Protein lethal(2) giant larvae

Overview
NameProtein lethal(2) giant larvae
Smed IDSMED30015890
Length (bp)3417
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Protein lethal(2) giant larvae (SMED30015890) t-SNE clustered cells

Violin plots show distribution of expression levels for Protein lethal(2) giant larvae (SMED30015890) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Protein lethal(2) giant larvae (SMED30015890) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Protein lethal(2) giant larvae (SMED30015890) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Homology
BLAST of Protein lethal(2) giant larvae vs. Ensembl Human
Match: LLGL2 (LLGL scribble cell polarity complex component 2 [Source:HGNC Symbol;Acc:HGNC:6629])

HSP 1 Score: 241.121 bits (614), Expect = 4.192e-65
Identity = 232/921 (25.19%), Postives = 396/921 (43.00%), Query Frame = 1
Query:  238 EPSCIDYDHKLSLLGIASKKGLIKIFGCPGVCYSTRLEGQDEIWNIKFIPGTNFFVTLTADNKLILWLISTL--TNELFKVDVISNLNVVNSARTSAHXXXXXXXXXXXXXXXXXTAIEVNDLTSSIIMGNGSGSLIQVKLDLLKMRKQANNYKTVPPGNTIWQMPTKSDVIDRDRIISKLPIGSQNRVIIDAVIHISARPGSRKHLLIGYRSGNSIIYNVQKDSVDFLLSAKSTLNALSWCPPDPIVQDNFMVAPNRNEPQYYSSMKLHSCHEDGSIITWNLPQNSDEFLVLDFQIFSPYKKDQKCLPISKILWKRYKQDY-LIVFSGGLPRSDYMTKSTITIMNNSCLDSSKANNEHLVLDLTSQLIDFTTIDDNDSGSV----EYLLVLTEEEFFIVDLTKESWPILHDRQPYLNCLHNSPITAYQFLSEVKSDWFQKLNEMSSNKEDCNISFSDWPIKGYAQKVRNDEIWQNDLLIIGHGDGTIVFWKFGMGGCMKKISTVKSSSLFKMADELHLN-EVSYEDDEIPLRRTGQFDPCCDDNRLAIQ---LIHYTGKHLLIGGYGGQIVLWGFQENKYEKHL--LDVDLTTHLSNFKWKGCQPFQHIEGSIKTGSNFQVMMSMCIFPPSQITALDILEDNNCNGYVIIACGTLHGLVIVSCPKETNLEALVLTTHCTV-PRNTLASQEASLGEGWARRRTXXXXXXXXXXXXXXXXXXXXXMEHPS-VSRHLSDNNDKTMRXXXXXXXXXXXXXXXXDRPKDTANDGLIRSIRINVSLIKRKGSNGPHEKLLNLFAGCYGGLLLWFQSDYSVENILKNSPINLRLIKQYQFQHRAPILHFNMLSPESGLSKLNENPDAGFDL--DPNRKPDH-LVVLTEEQVRLYAFPSFTLKCKIRVTAHDGFRLKNGSLIVFSDDR 2946
            +PS + Y   L +L I ++ G IK++G PGV +    +  + +  I  +PG    VTL  DN L LW +      +EL + D    L     A  SA                 IT +  +     + +G  SG++  V+L   +                      +   I  D ++ +LP  +++R + + V  +   P     +LIGY  G  +I+++Q   V +   +   L  + W       +D  +               L SCH DGS   W  P +S+       +   PY     C  I++ILW   +Q     +F GG+PR+ Y  +  I++++         + +    D TS++I FT + + D  +       L+VL EEE  ++DL    WP +  + PYL  LH S IT    +S +    ++++    S +++ + S  +WPI G           Q DLL+ GH DGT+ FW    G C++ +  + +  +F    + + N     ED+  PLR+ G FDP  DD RL IQ   L  Y+G +L + G  GQ+++    +   E+ +  ++ DL      ++WKG +      G ++    FQ  + +   PP+ +T+L +  +     + ++A GT HG  +    +        +   CT+ P + LA       EG   R     K   +S  R  R R + R  HP+       + + K  R  L   E+   +R IE R  + +  G +R++    + +K    + P     +L+AG  GG +  F           + P+     K+ Q  HRAP++   +L   S    L E  +   DL   P+ +  H L+V++EEQ +++  P  + K K+++TA +G R++  S+  F   R
Sbjct:   34 QPSALGYSPSLRILAIGTRSGAIKLYGAPGVEFMGLHQENNAVTQIHLLPGQCQLVTLLDDNSLHLWSLKVKGGASEL-QEDESFTLRGPPGAAPSA---------------TQITVVLPHSSCELLYLGTESGNVFVVQLPAFRA--------------------LEDRTISSDAVLQRLPEEARHRRVFEMVEALQEHPRDPNQILIGYSRGLVVIWDLQGSRVLYHFLSSQQLENIWW------QRDGRL---------------LVSCHSDGSYCQW--PVSSEAQQPEPLRSLVPYGPF-PCKAITRILWLTTRQGLPFTIFQGGMPRASYGDRHCISVIH---------DGQQTAFDFTSRVIGFTVLTEADPAATFDDPYALVVLAEEELVVIDLQTAGWPPV--QLPYLASLHCSAITCSHHVSNIPLKLWERIIAAGS-RQNAHFSTMEWPIDGGTSLTPAPP--QRDLLLTGHEDGTVRFWD-ASGVCLRLLYKLSTVRVFLTDTDPNENFSAQGEDEWPPLRKVGSFDPYSDDPRLGIQKIFLCKYSG-YLAVAGTAGQVLVLELNDEAAEQAVEQVEADLLQDQEGYRWKGHERLAARSGPVRFEPGFQPFVLVQCQPPAVVTSLALHSE-----WRLVAFGTSHGFGLFDHQQRRQ-----VFVKCTLHPSDQLAL------EGPLSRVKSLKKSLRQSFRRMRRSRVSSRKRHPAGPPGEAQEGSAKAERPGLQNMELAPVQRKIEARSAEDSFTGFVRTLYFADTYLKDSSRHCP-----SLWAGTNGGTIYAFSLRVPPAERRMDEPVRAEQAKEIQLMHRAPVVGILVLDGHS--VPLPEPLEVAHDLSKSPDMQGSHQLLVVSEEQFKVFTLPKVSAKLKLKLTALEGSRVRRVSVAHFGSRR 855          
BLAST of Protein lethal(2) giant larvae vs. Ensembl Human
Match: LLGL2 (LLGL scribble cell polarity complex component 2 [Source:HGNC Symbol;Acc:HGNC:6629])

HSP 1 Score: 241.121 bits (614), Expect = 4.578e-65
Identity = 231/921 (25.08%), Postives = 396/921 (43.00%), Query Frame = 1
Query:  238 EPSCIDYDHKLSLLGIASKKGLIKIFGCPGVCYSTRLEGQDEIWNIKFIPGTNFFVTLTADNKLILWLISTL--TNELFKVDVISNLNVVNSARTSAHXXXXXXXXXXXXXXXXXTAIEVNDLTSSIIMGNGSGSLIQVKLDLLKMRKQANNYKTVPPGNTIWQMPTKSDVIDRDRIISKLPIGSQNRVIIDAVIHISARPGSRKHLLIGYRSGNSIIYNVQKDSVDFLLSAKSTLNALSWCPPDPIVQDNFMVAPNRNEPQYYSSMKLHSCHEDGSIITWNLPQNSDEFLVLDFQIFSPYKKDQKCLPISKILWKRYKQDY-LIVFSGGLPRSDYMTKSTITIMNNSCLDSSKANNEHLVLDLTSQLIDFTTIDDNDSGSV----EYLLVLTEEEFFIVDLTKESWPILHDRQPYLNCLHNSPITAYQFLSEVKSDWFQKLNEMSSNKEDCNISFSDWPIKGYAQKVRNDEIWQNDLLIIGHGDGTIVFWKFGMGGCMKKISTVKSSSLFKMADELHLN-EVSYEDDEIPLRRTGQFDPCCDDNRLAIQ---LIHYTGKHLLIGGYGGQIVLWGFQENKYEKHL--LDVDLTTHLSNFKWKGCQPFQHIEGSIKTGSNFQVMMSMCIFPPSQITALDILEDNNCNGYVIIACGTLHGLVIVSCPKETNLEALVLTTHCTV-PRNTLASQEASLGEGWARRRTXXXXXXXXXXXXXXXXXXXXXMEHPS-VSRHLSDNNDKTMRXXXXXXXXXXXXXXXXDRPKDTANDGLIRSIRINVSLIKRKGSNGPHEKLLNLFAGCYGGLLLWFQSDYSVENILKNSPINLRLIKQYQFQHRAPILHFNMLSPESGLSKLNENPDAGFDL--DPNRKPDH-LVVLTEEQVRLYAFPSFTLKCKIRVTAHDGFRLKNGSLIVFSDDR 2946
            +PS + Y   L +L I ++ G IK++G PGV +    +  + +  I  +PG    VTL  DN L LW +      +EL + D    L     A  SA                 IT +  +     + +G  SG++  V+L   +                      +   I  D ++ +LP  +++R + + V  +   P     +LIGY  G  +I+++Q   V +   +   L  + W       +D  ++                SCH DGS   W  P +S+       +   PY     C  I++ILW   +Q     +F GG+PR+ Y  +  I++++         + +    D TS++I FT + + D  +       L+VL EEE  ++DL    WP +  + PYL  LH S IT    +S +    ++++    S +++ + S  +WPI G           Q DLL+ GH DGT+ FW    G C++ +  + +  +F    + + N     ED+  PLR+ G FDP  DD RL IQ   L  Y+G +L + G  GQ+++    +   E+ +  ++ DL      ++WKG +      G ++    FQ  + +   PP+ +T+L +  +     + ++A GT HG  +    +        +   CT+ P + LA       EG   R     K   +S  R  R R + R  HP+       + + K  R  L   E+   +R IE R  + +  G +R++    + +K    + P     +L+AG  GG +  F           + P+     K+ Q  HRAP++   +L   S    L E  +   DL   P+ +  H L+V++EEQ +++  P  + K K+++TA +G R++  S+  F   R
Sbjct:   34 QPSALGYSPSLRILAIGTRSGAIKLYGAPGVEFMGLHQENNAVTQIHLLPGQCQLVTLLDDNSLHLWSLKVKGGASEL-QEDESFTLRGPPGAAPSA---------------TQITVVLPHSSCELLYLGTESGNVFVVQLPAFRA--------------------LEDRTISSDAVLQRLPEEARHRRVFEMVEALQEHPRDPNQILIGYSRGLVVIWDLQGSRVLYHFLSSQQLENIWW------QRDGRLLV---------------SCHSDGSYCQW--PVSSEAQQPEPLRSLVPYGPF-PCKAITRILWLTTRQGLPFTIFQGGMPRASYGDRHCISVIH---------DGQQTAFDFTSRVIGFTVLTEADPAATFDDPYALVVLAEEELVVIDLQTAGWPPV--QLPYLASLHCSAITCSHHVSNIPLKLWERIIAAGS-RQNAHFSTMEWPIDGGTSLTPAPP--QRDLLLTGHEDGTVRFWD-ASGVCLRLLYKLSTVRVFLTDTDPNENFSAQGEDEWPPLRKVGSFDPYSDDPRLGIQKIFLCKYSG-YLAVAGTAGQVLVLELNDEAAEQAVEQVEADLLQDQEGYRWKGHERLAARSGPVRFEPGFQPFVLVQCQPPAVVTSLALHSE-----WRLVAFGTSHGFGLFDHQQRRQ-----VFVKCTLHPSDQLAL------EGPLSRVKSLKKSLRQSFRRMRRSRVSSRKRHPAGPPGEAQEGSAKAERPGLQNMELAPVQRKIEARSAEDSFTGFVRTLYFADTYLKDSSRHCP-----SLWAGTNGGTIYAFSLRVPPAERRMDEPVRAEQAKEIQLMHRAPVVGILVLDGHS--VPLPEPLEVAHDLSKSPDMQGSHQLLVVSEEQFKVFTLPKVSAKLKLKLTALEGSRVRRVSVAHFGSRR 855          
BLAST of Protein lethal(2) giant larvae vs. Ensembl Human
Match: LLGL2 (LLGL scribble cell polarity complex component 2 [Source:HGNC Symbol;Acc:HGNC:6629])

