Succinyl-CoA:3-ketoacid-coenzyme A transferase

Overview
NameSuccinyl-CoA:3-ketoacid-coenzyme A transferase
Smed IDSMED30015906
Length (bp)2266
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Succinyl-CoA:3-ketoacid-coenzyme A transferase (SMED30015906) t-SNE clustered cells

Violin plots show distribution of expression levels for Succinyl-CoA:3-ketoacid-coenzyme A transferase (SMED30015906) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Succinyl-CoA:3-ketoacid-coenzyme A transferase (SMED30015906) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Succinyl-CoA:3-ketoacid-coenzyme A transferase (SMED30015906) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Homology
BLAST of Succinyl-CoA:3-ketoacid-coenzyme A transferase vs. Ensembl Human
Match: OXCT1 (3-oxoacid CoA-transferase 1 [Source:HGNC Symbol;Acc:HGNC:8527])

HSP 1 Score: 179.104 bits (453), Expect = 1.355e-49
Identity = 81/125 (64.80%), Postives = 105/125 (84.00%), Query Frame = 2
Query: 1799 GHLDITVLGAMEVSKNGDLANWLIPGKMIKGMGGAMDLVSSFGTKVIITMEHSASDGTPKIVNQCTLPLTGSQCVNMIVTEKGVFEVDPEKGLTLTEVAEGVDIQDIVESTGCEFQLAEKILPMK 2173
            GH+D+T+LGAM+VSK GDLANW+IPGKM+KGMGGAMDLVSS  TKV++TMEHSA     KI+ +CTLPLTG QCVN I+TEK VF+VD +KGLTL E+ EG+ + D+ +STGC+F ++ K++PM+
Sbjct:  206 GHVDLTMLGAMQVSKYGDLANWMIPGKMVKGMGGAMDLVSSAKTKVVVTMEHSAKGNAHKIMEKCTLPLTGKQCVNRIITEKAVFDVDKKKGLTLIELWEGLTVDDVQKSTGCDFAVSPKLMPMQ 330          

HSP 2 Score: 65.855 bits (159), Expect = 8.300e-11
Identity = 30/38 (78.95%), Postives = 33/38 (86.84%), Query Frame = 2
Query:    2 PKESEIDADLINAGKETVTIRPGGSYFSSDNSFAMIRG 115
            P++ E DADLINAGKETVTI PG S+FSSD SFAMIRG
Sbjct:  168 PRQHEADADLINAGKETVTILPGASFFSSDESFAMIRG 205          
BLAST of Succinyl-CoA:3-ketoacid-coenzyme A transferase vs. Ensembl Human
Match: OXCT1 (3-oxoacid CoA-transferase 1 [Source:HGNC Symbol;Acc:HGNC:8527])

HSP 1 Score: 167.933 bits (424), Expect = 2.601e-48
Identity = 77/119 (64.71%), Postives = 99/119 (83.19%), Query Frame = 2
Query: 1817 VLGAMEVSKNGDLANWLIPGKMIKGMGGAMDLVSSFGTKVIITMEHSASDGTPKIVNQCTLPLTGSQCVNMIVTEKGVFEVDPEKGLTLTEVAEGVDIQDIVESTGCEFQLAEKILPMK 2173
            +LGAM+VSK GDLANW+IPGKM+KGMGGAMDLVSS  TKV++TMEHSA     KI+ +CTLPLTG QCVN I+TEK VF+VD +KGLTL E+ EG+ + D+ +STGC+F ++ K++PM+
Sbjct:    1 MLGAMQVSKYGDLANWMIPGKMVKGMGGAMDLVSSAKTKVVVTMEHSAKGNAHKIMEKCTLPLTGKQCVNRIITEKAVFDVDKKKGLTLIELWEGLTVDDVQKSTGCDFAVSPKLMPMQ 119          
BLAST of Succinyl-CoA:3-ketoacid-coenzyme A transferase vs. Ensembl Human
Match: OXCT1 (3-oxoacid CoA-transferase 1 [Source:HGNC Symbol;Acc:HGNC:8527])

HSP 1 Score: 167.933 bits (424), Expect = 2.601e-48
Identity = 77/119 (64.71%), Postives = 99/119 (83.19%), Query Frame = 2
Query: 1817 VLGAMEVSKNGDLANWLIPGKMIKGMGGAMDLVSSFGTKVIITMEHSASDGTPKIVNQCTLPLTGSQCVNMIVTEKGVFEVDPEKGLTLTEVAEGVDIQDIVESTGCEFQLAEKILPMK 2173
            +LGAM+VSK GDLANW+IPGKM+KGMGGAMDLVSS  TKV++TMEHSA     KI+ +CTLPLTG QCVN I+TEK VF+VD +KGLTL E+ EG+ + D+ +STGC+F ++ K++PM+
Sbjct:    1 MLGAMQVSKYGDLANWMIPGKMVKGMGGAMDLVSSAKTKVVVTMEHSAKGNAHKIMEKCTLPLTGKQCVNRIITEKAVFDVDKKKGLTLIELWEGLTVDDVQKSTGCDFAVSPKLMPMQ 119          
BLAST of Succinyl-CoA:3-ketoacid-coenzyme A transferase vs. Ensembl Human
Match: OXCT1 (3-oxoacid CoA-transferase 1 [Source:HGNC Symbol;Acc:HGNC:8527])

HSP 1 Score: 178.718 bits (452), Expect = 9.486e-48
Identity = 81/125 (64.80%), Postives = 105/125 (84.00%), Query Frame = 2
Query: 1799 GHLDITVLGAMEVSKNGDLANWLIPGKMIKGMGGAMDLVSSFGTKVIITMEHSASDGTPKIVNQCTLPLTGSQCVNMIVTEKGVFEVDPEKGLTLTEVAEGVDIQDIVESTGCEFQLAEKILPMK 2173
            GH+D+T+LGAM+VSK GDLANW+IPGKM+KGMGGAMDLVSS  TKV++TMEHSA     KI+ +CTLPLTG QCVN I+TEK VF+VD +KGLTL E+ EG+ + D+ +STGC+F ++ K++PM+
Sbjct:  392 GHVDLTMLGAMQVSKYGDLANWMIPGKMVKGMGGAMDLVSSAKTKVVVTMEHSAKGNAHKIMEKCTLPLTGKQCVNRIITEKAVFDVDKKKGLTLIELWEGLTVDDVQKSTGCDFAVSPKLMPMQ 516          

HSP 2 Score: 65.4698 bits (158), Expect = 2.139e-10
Identity = 30/38 (78.95%), Postives = 33/38 (86.84%), Query Frame = 2
Query:    2 PKESEIDADLINAGKETVTIRPGGSYFSSDNSFAMIRG 115
            P++ E DADLINAGKETVTI PG S+FSSD SFAMIRG
Sbjct:  354 PRQHEADADLINAGKETVTILPGASFFSSDESFAMIRG 391          
BLAST of Succinyl-CoA:3-ketoacid-coenzyme A transferase vs. Ensembl Human
Match: OXCT2 (3-oxoacid CoA-transferase 2 [Source:HGNC Symbol;Acc:HGNC:18606])

HSP 1 Score: 162.925 bits (411), Expect = 2.584e-42
Identity = 73/125 (58.40%), Postives = 99/125 (79.20%), Query Frame = 2
Query: 1799 GHLDITVLGAMEVSKNGDLANWLIPGKMIKGMGGAMDLVSSFGTKVIITMEHSASDGTPKIVNQCTLPLTGSQCVNMIVTEKGVFEVDPEKGLTLTEVAEGVDIQDIVESTGCEFQLAEKILPMK 2173
            GH+ +T+LGAM+VSK GDLANW+IPGK +KGMGGAMDLVSS  T+V++TM+H   D TPKI+ +CT+PLTG +CV+ I+TEK VF+V  +K LTL E+ EG+ + DI +STGC F ++  + PM+
Sbjct:  389 GHIQLTMLGAMQVSKYGDLANWMIPGKKVKGMGGAMDLVSSQKTRVVVTMQHCTKDNTPKIMEKCTMPLTGKRCVDRIITEKAVFDVHRKKELTLRELWEGLTVDDIKKSTGCAFAVSPNLRPMQ 513          

HSP 2 Score: 65.855 bits (159), Expect = 1.741e-10
Identity = 28/38 (73.68%), Postives = 34/38 (89.47%), Query Frame = 2
Query:    2 PKESEIDADLINAGKETVTIRPGGSYFSSDNSFAMIRG 115
            P E E+DADLINAGK+TVT+ PGG +F+SD+SFAMIRG
Sbjct:  351 PTEDEVDADLINAGKQTVTVLPGGCFFASDDSFAMIRG 388          
BLAST of Succinyl-CoA:3-ketoacid-coenzyme A transferase vs. Ensembl Celegans
Match: C05C10.3 (Probable succinyl-CoA:3-ketoacid coenzyme A transferase, mitochondrial [Source:UniProtKB/Swiss-Prot;Acc:Q09450])

HSP 1 Score: 147.517 bits (371), Expect = 2.042e-37
Identity = 68/126 (53.97%), Postives = 96/126 (76.19%), Query Frame = 2
Query: 1796 RG-HLDITVLGAMEVSKNGDLANWLIPGKMIKGMGGAMDLVSSFGTKVIITMEHSASDGTPKIVNQCTLPLTGSQCVNMIVTEKGVFEVDPEKGLTLTEVAEGVDIQDIVESTGCEFQLAEKILPM 2170
            RG H+DITVLGA++ S+ GDLANW+IPGK++KGMGGAMDLVS+ G +VI+ MEH + +G PKI+  C LPLTG   ++ I+T+  VF+VD + GLTL EV + + + DI + T C+F+++E + PM
Sbjct:  388 RGSHMDITVLGALQCSQFGDLANWMIPGKLVKGMGGAMDLVSAPGARVIVVMEHVSKNGEPKILEHCELPLTGKGVISRIITDMAVFDVDTKNGLTLIEVRKDLTVDDIKKLTACKFEISENLKPM 513          

HSP 2 Score: 49.2914 bits (116), Expect = 8.856e-6
Identity = 25/50 (50.00%), Postives = 32/50 (64.00%), Query Frame = 2
Query:    2 PKESEIDADLINAGKETVTIRPGGSYFSSDNSFAMIRGLDLPHFVIKCLK 151
            P++   DADLINAGKE +T+  G S   SD SFAMIRG  +   V+  L+
Sbjct:  352 PRKGTEDADLINAGKEPITLLKGASIVGSDESFAMIRGSHMDITVLGALQ 401          
BLAST of Succinyl-CoA:3-ketoacid-coenzyme A transferase vs. Ensembl Fly
Match: SCOT (gene:FBgn0035298 transcript:FBtr0333431)

