSPMAG00000010089.1 transcript:ENSPMAT00000011116.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 72.7886 bits (177), Expect = 1.147e-17
Identity = 33/50 (66.00%), Postives = 41/50 (82.00%), Query Frame = 3
Query:  300 RSAYTNNQLVELEKEFHYNNYLARGRRTELSKQLLLTERQVKIWFQNRRM 449
            R +Y+ +Q +ELEKEFH+N YLAR RR E++  L L+ERQVKIWFQNRRM
Sbjct:    5 RRSYSRHQSLELEKEFHFNRYLARRRRVEIAHSLCLSERQVKIWFQNRRM 54          
BLAST of Homeodomain protein vs. Ensembl Sea Lamprey
Match: ENSPMAT00000007188.1 (pep scaffold:Pmarinus_7.0:GL477571:301368:307708:1 gene:ENSPMAG00000006495.1 transcript:ENSPMAT00000007188.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 73.1738 bits (178), Expect = 1.664e-15
Identity = 31/50 (62.00%), Postives = 37/50 (74.00%), Query Frame = 3
Query:  300 RSAYTNNQLVELEKEFHYNNYLARGRRTELSKQLLLTERQVKIWFQNRRM 449
            R+ ++  QL ELEKEFH+N YL R RR E++  L L E QVKIWFQNRRM
Sbjct:  301 RTNFSTKQLTELEKEFHFNKYLTRARRVEIAAALQLNETQVKIWFQNRRM 350          
BLAST of Homeodomain protein vs. Ensembl Sea Lamprey
Match: ENSPMAT00000005057.1 (pep scaffold:Pmarinus_7.0:GL483321:9136:13526:-1 gene:ENSPMAG00000004598.1 transcript:ENSPMAT00000005057.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 68.1662 bits (165), Expect = 2.061e-15
Identity = 33/53 (62.26%), Postives = 39/53 (73.58%), Query Frame = 3
Query:  291 KRCRSAYTNNQLVELEKEFHYNNYLARGRRTELSKQLLLTERQVKIWFQNRRM 449
            +R R  Y+  Q +ELEKEF +N YL R RR E+S  L L+ERQVKIWFQNRRM
Sbjct:   28 RRGRQTYSRYQTLELEKEFLFNPYLTRKRRIEVSHVLGLSERQVKIWFQNRRM 80          
BLAST of Homeodomain protein vs. Ensembl Nematostella
Match: EDO42187 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S274])

HSP 1 Score: 84.3445 bits (207), Expect = 1.120e-21
Identity = 40/54 (74.07%), Postives = 45/54 (83.33%), Query Frame = 3
Query:  288 SKRCRSAYTNNQLVELEKEFHYNNYLARGRRTELSKQLLLTERQVKIWFQNRRM 449
            SKR R++YTN QL+ELEKEFH+N YL   RR E+SK L LTERQVKIWFQNRRM
Sbjct:    1 SKRHRTSYTNKQLLELEKEFHFNKYLCSSRRREISKALQLTERQVKIWFQNRRM 54          
BLAST of Homeodomain protein vs. Ensembl Nematostella
Match: ANTHOX7 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S272])

HSP 1 Score: 82.0333 bits (201), Expect = 4.142e-19
Identity = 37/54 (68.52%), Postives = 44/54 (81.48%), Query Frame = 3
Query:  288 SKRCRSAYTNNQLVELEKEFHYNNYLARGRRTELSKQLLLTERQVKIWFQNRRM 449
            +KR R++YTN QL+ELEKEFHYN YL   RR EL+  + LTERQVK+WFQNRRM
Sbjct:   99 TKRYRTSYTNRQLLELEKEFHYNKYLCGTRRRELANAMKLTERQVKVWFQNRRM 152          
BLAST of Homeodomain protein vs. Ensembl Nematostella
Match: ANTHOX1A.NV (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RGM8])