HSP 1 Score: 241.121 bits (614), Expect = 4.922e-65
Identity = 232/921 (25.19%), Postives = 396/921 (43.00%), Query Frame = 1
Query:  238 EPSCIDYDHKLSLLGIASKKGLIKIFGCPGVCYSTRLEGQDEIWNIKFIPGTNFFVTLTADNKLILWLISTL--TNELFKVDVISNLNVVNSARTSAHXXXXXXXXXXXXXXXXXTAIEVNDLTSSIIMGNGSGSLIQVKLDLLKMRKQANNYKTVPPGNTIWQMPTKSDVIDRDRIISKLPIGSQNRVIIDAVIHISARPGSRKHLLIGYRSGNSIIYNVQKDSVDFLLSAKSTLNALSWCPPDPIVQDNFMVAPNRNEPQYYSSMKLHSCHEDGSIITWNLPQNSDEFLVLDFQIFSPYKKDQKCLPISKILWKRYKQDY-LIVFSGGLPRSDYMTKSTITIMNNSCLDSSKANNEHLVLDLTSQLIDFTTIDDNDSGSV----EYLLVLTEEEFFIVDLTKESWPILHDRQPYLNCLHNSPITAYQFLSEVKSDWFQKLNEMSSNKEDCNISFSDWPIKGYAQKVRNDEIWQNDLLIIGHGDGTIVFWKFGMGGCMKKISTVKSSSLFKMADELHLN-EVSYEDDEIPLRRTGQFDPCCDDNRLAIQ---LIHYTGKHLLIGGYGGQIVLWGFQENKYEKHL--LDVDLTTHLSNFKWKGCQPFQHIEGSIKTGSNFQVMMSMCIFPPSQITALDILEDNNCNGYVIIACGTLHGLVIVSCPKETNLEALVLTTHCTV-PRNTLASQEASLGEGWARRRTXXXXXXXXXXXXXXXXXXXXXMEHPS-VSRHLSDNNDKTMRXXXXXXXXXXXXXXXXDRPKDTANDGLIRSIRINVSLIKRKGSNGPHEKLLNLFAGCYGGLLLWFQSDYSVENILKNSPINLRLIKQYQFQHRAPILHFNMLSPESGLSKLNENPDAGFDL--DPNRKPDH-LVVLTEEQVRLYAFPSFTLKCKIRVTAHDGFRLKNGSLIVFSDDR 2946
            +PS + Y   L +L I ++ G IK++G PGV +    +  + +  I  +PG    VTL  DN L LW +      +EL + D    L     A  SA                 IT +  +     + +G  SG++  V+L   +                      +   I  D ++ +LP  +++R + + V  +   P     +LIGY  G  +I+++Q   V +   +   L  + W       +D  +               L SCH DGS   W  P +S+       +   PY     C  I++ILW   +Q     +F GG+PR+ Y  +  I++++         + +    D TS++I FT + + D  +       L+VL EEE  ++DL    WP +  + PYL  LH S IT    +S +    ++++    S +++ + S  +WPI G           Q DLL+ GH DGT+ FW    G C++ +  + +  +F    + + N     ED+  PLR+ G FDP  DD RL IQ   L  Y+G +L + G  GQ+++    +   E+ +  ++ DL      ++WKG +      G ++    FQ  + +   PP+ +T+L +  +     + ++A GT HG  +    +        +   CT+ P + LA       EG   R     K   +S  R  R R + R  HP+       + + K  R  L   E+   +R IE R  + +  G +R++    + +K    + P     +L+AG  GG +  F           + P+     K+ Q  HRAP++   +L   S    L E  +   DL   P+ +  H L+V++EEQ +++  P  + K K+++TA +G R++  S+  F   R
Sbjct:   34 QPSALGYSPSLRILAIGTRSGAIKLYGAPGVEFMGLHQENNAVTQIHLLPGQCQLVTLLDDNSLHLWSLKVKGGASEL-QEDESFTLRGPPGAAPSA---------------TQITVVLPHSSCELLYLGTESGNVFVVQLPAFRA--------------------LEDRTISSDAVLQRLPEEARHRRVFEMVEALQEHPRDPNQILIGYSRGLVVIWDLQGSRVLYHFLSSQQLENIWW------QRDGRL---------------LVSCHSDGSYCQW--PVSSEAQQPEPLRSLVPYGPF-PCKAITRILWLTTRQGLPFTIFQGGMPRASYGDRHCISVIH---------DGQQTAFDFTSRVIGFTVLTEADPAATFDDPYALVVLAEEELVVIDLQTAGWPPV--QLPYLASLHCSAITCSHHVSNIPLKLWERIIAAGS-RQNAHFSTMEWPIDGGTSLTPAPP--QRDLLLTGHEDGTVRFWD-ASGVCLRLLYKLSTVRVFLTDTDPNENFSAQGEDEWPPLRKVGSFDPYSDDPRLGIQKIFLCKYSG-YLAVAGTAGQVLVLELNDEAAEQAVEQVEADLLQDQEGYRWKGHERLAARSGPVRFEPGFQPFVLVQCQPPAVVTSLALHSE-----WRLVAFGTSHGFGLFDHQQRRQ-----VFVKCTLHPSDQLAL------EGPLSRVKSLKKSLRQSFRRMRRSRVSSRKRHPAGPPGEAQEGSAKAERPGLQNMELAPVQRKIEARSAEDSFTGFVRTLYFADTYLKDSSRHCP-----SLWAGTNGGTIYAFSLRVPPAERRMDEPVRAEQAKEIQLMHRAPVVGILVLDGHS--VPLPEPLEVAHDLSKSPDMQGSHQLLVVSEEQFKVFTLPKVSAKLKLKLTALEGSRVRRVSVAHFGSRR 855          
BLAST of Protein lethal(2) giant larvae vs. Ensembl Human
Match: LLGL1 (LLGL scribble cell polarity complex component 1 [Source:HGNC Symbol;Acc:HGNC:6628])

HSP 1 Score: 185.652 bits (470), Expect = 3.693e-47
Identity = 185/741 (24.97%), Postives = 327/741 (44.13%), Query Frame = 1
Query:  850 LLIGYRSGNSIIYNVQKDSVDFLLSAKSTLNALSWCPPDPIVQDNFMVAPNRNEPQYYSSMKLHSCHEDGSIITWNLPQNSDEFLVLDFQIFSPYKKDQKCLPISKILWKRYKQD-YLIVFSGGLPRSDYMTKSTITIMNNSCLDSSKANNEHLVLDLTSQLIDFTTI----DDNDSGSVEYLLVLTEEEFFIVDLTKESWPILHDRQPYLNCLHNSPITAYQFLSEVKSDWFQKLNEMSSNKEDCNISFS-DWPIKGYAQKVRN--DEIWQNDLLIIGHGDGTIVFWKFGMGGCMKKISTVKSSSLFKMADELHLNEVS--YEDDEIPLRRTGQFDPCCDDNRLAIQ---LIHYTGKHLLIGGYGGQIVLWGFQENKYEK--HLLDVDLTTHLSNFKWKGCQPFQHIEGSIKTGSNFQVMMSMCIFPPSQITALDILEDNNCNGYVIIACGTLHGLVIVSCPKETNLEALVLTTHCTV-PRNTLASQEASLGEGWARRRTXXXXXXXXXXXXXXXXXXXXXMEHPSVSRHLSDNNDKTMRXXXXXXXXXXXXXXXXD-RPKDTANDGLIRSIRINVSLIKRKGSNGPHEKLLNLFAGCYGGLLLWFQSDYSVENI----LKNSPINLRLIKQYQFQHRAPILHFNMLSPESGLSKLNENPDAGFDL--DPNRKPDHLVVL-TEEQVRLYAFPSFTLKCKIRVTAHDGFRLKNGSLIVFSDDRLTTQNNTKEPLICATNNG 3000
            +LIGY  G  +I+N     VD +      L +L W                R+      S  + S H DGS   W++  ++  F  L   + +       C  I+KILW+  +   + I+FSGG+PR+ Y  +  ++++    L         + LD TS++IDF T+     +++    + L VL EEE  ++DL    WP +    PYL  LH+S IT    ++ V +  + ++      +    +S +  WPI G     RN   E  Q  LL+ GH DGT+ FW    G  ++ +  + ++ LF+  D  H + ++   EDD  P R+ G FDP  DD RL +Q   L  YT + +++ G  GQ+++    +   E+   +  +DL      F WKG +      G +   + FQ  + +   PP+ +TA+ +  +     + ++A GT HG  +    +++ + A      CT+ P ++LA       EG   R     K   +S  R  + R + +    + S  L + N +        +      +   + R  D +  G++R +    + ++    +GP      ++AG   G +  +  +     +         +   L K+ Q  HRAP++   +L        L E  +A  DL   P+ +  H V++ +EEQ +++  P  + K K ++TAH+G R++  +L  F+   +  ++  +  L C TN G
Sbjct:  211 ILIGYSRGLLVIWNQASQCVDHIFLGNQQLESLCW---------------GRD------SSTVVSSHSDGSYAVWSV--DAGSFPTLQPTVATTPYGPFPCKAINKILWRNCESGGHFIIFSGGMPRASYGDRHCVSVLRAETL---------VTLDFTSRIIDFFTVHSTRPEDEFDDPQALAVLLEEELVVLDLQTPGWPAVP--APYLAPLHSSAITCSAHVASVPAKLWARIVSAGEQQSPQPVSSALSWPITGG----RNLAQEPSQRGLLLTGHEDGTVRFWD-ASGVALRPLYKLSTAGLFQT-DCEHADSLAQAAEDDWPPFRKVGCFDPYSDDPRLGVQKVALCKYTAQ-MVVAGTAGQVLVLELSDVPVEQAVSVAIIDLLQDREGFTWKGHERLSPRTGPLPWPAGFQPRVLVQCLPPAAVTAVTLHTE-----WSLVAFGTSHGFGLFDYQRKSPVLA-----RCTLHPNDSLAM------EGPLSRVKSLKKSLRQSFRRIRKSRVSGKKRAANASSKLQEANAQLAEQACPHDVEMTPVQRRIEPRSADDSLSGVVRCLYFADTFLRDGAHHGP-----TMWAGTNSGSVFAYALEVPAAAVGGEKRPEQAVEAVLGKEVQLMHRAPVVAIAVLDGRG--RPLPEPYEASRDLAQAPDMQGGHAVLIASEEQFKVFTLPKVSAKTKFKLTAHEGCRVRKVALATFAS--VACEDYAETCLACLTNLG 885          
BLAST of Protein lethal(2) giant larvae vs. Ensembl Human
Match: LLGL1 (LLGL scribble cell polarity complex component 1 [Source:HGNC Symbol;Acc:HGNC:6628])

HSP 1 Score: 185.652 bits (470), Expect = 3.693e-47
Identity = 185/741 (24.97%), Postives = 327/741 (44.13%), Query Frame = 1
Query:  850 LLIGYRSGNSIIYNVQKDSVDFLLSAKSTLNALSWCPPDPIVQDNFMVAPNRNEPQYYSSMKLHSCHEDGSIITWNLPQNSDEFLVLDFQIFSPYKKDQKCLPISKILWKRYKQD-YLIVFSGGLPRSDYMTKSTITIMNNSCLDSSKANNEHLVLDLTSQLIDFTTI----DDNDSGSVEYLLVLTEEEFFIVDLTKESWPILHDRQPYLNCLHNSPITAYQFLSEVKSDWFQKLNEMSSNKEDCNISFS-DWPIKGYAQKVRN--DEIWQNDLLIIGHGDGTIVFWKFGMGGCMKKISTVKSSSLFKMADELHLNEVS--YEDDEIPLRRTGQFDPCCDDNRLAIQ---LIHYTGKHLLIGGYGGQIVLWGFQENKYEK--HLLDVDLTTHLSNFKWKGCQPFQHIEGSIKTGSNFQVMMSMCIFPPSQITALDILEDNNCNGYVIIACGTLHGLVIVSCPKETNLEALVLTTHCTV-PRNTLASQEASLGEGWARRRTXXXXXXXXXXXXXXXXXXXXXMEHPSVSRHLSDNNDKTMRXXXXXXXXXXXXXXXXD-RPKDTANDGLIRSIRINVSLIKRKGSNGPHEKLLNLFAGCYGGLLLWFQSDYSVENI----LKNSPINLRLIKQYQFQHRAPILHFNMLSPESGLSKLNENPDAGFDL--DPNRKPDHLVVL-TEEQVRLYAFPSFTLKCKIRVTAHDGFRLKNGSLIVFSDDRLTTQNNTKEPLICATNNG 3000
            +LIGY  G  +I+N     VD +      L +L W                R+      S  + S H DGS   W++  ++  F  L   + +       C  I+KILW+  +   + I+FSGG+PR+ Y  +  ++++    L         + LD TS++IDF T+     +++    + L VL EEE  ++DL    WP +    PYL  LH+S IT    ++ V +  + ++      +    +S +  WPI G     RN   E  Q  LL+ GH DGT+ FW    G  ++ +  + ++ LF+  D  H + ++   EDD  P R+ G FDP  DD RL +Q   L  YT + +++ G  GQ+++    +   E+   +  +DL      F WKG +      G +   + FQ  + +   PP+ +TA+ +  +     + ++A GT HG  +    +++ + A      CT+ P ++LA       EG   R     K   +S  R  + R + +    + S  L + N +        +      +   + R  D +  G++R +    + ++    +GP      ++AG   G +  +  +     +         +   L K+ Q  HRAP++   +L        L E  +A  DL   P+ +  H V++ +EEQ +++  P  + K K ++TAH+G R++  +L  F+   +  ++  +  L C TN G
Sbjct:  211 ILIGYSRGLLVIWNQASQCVDHIFLGNQQLESLCW---------------GRD------SSTVVSSHSDGSYAVWSV--DAGSFPTLQPTVATTPYGPFPCKAINKILWRNCESGGHFIIFSGGMPRASYGDRHCVSVLRAETL---------VTLDFTSRIIDFFTVHSTRPEDEFDDPQALAVLLEEELVVLDLQTPGWPAVP--APYLAPLHSSAITCSAHVASVPAKLWARIVSAGEQQSPQPVSSALSWPITGG----RNLAQEPSQRGLLLTGHEDGTVRFWD-ASGVALRPLYKLSTAGLFQT-DCEHADSLAQAAEDDWPPFRKVGCFDPYSDDPRLGVQKVALCKYTAQ-MVVAGTAGQVLVLELSDVPVEQAVSVAIIDLLQDREGFTWKGHERLSPRTGPLPWPAGFQPRVLVQCLPPAAVTAVTLHTE-----WSLVAFGTSHGFGLFDYQRKSPVLA-----RCTLHPNDSLAM------EGPLSRVKSLKKSLRQSFRRIRKSRVSGKKRAANASSKLQEANAQLAEQACPHDVEMTPVQRRIEPRSADDSLSGVVRCLYFADTFLRDGAHHGP-----TMWAGTNSGSVFAYALEVPAAAVGGEKRPEQAVEAVLGKEVQLMHRAPVVAIAVLDGRG--RPLPEPYEASRDLAQAPDMQGGHAVLIASEEQFKVFTLPKVSAKTKFKLTAHEGCRVRKVALATFAS--VACEDYAETCLACLTNLG 885          
BLAST of Protein lethal(2) giant larvae vs. Ensembl Celegans
Match: tom-1 (TOMosyn synaptic protein [Source:UniProtKB/TrEMBL;Acc:A0A0K3AWL6])

HSP 1 Score: 95.1301 bits (235), Expect = 1.977e-19
Identity = 90/390 (23.08%), Postives = 167/390 (42.82%), Query Frame = 1
Query:  793 RVIIDAVIHISARPGSRKHLLIGYRSGNSIIYNVQKDSVDFLLSAKSTLNALSWCPPDPIVQDNFMVAPNRNEPQYYSSMKLHSCHEDGSIITWNLPQNSDEFLVLDFQIFSPYKKDQKCLPISKILWKRYKQ-DYLIVFSGGLPRSDYMTKSTITIMNNSCLDSSKANNEHLVLDLTSQLIDFTTIDDNDSGSV----EYLLVLTEEEFFIVDLTKESWPILHDRQPYLNCLHNSPITAYQFLSEVKSDWFQKLNEMSSNKEDCNISFSDWPIKGYAQKVRNDEIWQNDLLIIGHGDGTIVFWKFGMGGCMKKISTVKSSSLFKMADELHL-NEVSYEDDEIPLRRTGQFDPCCDDNRLAIQLIHYTGKHLLIGGYGGQIVLWGFQENK 1944
            RV    V  ++  P     LLI Y  G  + +N+    VD               P DP         P ++   ++   ++ + + DGSI  +N  ++++       Q  +P+     C PI ++ WK   + + +I+FSGG+P  D +    +TI+        K      VL++   +I F  ++ N   S+      + VL + +F ++DL +   P++    P+   +H SP+T   + S+   D    L  + + + +   S   WP+ G     R       +L++ GH DG++ FW+   G  ++ +  +KSSS F+  +E+   ++VS+    I L         C ++R            LL+ G  GQ+ L+ F + +
Sbjct:  181 RVHPGPVRQLAVSPAENTKLLIVYDKGIVVQWNLGTREVDRY-------------PLDP---------PIKSVNWHFDGRQILTGNVDGSISLYNHKKSTEAI-----QRTTPHGSG-PCRPIQQVEWKHMSETESIIMFSGGMPTDDGLPMPALTIL--------KGGKSATVLEMDWPIIQFIPLNQNIWNSIPQCPHSVAVLLKHDFMVLDLNQNGHPVIES--PHAMNIHESPVTCMAYYSDCPLDLIGALTLVGTKQRNKEFSARSWPVTGGLG--RECATGHQELVVTGHKDGSLKFWQ-ETGEHLQILYKLKSSSHFERLEEMETSDKVSHAVKYIEL---------CLESR-----------QLLVAGISGQVTLFRFTKQE 509          
BLAST of Protein lethal(2) giant larvae vs. Ensembl Celegans
Match: tom-1 (TOMosyn synaptic protein [Source:UniProtKB/TrEMBL;Acc:A0A0K3AWL6])