HSP 1 Score: 166.392 bits (420), Expect = 2.747e-44
Identity = 78/128 (60.94%), Postives = 101/128 (78.91%), Query Frame = 2
Query: 1787 MCCRGHLDITVLGAMEVSKNGDLANWLIPGKMIKGMGGAMDLVSSFGTKVIITMEHSASDGTPKIVNQCTLPLTGSQCVNMIVTEKGVFEVDPEKGLTLTEVAEGVDIQDIVESTGCEFQLAEKILPM 2170
            M   GH+DIT+LGAMEVS  GDLANW+IPGK++KGMGGAMDLV++ GTKVIITMEH+A DG+PKI++ C+LPLTG   ++MI++EK VF V+   GLTL EVAEG  + DI+ STG +F ++  +  M
Sbjct:  318 MIRGGHVDITILGAMEVSATGDLANWMIPGKLVKGMGGAMDLVAAPGTKVIITMEHNARDGSPKILDTCSLPLTGKGVIDMIISEKAVFTVEKGVGLTLIEVAEGYTVDDIIASTGAKFTVSPNLKKM 445          

HSP 2 Score: 59.6918 bits (143), Expect = 5.627e-9
Identity = 26/38 (68.42%), Postives = 32/38 (84.21%), Query Frame = 2
Query:    2 PKESEIDADLINAGKETVTIRPGGSYFSSDNSFAMIRG 115
            P + ++D DLINAGKE+VT+ PG SYF SD+SFAMIRG
Sbjct:  284 PTKDKVDPDLINAGKESVTVVPGASYFGSDDSFAMIRG 321          
BLAST of Succinyl-CoA:3-ketoacid-coenzyme A transferase vs. Ensembl Fly
Match: SCOT (gene:FBgn0035298 transcript:FBtr0072843)

HSP 1 Score: 166.007 bits (419), Expect = 1.050e-43
Identity = 78/128 (60.94%), Postives = 101/128 (78.91%), Query Frame = 2
Query: 1787 MCCRGHLDITVLGAMEVSKNGDLANWLIPGKMIKGMGGAMDLVSSFGTKVIITMEHSASDGTPKIVNQCTLPLTGSQCVNMIVTEKGVFEVDPEKGLTLTEVAEGVDIQDIVESTGCEFQLAEKILPM 2170
            M   GH+DIT+LGAMEVS  GDLANW+IPGK++KGMGGAMDLV++ GTKVIITMEH+A DG+PKI++ C+LPLTG   ++MI++EK VF V+   GLTL EVAEG  + DI+ STG +F ++  +  M
Sbjct:  370 MIRGGHVDITILGAMEVSATGDLANWMIPGKLVKGMGGAMDLVAAPGTKVIITMEHNARDGSPKILDTCSLPLTGKGVIDMIISEKAVFTVEKGVGLTLIEVAEGYTVDDIIASTGAKFTVSPNLKKM 497          

HSP 2 Score: 59.6918 bits (143), Expect = 6.771e-9
Identity = 26/38 (68.42%), Postives = 32/38 (84.21%), Query Frame = 2
Query:    2 PKESEIDADLINAGKETVTIRPGGSYFSSDNSFAMIRG 115
            P + ++D DLINAGKE+VT+ PG SYF SD+SFAMIRG
Sbjct:  336 PTKDKVDPDLINAGKESVTVVPGASYFGSDDSFAMIRG 373          
BLAST of Succinyl-CoA:3-ketoacid-coenzyme A transferase vs. Ensembl Fly
Match: SCOT (gene:FBgn0035298 transcript:FBtr0072844)

HSP 1 Score: 166.007 bits (419), Expect = 1.207e-43
Identity = 78/128 (60.94%), Postives = 101/128 (78.91%), Query Frame = 2
Query: 1787 MCCRGHLDITVLGAMEVSKNGDLANWLIPGKMIKGMGGAMDLVSSFGTKVIITMEHSASDGTPKIVNQCTLPLTGSQCVNMIVTEKGVFEVDPEKGLTLTEVAEGVDIQDIVESTGCEFQLAEKILPM 2170
            M   GH+DIT+LGAMEVS  GDLANW+IPGK++KGMGGAMDLV++ GTKVIITMEH+A DG+PKI++ C+LPLTG   ++MI++EK VF V+   GLTL EVAEG  + DI+ STG +F ++  +  M
Sbjct:  384 MIRGGHVDITILGAMEVSATGDLANWMIPGKLVKGMGGAMDLVAAPGTKVIITMEHNARDGSPKILDTCSLPLTGKGVIDMIISEKAVFTVEKGVGLTLIEVAEGYTVDDIIASTGAKFTVSPNLKKM 511          

HSP 2 Score: 59.6918 bits (143), Expect = 6.639e-9
Identity = 26/38 (68.42%), Postives = 32/38 (84.21%), Query Frame = 2
Query:    2 PKESEIDADLINAGKETVTIRPGGSYFSSDNSFAMIRG 115
            P + ++D DLINAGKE+VT+ PG SYF SD+SFAMIRG
Sbjct:  350 PTKDKVDPDLINAGKESVTVVPGASYFGSDDSFAMIRG 387          
BLAST of Succinyl-CoA:3-ketoacid-coenzyme A transferase vs. Ensembl Zebrafish
Match: oxct1b (3-oxoacid CoA transferase 1b [Source:ZFIN;Acc:ZDB-GENE-060929-212])

HSP 1 Score: 172.17 bits (435), Expect = 1.283e-45
Identity = 79/125 (63.20%), Postives = 102/125 (81.60%), Query Frame = 2
Query: 1799 GHLDITVLGAMEVSKNGDLANWLIPGKMIKGMGGAMDLVSSFGTKVIITMEHSASDGTPKIVNQCTLPLTGSQCVNMIVTEKGVFEVDPEKGLTLTEVAEGVDIQDIVESTGCEFQLAEKILPMK 2173
            GH+D+T+LGAM+VSK GDLANW+IPGKM+KGMGGAMDLVSS  TKV++TMEH+A  G  KI+++CTLPLTG QCV+ I+TEK VF+VD  KGLTL E+ EG+   DI   TG EF++++ + PM+
Sbjct:  400 GHIDLTMLGAMQVSKYGDLANWMIPGKMVKGMGGAMDLVSSDATKVVVTMEHTAKGGKHKILDKCTLPLTGKQCVDRIITEKAVFDVDKSKGLTLIEILEGLTPDDIRACTGTEFEVSQNLRPMQ 524          

HSP 2 Score: 66.6254 bits (161), Expect = 6.640e-11
Identity = 30/38 (78.95%), Postives = 33/38 (86.84%), Query Frame = 2
Query:    2 PKESEIDADLINAGKETVTIRPGGSYFSSDNSFAMIRG 115
            P ESE+D DLINAGKETVT+ PG +YFSSD SFAMIRG
Sbjct:  362 PTESEVDPDLINAGKETVTVYPGAAYFSSDESFAMIRG 399          
BLAST of Succinyl-CoA:3-ketoacid-coenzyme A transferase vs. Ensembl Zebrafish
Match: oxct1a (3-oxoacid CoA transferase 1a [Source:ZFIN;Acc:ZDB-GENE-040723-3])

HSP 1 Score: 167.933 bits (424), Expect = 4.064e-44
Identity = 78/125 (62.40%), Postives = 101/125 (80.80%), Query Frame = 2
Query: 1799 GHLDITVLGAMEVSKNGDLANWLIPGKMIKGMGGAMDLVSSFGTKVIITMEHSASDGTPKIVNQCTLPLTGSQCVNMIVTEKGVFEVDPEKGLTLTEVAEGVDIQDIVESTGCEFQLAEKILPMK 2173
            GH+++T+LGAM+VSK GDLANW+IPGKM+KGMGGAMDLV+S GTKV++TMEHSA  G  KI+ +C LPLTG QCV+ I+TEK VF+VD +KGLTL EV EG+   DI + TG  F+++  + PM+
Sbjct:  399 GHINLTMLGAMQVSKYGDLANWMIPGKMVKGMGGAMDLVASAGTKVVVTMEHSAKGGKHKIMEKCNLPLTGKQCVDRIITEKAVFDVDKDKGLTLIEVWEGLTPDDIKKCTGTPFEVSPNLKPMQ 523          

HSP 2 Score: 65.0846 bits (157), Expect = 1.961e-10
Identity = 30/38 (78.95%), Postives = 32/38 (84.21%), Query Frame = 2
Query:    2 PKESEIDADLINAGKETVTIRPGGSYFSSDNSFAMIRG 115
            P E  +DADLINAGKETVTI PG +YFSSD SFAMIRG
Sbjct:  361 PTEDAVDADLINAGKETVTILPGAAYFSSDESFAMIRG 398          
BLAST of Succinyl-CoA:3-ketoacid-coenzyme A transferase vs. Ensembl Zebrafish
Match: oxct1a (3-oxoacid CoA transferase 1a [Source:ZFIN;Acc:ZDB-GENE-040723-3])

HSP 1 Score: 167.548 bits (423), Expect = 9.015e-44
Identity = 78/125 (62.40%), Postives = 101/125 (80.80%), Query Frame = 2
Query: 1799 GHLDITVLGAMEVSKNGDLANWLIPGKMIKGMGGAMDLVSSFGTKVIITMEHSASDGTPKIVNQCTLPLTGSQCVNMIVTEKGVFEVDPEKGLTLTEVAEGVDIQDIVESTGCEFQLAEKILPMK 2173
            GH+++T+LGAM+VSK GDLANW+IPGKM+KGMGGAMDLV+S GTKV++TMEHSA  G  KI+ +C LPLTG QCV+ I+TEK VF+VD +KGLTL EV EG+   DI + TG  F+++  + PM+
Sbjct:  437 GHINLTMLGAMQVSKYGDLANWMIPGKMVKGMGGAMDLVASAGTKVVVTMEHSAKGGKHKIMEKCNLPLTGKQCVDRIITEKAVFDVDKDKGLTLIEVWEGLTPDDIKKCTGTPFEVSPNLKPMQ 561          