HSP 1 Score: 79.7221 bits (195), Expect = 6.201e-19
Identity = 46/92 (50.00%), Postives = 62/92 (67.39%), Query Frame = 3
Query:  180 LSSRTAKAKKQDKKNSNESENAYNYKD-DACCTVSSTSK-RCRSAYTNNQLVELEKEFHYNNYLARGRRTELSKQLLLTERQVKIWFQNRRM 449
            L SR   A+K+ +++ +E E++ + +  DA        K R R AYT  QL+ELEKEFH+  YL + RRTE+++ L LTERQVKIWFQNRRM
Sbjct:   41 LLSRNEPAEKELERSDDECEDSKSEESGDAPWHYKQPFKHRKRMAYTRIQLLELEKEFHFTRYLTKERRTEMARMLDLTERQVKIWFQNRRM 132          
BLAST of Homeodomain protein vs. Ensembl Nematostella
Match: EDO45896 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RRW6])

HSP 1 Score: 77.0258 bits (188), Expect = 7.259e-19
Identity = 35/50 (70.00%), Postives = 41/50 (82.00%), Query Frame = 3
Query:  300 RSAYTNNQLVELEKEFHYNNYLARGRRTELSKQLLLTERQVKIWFQNRRM 449
            R+ Y+  QLVELEKEFHYN YL R RR E+++ L LTE+QVKIWFQNRRM
Sbjct:    5 RTIYSTRQLVELEKEFHYNRYLCRPRRIEIAQSLELTEKQVKIWFQNRRM 54          
BLAST of Homeodomain protein vs. Ensembl Nematostella
Match: HOX6 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S277])

HSP 1 Score: 75.8702 bits (185), Expect = 1.380e-16
Identity = 34/56 (60.71%), Postives = 42/56 (75.00%), Query Frame = 3
Query:  282 STSKRCRSAYTNNQLVELEKEFHYNNYLARGRRTELSKQLLLTERQVKIWFQNRRM 449
            S S++ R  +T  QLVELEKEFH++ YL R RR E++  L LTE Q+KIWFQNRRM
Sbjct:  151 SPSQKKRFTFTQRQLVELEKEFHFSKYLTRTRRIEIATTLKLTEMQIKIWFQNRRM 206          
BLAST of Homeodomain protein vs. Ensembl Medaka
Match: hoxa4a (homeobox protein Hox-A3a [Source:NCBI gene;Acc:100301594])

HSP 1 Score: 92.4337 bits (228), Expect = 1.728e-21
Identity = 55/127 (43.31%), Postives = 71/127 (55.91%), Query Frame = 3
Query:   69 MSFNSDQVEAGDGTFLCSNNNGIHAYPIYRWMIDTRTLSSRTAKAKKQDKKNSNESENAYNYKDDACCTVSSTSKRCRSAYTNNQLVELEKEFHYNNYLARGRRTELSKQLLLTERQVKIWFQNRRM 449
            +S N+    +  G    S  +G  +  I+ WM + R    +  K K     +S ES        D     S+ SKR R+AYT+ QLVELEKEFH+N YL R RR E++  L LTERQ+KIWFQNRRM
Sbjct:  104 ISQNASNGSSQPGAKNASPTSGARSKQIFPWMKECR----QNTKQKPASSSSSVES-----CPGDKSPPGSAASKRARTAYTSAQLVELEKEFHFNRYLCRPRRVEMANLLNLTERQIKIWFQNRRM 221          
BLAST of Homeodomain protein vs. Ensembl Medaka
Match: hoxd3a (homeobox D3 [Source:NCBI gene;Acc:101164107])