HSP 1 Score: 95.1301 bits (235), Expect = 2.058e-19
Identity = 90/390 (23.08%), Postives = 167/390 (42.82%), Query Frame = 1
Query:  793 RVIIDAVIHISARPGSRKHLLIGYRSGNSIIYNVQKDSVDFLLSAKSTLNALSWCPPDPIVQDNFMVAPNRNEPQYYSSMKLHSCHEDGSIITWNLPQNSDEFLVLDFQIFSPYKKDQKCLPISKILWKRYKQ-DYLIVFSGGLPRSDYMTKSTITIMNNSCLDSSKANNEHLVLDLTSQLIDFTTIDDNDSGSV----EYLLVLTEEEFFIVDLTKESWPILHDRQPYLNCLHNSPITAYQFLSEVKSDWFQKLNEMSSNKEDCNISFSDWPIKGYAQKVRNDEIWQNDLLIIGHGDGTIVFWKFGMGGCMKKISTVKSSSLFKMADELHL-NEVSYEDDEIPLRRTGQFDPCCDDNRLAIQLIHYTGKHLLIGGYGGQIVLWGFQENK 1944
            RV    V  ++  P     LLI Y  G  + +N+    VD               P DP         P ++   ++   ++ + + DGSI  +N  ++++       Q  +P+     C PI ++ WK   + + +I+FSGG+P  D +    +TI+        K      VL++   +I F  ++ N   S+      + VL + +F ++DL +   P++    P+   +H SP+T   + S+   D    L  + + + +   S   WP+ G     R       +L++ GH DG++ FW+   G  ++ +  +KSSS F+  +E+   ++VS+    I L         C ++R            LL+ G  GQ+ L+ F + +
Sbjct:  181 RVHPGPVRQLAVSPAENTKLLIVYDKGIVVQWNLGTREVDRY-------------PLDP---------PIKSVNWHFDGRQILTGNVDGSISLYNHKKSTEAI-----QRTTPHGSG-PCRPIQQVEWKHMSETESIIMFSGGMPTDDGLPMPALTIL--------KGGKSATVLEMDWPIIQFIPLNQNIWNSIPQCPHSVAVLLKHDFMVLDLNQNGHPVIES--PHAMNIHESPVTCMAYYSDCPLDLIGALTLVGTKQRNKEFSARSWPVTGGLG--RECATGHQELVVTGHKDGSLKFWQ-ETGEHLQILYKLKSSSHFERLEEMETSDKVSHAVKYIEL---------CLESR-----------QLLVAGISGQVTLFRFTKQE 509          
BLAST of Protein lethal(2) giant larvae vs. Ensembl Celegans
Match: tom-1 (TOMosyn synaptic protein [Source:UniProtKB/TrEMBL;Acc:A0A0K3AWL6])

HSP 1 Score: 95.1301 bits (235), Expect = 2.089e-19
Identity = 90/390 (23.08%), Postives = 167/390 (42.82%), Query Frame = 1
Query:  793 RVIIDAVIHISARPGSRKHLLIGYRSGNSIIYNVQKDSVDFLLSAKSTLNALSWCPPDPIVQDNFMVAPNRNEPQYYSSMKLHSCHEDGSIITWNLPQNSDEFLVLDFQIFSPYKKDQKCLPISKILWKRYKQ-DYLIVFSGGLPRSDYMTKSTITIMNNSCLDSSKANNEHLVLDLTSQLIDFTTIDDNDSGSV----EYLLVLTEEEFFIVDLTKESWPILHDRQPYLNCLHNSPITAYQFLSEVKSDWFQKLNEMSSNKEDCNISFSDWPIKGYAQKVRNDEIWQNDLLIIGHGDGTIVFWKFGMGGCMKKISTVKSSSLFKMADELHL-NEVSYEDDEIPLRRTGQFDPCCDDNRLAIQLIHYTGKHLLIGGYGGQIVLWGFQENK 1944
            RV    V  ++  P     LLI Y  G  + +N+    VD               P DP         P ++   ++   ++ + + DGSI  +N  ++++       Q  +P+     C PI ++ WK   + + +I+FSGG+P  D +    +TI+        K      VL++   +I F  ++ N   S+      + VL + +F ++DL +   P++    P+   +H SP+T   + S+   D    L  + + + +   S   WP+ G     R       +L++ GH DG++ FW+   G  ++ +  +KSSS F+  +E+   ++VS+    I L         C ++R            LL+ G  GQ+ L+ F + +
Sbjct:  181 RVHPGPVRQLAVSPAENTKLLIVYDKGIVVQWNLGTREVDRY-------------PLDP---------PIKSVNWHFDGRQILTGNVDGSISLYNHKKSTEAI-----QRTTPHGSG-PCRPIQQVEWKHMSETESIIMFSGGMPTDDGLPMPALTIL--------KGGKSATVLEMDWPIIQFIPLNQNIWNSIPQCPHSVAVLLKHDFMVLDLNQNGHPVIES--PHAMNIHESPVTCMAYYSDCPLDLIGALTLVGTKQRNKEFSARSWPVTGGLG--RECATGHQELVVTGHKDGSLKFWQ-ETGEHLQILYKLKSSSHFERLEEMETSDKVSHAVKYIEL---------CLESR-----------QLLVAGISGQVTLFRFTKQE 509          
BLAST of Protein lethal(2) giant larvae vs. Ensembl Celegans
Match: tom-1 (TOMosyn synaptic protein [Source:UniProtKB/TrEMBL;Acc:A0A0K3AWL6])

HSP 1 Score: 94.7449 bits (234), Expect = 2.569e-19
Identity = 90/390 (23.08%), Postives = 167/390 (42.82%), Query Frame = 1
Query:  793 RVIIDAVIHISARPGSRKHLLIGYRSGNSIIYNVQKDSVDFLLSAKSTLNALSWCPPDPIVQDNFMVAPNRNEPQYYSSMKLHSCHEDGSIITWNLPQNSDEFLVLDFQIFSPYKKDQKCLPISKILWKRYKQ-DYLIVFSGGLPRSDYMTKSTITIMNNSCLDSSKANNEHLVLDLTSQLIDFTTIDDNDSGSV----EYLLVLTEEEFFIVDLTKESWPILHDRQPYLNCLHNSPITAYQFLSEVKSDWFQKLNEMSSNKEDCNISFSDWPIKGYAQKVRNDEIWQNDLLIIGHGDGTIVFWKFGMGGCMKKISTVKSSSLFKMADELHL-NEVSYEDDEIPLRRTGQFDPCCDDNRLAIQLIHYTGKHLLIGGYGGQIVLWGFQENK 1944
            RV    V  ++  P     LLI Y  G  + +N+    VD               P DP         P ++   ++   ++ + + DGSI  +N  ++++       Q  +P+     C PI ++ WK   + + +I+FSGG+P  D +    +TI+        K      VL++   +I F  ++ N   S+      + VL + +F ++DL +   P++    P+   +H SP+T   + S+   D    L  + + + +   S   WP+ G     R       +L++ GH DG++ FW+   G  ++ +  +KSSS F+  +E+   ++VS+    I L         C ++R            LL+ G  GQ+ L+ F + +
Sbjct:  181 RVHPGPVRQLAVSPAENTKLLIVYDKGIVVQWNLGTREVDRY-------------PLDP---------PIKSVNWHFDGRQILTGNVDGSISLYNHKKSTEAI-----QRTTPHGSG-PCRPIQQVEWKHMSETESIIMFSGGMPTDDGLPMPALTIL--------KGGKSATVLEMDWPIIQFIPLNQNIWNSIPQCPHSVAVLLKHDFMVLDLNQNGHPVIES--PHAMNIHESPVTCMAYYSDCPLDLIGALTLVGTKQRNKEFSARSWPVTGGLG--RECATGHQELVVTGHKDGSLKFWQ-ETGEHLQILYKLKSSSHFERLEEMETSDKVSHAVKYIEL---------CLESR-----------QLLVAGISGQVTLFRFTKQE 509          
BLAST of Protein lethal(2) giant larvae vs. Ensembl Celegans
Match: tom-1 (TOMosyn synaptic protein [Source:UniProtKB/TrEMBL;Acc:A0A0K3AWL6])

HSP 1 Score: 94.7449 bits (234), Expect = 2.662e-19
Identity = 90/390 (23.08%), Postives = 167/390 (42.82%), Query Frame = 1
Query:  793 RVIIDAVIHISARPGSRKHLLIGYRSGNSIIYNVQKDSVDFLLSAKSTLNALSWCPPDPIVQDNFMVAPNRNEPQYYSSMKLHSCHEDGSIITWNLPQNSDEFLVLDFQIFSPYKKDQKCLPISKILWKRYKQ-DYLIVFSGGLPRSDYMTKSTITIMNNSCLDSSKANNEHLVLDLTSQLIDFTTIDDNDSGSV----EYLLVLTEEEFFIVDLTKESWPILHDRQPYLNCLHNSPITAYQFLSEVKSDWFQKLNEMSSNKEDCNISFSDWPIKGYAQKVRNDEIWQNDLLIIGHGDGTIVFWKFGMGGCMKKISTVKSSSLFKMADELHL-NEVSYEDDEIPLRRTGQFDPCCDDNRLAIQLIHYTGKHLLIGGYGGQIVLWGFQENK 1944
            RV    V  ++  P     LLI Y  G  + +N+    VD               P DP         P ++   ++   ++ + + DGSI  +N  ++++       Q  +P+     C PI ++ WK   + + +I+FSGG+P  D +    +TI+        K      VL++   +I F  ++ N   S+      + VL + +F ++DL +   P++    P+   +H SP+T   + S+   D    L  + + + +   S   WP+ G     R       +L++ GH DG++ FW+   G  ++ +  +KSSS F+  +E+   ++VS+    I L         C ++R            LL+ G  GQ+ L+ F + +
Sbjct:  181 RVHPGPVRQLAVSPAENTKLLIVYDKGIVVQWNLGTREVDRY-------------PLDP---------PIKSVNWHFDGRQILTGNVDGSISLYNHKKSTEAI-----QRTTPHGSG-PCRPIQQVEWKHMSETESIIMFSGGMPTDDGLPMPALTIL--------KGGKSATVLEMDWPIIQFIPLNQNIWNSIPQCPHSVAVLLKHDFMVLDLNQNGHPVIES--PHAMNIHESPVTCMAYYSDCPLDLIGALTLVGTKQRNKEFSARSWPVTGGLG--RECATGHQELVVTGHKDGSLKFWQ-ETGEHLQILYKLKSSSHFERLEEMETSDKVSHAVKYIEL---------CLESR-----------QLLVAGISGQVTLFRFTKQE 509          
BLAST of Protein lethal(2) giant larvae vs. Ensembl Fly
Match: l(2)gl (gene:FBgn0002121 transcript:FBtr0330655)

HSP 1 Score: 142.124 bits (357), Expect = 8.378e-34
Identity = 146/566 (25.80%), Postives = 246/566 (43.46%), Query Frame = 1
Query:  706 GNTIWQM-----PTKSDVIDRDRIISKLPIGSQNRVIIDAVIHISARPGSRKHLLIGYRSGNSIIYNVQKDSVDFLLSAKSTLNALSWCPPDPIVQDNFMVAPNRNEPQYYSSMKLHSCHEDGSIITWNL-----PQNSDEFLVLDFQIFSPYKKDQKCLPISKILWKRYKQDYLIVFSGGLPRSDYMTKSTITIMNNSCLDSSKANNEHLVLDLTSQLIDFTTIDDNDSGSVEYLLVLTEEEFFIVDLTKESWPILHDRQPYLNCLHNSPITAYQFLSEVKSDWFQKLNEMSSNKEDCNISFSDWPIKG------YAQKVRNDEIWQNDLLIIGHGDGTIVFWKFGMGGCMKKISTVKSSSLFKMADELH------LNEVSYEDDEIPLRRTGQFDPCCDDNRLAIQLIHYTGK--HLLIGGYGGQIVLWGFQE--NKYEKHLLDVDLTTHLSNFKWKGCQPFQ------HIEGSIKTGSNFQVMMSMCIFPPSQITALDILEDNNCNGYVIIACGTLHGLVIVSCPKETNLEALVLTTH-CTVPRNTLASQEASLGEGWARRRT 2304
            G  I+Q+       K  VI  D ++ ++P     ++   A+  I   P S   LL+ Y  G  ++++ +  SV             ++  P         V    +E  +Y        H DGS  TW++     P N +         + PY  D  C  I+++   + + + +IVFSGG+PRS Y         +++C+    ++   + LD TS++IDF    +N+    E L+VL EEE    DLT  +  I   + PYL+ +H S +T     SEV    ++ +   + +++D + S   WPI G        + V  D     ++L+ GH DG++ FW    G  +K I   K+SS+F    +        ++    ++ E P R++G FDP  DD RLA++ I +  K   L++GG  GQIV+  F +   K     + ++L +    F WKG             E    T     +   + + PP+ IT + +        + +++ GT HGLV+       + +  V   H CT+  N L       GE  +RR++
Sbjct:  149 GGNIYQLDLHTFTIKEPVIYHDVVLEQVP--PAYKLNPGAIESIRQLPNSPSKLLVAYNRGLCVLWDFESASVQ-----------RAYIAPGHGQSVGLTVNFEGSEFTWY--------HADGSYATWSIDNPEPPSNVN---------YVPYGPD-PCKSINRLYKGKRRSNDVIVFSGGMPRSAYG--------DHNCVSVHASDGHKVCLDFTSKVIDFFVTFENNRDVAEVLVVLLEEELCAYDLTDPN--ICAIKAPYLHSVHASAVTCNYLASEVVQSVYESILR-AGDEQDIDYSNISWPITGGTLPDNLEESVEEDATKLYEILLTGHEDGSVKFWDC-TGVLLKPIYNFKTSSIFGSESDFRDDAAADMSAEQVDEGEPPFRKSGLFDPYSDDPRLAVKKIAFCPKTGQLIVGGTAGQIVIADFIDLPEKVSLKYISMNLVSDRDGFVWKGHDQLNVRSNLLDGEAIPTTERGVNISGVLQVLPPASITCMALEAS-----WGLVSGGTAHGLVLF------DFKNFVPVFHRCTLNPNDLTGA----GEQLSRRKS 656          
BLAST of Protein lethal(2) giant larvae vs. Ensembl Fly
Match: l(2)gl (gene:FBgn0002121 transcript:FBtr0306592)