HSP 2 Score: 65.4698 bits (158), Expect = 1.698e-10
Identity = 30/38 (78.95%), Postives = 32/38 (84.21%), Query Frame = 2
Query:    2 PKESEIDADLINAGKETVTIRPGGSYFSSDNSFAMIRG 115
            P E  +DADLINAGKETVTI PG +YFSSD SFAMIRG
Sbjct:  399 PTEDAVDADLINAGKETVTILPGAAYFSSDESFAMIRG 436          
BLAST of Succinyl-CoA:3-ketoacid-coenzyme A transferase vs. Ensembl Zebrafish
Match: oxct1a (3-oxoacid CoA transferase 1a [Source:ZFIN;Acc:ZDB-GENE-040723-3])

HSP 1 Score: 123.25 bits (308), Expect = 9.612e-33
Identity = 60/100 (60.00%), Postives = 77/100 (77.00%), Query Frame = 2
Query: 1874 GKMIKGMGGAMDLVSSFGTKVIITMEHSASDGTPKIVNQCTLPLTGSQCVNMIVTEKGVFEVDPEKGLTLTEVAEGVDIQDIVESTGCEFQLAEKILPMK 2173
            GKM+KGMGGAMDLV+S GTKV++TMEHSA  G  KI+ +C LPLTG QCV+ I+TEK VF+VD +KGLTL EV EG+   DI + TG  F+++  + PM+
Sbjct:   12 GKMVKGMGGAMDLVASAGTKVVVTMEHSAKGGKHKIMEKCNLPLTGKQCVDRIITEKAVFDVDKDKGLTLIEVWEGLTPDDIKKCTGTPFEVSPNLKPMQ 111          
BLAST of Succinyl-CoA:3-ketoacid-coenzyme A transferase vs. Ensembl Zebrafish
Match: oxct1a (3-oxoacid CoA transferase 1a [Source:ZFIN;Acc:ZDB-GENE-040723-3])

HSP 1 Score: 107.071 bits (266), Expect = 1.764e-27
Identity = 49/68 (72.06%), Postives = 58/68 (85.29%), Query Frame = 2
Query: 1841 KNGDLANWLIPGKMIKGMGGAMDLVSSFGTKVIITMEHSASDGTPKIVNQCTLPLTGSQCVNMIVTEK 2044
            K GDLANW+IPGKM+KGMGGAMDLV+S GTKV++TMEHSA  G  KI+ +C LPLTG QCV+ I+TEK
Sbjct:    1 KYGDLANWMIPGKMVKGMGGAMDLVASAGTKVVVTMEHSAKGGKHKIMEKCNLPLTGKQCVDRIITEK 68          
BLAST of Succinyl-CoA:3-ketoacid-coenzyme A transferase vs. Ensembl Xenopus
Match: mettl18 (methyltransferase like 18 [Source:Xenbase;Acc:XB-GENE-5811219])

HSP 1 Score: 173.326 bits (438), Expect = 5.085e-46
Identity = 79/119 (66.39%), Postives = 99/119 (83.19%), Query Frame = 2
Query: 1799 GHLDITVLGAMEVSKNGDLANWLIPGKMIKGMGGAMDLVSSFGTKVIITMEHSASDGTPKIVNQCTLPLTGSQCVNMIVTEKGVFEVDPEKGLTLTEVAEGVDIQDIVESTGCEFQLAE 2155
            GH+D+T+LGAM+VSK GDLANW+IPGKM+KGMGGAMDLVSS GTKV++TMEHSA  G+ KI+ QC LPLTG QCV+ I+TEK VF+VD + GLTL E+AEG+ + DI + TGC F ++ 
Sbjct:  367 GHVDLTMLGAMQVSKYGDLANWMIPGKMVKGMGGAMDLVSSSGTKVVVTMEHSAKGGSHKILEQCNLPLTGKQCVDRIITEKAVFDVDRKNGLTLIEIAEGLSVDDIKKCTGCNFAVSR 485          

HSP 2 Score: 63.929 bits (154), Expect = 5.862e-10
Identity = 28/38 (73.68%), Postives = 33/38 (86.84%), Query Frame = 2
Query:    2 PKESEIDADLINAGKETVTIRPGGSYFSSDNSFAMIRG 115
            P + E+D DLINAGKETVT+ PG +YFSSD+SFAMIRG
Sbjct:  329 PLQEEVDPDLINAGKETVTVLPGAAYFSSDDSFAMIRG 366          
BLAST of Succinyl-CoA:3-ketoacid-coenzyme A transferase vs. Ensembl Xenopus
Match: mettl18 (methyltransferase like 18 [Source:Xenbase;Acc:XB-GENE-5811219])

HSP 1 Score: 173.326 bits (438), Expect = 5.377e-46
Identity = 79/119 (66.39%), Postives = 99/119 (83.19%), Query Frame = 2
Query: 1799 GHLDITVLGAMEVSKNGDLANWLIPGKMIKGMGGAMDLVSSFGTKVIITMEHSASDGTPKIVNQCTLPLTGSQCVNMIVTEKGVFEVDPEKGLTLTEVAEGVDIQDIVESTGCEFQLAE 2155
            GH+D+T+LGAM+VSK GDLANW+IPGKM+KGMGGAMDLVSS GTKV++TMEHSA  G+ KI+ QC LPLTG QCV+ I+TEK VF+VD + GLTL E+AEG+ + DI + TGC F ++ 
Sbjct:  381 GHVDLTMLGAMQVSKYGDLANWMIPGKMVKGMGGAMDLVSSSGTKVVVTMEHSAKGGSHKILEQCNLPLTGKQCVDRIITEKAVFDVDRKNGLTLIEIAEGLSVDDIKKCTGCNFAVSR 499          

HSP 2 Score: 63.929 bits (154), Expect = 5.872e-10
Identity = 28/38 (73.68%), Postives = 33/38 (86.84%), Query Frame = 2
Query:    2 PKESEIDADLINAGKETVTIRPGGSYFSSDNSFAMIRG 115
            P + E+D DLINAGKETVT+ PG +YFSSD+SFAMIRG
Sbjct:  343 PLQEEVDPDLINAGKETVTVLPGAAYFSSDDSFAMIRG 380          
BLAST of Succinyl-CoA:3-ketoacid-coenzyme A transferase vs. Ensembl Xenopus
Match: mettl18 (methyltransferase like 18 [Source:Xenbase;Acc:XB-GENE-5811219])

HSP 1 Score: 173.326 bits (438), Expect = 6.146e-46
Identity = 79/119 (66.39%), Postives = 99/119 (83.19%), Query Frame = 2
Query: 1799 GHLDITVLGAMEVSKNGDLANWLIPGKMIKGMGGAMDLVSSFGTKVIITMEHSASDGTPKIVNQCTLPLTGSQCVNMIVTEKGVFEVDPEKGLTLTEVAEGVDIQDIVESTGCEFQLAE 2155
            GH+D+T+LGAM+VSK GDLANW+IPGKM+KGMGGAMDLVSS GTKV++TMEHSA  G+ KI+ QC LPLTG QCV+ I+TEK VF+VD + GLTL E+AEG+ + DI + TGC F ++ 
Sbjct:  387 GHVDLTMLGAMQVSKYGDLANWMIPGKMVKGMGGAMDLVSSSGTKVVVTMEHSAKGGSHKILEQCNLPLTGKQCVDRIITEKAVFDVDRKNGLTLIEIAEGLSVDDIKKCTGCNFAVSR 505          

HSP 2 Score: 63.929 bits (154), Expect = 5.938e-10
Identity = 28/38 (73.68%), Postives = 33/38 (86.84%), Query Frame = 2
Query:    2 PKESEIDADLINAGKETVTIRPGGSYFSSDNSFAMIRG 115
            P + E+D DLINAGKETVT+ PG +YFSSD+SFAMIRG
Sbjct:  349 PLQEEVDPDLINAGKETVTVLPGAAYFSSDDSFAMIRG 386          
BLAST of Succinyl-CoA:3-ketoacid-coenzyme A transferase vs. Ensembl Xenopus
Match: mettl18 (methyltransferase like 18 [Source:Xenbase;Acc:XB-GENE-5811219])

HSP 1 Score: 172.94 bits (437), Expect = 6.151e-46
Identity = 79/119 (66.39%), Postives = 99/119 (83.19%), Query Frame = 2
Query: 1799 GHLDITVLGAMEVSKNGDLANWLIPGKMIKGMGGAMDLVSSFGTKVIITMEHSASDGTPKIVNQCTLPLTGSQCVNMIVTEKGVFEVDPEKGLTLTEVAEGVDIQDIVESTGCEFQLAE 2155
            GH+D+T+LGAM+VSK GDLANW+IPGKM+KGMGGAMDLVSS GTKV++TMEHSA  G+ KI+ QC LPLTG QCV+ I+TEK VF+VD + GLTL E+AEG+ + DI + TGC F ++ 
Sbjct:  370 GHVDLTMLGAMQVSKYGDLANWMIPGKMVKGMGGAMDLVSSSGTKVVVTMEHSAKGGSHKILEQCNLPLTGKQCVDRIITEKAVFDVDRKNGLTLIEIAEGLSVDDIKKCTGCNFAVSR 488          

HSP 2 Score: 63.929 bits (154), Expect = 6.054e-10
Identity = 28/38 (73.68%), Postives = 33/38 (86.84%), Query Frame = 2
Query:    2 PKESEIDADLINAGKETVTIRPGGSYFSSDNSFAMIRG 115
            P + E+D DLINAGKETVT+ PG +YFSSD+SFAMIRG
Sbjct:  332 PLQEEVDPDLINAGKETVTVLPGAAYFSSDDSFAMIRG 369          
BLAST of Succinyl-CoA:3-ketoacid-coenzyme A transferase vs. Ensembl Xenopus
Match: mettl18 (methyltransferase like 18 [Source:Xenbase;Acc:XB-GENE-5811219])