HSP 1 Score: 91.6633 bits (226), Expect = 2.719e-21
Identity = 47/100 (47.00%), Postives = 59/100 (59.00%), Query Frame = 3
Query:  150 IYRWMIDTRTLSSRTAKAKKQDKKNSNESENAYNYKDDACCTVSSTSKRCRSAYTNNQLVELEKEFHYNNYLARGRRTELSKQLLLTERQVKIWFQNRRM 449
            I+ WM +TR         +   +K++N          D        SKR R+AYT+ QLVELEKEFH+N YL R RR E++  L LTERQ+KIWFQNRRM
Sbjct:  128 IFPWMKETR---------QNSKQKSNNCVAAGSGEVSDEKSPPGPASKRVRTAYTSAQLVELEKEFHFNRYLCRPRRVEMANLLNLTERQIKIWFQNRRM 218          
BLAST of Homeodomain protein vs. Ensembl Medaka
Match: hoxb2a (homeobox B2 [Source:NCBI gene;Acc:101175483])

HSP 1 Score: 90.1225 bits (222), Expect = 9.563e-21
Identity = 41/75 (54.67%), Postives = 53/75 (70.67%), Query Frame = 3
Query:  225 SNESENAYNYKDDACCTVSSTSKRCRSAYTNNQLVELEKEFHYNNYLARGRRTELSKQLLLTERQVKIWFQNRRM 449
            S + E+  +    A    ++ S+R R+AYTN QL+ELEKEFH+N YL R RR E++  L LTERQVK+WFQNRRM
Sbjct:  152 SADVESPTDSSQAALDASAAGSRRLRTAYTNTQLLELEKEFHFNKYLCRPRRVEIAALLDLTERQVKVWFQNRRM 226          
BLAST of Homeodomain protein vs. Ensembl Medaka
Match: hoxa2b (homeobox protein Hox-A2b [Source:NCBI gene;Acc:101159040])

HSP 1 Score: 87.8113 bits (216), Expect = 2.941e-20
Identity = 39/59 (66.10%), Postives = 47/59 (79.66%), Query Frame = 3
Query:  273 TVSSTSKRCRSAYTNNQLVELEKEFHYNNYLARGRRTELSKQLLLTERQVKIWFQNRRM 449
            T    SKR R+AYTNNQL+ELEKEFH+N YL R RR E++  L L+E+QVK+WFQNRRM
Sbjct:  110 TDDGASKRLRTAYTNNQLLELEKEFHFNKYLCRPRRVEIAALLDLSEKQVKVWFQNRRM 168          
BLAST of Homeodomain protein vs. Ensembl Medaka
Match: ENSORLT00000006290.2 (pep primary_assembly:ASM223467v1:11:11321145:11323334:-1 gene:ENSORLG00000004987.2 transcript:ENSORLT00000006290.2 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 87.8113 bits (216), Expect = 4.058e-20
Identity = 38/54 (70.37%), Postives = 45/54 (83.33%), Query Frame = 3
Query:  288 SKRCRSAYTNNQLVELEKEFHYNNYLARGRRTELSKQLLLTERQVKIWFQNRRM 449
            S+R R+AYTN QL+ELEKEFH+N YL R RR E++  L LTERQVK+WFQNRRM
Sbjct:  137 SRRLRTAYTNTQLLELEKEFHFNKYLCRPRRVEIAALLDLTERQVKVWFQNRRM 190          
BLAST of Homeodomain protein vs. Planmine SMEST
Match: SMESG000029666.1 (SMESG000029666.1)