HSP 1 Score: 142.124 bits (357), Expect = 8.947e-34
Identity = 146/566 (25.80%), Postives = 246/566 (43.46%), Query Frame = 1
Query:  706 GNTIWQM-----PTKSDVIDRDRIISKLPIGSQNRVIIDAVIHISARPGSRKHLLIGYRSGNSIIYNVQKDSVDFLLSAKSTLNALSWCPPDPIVQDNFMVAPNRNEPQYYSSMKLHSCHEDGSIITWNL-----PQNSDEFLVLDFQIFSPYKKDQKCLPISKILWKRYKQDYLIVFSGGLPRSDYMTKSTITIMNNSCLDSSKANNEHLVLDLTSQLIDFTTIDDNDSGSVEYLLVLTEEEFFIVDLTKESWPILHDRQPYLNCLHNSPITAYQFLSEVKSDWFQKLNEMSSNKEDCNISFSDWPIKG------YAQKVRNDEIWQNDLLIIGHGDGTIVFWKFGMGGCMKKISTVKSSSLFKMADELH------LNEVSYEDDEIPLRRTGQFDPCCDDNRLAIQLIHYTGK--HLLIGGYGGQIVLWGFQE--NKYEKHLLDVDLTTHLSNFKWKGCQPFQ------HIEGSIKTGSNFQVMMSMCIFPPSQITALDILEDNNCNGYVIIACGTLHGLVIVSCPKETNLEALVLTTH-CTVPRNTLASQEASLGEGWARRRT 2304
            G  I+Q+       K  VI  D ++ ++P     ++   A+  I   P S   LL+ Y  G  ++++ +  SV             ++  P         V    +E  +Y        H DGS  TW++     P N +         + PY  D  C  I+++   + + + +IVFSGG+PRS Y         +++C+    ++   + LD TS++IDF    +N+    E L+VL EEE    DLT  +  I   + PYL+ +H S +T     SEV    ++ +   + +++D + S   WPI G        + V  D     ++L+ GH DG++ FW    G  +K I   K+SS+F    +        ++    ++ E P R++G FDP  DD RLA++ I +  K   L++GG  GQIV+  F +   K     + ++L +    F WKG             E    T     +   + + PP+ IT + +        + +++ GT HGLV+       + +  V   H CT+  N L       GE  +RR++
Sbjct:  149 GGNIYQLDLHTFTIKEPVIYHDVVLEQVP--PAYKLNPGAIESIRQLPNSPSKLLVAYNRGLCVLWDFESASVQ-----------RAYIAPGHGQSVGLTVNFEGSEFTWY--------HADGSYATWSIDNPEPPSNVN---------YVPYGPD-PCKSINRLYKGKRRSNDVIVFSGGMPRSAYG--------DHNCVSVHASDGHKVCLDFTSKVIDFFVTFENNRDVAEVLVVLLEEELCAYDLTDPN--ICAIKAPYLHSVHASAVTCNYLASEVVQSVYESILR-AGDEQDIDYSNISWPITGGTLPDNLEESVEEDATKLYEILLTGHEDGSVKFWDC-TGVLLKPIYNFKTSSIFGSESDFRDDAAADMSAEQVDEGEPPFRKSGLFDPYSDDPRLAVKKIAFCPKTGQLIVGGTAGQIVIADFIDLPEKVSLKYISMNLVSDRDGFVWKGHDQLNVRSNLLDGEAIPTTERGVNISGVLQVLPPASITCMALEAS-----WGLVSGGTAHGLVLF------DFKNFVPVFHRCTLNPNDLTGA----GEQLSRRKS 656          
BLAST of Protein lethal(2) giant larvae vs. Ensembl Fly
Match: l(2)gl (gene:FBgn0002121 transcript:FBtr0306590)

HSP 1 Score: 142.124 bits (357), Expect = 8.947e-34
Identity = 146/566 (25.80%), Postives = 246/566 (43.46%), Query Frame = 1
Query:  706 GNTIWQM-----PTKSDVIDRDRIISKLPIGSQNRVIIDAVIHISARPGSRKHLLIGYRSGNSIIYNVQKDSVDFLLSAKSTLNALSWCPPDPIVQDNFMVAPNRNEPQYYSSMKLHSCHEDGSIITWNL-----PQNSDEFLVLDFQIFSPYKKDQKCLPISKILWKRYKQDYLIVFSGGLPRSDYMTKSTITIMNNSCLDSSKANNEHLVLDLTSQLIDFTTIDDNDSGSVEYLLVLTEEEFFIVDLTKESWPILHDRQPYLNCLHNSPITAYQFLSEVKSDWFQKLNEMSSNKEDCNISFSDWPIKG------YAQKVRNDEIWQNDLLIIGHGDGTIVFWKFGMGGCMKKISTVKSSSLFKMADELH------LNEVSYEDDEIPLRRTGQFDPCCDDNRLAIQLIHYTGK--HLLIGGYGGQIVLWGFQE--NKYEKHLLDVDLTTHLSNFKWKGCQPFQ------HIEGSIKTGSNFQVMMSMCIFPPSQITALDILEDNNCNGYVIIACGTLHGLVIVSCPKETNLEALVLTTH-CTVPRNTLASQEASLGEGWARRRT 2304
            G  I+Q+       K  VI  D ++ ++P     ++   A+  I   P S   LL+ Y  G  ++++ +  SV             ++  P         V    +E  +Y        H DGS  TW++     P N +         + PY  D  C  I+++   + + + +IVFSGG+PRS Y         +++C+    ++   + LD TS++IDF    +N+    E L+VL EEE    DLT  +  I   + PYL+ +H S +T     SEV    ++ +   + +++D + S   WPI G        + V  D     ++L+ GH DG++ FW    G  +K I   K+SS+F    +        ++    ++ E P R++G FDP  DD RLA++ I +  K   L++GG  GQIV+  F +   K     + ++L +    F WKG             E    T     +   + + PP+ IT + +        + +++ GT HGLV+       + +  V   H CT+  N L       GE  +RR++
Sbjct:  149 GGNIYQLDLHTFTIKEPVIYHDVVLEQVP--PAYKLNPGAIESIRQLPNSPSKLLVAYNRGLCVLWDFESASVQ-----------RAYIAPGHGQSVGLTVNFEGSEFTWY--------HADGSYATWSIDNPEPPSNVN---------YVPYGPD-PCKSINRLYKGKRRSNDVIVFSGGMPRSAYG--------DHNCVSVHASDGHKVCLDFTSKVIDFFVTFENNRDVAEVLVVLLEEELCAYDLTDPN--ICAIKAPYLHSVHASAVTCNYLASEVVQSVYESILR-AGDEQDIDYSNISWPITGGTLPDNLEESVEEDATKLYEILLTGHEDGSVKFWDC-TGVLLKPIYNFKTSSIFGSESDFRDDAAADMSAEQVDEGEPPFRKSGLFDPYSDDPRLAVKKIAFCPKTGQLIVGGTAGQIVIADFIDLPEKVSLKYISMNLVSDRDGFVWKGHDQLNVRSNLLDGEAIPTTERGVNISGVLQVLPPASITCMALEAS-----WGLVSGGTAHGLVLF------DFKNFVPVFHRCTLNPNDLTGA----GEQLSRRKS 656          
BLAST of Protein lethal(2) giant larvae vs. Ensembl Fly
Match: l(2)gl (gene:FBgn0002121 transcript:FBtr0306589)

HSP 1 Score: 142.124 bits (357), Expect = 8.947e-34
Identity = 146/566 (25.80%), Postives = 246/566 (43.46%), Query Frame = 1
Query:  706 GNTIWQM-----PTKSDVIDRDRIISKLPIGSQNRVIIDAVIHISARPGSRKHLLIGYRSGNSIIYNVQKDSVDFLLSAKSTLNALSWCPPDPIVQDNFMVAPNRNEPQYYSSMKLHSCHEDGSIITWNL-----PQNSDEFLVLDFQIFSPYKKDQKCLPISKILWKRYKQDYLIVFSGGLPRSDYMTKSTITIMNNSCLDSSKANNEHLVLDLTSQLIDFTTIDDNDSGSVEYLLVLTEEEFFIVDLTKESWPILHDRQPYLNCLHNSPITAYQFLSEVKSDWFQKLNEMSSNKEDCNISFSDWPIKG------YAQKVRNDEIWQNDLLIIGHGDGTIVFWKFGMGGCMKKISTVKSSSLFKMADELH------LNEVSYEDDEIPLRRTGQFDPCCDDNRLAIQLIHYTGK--HLLIGGYGGQIVLWGFQE--NKYEKHLLDVDLTTHLSNFKWKGCQPFQ------HIEGSIKTGSNFQVMMSMCIFPPSQITALDILEDNNCNGYVIIACGTLHGLVIVSCPKETNLEALVLTTH-CTVPRNTLASQEASLGEGWARRRT 2304
            G  I+Q+       K  VI  D ++ ++P     ++   A+  I   P S   LL+ Y  G  ++++ +  SV             ++  P         V    +E  +Y        H DGS  TW++     P N +         + PY  D  C  I+++   + + + +IVFSGG+PRS Y         +++C+    ++   + LD TS++IDF    +N+    E L+VL EEE    DLT  +  I   + PYL+ +H S +T     SEV    ++ +   + +++D + S   WPI G        + V  D     ++L+ GH DG++ FW    G  +K I   K+SS+F    +        ++    ++ E P R++G FDP  DD RLA++ I +  K   L++GG  GQIV+  F +   K     + ++L +    F WKG             E    T     +   + + PP+ IT + +        + +++ GT HGLV+       + +  V   H CT+  N L       GE  +RR++
Sbjct:  149 GGNIYQLDLHTFTIKEPVIYHDVVLEQVP--PAYKLNPGAIESIRQLPNSPSKLLVAYNRGLCVLWDFESASVQ-----------RAYIAPGHGQSVGLTVNFEGSEFTWY--------HADGSYATWSIDNPEPPSNVN---------YVPYGPD-PCKSINRLYKGKRRSNDVIVFSGGMPRSAYG--------DHNCVSVHASDGHKVCLDFTSKVIDFFVTFENNRDVAEVLVVLLEEELCAYDLTDPN--ICAIKAPYLHSVHASAVTCNYLASEVVQSVYESILR-AGDEQDIDYSNISWPITGGTLPDNLEESVEEDATKLYEILLTGHEDGSVKFWDC-TGVLLKPIYNFKTSSIFGSESDFRDDAAADMSAEQVDEGEPPFRKSGLFDPYSDDPRLAVKKIAFCPKTGQLIVGGTAGQIVIADFIDLPEKVSLKYISMNLVSDRDGFVWKGHDQLNVRSNLLDGEAIPTTERGVNISGVLQVLPPASITCMALEAS-----WGLVSGGTAHGLVLF------DFKNFVPVFHRCTLNPNDLTGA----GEQLSRRKS 656          
BLAST of Protein lethal(2) giant larvae vs. Ensembl Fly
Match: l(2)gl (gene:FBgn0002121 transcript:FBtr0306591)

HSP 1 Score: 142.124 bits (357), Expect = 8.947e-34
Identity = 146/566 (25.80%), Postives = 246/566 (43.46%), Query Frame = 1
Query:  706 GNTIWQM-----PTKSDVIDRDRIISKLPIGSQNRVIIDAVIHISARPGSRKHLLIGYRSGNSIIYNVQKDSVDFLLSAKSTLNALSWCPPDPIVQDNFMVAPNRNEPQYYSSMKLHSCHEDGSIITWNL-----PQNSDEFLVLDFQIFSPYKKDQKCLPISKILWKRYKQDYLIVFSGGLPRSDYMTKSTITIMNNSCLDSSKANNEHLVLDLTSQLIDFTTIDDNDSGSVEYLLVLTEEEFFIVDLTKESWPILHDRQPYLNCLHNSPITAYQFLSEVKSDWFQKLNEMSSNKEDCNISFSDWPIKG------YAQKVRNDEIWQNDLLIIGHGDGTIVFWKFGMGGCMKKISTVKSSSLFKMADELH------LNEVSYEDDEIPLRRTGQFDPCCDDNRLAIQLIHYTGK--HLLIGGYGGQIVLWGFQE--NKYEKHLLDVDLTTHLSNFKWKGCQPFQ------HIEGSIKTGSNFQVMMSMCIFPPSQITALDILEDNNCNGYVIIACGTLHGLVIVSCPKETNLEALVLTTH-CTVPRNTLASQEASLGEGWARRRT 2304
            G  I+Q+       K  VI  D ++ ++P     ++   A+  I   P S   LL+ Y  G  ++++ +  SV             ++  P         V    +E  +Y        H DGS  TW++     P N +         + PY  D  C  I+++   + + + +IVFSGG+PRS Y         +++C+    ++   + LD TS++IDF    +N+    E L+VL EEE    DLT  +  I   + PYL+ +H S +T     SEV    ++ +   + +++D + S   WPI G        + V  D     ++L+ GH DG++ FW    G  +K I   K+SS+F    +        ++    ++ E P R++G FDP  DD RLA++ I +  K   L++GG  GQIV+  F +   K     + ++L +    F WKG             E    T     +   + + PP+ IT + +        + +++ GT HGLV+       + +  V   H CT+  N L       GE  +RR++
Sbjct:  149 GGNIYQLDLHTFTIKEPVIYHDVVLEQVP--PAYKLNPGAIESIRQLPNSPSKLLVAYNRGLCVLWDFESASVQ-----------RAYIAPGHGQSVGLTVNFEGSEFTWY--------HADGSYATWSIDNPEPPSNVN---------YVPYGPD-PCKSINRLYKGKRRSNDVIVFSGGMPRSAYG--------DHNCVSVHASDGHKVCLDFTSKVIDFFVTFENNRDVAEVLVVLLEEELCAYDLTDPN--ICAIKAPYLHSVHASAVTCNYLASEVVQSVYESILR-AGDEQDIDYSNISWPITGGTLPDNLEESVEEDATKLYEILLTGHEDGSVKFWDC-TGVLLKPIYNFKTSSIFGSESDFRDDAAADMSAEQVDEGEPPFRKSGLFDPYSDDPRLAVKKIAFCPKTGQLIVGGTAGQIVIADFIDLPEKVSLKYISMNLVSDRDGFVWKGHDQLNVRSNLLDGEAIPTTERGVNISGVLQVLPPASITCMALEAS-----WGLVSGGTAHGLVLF------DFKNFVPVFHRCTLNPNDLTGA----GEQLSRRKS 656          
BLAST of Protein lethal(2) giant larvae vs. Ensembl Zebrafish
Match: llgl1 (LLGL scribble cell polarity complex component 1 [Source:ZFIN;Acc:ZDB-GENE-060825-69])