HSP 1 Score: 172.94 bits (437), Expect = 6.555e-46
Identity = 79/119 (66.39%), Postives = 99/119 (83.19%), Query Frame = 2
Query: 1799 GHLDITVLGAMEVSKNGDLANWLIPGKMIKGMGGAMDLVSSFGTKVIITMEHSASDGTPKIVNQCTLPLTGSQCVNMIVTEKGVFEVDPEKGLTLTEVAEGVDIQDIVESTGCEFQLAE 2155
            GH+D+T+LGAM+VSK GDLANW+IPGKM+KGMGGAMDLVSS GTKV++TMEHSA  G+ KI+ QC LPLTG QCV+ I+TEK VF+VD + GLTL E+AEG+ + DI + TGC F ++ 
Sbjct:  373 GHVDLTMLGAMQVSKYGDLANWMIPGKMVKGMGGAMDLVSSSGTKVVVTMEHSAKGGSHKILEQCNLPLTGKQCVDRIITEKAVFDVDRKNGLTLIEIAEGLSVDDIKKCTGCNFAVSR 491          

HSP 2 Score: 63.929 bits (154), Expect = 5.632e-10
Identity = 28/38 (73.68%), Postives = 33/38 (86.84%), Query Frame = 2
Query:    2 PKESEIDADLINAGKETVTIRPGGSYFSSDNSFAMIRG 115
            P + E+D DLINAGKETVT+ PG +YFSSD+SFAMIRG
Sbjct:  335 PLQEEVDPDLINAGKETVTVLPGAAYFSSDDSFAMIRG 372          
BLAST of Succinyl-CoA:3-ketoacid-coenzyme A transferase vs. Ensembl Mouse
Match: Oxct1 (3-oxoacid CoA transferase 1 [Source:MGI Symbol;Acc:MGI:1914291])

HSP 1 Score: 176.407 bits (446), Expect = 4.988e-47
Identity = 80/125 (64.00%), Postives = 104/125 (83.20%), Query Frame = 2
Query: 1799 GHLDITVLGAMEVSKNGDLANWLIPGKMIKGMGGAMDLVSSFGTKVIITMEHSASDGTPKIVNQCTLPLTGSQCVNMIVTEKGVFEVDPEKGLTLTEVAEGVDIQDIVESTGCEFQLAEKILPMK 2173
            GH+++T+LGAM+VSK GDLANW+IPGKM+KGMGGAMDLVSS  TKV++TMEHSA     KI+ +CTLPLTG QCVN I+TEKGVF+VD + GLTL E+ EG+ + DI +STGC+F ++  ++PM+
Sbjct:  392 GHVNLTMLGAMQVSKYGDLANWMIPGKMVKGMGGAMDLVSSSKTKVVVTMEHSAKGNAHKIMEKCTLPLTGKQCVNRIITEKGVFDVDKKNGLTLIELWEGLTVDDIKKSTGCDFAVSPNLMPMQ 516          

HSP 2 Score: 62.7734 bits (151), Expect = 1.177e-9
Identity = 29/38 (76.32%), Postives = 32/38 (84.21%), Query Frame = 2
Query:    2 PKESEIDADLINAGKETVTIRPGGSYFSSDNSFAMIRG 115
            P + E DADLINAGKETVT+ PG S+FSSD SFAMIRG
Sbjct:  354 PLKDEADADLINAGKETVTVLPGASFFSSDESFAMIRG 391          
BLAST of Succinyl-CoA:3-ketoacid-coenzyme A transferase vs. Ensembl Mouse
Match: Oxct2b (3-oxoacid CoA transferase 2B [Source:MGI Symbol;Acc:MGI:2664115])

HSP 1 Score: 159.458 bits (402), Expect = 3.872e-41
Identity = 71/125 (56.80%), Postives = 96/125 (76.80%), Query Frame = 2
Query: 1799 GHLDITVLGAMEVSKNGDLANWLIPGKMIKGMGGAMDLVSSFGTKVIITMEHSASDGTPKIVNQCTLPLTGSQCVNMIVTEKGVFEVDPEKGLTLTEVAEGVDIQDIVESTGCEFQLAEKILPMK 2173
            GHL +T+LGAM+VS+ GDLANW++PGK +KGMGGAMDLVSS  T+V++TMEH      PKI+ +CT+PLTG +CV++I+TEK VFEV+  KGLTL E+ EG  + DI  +T C F ++  + PM+
Sbjct:  390 GHLQLTMLGAMQVSQYGDLANWMVPGKKVKGMGGAMDLVSSKKTRVVVTMEHCTKTKQPKILKKCTMPLTGKRCVDLIITEKAVFEVNHSKGLTLVELWEGSSVDDIKATTACSFAVSPNLKPMQ 514          

HSP 2 Score: 62.3882 bits (150), Expect = 1.488e-9
Identity = 26/38 (68.42%), Postives = 35/38 (92.11%), Query Frame = 2
Query:    2 PKESEIDADLINAGKETVTIRPGGSYFSSDNSFAMIRG 115
            P ++E+DAD+INAGK+TVT+ PGG +F+SD+SFAMIRG
Sbjct:  352 PLKNEVDADVINAGKQTVTVVPGGCFFASDDSFAMIRG 389          
BLAST of Succinyl-CoA:3-ketoacid-coenzyme A transferase vs. Ensembl Mouse
Match: Oxct2a (3-oxoacid CoA transferase 2A [Source:MGI Symbol;Acc:MGI:1891061])

HSP 1 Score: 159.073 bits (401), Expect = 4.178e-41
Identity = 71/125 (56.80%), Postives = 96/125 (76.80%), Query Frame = 2
Query: 1799 GHLDITVLGAMEVSKNGDLANWLIPGKMIKGMGGAMDLVSSFGTKVIITMEHSASDGTPKIVNQCTLPLTGSQCVNMIVTEKGVFEVDPEKGLTLTEVAEGVDIQDIVESTGCEFQLAEKILPMK 2173
            GHL +T+LGAM+VS+ GDLANW++PGK +KGMGGAMDLVSS  T+V++TMEH      PKI+ +CT+PLTG +CV++I+TEK VFEV+  KGLTL E+ EG  + DI  +T C F ++  + PM+
Sbjct:  390 GHLQLTMLGAMQVSQYGDLANWMVPGKKVKGMGGAMDLVSSKKTRVVVTMEHCTKTKQPKILKKCTMPLTGKRCVDLIITEKAVFEVNHSKGLTLVELWEGSSVDDIKATTACSFAVSPNLKPMQ 514          

HSP 2 Score: 62.3882 bits (150), Expect = 1.527e-9
Identity = 26/38 (68.42%), Postives = 35/38 (92.11%), Query Frame = 2
Query:    2 PKESEIDADLINAGKETVTIRPGGSYFSSDNSFAMIRG 115
            P ++E+DAD+INAGK+TVT+ PGG +F+SD+SFAMIRG
Sbjct:  352 PLKNEVDADVINAGKQTVTVVPGGCFFASDDSFAMIRG 389          
BLAST of Succinyl-CoA:3-ketoacid-coenzyme A transferase vs. Ensembl Mouse
Match: Oxct1 (3-oxoacid CoA transferase 1 [Source:MGI Symbol;Acc:MGI:1914291])

HSP 1 Score: 130.568 bits (327), Expect = 1.168e-31
Identity = 59/82 (71.95%), Postives = 71/82 (86.59%), Query Frame = 2
Query: 1799 GHLDITVLGAMEVSKNGDLANWLIPGKMIKGMGGAMDLVSSFGTKVIITMEHSASDGTPKIVNQCTLPLTGSQCVNMIVTEK 2044
            GH+++T+LGAM+VSK GDLANW+IPGKM+KGMGGAMDLVSS  TKV++TMEHSA     KI+ +CTLPLTG QCVN I+TEK
Sbjct:  392 GHVNLTMLGAMQVSKYGDLANWMIPGKMVKGMGGAMDLVSSSKTKVVVTMEHSAKGNAHKIMEKCTLPLTGKQCVNRIITEK 473          

HSP 2 Score: 62.7734 bits (151), Expect = 1.083e-9
Identity = 29/38 (76.32%), Postives = 32/38 (84.21%), Query Frame = 2
Query:    2 PKESEIDADLINAGKETVTIRPGGSYFSSDNSFAMIRG 115
            P + E DADLINAGKETVT+ PG S+FSSD SFAMIRG
Sbjct:  354 PLKDEADADLINAGKETVTVLPGASFFSSDESFAMIRG 391          
BLAST of Succinyl-CoA:3-ketoacid-coenzyme A transferase vs. UniProt/SwissProt
Match: sp|P55809|SCOT1_HUMAN (Succinyl-CoA:3-ketoacid coenzyme A transferase 1, mitochondrial OS=Homo sapiens OX=9606 GN=OXCT1 PE=1 SV=1)

HSP 1 Score: 178.718 bits (452), Expect = 4.556e-47
Identity = 81/125 (64.80%), Postives = 105/125 (84.00%), Query Frame = 2
Query: 1799 GHLDITVLGAMEVSKNGDLANWLIPGKMIKGMGGAMDLVSSFGTKVIITMEHSASDGTPKIVNQCTLPLTGSQCVNMIVTEKGVFEVDPEKGLTLTEVAEGVDIQDIVESTGCEFQLAEKILPMK 2173
            GH+D+T+LGAM+VSK GDLANW+IPGKM+KGMGGAMDLVSS  TKV++TMEHSA     KI+ +CTLPLTG QCVN I+TEK VF+VD +KGLTL E+ EG+ + D+ +STGC+F ++ K++PM+
Sbjct:  392 GHVDLTMLGAMQVSKYGDLANWMIPGKMVKGMGGAMDLVSSAKTKVVVTMEHSAKGNAHKIMEKCTLPLTGKQCVNRIITEKAVFDVDKKKGLTLIELWEGLTVDDVQKSTGCDFAVSPKLMPMQ 516          

HSP 2 Score: 65.4698 bits (158), Expect = 1.027e-9
Identity = 30/38 (78.95%), Postives = 33/38 (86.84%), Query Frame = 2
Query:    2 PKESEIDADLINAGKETVTIRPGGSYFSSDNSFAMIRG 115
            P++ E DADLINAGKETVTI PG S+FSSD SFAMIRG
Sbjct:  354 PRQHEADADLINAGKETVTILPGASFFSSDESFAMIRG 391          
BLAST of Succinyl-CoA:3-ketoacid-coenzyme A transferase vs. UniProt/SwissProt
Match: sp|Q29551|SCOT1_PIG (Succinyl-CoA:3-ketoacid coenzyme A transferase 1, mitochondrial OS=Sus scrofa OX=9823 GN=OXCT1 PE=1 SV=2)