HSP 1 Score: 378.252 bits (970), Expect = 2.441e-135
Identity = 193/193 (100.00%), Postives = 193/193 (100.00%), Query Frame = 3
Query:   69 MSFNSDQVEAGDGTFLCSNNNGIHAYPIYRWMIDTRTLSSRTAKAKKQDKKNSNESENAYNYKDDACCTVSSTSKRCRSAYTNNQLVELEKEFHYNNYLARGRRTELSKQLLLTERQVKIWFQNRRMXXXXXXXXXXXSRIQFSVSNRVPGHESYQKIFGSGIFPLSSLDADNPANCSVYSRPEFCYQFSGVN 647
            MSFNSDQVEAGDGTFLCSNNNGIHAYPIYRWMIDTRTLSSRTAKAKKQDKKNSNESENAYNYKDDACCTVSSTSKRCRSAYTNNQLVELEKEFHYNNYLARGRRTELSKQLLLTERQVKIWFQNRRMKQKKEKKEIEKSRIQFSVSNRVPGHESYQKIFGSGIFPLSSLDADNPANCSVYSRPEFCYQFSGVN
Sbjct:    1 MSFNSDQVEAGDGTFLCSNNNGIHAYPIYRWMIDTRTLSSRTAKAKKQDKKNSNESENAYNYKDDACCTVSSTSKRCRSAYTNNQLVELEKEFHYNNYLARGRRTELSKQLLLTERQVKIWFQNRRMKQKKEKKEIEKSRIQFSVSNRVPGHESYQKIFGSGIFPLSSLDADNPANCSVYSRPEFCYQFSGVN 193          
BLAST of Homeodomain protein vs. Planmine SMEST
Match: SMESG000022667.1 (SMESG000022667.1)

HSP 1 Score: 84.3445 bits (207), Expect = 2.303e-19
Identity = 40/67 (59.70%), Postives = 48/67 (71.64%), Query Frame = 3
Query:  249 NYKDDACCTVSSTSKRCRSAYTNNQLVELEKEFHYNNYLARGRRTELSKQLLLTERQVKIWFQNRRM 449
            N K  A    SS +KR R  YT +Q +ELEKEFH+N YL R RR E++  L+LTERQ+KIWFQNRRM
Sbjct:  150 NPKSGADNPNSSNNKRTRQTYTRHQTLELEKEFHFNKYLTRRRRIEIAHSLILTERQIKIWFQNRRM 216          
BLAST of Homeodomain protein vs. Planmine SMEST
Match: SMESG000071019.1 (SMESG000071019.1)

HSP 1 Score: 84.7297 bits (208), Expect = 3.816e-19
Identity = 38/58 (65.52%), Postives = 47/58 (81.03%), Query Frame = 3
Query:  276 VSSTSKRCRSAYTNNQLVELEKEFHYNNYLARGRRTELSKQLLLTERQVKIWFQNRRM 449
            + S SKR R+AYT  Q++ELEKEFH+N YL R RR E+++ L L+ERQVKIWFQNRRM
Sbjct:  221 ILSDSKRNRTAYTRQQILELEKEFHFNKYLTRKRRIEIAQSLQLSERQVKIWFQNRRM 278          
BLAST of Homeodomain protein vs. Planmine SMEST
Match: SMESG000044469.1 (SMESG000044469.1)

HSP 1 Score: 77.0258 bits (188), Expect = 2.143e-17
Identity = 34/57 (59.65%), Postives = 43/57 (75.44%), Query Frame = 3
Query:  279 SSTSKRCRSAYTNNQLVELEKEFHYNNYLARGRRTELSKQLLLTERQVKIWFQNRRM 449
            S+  KR R AY+  Q +ELEKEF+YN YL R RR E++  + L+ERQ+KIWFQNRRM
Sbjct:  102 SAEYKRSRQAYSRQQTLELEKEFYYNQYLTRRRRIEIANSVCLSERQIKIWFQNRRM 158          
BLAST of Homeodomain protein vs. Planmine SMEST
Match: SMESG000079807.1 (SMESG000079807.1)