HSP 1 Score: 236.884 bits (603), Expect = 7.451e-64
Identity = 244/955 (25.55%), Postives = 421/955 (44.08%), Query Frame = 1
Query:  238 EPSCIDYDHKLSLLGIASKKGLIKIFGCPGVCYSTRLEGQDEIWNIKFIPGTNFFVTLTADNKLILWLISTLTNELFKVDVISNLNVVNSARTSAHXXXXXXXXXXXXXXXXXTAIEVNDLTSSIIMGNGSGSLIQVKLDLLKMRKQANNYKTVPPGNTIWQMPTKS---DVIDRDRIISKLPIGSQNRVIIDAVIHISARPGSRKHLLIGYRSGNSIIYNVQKDSVDFLLSAKSTLNALSWCPPDPIVQDNFMVAPNRNEPQYYSSMKLHSCHEDGSIITWNL----PQNSDEFLVLDFQIFSPYKKDQKCLPISKILWKRYKQDY-LIVFSGGLPRSDYMTKSTITIMNNSCLDSSKANNEHLVLDLTSQLIDFTTID----DNDSGSVEYLLVLTEEEFFIVDLTKESWPILHDRQPYLNCLHNSPITAYQFLSEVKSDWFQKLNEMSSNKEDCNI-SFSDWPIKGYAQKVRNDEIWQNDLLIIGHGDGTIVFWKFGMGGCMKKISTVKSSSLFKMADELHLNEVSYEDDE--IPLRRTGQFDPCCDDNRLAIQ---LIHYTGKHLLIGGYGGQIVLWGFQENKYEKHLLDV---DLTTHLSNFKWKGCQPFQHIEGSIKTGSNFQVMMSMCIFPPSQITALDILEDNNCNGYVIIACGTLHGLVIVSCPKETNLEALVLTTHCTV-PRNTLA---------SQEASLGEGWARRRTXXXXXXXXXXXXXXXXXXXXXMEHPSVSRHLSDNNDKTMRXXXXXXXXXXXXXXXXDRPKDTANDGLIRSIRINVSLIKRKGSNGPHEKLLNLFAGCYGGLLLWFQSDYSVENILKNSPINLRLIKQYQFQHRAPILHFNMLSPESGLSKLNENPDAGFDL--DPNRKPDHLVVL-TEEQVRLYAFPSFTLKCKIRVTAHDGFRLKNGSLIVFSDDRLTTQNNTKEPLICATNNG 3000
            +PS + YD KL L+ I +K G IKI+G PGV  +   +    +  I F+ G    ++L  DN + LW I    N    ++V S  N+                            IE    T   +M      L+ +  +LL +  +         G    ++PT +     + +D I+  +P   +    +  V  +   P     +LIGY  G  +++++    VD L   K  L +L W                R+   + SS      H DG  + W +    P   D   V     + P+     C  ++KILW+  +    L++FSGG+PR+ Y  +  +TI+ +S          H+ LD TS++IDF TI     + D      L+VL EEE  ++DL    WP +    PYL  LH+S IT    +S V    ++++  +S+ ++ C + ++ +WPI G      + +  Q +LL+ GH DGT+ FW    G  +K +  + ++S+F+  D  H + ++   +E   P R+ G FDP  DD RL IQ   L  Y+GK L++ G  GQ+++    + K + H++DV   DL      F WKG        GS+     FQ ++ +   PP+ +TA+ +  + N     +IA GT HG  +    + + + A      CT+ P ++LA         S + SL + + R R   +    R        +          + HL+D++ +              +R IE R  D +  G++R +    + ++    +GP      ++AG   G +  +  D   +       +   L K+ Q  HRAP++   +L      + L E  +   DL   P+ +  H V++ +EEQ +++  P  + K K ++TAH+G R++  +L  F+   +++++ ++  L+C TN G
Sbjct:    9 QPSALAYDPKLQLMAIGTKSGAIKIYGAPGVEMTGLHKDTAAVTQIHFLCGQGRILSLLDDNTIHLWEIVQRENRSHLLEVHS-FNLPGRP-----------------------GIESTSATRVTVM------LLNLSCNLLALGTEGG-------GVHFLELPTLTLLNKSLFQDEIMQSVPEEYKCGKSLGPVESLQEHPKDSDKILIGYSRGLVVLWDLSSRHVDNLFLGKQQLESLVW---------------ERSGNSFVSS------HSDGGYMVWAVSSSNPCTHDP--VSSTIPYGPFP----CKAVNKILWRTTESGAPLVLFSGGMPRASYGDRHCLTILQDS---------SHVTLDFTSRVIDFFTIHCTDTEKDFDEPSALVVLLEEELVVIDLQMPGWPTV--PAPYLAPLHSSAITCSCHISNVPPKLWERV--ISAGQQQCPLQNYENWPICGGKNLAPDPK--QKELLLTGHEDGTVRFWD-ASGVSLKPLYKLSTASIFQ-TDCEHNDSLTQAGEEEWPPFRKVGCFDPYSDDPRLGIQKISLCKYSGK-LVVAGTAGQVIVMVLGDEKSD-HMIDVATVDLLQDREGFTWKGHDRLPPKSGSVVFAPGFQPVVLVQCLPPAAVTAVTLHAEWN-----LIAFGTSHGFGLFDYHRRSPVLA-----RCTLHPNDSLAMEGPLSRVKSLKKSLRQSFRRIRKSRVSGKKRVVVNSPTSKVQ------EANAHLADHDAEV----------TPVQRRIEPRSADDSLSGVVRCLCFADTFLRDGTHHGP-----TMWAGTNSGSVYAYALDVPSQEKFSEQSVEALLGKEIQLMHRAPVVSIAVLDGRG--NPLPEPYEVSRDLAKAPDMQGSHSVLIASEEQFKVFMLPKVSAKTKFKLTAHEGCRVRKVALANFTS--VSSEDYSENALVCLTNMG 845          
BLAST of Protein lethal(2) giant larvae vs. Ensembl Zebrafish
Match: llgl1 (LLGL scribble cell polarity complex component 1 [Source:ZFIN;Acc:ZDB-GENE-060825-69])

HSP 1 Score: 237.269 bits (604), Expect = 7.913e-64
Identity = 244/955 (25.55%), Postives = 421/955 (44.08%), Query Frame = 1
Query:  238 EPSCIDYDHKLSLLGIASKKGLIKIFGCPGVCYSTRLEGQDEIWNIKFIPGTNFFVTLTADNKLILWLISTLTNELFKVDVISNLNVVNSARTSAHXXXXXXXXXXXXXXXXXTAIEVNDLTSSIIMGNGSGSLIQVKLDLLKMRKQANNYKTVPPGNTIWQMPTKS---DVIDRDRIISKLPIGSQNRVIIDAVIHISARPGSRKHLLIGYRSGNSIIYNVQKDSVDFLLSAKSTLNALSWCPPDPIVQDNFMVAPNRNEPQYYSSMKLHSCHEDGSIITWNL----PQNSDEFLVLDFQIFSPYKKDQKCLPISKILWKRYKQDY-LIVFSGGLPRSDYMTKSTITIMNNSCLDSSKANNEHLVLDLTSQLIDFTTID----DNDSGSVEYLLVLTEEEFFIVDLTKESWPILHDRQPYLNCLHNSPITAYQFLSEVKSDWFQKLNEMSSNKEDCNI-SFSDWPIKGYAQKVRNDEIWQNDLLIIGHGDGTIVFWKFGMGGCMKKISTVKSSSLFKMADELHLNEVSYEDDE--IPLRRTGQFDPCCDDNRLAIQ---LIHYTGKHLLIGGYGGQIVLWGFQENKYEKHLLDV---DLTTHLSNFKWKGCQPFQHIEGSIKTGSNFQVMMSMCIFPPSQITALDILEDNNCNGYVIIACGTLHGLVIVSCPKETNLEALVLTTHCTV-PRNTLA---------SQEASLGEGWARRRTXXXXXXXXXXXXXXXXXXXXXMEHPSVSRHLSDNNDKTMRXXXXXXXXXXXXXXXXDRPKDTANDGLIRSIRINVSLIKRKGSNGPHEKLLNLFAGCYGGLLLWFQSDYSVENILKNSPINLRLIKQYQFQHRAPILHFNMLSPESGLSKLNENPDAGFDL--DPNRKPDHLVVL-TEEQVRLYAFPSFTLKCKIRVTAHDGFRLKNGSLIVFSDDRLTTQNNTKEPLICATNNG 3000
            +PS + YD KL L+ I +K G IKI+G PGV  +   +    +  I F+ G    ++L  DN + LW I    N    ++V S  N+                            IE    T   +M      L+ +  +LL +  +         G    ++PT +     + +D I+  +P   +    +  V  +   P     +LIGY  G  +++++    VD L   K  L +L W                R+   + SS      H DG  + W +    P   D   V     + P+     C  ++KILW+  +    L++FSGG+PR+ Y  +  +TI+ +S          H+ LD TS++IDF TI     + D      L+VL EEE  ++DL    WP +    PYL  LH+S IT    +S V    ++++  +S+ ++ C + ++ +WPI G      + +  Q +LL+ GH DGT+ FW    G  +K +  + ++S+F+  D  H + ++   +E   P R+ G FDP  DD RL IQ   L  Y+GK L++ G  GQ+++    + K + H++DV   DL      F WKG        GS+     FQ ++ +   PP+ +TA+ +  + N     +IA GT HG  +    + + + A      CT+ P ++LA         S + SL + + R R   +    R        +          + HL+D++ +              +R IE R  D +  G++R +    + ++    +GP      ++AG   G +  +  D   +       +   L K+ Q  HRAP++   +L      + L E  +   DL   P+ +  H V++ +EEQ +++  P  + K K ++TAH+G R++  +L  F+   +++++ ++  L+C TN G
Sbjct:   36 QPSALAYDPKLQLMAIGTKSGAIKIYGAPGVEMTGLHKDTAAVTQIHFLCGQGRILSLLDDNTIHLWEIVQRENRSHLLEVHS-FNLPGRP-----------------------GIESTSATRVTVM------LLNLSCNLLALGTEGG-------GVHFLELPTLTLLNKSLFQDEIMQSVPEEYKCGKSLGPVESLQEHPKDSDKILIGYSRGLVVLWDLSSRHVDNLFLGKQQLESLVW---------------ERSGNSFVSS------HSDGGYMVWAVSSSNPCTHDP--VSSTIPYGPFP----CKAVNKILWRTTESGAPLVLFSGGMPRASYGDRHCLTILQDS---------SHVTLDFTSRVIDFFTIHCTDTEKDFDEPSALVVLLEEELVVIDLQMPGWPTV--PAPYLAPLHSSAITCSCHISNVPPKLWERV--ISAGQQQCPLQNYENWPICGGKNLAPDPK--QKELLLTGHEDGTVRFWD-ASGVSLKPLYKLSTASIFQ-TDCEHNDSLTQAGEEEWPPFRKVGCFDPYSDDPRLGIQKISLCKYSGK-LVVAGTAGQVIVMVLGDEKSD-HMIDVATVDLLQDREGFTWKGHDRLPPKSGSVVFAPGFQPVVLVQCLPPAAVTAVTLHAEWN-----LIAFGTSHGFGLFDYHRRSPVLA-----RCTLHPNDSLAMEGPLSRVKSLKKSLRQSFRRIRKSRVSGKKRVVVNSPTSKVQ------EANAHLADHDAEV----------TPVQRRIEPRSADDSLSGVVRCLCFADTFLRDGTHHGP-----TMWAGTNSGSVYAYALDVPSQEKFSEQSVEALLGKEIQLMHRAPVVSIAVLDGRG--NPLPEPYEVSRDLAKAPDMQGSHSVLIASEEQFKVFMLPKVSAKTKFKLTAHEGCRVRKVALANFTS--VSSEDYSENALVCLTNMG 872          
BLAST of Protein lethal(2) giant larvae vs. Ensembl Zebrafish
Match: llgl2 (LLGL scribble cell polarity complex component 2 [Source:NCBI gene;Acc:795670])