HSP 1 Score: 176.792 bits (447), Expect = 2.208e-46
Identity = 80/125 (64.00%), Postives = 105/125 (84.00%), Query Frame = 2
Query: 1799 GHLDITVLGAMEVSKNGDLANWLIPGKMIKGMGGAMDLVSSFGTKVIITMEHSASDGTPKIVNQCTLPLTGSQCVNMIVTEKGVFEVDPEKGLTLTEVAEGVDIQDIVESTGCEFQLAEKILPMK 2173
            GH+++T+LGAM+VSK GDLANW+IPGK++KGMGGAMDLVSS  TKV++TMEHSA     KI+ +CTLPLTG QCVN I+TEK VF+VD +KGLTL E+ EG+ + DI +STGC+F ++ K++PM+
Sbjct:  392 GHVNLTMLGAMQVSKYGDLANWMIPGKLVKGMGGAMDLVSSAKTKVVVTMEHSAKGNAHKIMEKCTLPLTGKQCVNRIITEKAVFDVDSKKGLTLIELWEGLTVDDIKKSTGCDFAVSPKLIPMQ 516          

HSP 2 Score: 67.0106 bits (162), Expect = 3.237e-10
Identity = 30/38 (78.95%), Postives = 34/38 (89.47%), Query Frame = 2
Query:    2 PKESEIDADLINAGKETVTIRPGGSYFSSDNSFAMIRG 115
            P ++E+DADLINAGKETVT+ PG SYFSSD SFAMIRG
Sbjct:  354 PLQNEVDADLINAGKETVTVLPGASYFSSDESFAMIRG 391          
BLAST of Succinyl-CoA:3-ketoacid-coenzyme A transferase vs. UniProt/SwissProt
Match: sp|Q9D0K2|SCOT1_MOUSE (Succinyl-CoA:3-ketoacid coenzyme A transferase 1, mitochondrial OS=Mus musculus OX=10090 GN=Oxct1 PE=1 SV=1)

HSP 1 Score: 176.407 bits (446), Expect = 3.489e-46
Identity = 80/125 (64.00%), Postives = 104/125 (83.20%), Query Frame = 2
Query: 1799 GHLDITVLGAMEVSKNGDLANWLIPGKMIKGMGGAMDLVSSFGTKVIITMEHSASDGTPKIVNQCTLPLTGSQCVNMIVTEKGVFEVDPEKGLTLTEVAEGVDIQDIVESTGCEFQLAEKILPMK 2173
            GH+++T+LGAM+VSK GDLANW+IPGKM+KGMGGAMDLVSS  TKV++TMEHSA     KI+ +CTLPLTG QCVN I+TEKGVF+VD + GLTL E+ EG+ + DI +STGC+F ++  ++PM+
Sbjct:  392 GHVNLTMLGAMQVSKYGDLANWMIPGKMVKGMGGAMDLVSSSKTKVVVTMEHSAKGNAHKIMEKCTLPLTGKQCVNRIITEKGVFDVDKKNGLTLIELWEGLTVDDIKKSTGCDFAVSPNLMPMQ 516          

HSP 2 Score: 62.7734 bits (151), Expect = 8.235e-9
Identity = 29/38 (76.32%), Postives = 32/38 (84.21%), Query Frame = 2
Query:    2 PKESEIDADLINAGKETVTIRPGGSYFSSDNSFAMIRG 115
            P + E DADLINAGKETVT+ PG S+FSSD SFAMIRG
Sbjct:  354 PLKDEADADLINAGKETVTVLPGASFFSSDESFAMIRG 391          
BLAST of Succinyl-CoA:3-ketoacid-coenzyme A transferase vs. UniProt/SwissProt
Match: sp|B2GV06|SCOT1_RAT (Succinyl-CoA:3-ketoacid coenzyme A transferase 1, mitochondrial OS=Rattus norvegicus OX=10116 GN=Oxct1 PE=1 SV=1)

HSP 1 Score: 176.022 bits (445), Expect = 3.808e-46
Identity = 80/125 (64.00%), Postives = 104/125 (83.20%), Query Frame = 2
Query: 1799 GHLDITVLGAMEVSKNGDLANWLIPGKMIKGMGGAMDLVSSFGTKVIITMEHSASDGTPKIVNQCTLPLTGSQCVNMIVTEKGVFEVDPEKGLTLTEVAEGVDIQDIVESTGCEFQLAEKILPMK 2173
            GH+++T+LGAM+VSK GDLANW+IPGKM+KGMGGAMDLVSS  TKV++TMEHSA     KI+ +CTLPLTG QCVN I+TEKGVF+VD + GLTL E+ EG+ + DI +STGC+F ++  ++PM+
Sbjct:  392 GHVNLTMLGAMQVSKYGDLANWMIPGKMVKGMGGAMDLVSSSKTKVVVTMEHSAKGNAHKIMEKCTLPLTGKQCVNRIITEKGVFDVDKKNGLTLIELWEGLTVDDIRKSTGCDFAVSPNLMPMQ 516          

HSP 2 Score: 62.3882 bits (150), Expect = 8.600e-9
Identity = 29/38 (76.32%), Postives = 32/38 (84.21%), Query Frame = 2
Query:    2 PKESEIDADLINAGKETVTIRPGGSYFSSDNSFAMIRG 115
            P + E DADLINAGKETVT+ PG S+FSSD SFAMIRG
Sbjct:  354 PLKDEADADLINAGKETVTVLPGASFFSSDESFAMIRG 391          
BLAST of Succinyl-CoA:3-ketoacid-coenzyme A transferase vs. UniProt/SwissProt
Match: sp|Q9W058|SCOT_DROME (Succinyl-CoA:3-ketoacid-coenzyme A transferase, mitochondrial OS=Drosophila melanogaster OX=7227 GN=SCOT PE=1 SV=1)

HSP 1 Score: 166.007 bits (419), Expect = 1.209e-42
Identity = 78/128 (60.94%), Postives = 101/128 (78.91%), Query Frame = 2
Query: 1787 MCCRGHLDITVLGAMEVSKNGDLANWLIPGKMIKGMGGAMDLVSSFGTKVIITMEHSASDGTPKIVNQCTLPLTGSQCVNMIVTEKGVFEVDPEKGLTLTEVAEGVDIQDIVESTGCEFQLAEKILPM 2170
            M   GH+DIT+LGAMEVS  GDLANW+IPGK++KGMGGAMDLV++ GTKVIITMEH+A DG+PKI++ C+LPLTG   ++MI++EK VF V+   GLTL EVAEG  + DI+ STG +F ++  +  M
Sbjct:  384 MIRGGHVDITILGAMEVSATGDLANWMIPGKLVKGMGGAMDLVAAPGTKVIITMEHNARDGSPKILDTCSLPLTGKGVIDMIISEKAVFTVEKGVGLTLIEVAEGYTVDDIIASTGAKFTVSPNLKKM 511          

HSP 2 Score: 59.6918 bits (143), Expect = 6.655e-8
Identity = 26/38 (68.42%), Postives = 32/38 (84.21%), Query Frame = 2
Query:    2 PKESEIDADLINAGKETVTIRPGGSYFSSDNSFAMIRG 115
            P + ++D DLINAGKE+VT+ PG SYF SD+SFAMIRG
Sbjct:  350 PTKDKVDPDLINAGKESVTVVPGASYFGSDDSFAMIRG 387          
BLAST of Succinyl-CoA:3-ketoacid-coenzyme A transferase vs. TrEMBL
Match: A0A2G8LHQ6 (Succinyl-CoA:3-ketoacid-coenzyme A transferase OS=Stichopus japonicus OX=307972 GN=BSL78_03343 PE=3 SV=1)

HSP 1 Score: 191.43 bits (485), Expect = 5.038e-49
Identity = 89/124 (71.77%), Postives = 109/124 (87.90%), Query Frame = 2
Query: 1799 GHLDITVLGAMEVSKNGDLANWLIPGKMIKGMGGAMDLVSSFGTKVIITMEHSASDGTPKIVNQCTLPLTGSQCVNMIVTEKGVFEVDPEKGLTLTEVAEGVDIQDIVESTGCEFQLAEKILPM 2170
            GHLD+T+LGAM+VSK GDLANW+IPGKM+KGMGGAMDLVS+  TKVI+TMEH+A  G PKI++ CTLPLTG QCV+MI+TE  VFEVD E GLTLTE+A+GV ++D+VESTG EFQLA+++ PM
Sbjct:  394 GHLDLTILGAMQVSKYGDLANWMIPGKMVKGMGGAMDLVSAPHTKVIVTMEHAAKGGKPKILDNCTLPLTGVQCVDMIITEMCVFEVDKENGLTLTELADGVTVEDVVESTGAEFQLADEVRPM 517          

HSP 2 Score: 62.003 bits (149), Expect = 3.422e-6
Identity = 31/43 (72.09%), Postives = 35/43 (81.40%), Query Frame = 2
Query:    2 PKESEIDADLINAGKETVTIRPGGSYFSSDNSFAMIRG--LDL 124
            P++ E D DLINAGKETVT+ PG SYF SD+SFAMIRG  LDL
Sbjct:  356 PRKGEEDPDLINAGKETVTVLPGASYFGSDDSFAMIRGGHLDL 398          
BLAST of Succinyl-CoA:3-ketoacid-coenzyme A transferase vs. TrEMBL
Match: A0A1U7S2D6 (succinyl-CoA:3-ketoacid coenzyme A transferase 1, mitochondrial-like OS=Alligator sinensis OX=38654 GN=LOC102377211 PE=4 SV=2)

HSP 1 Score: 178.333 bits (451), Expect = 8.280e-49
Identity = 81/125 (64.80%), Postives = 104/125 (83.20%), Query Frame = 2
Query: 1799 GHLDITVLGAMEVSKNGDLANWLIPGKMIKGMGGAMDLVSSFGTKVIITMEHSASDGTPKIVNQCTLPLTGSQCVNMIVTEKGVFEVDPEKGLTLTEVAEGVDIQDIVESTGCEFQLAEKILPMK 2173
            GH+D+T+LGAM+VSK GDLANW+IPGKM+KGMGGAMDLVSS  TKV++TMEHSA   T KI+ +C LPLTG QCV+ I+TEK VF+VD +KGLTL E+ EG+ + DI +STGC+F ++  ++PMK
Sbjct:    5 GHIDLTMLGAMQVSKYGDLANWMIPGKMVKGMGGAMDLVSSSQTKVVVTMEHSAKGNTHKILEKCNLPLTGKQCVDRIITEKAVFDVDKKKGLTLIEIWEGLSVDDIKKSTGCDFAVSSNLIPMK 129          
BLAST of Succinyl-CoA:3-ketoacid-coenzyme A transferase vs. TrEMBL
Match: A0A1B6GFN6 (Succinyl-CoA:3-ketoacid-coenzyme A transferase OS=Cuerna arida OX=1464854 GN=g.39555 PE=3 SV=1)