HSP 1 Score: 78.9518 bits (193), Expect = 3.248e-17
Identity = 37/57 (64.91%), Postives = 42/57 (73.68%), Query Frame = 3
Query:  279 SSTSKRCRSAYTNNQLVELEKEFHYNNYLARGRRTELSKQLLLTERQVKIWFQNRRM 449
            SS  KR R  YT  Q +ELEKEFH+N YL R RR E++  L LTERQ+KIWFQNRRM
Sbjct:  210 SSDHKRSRQTYTRYQTLELEKEFHFNKYLTRRRRIEIAHALSLTERQIKIWFQNRRM 266          
The following BLAST results are available for this feature:
BLAST of Homeodomain protein vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
HOXA31.916e-2146.00homeobox A3 [Source:HGNC Symbol;Acc:HGNC:5104][more]
HOXA31.916e-2146.00homeobox A3 [Source:HGNC Symbol;Acc:HGNC:5104][more]
HOXA31.916e-2146.00homeobox A3 [Source:HGNC Symbol;Acc:HGNC:5104][more]
HOXD32.110e-2148.00homeobox D3 [Source:HGNC Symbol;Acc:HGNC:5137][more]
HOXD32.110e-2148.00homeobox D3 [Source:HGNC Symbol;Acc:HGNC:5137][more]
back to top
BLAST of Homeodomain protein vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
lin-398.347e-2053.25Homeobox protein lin-39 [Source:UniProtKB/Swiss-P... [more]
lin-398.347e-2053.25Homeobox protein lin-39 [Source:UniProtKB/Swiss-P... [more]
mab-51.112e-1868.52Homeobox protein mab-5 [Source:UniProtKB/Swiss-Pr... [more]
ceh-123.799e-1658.49Homeobox protein ceh-12 [Source:UniProtKB/Swiss-P... [more]
ceh-121.683e-1558.49Homeobox protein ceh-12 [Source:UniProtKB/Swiss-P... [more]
back to top
BLAST of Homeodomain protein vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
pb4.512e-2245.79gene:FBgn0051481 transcript:FBtr0089278[more]
pb6.364e-2245.79gene:FBgn0051481 transcript:FBtr0089277[more]
pb7.217e-2244.55gene:FBgn0051481 transcript:FBtr0089276[more]
pb3.477e-2145.87gene:FBgn0051481 transcript:FBtr0089279[more]
zen23.334e-2064.52gene:FBgn0004054 transcript:FBtr0290296[more]
back to top
BLAST of Homeodomain protein vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
hoxd3a1.280e-2150.00homeobox D3a [Source:NCBI gene;Acc:30349][more]
hoxd3a1.280e-2150.00homeobox D3a [Source:NCBI gene;Acc:30349][more]
hoxd3a1.280e-2150.00homeobox D3a [Source:NCBI gene;Acc:30349][more]
hoxa4a8.029e-2143.86homeobox A4a [Source:NCBI gene;Acc:58050][more]
hoxa4a8.029e-2143.86homeobox A4a [Source:NCBI gene;Acc:58050][more]
back to top
BLAST of Homeodomain protein vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
rab184.660e-2351.00RAB18, member RAS oncogene family [Source:Xenbase;... [more]
pbx21.096e-2250.00pre-B-cell leukemia homeobox 2 [Source:Xenbase;Acc... [more]
hoxb31.401e-2248.00homeobox B3 [Source:NCBI gene;Acc:548725][more]
castor24.904e-2148.54cytosolic arginine sensor for mTORC1 subunit 2 [So... [more]
mvk4.668e-2070.37mevalonate kinase [Source:Xenbase;Acc:XB-GENE-9988... [more]
back to top
BLAST of Homeodomain protein vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Hoxa31.339e-2248.00homeobox A3 [Source:MGI Symbol;Acc:MGI:96175][more]
Hoxd32.851e-2169.64homeobox D3 [Source:MGI Symbol;Acc:MGI:96207][more]
Hoxd35.184e-2148.00homeobox D3 [Source:MGI Symbol;Acc:MGI:96207][more]
Hoxd35.184e-2148.00homeobox D3 [Source:MGI Symbol;Acc:MGI:96207][more]
Hoxd35.184e-2148.00homeobox D3 [Source:MGI Symbol;Acc:MGI:96207][more]
back to top
BLAST of Homeodomain protein vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q1KKX7|HXB3A_TAKRU8.947e-2248.04Homeobox protein Hox-B3a OS=Takifugu rubripes OX=3... [more]
sp|Q1KL12|HXA3A_TAKRU9.324e-2249.00Homeobox protein Hox-A3a OS=Takifugu rubripes OX=3... [more]
sp|P02831|HXA3_MOUSE9.364e-2248.00Homeobox protein Hox-A3 OS=Mus musculus OX=10090 G... [more]
sp|Q08DG7|HXA3_BOVIN1.180e-2148.00Homeobox protein Hox-A3 OS=Bos taurus OX=9913 GN=H... [more]
sp|Q3V5Z9|HXD3_ORYLA3.500e-2148.00Homeobox protein Hox-D3 OS=Oryzias latipes OX=8090... [more]
back to top