HSP 1 Score: 211.46 bits (537), Expect = 1.328e-55
Identity = 237/957 (24.76%), Postives = 406/957 (42.42%), Query Frame = 1
Query:  193 EFYKKQSIEDFGSIPEPSCIDYDHKLSLLGIASKKGLIKIFGCPGVCYSTRLEGQDEIWNIKFIPGTNFFVTLTADNKLILWLISTLTN--ELFKVDVISNLNVVNSARTSAHXXXXXXXXXXXXXXXXXTAIEVNDLTSSIIMGNGSGSLIQVKLDLLKMRKQANNYKTVPPGNTIWQMPTKSDVIDRDRIISKLPIGSQNRVIIDAVIHISARPGSRKHLLIGYRSGNSIIYNVQKDSVDFLLSAKSTLNALSWCPPDPIVQDNFMVAPNRNEPQYYSSMKLHSCHEDGSIITWNL----PQNSDEFLVLDFQIFSPYKKDQKCLPISKILWKRYKQDY-LIVFSGGLPRSDYMTKSTITIMNNSCLDSSKANNEHLVLDLTSQLIDFTTI--DDNDSGSVEYLLVLTEEEFFIVDLTKESWPILHDRQPYLNCLHNSPITAYQFLSEVKSDWFQKLNEMSSNKEDCNISFSDWPIKGYAQKVRNDEIWQNDLLIIGHGDGTIVFWKFGMGGCMKKISTVKSSSLFKM-ADELHLNEVSYEDDEIPLRRTGQFDPCCDDNRLAIQLIH---YTGKHLLIGGYGGQIVLWGFQENKYEKHLLD--VDLTTHLSNFKWKGCQPFQHIEGSIKTGSNFQVMMSMCIFPPSQITALDILEDNNCNGYVIIACGTLHGLVIVSCPKETNLEALVLTTHCTV-PRNTLASQEASLGEGWARRRTXXXXXXXXXXXXXXXXXXXXXMEHPSVSRHLSDNNDKTMRXXXXXXXXXXXXXXXXDRPKDTANDGLIRSIRINVSLIKRKGSNGPHEKLLNLFAGCYGGLLLWFQSDYSVENILKNSPINLRLIKQYQFQHRAPILHFNMLSPESGLSKLNENPDAGFDLDPNRKPD-----HLVVLTEEQVRLYAFPSFTLKCKIRVTAHDGFRLKNGSLIVFSDDRLTTQNNTKEPLICATNNG 3000
            + Y+     + G   +PS + +   L LL I ++ G IK++G PGV +    +    +  + F+P     VTL  DN L +W +    +  EL ++   + L+    A  S                  +TA+  +     +++G   G +  V++   +  ++ N                    I  + + +++P     R  +++V  +   P + + +LIGY  G  +++++ +            L ++ W      ++D   +                S H DGS   W +    PQ   E     +  F        C  ISKI+    KQ    ++FSGG+PR+ Y  +  I+++++           H  LD TS++IDF  I   +N  G    L+VL EEE  +VDL  E WP++  + PYL  LH S IT    +S +    ++++    ++ ++ + S   WPI G  + +  D   Q DLL+ GH DGT+ FW    G C+  +  + ++ +F   AD         E +  P R+ G FDP  DD RL IQ IH   Y+G +L + G  GQI++    +   E+ +    VDL      F+WKG       E  +     FQ    +   PP+ +TA+ +  +     + ++  GT HG  +    +  N     +   CT+ P + +A       EG   R     K   +S  R  R R + R  H + +  L + N +     L E E+   +R IE R  D +  GL+R++    + +     + P     +L+AG  GG +  +      +      P+     K+ Q  HRAP++   +L  +   + L E  +   DL   R P+     HL+V++EEQ +L+  P  + K K+++TA DG R++   +  F      T    +  L+  TN G
Sbjct:   19 DLYQFNKTVEHGFPHQPSALGFSPSLELLAIGTRSGAIKLYGAPGVEFMGLHDENAAVTQVHFLPNQVELVTLLEDNSLHMWTLRAHNSMCELLEIGRFT-LSGPPGAIPSV---------------TRVTAVLAHSSGELLLLGTEGGHVFVVEVPGFRELEENN--------------------ISVEDVQNRVPEDYVGRRNLESVETLHENPLNPRQVLIGYSRGLMVLWDLDRQRPVQHFLGTQQLESVWW------MEDGESIL---------------SSHSDGSYCQWTVTGEDPQTEPEKQETPYGAFP-------CKAISKIIQLPSKQGPPFLIFSGGMPRASYGDRHCISVIHSKT---------HEALDFTSRIIDFFVIREGENHKGEPSALVVLVEEELVVVDLQTEGWPVI--QTPYLVPLHCSAITCSHHVSSIPLKLWERVQAAGAH-QNTHYSRKPWPING-GKNLAPDPP-QRDLLLTGHEDGTVRFWD-ASGVCLYPMYKLSTAGVFHTDADPNDNMNQGSEGEWPPFRKVGCFDPYSDDPRLGIQKIHLCKYSG-YLTVAGTAGQILVLELNDEAAEQMVEATVVDLLQGQEGFRWKGQARLDVREEPVLFPPGFQPFALVQCQPPAVVTAIALHSE-----WKLVGFGTSHGFGLYDYNQRNN-----IMVKCTLNPSDQMAM------EGPLSRVKSIKKSLRQSFRRIRRSRVSMRKHHTNNAAKLQEINARLEAEALQEMELAPVQRKIEARSSDDSFTGLVRTLYFADTFVSDSSHSTP-----SLWAGTNGGAVFAYVLRVPPQERRAEDPVTAHAAKEIQLMHRAPVVGLVVLDGKG--APLPEPLEVAHDL--ARSPEMHGSHHLLVVSEEQFKLFTLPKVSSKSKLKLTAVDGSRVRRVGVAWFGS---RTDEQLESCLVVLTNQG 867          
BLAST of Protein lethal(2) giant larvae vs. Ensembl Zebrafish
Match: llgl2 (LLGL scribble cell polarity complex component 2 [Source:NCBI gene;Acc:795670])

HSP 1 Score: 211.46 bits (537), Expect = 1.328e-55
Identity = 237/957 (24.76%), Postives = 406/957 (42.42%), Query Frame = 1
Query:  193 EFYKKQSIEDFGSIPEPSCIDYDHKLSLLGIASKKGLIKIFGCPGVCYSTRLEGQDEIWNIKFIPGTNFFVTLTADNKLILWLISTLTN--ELFKVDVISNLNVVNSARTSAHXXXXXXXXXXXXXXXXXTAIEVNDLTSSIIMGNGSGSLIQVKLDLLKMRKQANNYKTVPPGNTIWQMPTKSDVIDRDRIISKLPIGSQNRVIIDAVIHISARPGSRKHLLIGYRSGNSIIYNVQKDSVDFLLSAKSTLNALSWCPPDPIVQDNFMVAPNRNEPQYYSSMKLHSCHEDGSIITWNL----PQNSDEFLVLDFQIFSPYKKDQKCLPISKILWKRYKQDY-LIVFSGGLPRSDYMTKSTITIMNNSCLDSSKANNEHLVLDLTSQLIDFTTI--DDNDSGSVEYLLVLTEEEFFIVDLTKESWPILHDRQPYLNCLHNSPITAYQFLSEVKSDWFQKLNEMSSNKEDCNISFSDWPIKGYAQKVRNDEIWQNDLLIIGHGDGTIVFWKFGMGGCMKKISTVKSSSLFKM-ADELHLNEVSYEDDEIPLRRTGQFDPCCDDNRLAIQLIH---YTGKHLLIGGYGGQIVLWGFQENKYEKHLLD--VDLTTHLSNFKWKGCQPFQHIEGSIKTGSNFQVMMSMCIFPPSQITALDILEDNNCNGYVIIACGTLHGLVIVSCPKETNLEALVLTTHCTV-PRNTLASQEASLGEGWARRRTXXXXXXXXXXXXXXXXXXXXXMEHPSVSRHLSDNNDKTMRXXXXXXXXXXXXXXXXDRPKDTANDGLIRSIRINVSLIKRKGSNGPHEKLLNLFAGCYGGLLLWFQSDYSVENILKNSPINLRLIKQYQFQHRAPILHFNMLSPESGLSKLNENPDAGFDLDPNRKPD-----HLVVLTEEQVRLYAFPSFTLKCKIRVTAHDGFRLKNGSLIVFSDDRLTTQNNTKEPLICATNNG 3000
            + Y+     + G   +PS + +   L LL I ++ G IK++G PGV +    +    +  + F+P     VTL  DN L +W +    +  EL ++   + L+    A  S                  +TA+  +     +++G   G +  V++   +  ++ N                    I  + + +++P     R  +++V  +   P + + +LIGY  G  +++++ +            L ++ W      ++D   +                S H DGS   W +    PQ   E     +  F        C  ISKI+    KQ    ++FSGG+PR+ Y  +  I+++++           H  LD TS++IDF  I   +N  G    L+VL EEE  +VDL  E WP++  + PYL  LH S IT    +S +    ++++    ++ ++ + S   WPI G  + +  D   Q DLL+ GH DGT+ FW    G C+  +  + ++ +F   AD         E +  P R+ G FDP  DD RL IQ IH   Y+G +L + G  GQI++    +   E+ +    VDL      F+WKG       E  +     FQ    +   PP+ +TA+ +  +     + ++  GT HG  +    +  N     +   CT+ P + +A       EG   R     K   +S  R  R R + R  H + +  L + N +     L E E+   +R IE R  D +  GL+R++    + +     + P     +L+AG  GG +  +      +      P+     K+ Q  HRAP++   +L  +   + L E  +   DL   R P+     HL+V++EEQ +L+  P  + K K+++TA DG R++   +  F      T    +  L+  TN G
Sbjct:   19 DLYQFNKTVEHGFPHQPSALGFSPSLELLAIGTRSGAIKLYGAPGVEFMGLHDENAAVTQVHFLPNQVELVTLLEDNSLHMWTLRAHNSMCELLEIGRFT-LSGPPGAIPSV---------------TRVTAVLAHSSGELLLLGTEGGHVFVVEVPGFRELEENN--------------------ISVEDVQNRVPEDYVGRRNLESVETLHENPLNPRQVLIGYSRGLMVLWDLDRQRPVQHFLGTQQLESVWW------MEDGESIL---------------SSHSDGSYCQWTVTGEDPQTEPEKQETPYGAFP-------CKAISKIIQLPSKQGPPFLIFSGGMPRASYGDRHCISVIHSKT---------HEALDFTSRIIDFFVIREGENHKGEPSALVVLVEEELVVVDLQTEGWPVI--QTPYLVPLHCSAITCSHHVSSIPLKLWERVQAAGAH-QNTHYSRKPWPING-GKNLAPDPP-QRDLLLTGHEDGTVRFWD-ASGVCLYPMYKLSTAGVFHTDADPNDNMNQGSEGEWPPFRKVGCFDPYSDDPRLGIQKIHLCKYSG-YLTVAGTAGQILVLELNDEAAEQMVEATVVDLLQGQEGFRWKGQARLDVREEPVLFPPGFQPFALVQCQPPAVVTAIALHSE-----WKLVGFGTSHGFGLYDYNQRNN-----IMVKCTLNPSDQMAM------EGPLSRVKSIKKSLRQSFRRIRRSRVSMRKHHTNNAAKLQEINARLEAEALQEMELAPVQRKIEARSSDDSFTGLVRTLYFADTFVSDSSHSTP-----SLWAGTNGGAVFAYVLRVPPQERRAEDPVTAHAAKEIQLMHRAPVVGLVVLDGKG--APLPEPLEVAHDL--ARSPEMHGSHHLLVVSEEQFKLFTLPKVSSKSKLKLTAVDGSRVRRVGVAWFGS---RTDEQLESCLVVLTNQG 867          
BLAST of Protein lethal(2) giant larvae vs. Ensembl Zebrafish
Match: llgl2 (LLGL scribble cell polarity complex component 2 [Source:NCBI gene;Acc:795670])

HSP 1 Score: 211.46 bits (537), Expect = 1.416e-55
Identity = 237/957 (24.76%), Postives = 406/957 (42.42%), Query Frame = 1
Query:  193 EFYKKQSIEDFGSIPEPSCIDYDHKLSLLGIASKKGLIKIFGCPGVCYSTRLEGQDEIWNIKFIPGTNFFVTLTADNKLILWLISTLTN--ELFKVDVISNLNVVNSARTSAHXXXXXXXXXXXXXXXXXTAIEVNDLTSSIIMGNGSGSLIQVKLDLLKMRKQANNYKTVPPGNTIWQMPTKSDVIDRDRIISKLPIGSQNRVIIDAVIHISARPGSRKHLLIGYRSGNSIIYNVQKDSVDFLLSAKSTLNALSWCPPDPIVQDNFMVAPNRNEPQYYSSMKLHSCHEDGSIITWNL----PQNSDEFLVLDFQIFSPYKKDQKCLPISKILWKRYKQDY-LIVFSGGLPRSDYMTKSTITIMNNSCLDSSKANNEHLVLDLTSQLIDFTTI--DDNDSGSVEYLLVLTEEEFFIVDLTKESWPILHDRQPYLNCLHNSPITAYQFLSEVKSDWFQKLNEMSSNKEDCNISFSDWPIKGYAQKVRNDEIWQNDLLIIGHGDGTIVFWKFGMGGCMKKISTVKSSSLFKM-ADELHLNEVSYEDDEIPLRRTGQFDPCCDDNRLAIQLIH---YTGKHLLIGGYGGQIVLWGFQENKYEKHLLD--VDLTTHLSNFKWKGCQPFQHIEGSIKTGSNFQVMMSMCIFPPSQITALDILEDNNCNGYVIIACGTLHGLVIVSCPKETNLEALVLTTHCTV-PRNTLASQEASLGEGWARRRTXXXXXXXXXXXXXXXXXXXXXMEHPSVSRHLSDNNDKTMRXXXXXXXXXXXXXXXXDRPKDTANDGLIRSIRINVSLIKRKGSNGPHEKLLNLFAGCYGGLLLWFQSDYSVENILKNSPINLRLIKQYQFQHRAPILHFNMLSPESGLSKLNENPDAGFDLDPNRKPD-----HLVVLTEEQVRLYAFPSFTLKCKIRVTAHDGFRLKNGSLIVFSDDRLTTQNNTKEPLICATNNG 3000
            + Y+     + G   +PS + +   L LL I ++ G IK++G PGV +    +    +  + F+P     VTL  DN L +W +    +  EL ++   + L+    A  S                  +TA+  +     +++G   G +  V++   +  ++ N                    I  + + +++P     R  +++V  +   P + + +LIGY  G  +++++ +            L ++ W      ++D   +                S H DGS   W +    PQ   E     +  F        C  ISKI+    KQ    ++FSGG+PR+ Y  +  I+++++           H  LD TS++IDF  I   +N  G    L+VL EEE  +VDL  E WP++  + PYL  LH S IT    +S +    ++++    ++ ++ + S   WPI G  + +  D   Q DLL+ GH DGT+ FW    G C+  +  + ++ +F   AD         E +  P R+ G FDP  DD RL IQ IH   Y+G +L + G  GQI++    +   E+ +    VDL      F+WKG       E  +     FQ    +   PP+ +TA+ +  +     + ++  GT HG  +    +  N     +   CT+ P + +A       EG   R     K   +S  R  R R + R  H + +  L + N +     L E E+   +R IE R  D +  GL+R++    + +     + P     +L+AG  GG +  +      +      P+     K+ Q  HRAP++   +L  +   + L E  +   DL   R P+     HL+V++EEQ +L+  P  + K K+++TA DG R++   +  F      T    +  L+  TN G
Sbjct:   19 DLYQFNKTVEHGFPHQPSALGFSPSLELLAIGTRSGAIKLYGAPGVEFMGLHDENAAVTQVHFLPNQVELVTLLEDNSLHMWTLRAHNSMCELLEIGRFT-LSGPPGAIPSV---------------TRVTAVLAHSSGELLLLGTEGGHVFVVEVPGFRELEENN--------------------ISVEDVQNRVPEDYVGRRNLESVETLHENPLNPRQVLIGYSRGLMVLWDLDRQRPVQHFLGTQQLESVWW------MEDGESIL---------------SSHSDGSYCQWTVTGEDPQTEPEKQETPYGAFP-------CKAISKIIQLPSKQGPPFLIFSGGMPRASYGDRHCISVIHSKT---------HEALDFTSRIIDFFVIREGENHKGEPSALVVLVEEELVVVDLQTEGWPVI--QTPYLVPLHCSAITCSHHVSSIPLKLWERVQAAGAH-QNTHYSRKPWPING-GKNLAPDPP-QRDLLLTGHEDGTVRFWD-ASGVCLYPMYKLSTAGVFHTDADPNDNMNQGSEGEWPPFRKVGCFDPYSDDPRLGIQKIHLCKYSG-YLTVAGTAGQILVLELNDEAAEQMVEATVVDLLQGQEGFRWKGQARLDVREEPVLFPPGFQPFALVQCQPPAVVTAIALHSE-----WKLVGFGTSHGFGLYDYNQRNN-----IMVKCTLNPSDQMAM------EGPLSRVKSIKKSLRQSFRRIRRSRVSMRKHHTNNAAKLQEINARLEAEALQEMELAPVQRKIEARSSDDSFTGLVRTLYFADTFVSDSSHSTP-----SLWAGTNGGAVFAYVLRVPPQERRAEDPVTAHAAKEIQLMHRAPVVGLVVLDGKG--APLPEPLEVAHDL--ARSPEMHGSHHLLVVSEEQFKLFTLPKVSSKSKLKLTAVDGSRVRRVGVAWFGS---RTDEQLESCLVVLTNQG 867          
BLAST of Protein lethal(2) giant larvae vs. Ensembl Xenopus
Match: LLGL1 (LLGL1, scribble cell polarity complex component [Source:NCBI gene;Acc:100486472])