HSP 1 Score: 189.504 bits (480), Expect = 1.787e-48
Identity = 87/125 (69.60%), Postives = 108/125 (86.40%), Query Frame = 2
Query: 1799 GHLDITVLGAMEVSKNGDLANWLIPGKMIKGMGGAMDLVSSFGTKVIITMEHSASDGTPKIVNQCTLPLTGSQCVNMIVTEKGVFEVDPEKGLTLTEVAEGVDIQDIVESTGCEFQLAEKILPMK 2173
            GH+D+T+LGAM+VS+ GDLANW+IPGK +KGMGGAMDLVSS  TKV++TMEHSA +G  KIV+ C+LPLTG  CVN I+TEK VFEVDPE+GLTLTEVAEGV++ DI+ STGCEFQ++  + PM+
Sbjct:  386 GHIDLTMLGAMQVSQYGDLANWMIPGKKVKGMGGAMDLVSSPNTKVVVTMEHSAKNGEHKIVSSCSLPLTGKNCVNTIITEKCVFEVDPEQGLTLTEVAEGVEVADIITSTGCEFQVSPDLRPMQ 510          

HSP 2 Score: 64.6994 bits (156), Expect = 4.744e-7
Identity = 28/36 (77.78%), Postives = 34/36 (94.44%), Query Frame = 2
Query:    8 ESEIDADLINAGKETVTIRPGGSYFSSDNSFAMIRG 115
            + E+DADL+NAGKETVT+ PGGS+FSSD+SFAMIRG
Sbjct:  350 KQEVDADLVNAGKETVTVLPGGSFFSSDDSFAMIRG 385          
BLAST of Succinyl-CoA:3-ketoacid-coenzyme A transferase vs. TrEMBL
Match: A0A1B6LGY0 (Uncharacterized protein (Fragment) OS=Graphocephala atropunctata OX=36148 GN=g.46740 PE=4 SV=1)

HSP 1 Score: 179.489 bits (454), Expect = 1.815e-48
Identity = 84/125 (67.20%), Postives = 106/125 (84.80%), Query Frame = 2
Query: 1799 GHLDITVLGAMEVSKNGDLANWLIPGKMIKGMGGAMDLVSSFGTKVIITMEHSASDGTPKIVNQCTLPLTGSQCVNMIVTEKGVFEVDPEKGLTLTEVAEGVDIQDIVESTGCEFQLAEKILPMK 2173
            GH+++T+LGAM+VS+ GDLANW+IPGK +KGMGGAMDLV+S  TKV++TMEHSA +G  KIV+ C LPLTG  CVNMI+TEK VFEVD E+GLTLTE+AEGV+I DI+ STG EFQ++  + PM+
Sbjct:   57 GHINLTMLGAMQVSQYGDLANWMIPGKKVKGMGGAMDLVASPKTKVVVTMEHSAKNGEHKIVSNCNLPLTGKNCVNMIITEKCVFEVDSEQGLTLTELAEGVEIADIITSTGSEFQVSPDLRPMQ 181          

HSP 2 Score: 65.855 bits (159), Expect = 1.431e-8
Identity = 29/36 (80.56%), Postives = 34/36 (94.44%), Query Frame = 2
Query:    8 ESEIDADLINAGKETVTIRPGGSYFSSDNSFAMIRG 115
            + E+DADLINAGKETVT+ PGGS+FSSD+SFAMIRG
Sbjct:   21 KQEVDADLINAGKETVTVLPGGSFFSSDDSFAMIRG 56          
BLAST of Succinyl-CoA:3-ketoacid-coenzyme A transferase vs. TrEMBL
Match: A0A2J7R0Q5 (Succinyl-CoA:3-ketoacid coenzyme A transferase 1, mitochondrial OS=Cryptotermes secundus OX=105785 GN=OXCT1_1 PE=4 SV=1)

HSP 1 Score: 184.111 bits (466), Expect = 1.965e-48
Identity = 85/124 (68.55%), Postives = 106/124 (85.48%), Query Frame = 2
Query: 1799 GHLDITVLGAMEVSKNGDLANWLIPGKMIKGMGGAMDLVSSFGTKVIITMEHSASDGTPKIVNQCTLPLTGSQCVNMIVTEKGVFEVDPEKGLTLTEVAEGVDIQDIVESTGCEFQLAEKILPM 2170
            GH+DITVLG M+VS+ GDLANW+IPGK++KGMGGAMDLV++ GTKVI+TM H+A DG+ KIVN+CTLPLTG  CV+MIVTE GVF VD E+GLTLTE AEGV ++DI+ +TGCEF ++  + PM
Sbjct:  194 GHIDITVLGGMQVSQYGDLANWMIPGKLVKGMGGAMDLVAAPGTKVIVTMIHTAGDGSYKIVNRCTLPLTGRNCVDMIVTEMGVFNVDKEEGLTLTETAEGVGVEDIIAATGCEFAVSPDLKPM 317          

HSP 2 Score: 62.7734 bits (151), Expect = 1.134e-6
Identity = 29/38 (76.32%), Postives = 32/38 (84.21%), Query Frame = 2
Query:    2 PKESEIDADLINAGKETVTIRPGGSYFSSDNSFAMIRG 115
            P ESE+D DLINAGKETVT+  G SYF SD+SFAMIRG
Sbjct:  156 PSESEVDPDLINAGKETVTVIQGASYFGSDDSFAMIRG 193          
BLAST of Succinyl-CoA:3-ketoacid-coenzyme A transferase vs. Ensembl Cavefish
Match: oxct1b (succinyl-CoA:3-ketoacid coenzyme A transferase 1, mitochondrial-like [Source:NCBI gene;Acc:103028178])

HSP 1 Score: 172.17 bits (435), Expect = 1.028e-45
Identity = 80/125 (64.00%), Postives = 102/125 (81.60%), Query Frame = 2
Query: 1799 GHLDITVLGAMEVSKNGDLANWLIPGKMIKGMGGAMDLVSSFGTKVIITMEHSASDGTPKIVNQCTLPLTGSQCVNMIVTEKGVFEVDPEKGLTLTEVAEGVDIQDIVESTGCEFQLAEKILPMK 2173
            GH+D+T+LGAM+VSK GDLANW+IPGKM+KGMGGAMDLVSS GTKV++TMEHSA  G  KI+ +CTLPLTG QCV+ I+TEK VF+VD  +GLTL EV EG+  +DI   TG +F+++  + PM+
Sbjct:  399 GHVDLTMLGAMQVSKYGDLANWMIPGKMVKGMGGAMDLVSSAGTKVVVTMEHSAKGGKHKILEKCTLPLTGKQCVDRIITEKAVFDVDKTRGLTLIEVCEGLTPEDIRACTGTDFKVSPALKPMQ 523          

HSP 2 Score: 65.0846 bits (157), Expect = 1.676e-10
Identity = 29/38 (76.32%), Postives = 33/38 (86.84%), Query Frame = 2
Query:    2 PKESEIDADLINAGKETVTIRPGGSYFSSDNSFAMIRG 115
            P ESE+D +LINAGKETVT+ PG +YFSSD SFAMIRG
Sbjct:  361 PTESEVDPELINAGKETVTVLPGAAYFSSDESFAMIRG 398          
BLAST of Succinyl-CoA:3-ketoacid-coenzyme A transferase vs. Ensembl Cavefish
Match: oxct1a (succinyl-CoA:3-ketoacid coenzyme A transferase 1, mitochondrial [Source:NCBI gene;Acc:103039388])

HSP 1 Score: 167.548 bits (423), Expect = 3.357e-44
Identity = 77/125 (61.60%), Postives = 103/125 (82.40%), Query Frame = 2
Query: 1799 GHLDITVLGAMEVSKNGDLANWLIPGKMIKGMGGAMDLVSSFGTKVIITMEHSASDGTPKIVNQCTLPLTGSQCVNMIVTEKGVFEVDPEKGLTLTEVAEGVDIQDIVESTGCEFQLAEKILPMK 2173
            GH+++T+LGAM+VSK+GDLANW+IPGKM+KGMGGAMDLV+S GTKV++TMEHSA  G  KI+ +C+LPLTG  CV+ I+TEK VF+VD  KGLTL EV EG+  +DI + TG +F+++  + PM+
Sbjct:  387 GHINLTMLGAMQVSKHGDLANWMIPGKMVKGMGGAMDLVASAGTKVVVTMEHSAKGGKHKILEKCSLPLTGKGCVDRIITEKAVFDVDTNKGLTLIEVWEGLTPEDIRKCTGADFEVSPNLKPMQ 511          

HSP 2 Score: 66.2402 bits (160), Expect = 6.522e-11
Identity = 30/38 (78.95%), Postives = 32/38 (84.21%), Query Frame = 2
Query:    2 PKESEIDADLINAGKETVTIRPGGSYFSSDNSFAMIRG 115
            P E E+DADLINAGKETVT+ PG SYFSSD SF MIRG
Sbjct:  349 PTEEEVDADLINAGKETVTVLPGASYFSSDESFGMIRG 386          
BLAST of Succinyl-CoA:3-ketoacid-coenzyme A transferase vs. Ensembl Cavefish
Match: oxct1a (succinyl-CoA:3-ketoacid coenzyme A transferase 1, mitochondrial [Source:NCBI gene;Acc:103039388])

HSP 1 Score: 129.028 bits (323), Expect = 3.437e-31
Identity = 57/82 (69.51%), Postives = 73/82 (89.02%), Query Frame = 2
Query: 1799 GHLDITVLGAMEVSKNGDLANWLIPGKMIKGMGGAMDLVSSFGTKVIITMEHSASDGTPKIVNQCTLPLTGSQCVNMIVTEK 2044
            GH+++T+LGAM+VSK+GDLANW+IPGKM+KGMGGAMDLV+S GTKV++TMEHSA  G  KI+ +C+LPLTG  CV+ I+TEK
Sbjct:  387 GHINLTMLGAMQVSKHGDLANWMIPGKMVKGMGGAMDLVASAGTKVVVTMEHSAKGGKHKILEKCSLPLTGKGCVDRIITEK 468          