BLAST of Homeodomain protein vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
P917152.552e-10383.33Homeodomain protein (Fragment) OS=Girardia tigrina... [more]
Q9XXZ93.305e-9385.03PLOX2-Dj (Fragment) OS=Dugesia japonica OX=6161 GN... [more]
Q246802.992e-5888.60DNA-binding protein (Fragment) OS=Girardia tigrina... [more]
Q260864.449e-3295.00Homeodomain protein (Fragment) OS=Polycelis nigra ... [more]
A0A5J4NS571.361e-2573.17Homeobox domain-containing protein OS=Paragonimus ... [more]
back to top
BLAST of Homeodomain protein vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
hoxd3a4.952e-2247.41homeobox D3 [Source:NCBI gene;Acc:103034417][more]
hoxd3a4.952e-2247.41homeobox D3 [Source:NCBI gene;Acc:103034417][more]
hoxa4a7.953e-2248.00homeobox A3 [Source:NCBI gene;Acc:103023252][more]
hoxa4a7.953e-2248.00homeobox A3 [Source:NCBI gene;Acc:103023252][more]
hoxb2a1.182e-2049.04homeobox B2 [Source:NCBI gene;Acc:103047202][more]
back to top
BLAST of Homeodomain protein vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 5
Match NameE-valueIdentityDescription
hoxd4a2.703e-2066.67homeobox D4a [Source:NCBI gene;Acc:30329][more]
hoxb7a7.196e-1862.96homeobox B7a [Source:NCBI gene;Acc:58044][more]
ENSPMAT00000011116.11.147e-1766.00pep scaffold:Pmarinus_7.0:GL482944:7995:8174:-1 ge... [more]
ENSPMAT00000007188.11.664e-1562.00pep scaffold:Pmarinus_7.0:GL477571:301368:307708:1... [more]
ENSPMAT00000005057.12.061e-1562.26pep scaffold:Pmarinus_7.0:GL483321:9136:13526:-1 g... [more]
back to top
BLAST of Homeodomain protein vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Homeodomain protein vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
EDO421871.120e-2174.07Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
ANTHOX74.142e-1968.52Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
ANTHOX1A.NV6.201e-1950.00Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO458967.259e-1970.00Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
HOX61.380e-1660.71Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Homeodomain protein vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
hoxa4a1.728e-2143.31homeobox protein Hox-A3a [Source:NCBI gene;Acc:100... [more]
hoxd3a2.719e-2147.00homeobox D3 [Source:NCBI gene;Acc:101164107][more]
hoxb2a9.563e-2154.67homeobox B2 [Source:NCBI gene;Acc:101175483][more]
hoxa2b2.941e-2066.10homeobox protein Hox-A2b [Source:NCBI gene;Acc:101... [more]
ENSORLT00000006290.24.058e-2070.37pep primary_assembly:ASM223467v1:11:11321145:11323... [more]
back to top
BLAST of Homeodomain protein vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000029666.12.441e-135100.00SMESG000029666.1[more]
SMESG000022667.12.303e-1959.70SMESG000022667.1[more]
SMESG000071019.13.816e-1965.52SMESG000071019.1[more]
SMESG000044469.12.143e-1759.65SMESG000044469.1[more]
SMESG000079807.13.248e-1764.91SMESG000079807.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30015916 ID=SMED30015916|Name=Homeodomain protein|organism=Schmidtea mediterranea sexual|type=transcript|length=680bp
ATTGACAAATCGCGTTATTTCACATATATTTATAAAAAAATAAATTCCAA
TCAGATTTTACAAACGAAATGAGCTTCAATTCTGATCAAGTGGAAGCAGG
AGATGGAACGTTTTTGTGCTCGAATAATAACGGAATCCATGCATATCCCA
TTTACAGGTGGATGATAGACACAAGGACGCTCTCTTCTAGGACCGCAAAG
GCAAAGAAACAAGATAAAAAGAATAGCAATGAATCTGAAAATGCTTACAA
TTATAAGGATGACGCTTGTTGTACAGTTTCCTCCACGAGCAAACGATGCC
GGTCGGCGTACACAAATAATCAACTCGTGGAATTGGAAAAGGAATTCCAT
TACAATAATTATTTGGCACGGGGCCGACGGACTGAATTATCCAAACAATT
ACTCCTGACTGAACGACAAGTCAAAATTTGGTTTCAGAATCGGCGTATGA
AACAAAAGAAAGAGAAAAAGGAGATCGAAAAATCACGAATTCAATTTTCC
GTCTCCAATCGCGTTCCTGGTCATGAAAGTTATCAAAAGATATTTGGATC
TGGAATATTTCCATTAAGCTCCTTGGACGCAGATAACCCAGCAAATTGTT
CAGTTTATTCCCGCCCAGAGTTCTGCTATCAATTTTCTGGTGTCAACTGA
CCTTTTGTCTCATTTTCTGCTAATTTCGGC
back to top