HSP 1 Score: 221.09 bits (562), Expect = 1.942e-58
Identity = 235/946 (24.84%), Postives = 400/946 (42.28%), Query Frame = 1
Query:  238 EPSCIDYDHKLSLLGIASKKGLIKIFGCPGVCYSTRLEGQDEIWNIKFIPGTNFFVTLTADNKLILWLISTLTNELFKVDVISNLNVVNSARTSAHXXXXXXXXXXXXXXXXXTAIEVNDLTSSIIMGNGSGSLIQVKLDLLKMRKQANNYKTVPPGNTIWQMPTKSDVID----RDRIISKLPIGSQNRVIIDAVIHISARPGSRKHLLIGYRSGNSIIYNVQKDSVDFLLSAKSTLNALSWCPPDPIVQDNFMVAPNRNEPQYYSSMKLHSCHEDGSIITWNLPQNSDEF--LVLDFQIFSPYKKDQKCLPISKILWKRYKQ-DYLIVFSGGLPRSDYMTKSTITIMNNSCLDSSKANNEHLVLDLTSQLIDFTTI----DDNDSGSVEYLLVLTEEEFFIVDLTKESWPILHDRQPYLNCLHNSPITAYQFLSEVKSDWFQKLNEMSSNKEDCNISFS--DWPIKGYAQKVRN--DEIWQNDLLIIGHGDGTIVFWKFGMGGCMKKISTVKSSSLFKMADELHLNEVSYEDDE--IPLRRTGQFDPCCDDNRLAIQ---LIHYTGKHLLIGGYGGQIVLWGFQENKYEK--HLLDVDLTTHLSNFKWKGCQPFQHIEGSIKTGSNFQVMMSMCIFPPSQITALDILEDNNCNGYVIIACGTLHGLVIVSCPKETNLEALVLTTHCTVPRNTLASQEASLGEGWARRRTXXXXXXXXXXXXXXXXXXXXXMEHPSVSRHLSDNNDKTMRXXXXXXXXXXXXXXXXDRPKDTANDGLIRSIRINVSLIKRKGSNGPHEKLLNLFAGCYGGLLLWFQSDYSVENILKNSPINLRLIKQYQFQHRAPILHFNMLSPESGLSKLNENPDAGFDL--DPNRKPDHLVVL-TEEQVRLYAFPSFTLKCKIRVTAHDGFRLKNGSLIVFSDDRLTTQNNTKEPLICATNNG 3000
            +PS + +D  L ++ I +K G +KI+G PGV ++   +    +  + F+PG    ++L  DN + LW       EL + D  S+L    S                                      N   S  +V + L+    +     T   G    Q+P+   + +    +D I+  LP   +    +  V  +   P  R  +LIGY  G  ++++ +   V+ L      L ++ W                R    + SS      H DG  + W    +S      V     + P+     C  I+KI W+     +  I+FSGG+PR+ Y  +  +TI+    L         + LD TS+++DF T+     ++DS +   L+VL EEE  ++DL    WP +    PYL  LH+S IT    +S V +  ++++    S  E  N  FS  +WPI G     RN  +E  Q  LL+ GH DGT+ FW    G  ++ +  + ++ +F+  D  H    +  +DE   P R+ G FDP  DD RL IQ   L  Y+GK +L+ G  GQ+++    + K E   ++  VDL      F WKG        GS+     FQ +  +   PP+ +TA+ +  + N     ++A GT HG  +    + + + A      CT+  N   + E  L    + +++           R   ++       P  SR    N     +    + ++   +R IE R  D +  G++R +    + ++    +GP      ++AG   G +  +  +      L +      L K+ Q  HRAP++   +L      + L E  +   DL   P+ +  H V++ +EEQ +++  P  + K K ++TAH+G R++  +L  F+    T+ + ++  L C TN G
Sbjct:   36 QPSSLAFDPLLRIMAIGAKSGAVKIYGAPGVEFTGLHKDTATVTQMHFLPGQGRLLSLLDDNTMHLW-------ELQQKDGSSHLEETRSFLLPGK--------------------------PGFDCANSPPSFTRVTVILITASCEVAGLGTEGGGVYFIQIPSLKLLEEKTLLQDEIVKSLPEEYRCGKTLGPVESLQEHPCQRGKILIGYSRGLVVLWDQEGRKVEHLFLGNQQLESVFW---------------GRKGTSFISS------HSDGGYMVWEADSDSSTTSQPVTSKIPYGPFP----CKAINKIQWRSSSSGNPYIIFSGGMPRASYGDRHCVTILQGQNL---------VTLDFTSRVVDFFTVCPLKSEDDSDNPTALVVLVEEELVVIDLQTPGWPTVP--TPYLAPLHSSAITCAYHISNVTTKLWERI---ISAGEQQNPQFSSVNWPIDGG----RNLAEEPAQRGLLLTGHEDGTVRFWD-ASGVALRPLYKLSTAGIFQ-TDCDHNESFNQSNDEEWPPFRKVGCFDPYSDDPRLGIQKIALCKYSGK-MLVAGTAGQVLVMDLNDEKVEHTINVATVDLLQEREGFTWKGHDRLTPRNGSLFFQPGFQTITLVQCMPPAAVTAVALHSEWN-----LVAFGTSHGFGLFDYHRRSPVLA-----RCTLHPNDSLAMEGPLSRVKSLKKSLRQSFRRIRKSRVSGKKRPNTGSPP--SRLQEANAQLAEQAGPHDLDIAPVQRRIEPRSADDSLSGVVRCLYFADTFLRDAIHHGP-----TMWAGTNSGSVFAYALEVPSREKLSDRSAEAVLGKEIQLMHRAPVVSIAVLDGRG--NPLPEPFEVSQDLAKAPDMQGTHSVLISSEEQFKVFTLPKVSAKTKFKLTAHEGCRVRKVALATFTS--ATSDDYSENCLACLTNLG 881          
BLAST of Protein lethal(2) giant larvae vs. Ensembl Xenopus
Match: LLGL1 (LLGL1, scribble cell polarity complex component [Source:NCBI gene;Acc:100486472])

HSP 1 Score: 213.386 bits (542), Expect = 4.571e-56
Identity = 224/947 (23.65%), Postives = 395/947 (41.71%), Query Frame = 1
Query:  238 EPSCIDYDHKLSLLGIASKKGLIKIFGCPGVCYSTRLEGQDEIWNIKFIPGTNFFVTLTADNKLILWLISTLTNELFKVDVISNLNVVNSARTSAHXXXXXXXXXXXXXXXXXTAIEVNDLTSSIIMGNGSGS---LIQVKLDLLKMRKQANNYKTVPPGNTIWQMPTKSDVID----RDRIISKLPIGSQNRVIIDAVIHISARPGSRKHLLIGYRSGNSIIYNVQKDSVDFLLSAKSTLNALSWCPPDPIVQDNFMVAPNRNEPQYYSSMKLHSCHEDGSIITWNLPQNSDEFLVLDFQIFSPYKKDQKCLPISKILWK-RYKQDYLIVFSGGLPRSDYMTKSTITIMNNSCLDSSKANNEHLVLDLTSQLIDFTTI------DDNDSGSVEYLLVLTEEEFFIVDLTKESWPILHDRQPYLNCLHNSPITAYQFLSEVKSDWFQKLNEMSSNKEDCNISFSDWPIKGYAQKVRN--DEIWQNDLLIIGHGDGTIVFWKFGMGGCMKKISTVKSSSLFKMADELHLNEVSYEDDE--IPLRRTGQFDPCCDDNRLAIQ---LIHYTGKHLLIGGYGGQIVLWGFQENKYEK--HLLDVDLTTHLSNFKWKGCQPFQHIEGSIKTGSNFQVMMSMCIFPPSQITALDILEDNNCNGYVIIACGTLHGLVIVSCPKETNLEALVLTTHCTVPRNTLASQEASLGEGWARRRTXXXXXXXXXXXXXXXXXXXXXMEHPSVSRHLSDNNDKTMRXXXXXXXXXXXXXXXXDRPKDTANDGLIRSIRINVSLIKRKGSNGPHEKLLNLFAGCYGGLLLWFQSDYSVENILKNSPINLRLIKQYQFQHRAPILHFNMLSPESGLSKLNENPDAGFDL--DPNRKPDHLVVL-TEEQVRLYAFPSFTLKCKIRVTAHDGFRLKNGSLIVFSDDRLTTQNNTKEPLICATNNG 3000
            +PS + +D  L ++ I +K G +KI+G PGV ++   +    +  + F+PG    ++L  DN + LW       EL + D  S+L                                  + T S ++    GS     +V + L+    +     T   G    Q+P+   + +    +D I+  LP   +    +  V  +   P  R  +LIGY  G  ++++ +   V+ L      L ++ W                R    + SS      H DG  + W    +S         + S + K   C+ I+       + ++  I+FSGG+PR+ Y  +  +TI+    L         + LD TS+++DF T+      DDN +  V  +          +DL    WP +    PYL  LH+S IT    +S V +  ++++   +  +++   S  +WPI G     RN  +E  Q  LL+ GH DGT+ FW    G  ++ +  + ++ +F+  D  H    +  +DE   P R+ G FDP  DD RL IQ   L  Y+GK +L+ G  GQ+++    + K E   ++  VDL      F WKG        GS+     FQ +  +   PP+ +TA+ +  + N     ++A GT HG  +    + + +        CT+  N   + E  L    + +++           R   ++       P  SR    N     +    + ++   +R IE R  D +  G++R +    + ++    +GP      ++AG   G +  +  +      L +      L K+ Q  HRAP++   +L      + L E  +   DL   P+ +  H V++ +EEQ +++  P  + K K ++TAH+G R++  +L  F+    T+ + ++  L C TN G
Sbjct:   48 QPSSLAFDPLLRIMAIGAKSGAVKIYGAPGVEFTGLHKDTATVTQMHFLPGQGRLLSLLDDNTMHLW-------ELQQKDGSSHL----------------------------------EETRSFLLPGKPGSPPSFTRVTVILITASCEVAGLGTEGGGVYFIQIPSLKLLEEKTLLQDEIVKSLPEEYRCGKTLGPVESLQEHPCQRGKILIGYSRGLVVLWDQEGRKVEHLFLGNQQLESVFW---------------GRKGTSFISS------HSDGGYMVWEADSDSSTTSQPAL-VTSSFAKGVLCVAIAPDCSSVSFIRNPYIIFSGGMPRASYGDRHCVTILQGQNL---------VTLDFTSRVVDFFTVCPLKSEDDNPTALVVLVEEELVV----IDLQTPGWPTV--PTPYLAPLHSSAITCAYHISNVTTKLWERIIS-AGEQQNPQFSSVNWPIDGG----RNLAEEPAQRGLLLTGHEDGTVRFWD-ASGVALRPLYKLSTAGIFQ-TDCDHNESFNQSNDEEWPPFRKVGCFDPYSDDPRLGIQKIALCKYSGK-MLVAGTAGQVLVMDLNDEKVEHTINVATVDLLQEREGFTWKGHDRLTPRNGSLFFQPGFQTITLVQCMPPAAVTAVALHSEWN-----LVAFGTSHGFGLFDYHRRSPV--------CTLHPNDSLAMEGPLSRVKSLKKSLRQSFRRIRKSRVSGKKRPNTGSPP--SRLQEANAQLAEQAGPHDLDIAPVQRRIEPRSADDSLSGVVRCLYFADTFLRDAIHHGP-----TMWAGTNSGSVFAYALEVPSREKLSDRSAEAVLGKEIQLMHRAPVVSIAVLDGRG--NPLPEPFEVSQDLAKAPDMQGTHSVLISSEEQFKVFTLPKVSAKTKFKLTAHEGCRVRKVALATFTS--ATSDDYSENCLACLTNLG 884          
BLAST of Protein lethal(2) giant larvae vs. Ensembl Xenopus
Match: llgl2 (LLGL2, scribble cell polarity complex component [Source:NCBI gene;Acc:548396])