HSP 2 Score: 66.2402 bits (160), Expect = 5.723e-11
Identity = 30/38 (78.95%), Postives = 32/38 (84.21%), Query Frame = 2
Query:    2 PKESEIDADLINAGKETVTIRPGGSYFSSDNSFAMIRG 115
            P E E+DADLINAGKETVT+ PG SYFSSD SF MIRG
Sbjct:  349 PTEEEVDADLINAGKETVTVLPGASYFSSDESFGMIRG 386          
BLAST of Succinyl-CoA:3-ketoacid-coenzyme A transferase vs. Ensembl Nematostella
Match: EDO46906 (Succinyl-CoA:3-ketoacid-coenzyme A transferase [Source:UniProtKB/TrEMBL;Acc:A7RNT1])

HSP 1 Score: 160.999 bits (406), Expect = 3.401e-42
Identity = 77/117 (65.81%), Postives = 98/117 (83.76%), Query Frame = 2
Query: 1799 GHLDITVLGAMEVSKNGDLANWLIPGKMIKGMGGAMDLVSSFGTKVIITMEHSASDGTPKIVNQCTLPLTGSQCVNMIVTEKGVFEVDPEKGLTLTEVAEGVDIQDIVESTGCEFQL 2149
            GH+DIT+LGAM+VS+ GD+AN++IPGKM+KGMGGAMDLVSS  ++VI+TMEH A     KI+ +CTLPLTG  CVNMI+TEK VF+VDPE+GLTLTE+  GV IQ++  STGC F++
Sbjct:  392 GHIDITILGAMQVSQFGDIANYMIPGKMVKGMGGAMDLVSS-PSRVIVTMEHVAKGNDHKILEECTLPLTGKNCVNMIITEKCVFDVDPEEGLTLTELWPGVSIQEVQTSTGCGFKV 507          

HSP 2 Score: 61.2326 bits (147), Expect = 9.678e-10
Identity = 28/38 (73.68%), Postives = 32/38 (84.21%), Query Frame = 2
Query:    2 PKESEIDADLINAGKETVTIRPGGSYFSSDNSFAMIRG 115
            P+  + D DLINAGKETVT+ PGGS+FSSD SFAMIRG
Sbjct:  354 PRPGDEDGDLINAGKETVTVLPGGSFFSSDESFAMIRG 391          
BLAST of Succinyl-CoA:3-ketoacid-coenzyme A transferase vs. Ensembl Medaka
Match: oxct1a (3-oxoacid CoA-transferase 1 [Source:NCBI gene;Acc:101163581])

HSP 1 Score: 169.474 bits (428), Expect = 9.548e-45
Identity = 76/125 (60.80%), Postives = 104/125 (83.20%), Query Frame = 2
Query: 1799 GHLDITVLGAMEVSKNGDLANWLIPGKMIKGMGGAMDLVSSFGTKVIITMEHSASDGTPKIVNQCTLPLTGSQCVNMIVTEKGVFEVDPEKGLTLTEVAEGVDIQDIVESTGCEFQLAEKILPMK 2173
            GH+++T+LGAM+VSK+GDLANW+IPGKM+KGMGGAMDLV+S GTKV++TMEHSA  G  KI+++C+LPLTG QCV+ I+TEK VF++D +KGLTL E+ EG+   DI   TG +F+++  + PM+
Sbjct:  401 GHINLTMLGAMQVSKHGDLANWMIPGKMVKGMGGAMDLVASAGTKVVVTMEHSAKGGKHKILDKCSLPLTGKQCVDRIITEKAVFDIDKKKGLTLIEIWEGLTPDDIKACTGTDFEVSPNLRPMQ 525          

HSP 2 Score: 65.855 bits (159), Expect = 9.680e-11
Identity = 29/38 (76.32%), Postives = 33/38 (86.84%), Query Frame = 2
Query:    2 PKESEIDADLINAGKETVTIRPGGSYFSSDNSFAMIRG 115
            P + E+DADLINAGKETVT+ PG +YFSSD SFAMIRG
Sbjct:  363 PTQDEVDADLINAGKETVTVLPGAAYFSSDESFAMIRG 400          
BLAST of Succinyl-CoA:3-ketoacid-coenzyme A transferase vs. Planmine SMEST
Match: SMESG000080432.1 (SMESG000080432.1)

HSP 1 Score: 256.914 bits (655), Expect = 1.127e-76
Identity = 126/129 (97.67%), Postives = 126/129 (97.67%), Query Frame = 2
Query: 1787 MCCRGHLDITVLGAMEVSKNGDLANWLIPGKMIKGMGGAMDLVSSFGTKVIITMEHSASDGTPKIVNQCTLPLTGSQCVNMIVTEKGVFEVDPEKGLTLTEVAEGVDIQDIVESTGCEFQLAEKILPMK 2173
            M   GHLDITVLGAMEVSKNGDLANWLIPGKMIKGMGGAMDLVSSFGTKVIITMEHSASDGTPKIVNQCTLPLTGSQCVNMIVTEKGVFEVDPEKGLTLTEVAEGVDIQDIVESTGCEFQLAEKILPMK
Sbjct:  382 MIRGGHLDITVLGAMEVSKNGDLANWLIPGKMIKGMGGAMDLVSSFGTKVIITMEHSASDGTPKIVNQCTLPLTGSQCVNMIVTEKGVFEVDPEKGLTLTEVAEGVDIQDIVESTGCEFQLAEKILPMK 510          

HSP 2 Score: 80.8777 bits (198), Expect = 1.170e-15
Identity = 42/52 (80.77%), Postives = 43/52 (82.69%), Query Frame = 2
Query:    2 PKESEIDADLINAGKETVTIRPGGSYFSSDNSFAMIRGLDLPHFVIKCLKAI 157
            PKESEIDADLINAGKETVTIRPGGSYFSSDNSFAMIRG    H  I  L A+
Sbjct:  348 PKESEIDADLINAGKETVTIRPGGSYFSSDNSFAMIRG---GHLDITVLGAM 396          
BLAST of Succinyl-CoA:3-ketoacid-coenzyme A transferase vs. Planmine SMEST
Match: SMESG000080424.1 (SMESG000080424.1)