protein sequence of SMED30015916-orf-1

>SMED30015916-orf-1 ID=SMED30015916-orf-1|Name=SMED30015916-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=194bp
MSFNSDQVEAGDGTFLCSNNNGIHAYPIYRWMIDTRTLSSRTAKAKKQDK
KNSNESENAYNYKDDACCTVSSTSKRCRSAYTNNQLVELEKEFHYNNYLA
RGRRTELSKQLLLTERQVKIWFQNRRMKQKKEKKEIEKSRIQFSVSNRVP
GHESYQKIFGSGIFPLSSLDADNPANCSVYSRPEFCYQFSGVN*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000103central nervous system
PLANA:0000418head
Vocabulary: INTERPRO
TermDefinition
IPR014760Serum_albumin_N
IPR020479Homeobox_metazoa
IPR001356Homeobox_dom
IPR009057Homeobox-like_sf
IPR017970Homeobox_CS
Vocabulary: cellular component
TermDefinition
GO:0005615extracellular space
GO:0005634nucleus
Vocabulary: molecular function
TermDefinition
GO:0003677DNA binding
GO:0043565sequence-specific DNA binding
Vocabulary: biological process
TermDefinition
GO:0006355regulation of transcription, DNA-templated
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR020479Homeobox domain, metazoaPRINTSPR00024HOMEOBOXcoord: 111..121
score: 68.78
coord: 121..130
score: 80.35
coord: 96..107
score: 45.0
IPR001356Homeobox domainSMARTSM00389HOX_1coord: 74..136
e-value: 1.6E-23
score: 94.2
IPR001356Homeobox domainPFAMPF00046Homeodomaincoord: 75..131
e-value: 2.8E-20
score: 71.9
IPR001356Homeobox domainPROSITEPS50071HOMEOBOX_2coord: 72..132
score: 21.103
IPR001356Homeobox domainCDDcd00086homeodomaincoord: 75..127
e-value: 2.95506E-18
score: 72.6612
NoneNo IPR availableGENE3DG3DSA:1.10.10.60coord: 23..136
e-value: 3.0E-26
score: 93.4
NoneNo IPR availablePANTHERPTHR45664FAMILY NOT NAMEDcoord: 17..140
IPR017970Homeobox, conserved sitePROSITEPS00027HOMEOBOX_1coord: 107..130
IPR009057Homeobox-like domain superfamilySUPERFAMILYSSF46689Homeodomain-likecoord: 64..134