HSP 1 Score: 228.409 bits (581), Expect = 5.854e-66
Identity = 111/129 (86.05%), Postives = 119/129 (92.25%), Query Frame = 2
Query: 1787 MCCRGHLDITVLGAMEVSKNGDLANWLIPGKMIKGMGGAMDLVSSFGTKVIITMEHSASDGTPKIVNQCTLPLTGSQCVNMIVTEKGVFEVDPEKGLTLTEVAEGVDIQDIVESTGCEFQLAEKILPMK 2173
            M   GHLD+TVLG MEVSKNGDLANW+IPGKMIKGMGGAMDLVSS  TKVI+ MEH A+DGTPKIVNQCTLPLTGSQCV+MIVTEKGVFEV+  KGLTLTEVAEGVDIQDIV++TGCEFQLAEKILPMK
Sbjct:  396 MIRGGHLDVTVLGGMEVSKNGDLANWMIPGKMIKGMGGAMDLVSSLRTKVIVIMEHCAADGTPKIVNQCTLPLTGSQCVSMIVTEKGVFEVNRGKGLTLTEVAEGVDIQDIVKTTGCEFQLAEKILPMK 524          
The following BLAST results are available for this feature:
BLAST of Succinyl-CoA:3-ketoacid-coenzyme A transferase vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
OXCT11.355e-4964.803-oxoacid CoA-transferase 1 [Source:HGNC Symbol;Ac... [more]
OXCT12.601e-4864.713-oxoacid CoA-transferase 1 [Source:HGNC Symbol;Ac... [more]
OXCT12.601e-4864.713-oxoacid CoA-transferase 1 [Source:HGNC Symbol;Ac... [more]
OXCT19.486e-4864.803-oxoacid CoA-transferase 1 [Source:HGNC Symbol;Ac... [more]
OXCT22.584e-4258.403-oxoacid CoA-transferase 2 [Source:HGNC Symbol;Ac... [more]
back to top
BLAST of Succinyl-CoA:3-ketoacid-coenzyme A transferase vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 1
Match NameE-valueIdentityDescription
C05C10.32.042e-3753.97Probable succinyl-CoA:3-ketoacid coenzyme A transf... [more]
back to top
BLAST of Succinyl-CoA:3-ketoacid-coenzyme A transferase vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 3
Match NameE-valueIdentityDescription
SCOT2.747e-4460.94gene:FBgn0035298 transcript:FBtr0333431[more]
SCOT1.050e-4360.94gene:FBgn0035298 transcript:FBtr0072843[more]
SCOT1.207e-4360.94gene:FBgn0035298 transcript:FBtr0072844[more]
back to top
BLAST of Succinyl-CoA:3-ketoacid-coenzyme A transferase vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
oxct1b1.283e-4563.203-oxoacid CoA transferase 1b [Source:ZFIN;Acc:ZDB-... [more]
oxct1a4.064e-4462.403-oxoacid CoA transferase 1a [Source:ZFIN;Acc:ZDB-... [more]
oxct1a9.015e-4462.403-oxoacid CoA transferase 1a [Source:ZFIN;Acc:ZDB-... [more]
oxct1a9.612e-3360.003-oxoacid CoA transferase 1a [Source:ZFIN;Acc:ZDB-... [more]
oxct1a1.764e-2772.063-oxoacid CoA transferase 1a [Source:ZFIN;Acc:ZDB-... [more]
back to top
BLAST of Succinyl-CoA:3-ketoacid-coenzyme A transferase vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
mettl185.085e-4666.39methyltransferase like 18 [Source:Xenbase;Acc:XB-G... [more]
mettl185.377e-4666.39methyltransferase like 18 [Source:Xenbase;Acc:XB-G... [more]
mettl186.146e-4666.39methyltransferase like 18 [Source:Xenbase;Acc:XB-G... [more]
mettl186.151e-4666.39methyltransferase like 18 [Source:Xenbase;Acc:XB-G... [more]
mettl186.555e-4666.39methyltransferase like 18 [Source:Xenbase;Acc:XB-G... [more]
back to top
BLAST of Succinyl-CoA:3-ketoacid-coenzyme A transferase vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 4
Match NameE-valueIdentityDescription
Oxct14.988e-4764.003-oxoacid CoA transferase 1 [Source:MGI Symbol;Acc... [more]
Oxct2b3.872e-4156.803-oxoacid CoA transferase 2B [Source:MGI Symbol;Ac... [more]
Oxct2a4.178e-4156.803-oxoacid CoA transferase 2A [Source:MGI Symbol;Ac... [more]
Oxct11.168e-3171.953-oxoacid CoA transferase 1 [Source:MGI Symbol;Acc... [more]
back to top
BLAST of Succinyl-CoA:3-ketoacid-coenzyme A transferase vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|P55809|SCOT1_HUMAN4.556e-4764.80Succinyl-CoA:3-ketoacid coenzyme A transferase 1, ... [more]
sp|Q29551|SCOT1_PIG2.208e-4664.00Succinyl-CoA:3-ketoacid coenzyme A transferase 1, ... [more]
sp|Q9D0K2|SCOT1_MOUSE3.489e-4664.00Succinyl-CoA:3-ketoacid coenzyme A transferase 1, ... [more]
sp|B2GV06|SCOT1_RAT3.808e-4664.00Succinyl-CoA:3-ketoacid coenzyme A transferase 1, ... [more]
sp|Q9W058|SCOT_DROME1.209e-4260.94Succinyl-CoA:3-ketoacid-coenzyme A transferase, mi... [more]
back to top
BLAST of Succinyl-CoA:3-ketoacid-coenzyme A transferase vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A2G8LHQ65.038e-4971.77Succinyl-CoA:3-ketoacid-coenzyme A transferase OS=... [more]
A0A1U7S2D68.280e-4964.80succinyl-CoA:3-ketoacid coenzyme A transferase 1, ... [more]
A0A1B6GFN61.787e-4869.60Succinyl-CoA:3-ketoacid-coenzyme A transferase OS=... [more]
A0A1B6LGY01.815e-4867.20Uncharacterized protein (Fragment) OS=Graphocephal... [more]
A0A2J7R0Q51.965e-4868.55Succinyl-CoA:3-ketoacid coenzyme A transferase 1, ... [more]
back to top
BLAST of Succinyl-CoA:3-ketoacid-coenzyme A transferase vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 3
Match NameE-valueIdentityDescription
oxct1b1.028e-4564.00succinyl-CoA:3-ketoacid coenzyme A transferase 1, ... [more]
oxct1a3.357e-4461.60succinyl-CoA:3-ketoacid coenzyme A transferase 1, ... [more]
oxct1a3.437e-3169.51succinyl-CoA:3-ketoacid coenzyme A transferase 1, ... [more]
back to top
BLAST of Succinyl-CoA:3-ketoacid-coenzyme A transferase vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Succinyl-CoA:3-ketoacid-coenzyme A transferase vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Succinyl-CoA:3-ketoacid-coenzyme A transferase vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 1
Match NameE-valueIdentityDescription
EDO469063.401e-4265.81Succinyl-CoA:3-ketoacid-coenzyme A transferase [S... [more]
back to top
BLAST of Succinyl-CoA:3-ketoacid-coenzyme A transferase vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 1
Match NameE-valueIdentityDescription
oxct1a9.548e-4560.803-oxoacid CoA-transferase 1 [Source:NCBI gene;Acc:... [more]
back to top
BLAST of Succinyl-CoA:3-ketoacid-coenzyme A transferase vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 2
Match NameE-valueIdentityDescription
SMESG000080432.11.127e-7697.67SMESG000080432.1[more]
SMESG000080424.15.854e-6686.05SMESG000080424.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30015906 ID=SMED30015906|Name=Succinyl-CoA:3-ketoacid-coenzyme A transferase|organism=Schmidtea mediterranea sexual|type=transcript|length=2266bp
TCCAAAAGAAAGCGAAATAGATGCTGATCTCATTAATGCTGGCAAAGAAA
CTGTCACGATAAGACCCGGAGGATCATATTTTTCTTCTGATAATAGTTTT
GCTATGATTAGAGGGTTGGATTTACCTCATTTTGTTATTAAATGTTTAAA
AGCAATAAATTAAACATTTATTTAATCTAGCATAAAATTTGATAACGTAA
TTTGATTTTTAGTGAATAATTTTAAATTGAACGTTTAACAATCGAATATT
TTCTTAGAAAATAGTTTAAAAATTCTGAAAAAGGCCGTTAATAAAATTTA
TGAAATGTATTTGAAATCAAATTAATTTTTGATTGCTCAATGTATTATGA
TACAAAATATTAAATTGTTATTTTAAAATTAAATAAATGTTTAATTATAT
AGTTTTTAATGAATACAATGATTTAATGTAAAATTTCTATTGCTTATTAT
ATTATTATGGTTAGCTAAGTTTTGCTTAGAAAAATCCATATTTGAATTAT
ACTACAGATCATACTCCAAACCACTTTCTATGGACCAAATGCTCTTCTAG
CAGTCTTAACCAGCCTCAATTAACATTTTCTTATTCATCGGATTATTATC
AATTGAGCTAGAAAAATCACTTCCATATCAAATTAATCTCCTGTTAACAA
TAGATAAAATATACTCTTAAGATTTTGTCTTATTTCATGATGTAATAATT
GAATTCTTTATAATATCTGTAGTAATCAGCTATTGAGTCTCATGAAAGGT
TTAGATTTATCCAACAAATTCTTCAGATGTAAACAATTGTTTCGGTAACG
GTTTACAGTGAAAAATCGTCATCAGGAAACAAAAGTAAATTTTAAAATCG
CCTGTCATATAATTTTTAGGAAAAAAATTAACCCATAATGGCAATCTTTG
GATTTTTGCGTTGGCAATTAATAATTTTAATAAAGAAAATTACGGCAAAC
AGCGAAATAATATTTGTATTGTGCTACCTAATGCTATAATATTAAGAAAT
CAGGACGGTGAAAGAATCGATTTGGAACTGGTGACATTAACACTTGATCA
GTAATATTTTCTGCTTTACAATAAAGTAAATAAAGGCTCTTACTCAAAAT
CACTGGATTGCGGAGGCTGTCAACAACCGTTTACAATAAGCTGATATACA
CAGGGAATAATTTTACATCTGATGGGTTTGGTTTTCGAAAGTCTGTTCGA
GATATTTCGTTCTCATTAGATCAAATTCCTACCTGAGGACACTGAAAATG
ACCAGGATCAAATATAGTTGAAATTGGAGAATCTGATTCTACTGGCATTG
AATTAGTCAAAAACGTCCGCTAGTTTCGACTTAGCAGGTGAAATCTATTA
ACAATCAGTCGTGGTTCATCAACACTTCATTAACTCGAACTATGCAGAAT
TCCACAGAACATTTAAAATGTGAATTCGGGCTGAAAGCAAGTCGAAGAGA
CATTTCGAGATGTGCTCTTTTTCAATTCAATTTACATATCGTTGTTATTT
TAGGGATTCAGACTTATCTACAGCGTTCATAATCACATTGACTCTCAATT
ATGGATAATTTAATGTTTTTAATATTACCTGTTTTGATTTAAATGTTTAT
TAATTTCCGACACTAAAACCAAAAATTACCCCGATAATAATATCAATTAA
TGAAATGACCAAAATAATGTACAAAATCGTTGTACAAAATATAATAAAGT
ATGATATTTAATTGTAGGATATATTTTCAAATAATTAAATCCAAATTTGT
TATATAAACAATAAACGATTTTATTGACTAACTGTCATGTGTTGTAGAGG
TCATCTTGACATCACGGTTTTGGGCGCCATGGAGGTTTCTAAGAATGGCG
ATCTTGCAAATTGGTTGATTCCGGGCAAAATGATCAAAGGAATGGGTGGA
GCCATGGATTTAGTTTCAAGTTTCGGAACAAAAGTTATAATAACAATGGA
GCATAGTGCATCTGATGGAACTCCAAAAATTGTAAATCAGTGCACCCTCC
CACTCACTGGATCACAGTGTGTAAATATGATCGTAACTGAAAAGGGTGTA
TTTGAAGTAGATCCTGAAAAGGGCCTCACATTAACAGAAGTAGCTGAAGG
TGTAGATATTCAGGATATAGTTGAATCGACTGGCTGTGAATTCCAATTAG
CTGAAAAAATCTTGCCAATGAAGCAAATTTAATAAATTCAAATTTTATCA
TTGCCGATTTACTTTTATATATTGTGCTAAAATTTCAAATTCATCTTATT
TTCATATGTGATTTAA
back to top

protein sequence of SMED30015906-orf-1

>SMED30015906-orf-1 ID=SMED30015906-orf-1|Name=SMED30015906-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=132bp
MCCRGHLDITVLGAMEVSKNGDLANWLIPGKMIKGMGGAMDLVSSFGTKV
IITMEHSASDGTPKIVNQCTLPLTGSQCVNMIVTEKGVFEVDPEKGLTLT
EVAEGVDIQDIVESTGCEFQLAEKILPMKQI*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000035Category 3 cell
Vocabulary: INTERPRO
TermDefinition
IPR037171NagB/RpiA_transferase-like
IPR004165CoA_trans_fam_I
Vocabulary: molecular function
TermDefinition
GO:0008410CoA-transferase activity
GO:00082603-oxoacid CoA-transferase activity
GO:0016740transferase activity
Vocabulary: biological process
TermDefinition
GO:0008152metabolic process
GO:0046952ketone body catabolic process
Vocabulary: cellular component
TermDefinition
GO:0005739mitochondrion
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR004165Coenzyme A transferase family ISMARTSM00882CoA_trans_3coord: 2..114
e-value: 0.0023
score: -0.1
IPR004165Coenzyme A transferase family IPFAMPF01144CoA_transcoord: 5..113
e-value: 2.4E-21
score: 76.1
IPR004165Coenzyme A transferase family IPANTHERPTHR13707KETOACID-COENZYME A TRANSFERASEcoord: 2..125
NoneNo IPR availableGENE3DG3DSA:3.40.1080.10coord: 1..126
e-value: 1.4E-58
score: 199.8
NoneNo IPR availablePANTHERPTHR13707:SF23SUCCINYL-COA:3-KETOACID-COENZYME A TRANSFERASEcoord: 2..125
IPR037171NagB/RpiA transferase-likeSUPERFAMILYSSF100950NagB/RpiA/CoA transferase-likecoord: 2..125