HSP 1 Score: 211.846 bits (538), Expect = 1.604e-55
Identity = 234/950 (24.63%), Postives = 410/950 (43.16%), Query Frame = 1
Query:  238 EPSCIDYDHKLSLLGIASKKGLIKIFGCPGVCYSTRLEGQDEIWNIKFIPGTNFFVTLTADNKLILWLISTLTNELFKVDVISNLNVVNSARTSAHXXXXXXXXXXXXXXXXXTAIEV---NDLTSSIIMGNGSGSLIQVKLDLLKMRKQANNYKTVPPGNTIWQMPTKSDVIDRDRIISKLPIGSQNRVIIDAVIHISARPGSRKHLLIGYRSGNSIIYN-VQKDSVDFLLSAKSTLNALSWCPPDPIVQDNFMVAPNRNEPQYYSSMKLHSCHEDGSIITWNLPQNSDEFLVLDFQI-FSPYKKDQKCLPISKILW---KRYKQDYLIVFSGGLPRSDYMTKSTITIMNNSCLDSSKANNEHLVLDLTSQLIDFTTIDDNDSGSVEY-----LLVLTEEEFFIVDLTKESWPILHDRQPYLNCLHNSPITAYQFLSEVKSDWFQKLNEMSSNKEDCNISFSDWPIKGYAQKVRNDEIWQNDLLIIGHGDGTIVFWKFGMGGCMKKISTVKSSSLFKMADELHLNEVSYEDDE-IPLRRTGQFDPCCDDNRLAIQLIH---YTGKHLLIGGYGGQIVLWGFQENKYEKHLLD---VDLTTHLSNFKWKGCQPFQHIEGSIKTGSNFQVMMSMCIFPPSQITALDILEDNNCNGYVIIACGTLHGLVIVSCPKETNLEALVLTTHCT------VPRNTLASQEASLGEGWARRRTXXXXXXXXXXXXXXXXXXXXXMEHPSVSRHLSDNNDKTMRXXXXXXXXXXXXXXXXDRPKDTANDGLIRSIRINVSLIKRKGSNGPHEKLLNLFAGCYGGLLLWFQSDYSVENILKNSPINLRLIKQYQFQHRAPILHFNMLSPESGLSKLNENPDAGFDL--DPNRKPDH-LVVLTEEQVRLYAFPSFTLKCKIRVTAHDGFRLKNGSLIVFSDDRLTTQNNTKEPLICATNNG 3000
            +PS + Y   LSL+ I ++ G +K++G PGV +    +  + +  I FIP     VT+  DN L LW            D +S L            +  +          ++T I+V   +     + +G   GS+  ++L  L++ ++                      +  +  +  LP    +R   ++V  +   P +   LLIGY  G  + ++ V+  SV + L  K  L  + WC                         ++ SCH DG    W +     +    + ++ + P++    C  ISKI W   +R +  Y +VF GG+P + Y  +  I++++          N+    D TS++ID   I + D  S EY     LLVL EEE  ++DL    WP++  + PYL  LH S IT    +S +    ++++   +  K++   S   WPI G           Q DLL+ GH DGT+ FW    G C++ +  + + S+F+   + + N  S E++E  PLR+ G FDP  DD RL IQ I+   Y+G +L + G  GQ+++    +   E H++D   VDL      ++WKG +     E  ++    FQ    +   PP+ +T+L +  +     + ++A GT HG  +    ++  + A   T H +       P + + S + SL + + R R  ++ K                   P   R + + N +  +  L E E+   +R IE R  + +  G +R++    + ++    + P     +L+AG  GG +  F              +     K+ Q  HRAP++   +L   S    L E  +A  DL   P+ +  H L+V +EEQ +++  P  + K K+++TA DG R++  ++  +      ++ +++  L   TN G
Sbjct:   34 QPSALGYSDCLSLMAIGTRSGALKVYGSPGVEFMGLHDENNSVTKISFIPDQCQLVTVLDDNSLHLW-------SFPHHDGVSELQ----------EEKKFTLRGPPGSPPSVTQIKVLLPHSSGEKLYVGTEGGSVFILELPSLRVLEE--------------------KTVGHEAALQGLPDEYSSRRAFESVEALQENPRNPDQLLIGYSRGMMVTWDLVKGRSVQYFL-GKQQLENVFWC---------------------RDGKQIVSCHSDGGYNQWEVSNELVQVSPKESKVPYGPFR----CKAISKITWHTTRRSRSPY-VVFQGGMPMASYGDRHIISVVHG---------NQQTAFDFTSRIIDHVVIANPDP-SAEYDDPRALLVLVEEELVMIDLQSPGWPVI--QCPYLISLHCSAITCSHHISSIPLKLWERIIS-AGRKQNTQYSNMPWPIDGGVNLAPAPP--QRDLLLTGHEDGTVRFWD-ASGICLQLMYKMSTVSVFQTESDHNDNVNSNEEEEWPPLRKVGSFDPYSDDPRLGIQKIYMCKYSG-YLSVAGTAGQVLVMELNDEAAE-HVVDETLVDLLQEQEGYRWKGHERLHAREDPVRFPPGFQPFALVQCQPPAAVTSLALHSE-----WRLLAFGTSHGFGLYDFQQKRQVMAKC-TLHASDQMALEGPLSRVKSLKKSLRQSFRRIRRSQVNK-----------------RRPGPDR-VQEANARFEQEALQEMELAPVQRRIEARSAEDSFTGFVRTLYFADTYLRDSSRHTP-----SLWAGTNGGTVYAFSLRVPPTERRMEEAVAATQAKEIQLMHRAPVVGILVLDGHS--VPLPEPLEAAHDLSKSPDMQGSHQLLVTSEEQFKVFTLPKVSSKLKLKLTATDGCRVRKMTVCTYGS--CKSEEHSENHLTILTNLG 868          
BLAST of Protein lethal(2) giant larvae vs. Ensembl Xenopus
Match: llgl2 (LLGL2, scribble cell polarity complex component [Source:NCBI gene;Acc:548396])

HSP 1 Score: 211.846 bits (538), Expect = 1.722e-55
Identity = 237/950 (24.95%), Postives = 412/950 (43.37%), Query Frame = 1
Query:  238 EPSCIDYDHKLSLLGIASKKGLIKIFGCPGVCYSTRLEGQDEIWNIKFIPGTNFFVTLTADNKLILWLISTLTNELFKVDVISNLNVVNSARTSAHXXXXXXXXXXXXXXXXXTAIEV---NDLTSSIIMGNGSGSLIQVKLDLLKMRKQANNYKTVPPGNTIWQMPTKSDVIDRDRIISKLPIGSQNRVIIDAVIHISARPGSRKHLLIGYRSGNSIIYN-VQKDSVDFLLSAKSTLNALSWCPPDPIVQDNFMVAPNRNEPQYYSSMKLHSCHEDGSIITWNLPQNSDEFLVLDFQI-FSPYKKDQKCLPISKILW---KRYKQDYLIVFSGGLPRSDYMTKSTITIMNNSCLDSSKANNEHLVLDLTSQLIDFTTIDDNDSGSVEY-----LLVLTEEEFFIVDLTKESWPILHDRQPYLNCLHNSPITAYQFLSEVKSDWFQKLNEMSSNKEDCNISFSDWPIKGYAQKVRNDEIWQNDLLIIGHGDGTIVFWKFGMGGCMKKISTVKSSSLFKMADELHLNEVSYEDDE-IPLRRTGQFDPCCDDNRLAIQLIH---YTGKHLLIGGYGGQIVLWGFQENKYEKHLLD---VDLTTHLSNFKWKGCQPFQHIEGSIKTGSNFQVMMSMCIFPPSQITALDILEDNNCNGYVIIACGTLHGLVIVSCPKETNLEALVLTTHCT------VPRNTLASQEASLGEGWARRRTXXXXXXXXXXXXXXXXXXXXXMEHPSVSRHLSDNNDKTMRXXXXXXXXXXXXXXXXDRPKDTANDGLIRSIRINVSLIKRKGSNGPHEKLLNLFAGCYGGLLLWFQSDYSVENILKNSPINLRLIKQYQFQHRAPILHFNMLSPESGLSKLNENPDAGFDL--DPNRKPDH-LVVLTEEQVRLYAFPSFTLKCKIRVTAHDGFRLKNGSLIVFSDDRLTTQNNTKEPLICATNNG 3000
            +PS + Y   LSL+ I ++ G +K++G PGV +    +  + +  I FIP     VT+  DN L LW            D +S L            +  +          ++T I+V   +     + +G   GS+  ++L  L++ ++    KTV                  +  +  LP    +R   ++V  +   P +   LLIGY  G  + ++ V+  SV + L  K  L  + WC                         ++ SCH DG    W +     +    + ++ + P++    C  ISKI W   +R +  Y +VF GG+P + Y  +  I++++          N+    D TS++ID   I + D  S EY     LLVL EEE  ++DL    WP++  + PYL  LH S IT    +S +    ++++   +  K++   S   WPI G           Q DLL+ GH DGT+ FW    G C++ +  + + S+F+   + + N  S E++E  PLR+ G FDP  DD RL IQ I+   Y+G +L + G  GQ+++    +   E H++D   VDL      ++WKG +     E  ++    FQ    +   PP+ +T+L +  +     + ++A GT HG  +    ++  + A   T H +       P + + S + SL + + R R  ++ K                   P   R + + N +  +  L E E+   +R IE R  + +  G +R++    + ++    + P     +L+AG  GG +  F              +     K+ Q  HRAP++   +L   S    L E  +A  DL   P+ +  H L+V +EEQ +++  P  + K K+++TA DG R++  ++  +      ++ +++  L   TN G
Sbjct:   34 QPSALGYSDCLSLMAIGTRSGALKVYGSPGVEFMGLHDENNSVTKISFIPDQCQLVTVLDDNSLHLW-------SFPHHDGVSELQ----------EEKKFTLRGPPGSPPSVTQIKVLLPHSSGEKLYVGTEGGSVFILELPSLRVLEE----KTV----------------GHEAALQGLPDEYSSRRAFESVEALQENPRNPDQLLIGYSRGMMVTWDLVKGRSVQYFL-GKQQLENVFWC---------------------RDGKQIVSCHSDGGYNQWEVSNELVQVSPKESKVPYGPFR----CKAISKITWHTTRRSRSPY-VVFQGGMPMASYGDRHIISVVHG---------NQQTAFDFTSRIIDHVVIANPDP-SAEYDDPRALLVLVEEELVMIDLQSPGWPVI--QCPYLISLHCSAITCSHHISSIPLKLWERIIS-AGRKQNTQYSNMPWPIDGGVNLAPAPP--QRDLLLTGHEDGTVRFWD-ASGICLQLMYKMSTVSVFQTESDHNDNVNSNEEEEWPPLRKVGSFDPYSDDPRLGIQKIYMCKYSG-YLSVAGTAGQVLVMELNDEAAE-HVVDETLVDLLQEQEGYRWKGHERLHAREDPVRFPPGFQPFALVQCQPPAAVTSLALHSE-----WRLLAFGTSHGFGLYDFQQKRQVMAKC-TLHASDQMALEGPLSRVKSLKKSLRQSFRRIRRSQVNK-----------------RRPGPDR-VQEANARFEQEALQEMELAPVQRRIEARSAEDSFTGFVRTLYFADTYLRDSSRHTP-----SLWAGTNGGTVYAFSLRVPPTERRMEEAVAATQAKEIQLMHRAPVVGILVLDGHS--VPLPEPLEAAHDLSKSPDMQGSHQLLVTSEEQFKVFTLPKVSSKLKLKLTATDGCRVRKMTVCTYGS--CKSEEHSENHLTILTNLG 868          
BLAST of Protein lethal(2) giant larvae vs. Ensembl Xenopus
Match: LLGL1 (LLGL1, scribble cell polarity complex component [Source:NCBI gene;Acc:100486472])

HSP 1 Score: 208.379 bits (529), Expect = 1.674e-54
Identity = 229/949 (24.13%), Postives = 398/949 (41.94%), Query Frame = 1
Query:  238 EPSCIDYDHKLSLLGIASKKGLIKIFGCPGVCYSTRLEGQDEIWNIKFIPGTNFFVTLTADNKLILWLISTLTNELFKVDVISNLNVVNSARTSAHXXXXXXXXXXXXXXXXXTAIEVNDLTSSIIMGNGSGS---LIQVKLDLLKMRKQANNYKTVPPGNTIWQMPTKSDVID----RDRIISKLPIGSQNRVIIDAVIHISARPGSRKHLLIGYRSGNSIIYNVQKDSVDFLLSAKSTLNALSWCPPDPIVQDNFMVAPNRNEPQYYSSMKLHSCHEDGSIITWNLPQNSDEFLVLDFQIFSPYKKDQKCLPISKILWKRYKQ-DYLIVFSGGLPRSDYMTKSTITIMNNSCLDSSKANNEHLVLDLTSQLIDFTTI---DDNDSGSV-----EYLLVLTEEEFFIVDLTKESWPILHDRQPYLNCLHNSPITAYQFLSEVKSDWFQKLNEMSSNKEDCNISFSDWPIKGYAQKVRN--DEIWQNDLLIIGHGDGTIVFWKFGMGGCMKKISTVKSSSLFKMADELHLNEVSYEDDE--IPLRRTGQFDPCCDDNRLAIQ---LIHYTGKHLLIGGYGGQIVLWGFQENKYEK--HLLDVDLTTHLSNFKWKGCQPFQHIEGSIKTGSNFQVMMSMCIFPPSQITALDILEDNNCNGYVIIACGTLHGLVIVSCPKETNLEALVLTTHCTVPRNTLASQEASLGEGWARRRTXXXXXXXXXXXXXXXXXXXXXMEHPSVSRHLSDNNDKTMRXXXXXXXXXXXXXXXXDRPKDTANDGLIRSIRINVSLIKRKGSNGPHEKLLNLFAGCYGGLLLWFQSDYSVENILKNSPINLRLIKQYQFQHRAPILHFNMLSPESGLSKLNENPDAGFDL--DPNRKPDHLVVL-TEEQVRLYAFPSFTLKCKIRVTAHDGFRLKNGSLIVFSDDRLTTQNNTKEPLICATNNG 3000
            +PS + +D  L ++ I +K G +KI+G PGV ++   +    +  + F+PG    ++L  DN + LW       EL + D  S+L                                  + T S ++    GS     +V + L+    +     T   G    Q+P+   + +    +D I+  LP   +    +  V  +   P  R  +LIGY  G  ++++ +   V+ L      L ++ W                R    + SS      H DG  + W    +S           S   +  + L  S     R    +  I+FSGG+PR+ Y  +  +TI+    L         + LD TS+++DF T+      D+G+        L+VL EEE  ++DL    WP +    PYL  LH+S IT    +S V +  ++++   +  +++   S  +WPI G     RN  +E  Q  LL+ GH DGT+ FW    G  ++ +  + ++ +F+  D  H    +  +DE   P R+ G FDP  DD RL IQ   L  Y+GK +L+ G  GQ+++    + K E   ++  VDL      F WKG        GS+     FQ +  +   PP+ +TA+ +  + N     ++A GT HG  +    + + + A      CT+  N   + E  L    + +++           R   ++       P  SR    N     +    + ++   +R IE R  D +  G++R +    + ++    +GP      ++AG   G +  +  +      L +      L K+ Q  HRAP++   +L      + L E  +   DL   P+ +  H V++ +EEQ +++  P  + K K ++TAH+G R++  +L  F+    T+ + ++  L C TN G
Sbjct:   30 QPSSLAFDPLLRIMAIGAKSGAVKIYGAPGVEFTGLHKDTATVTQMHFLPGQGRLLSLLDDNTMHLW-------ELQQKDGSSHL----------------------------------EETRSFLLPGKPGSPPSFTRVTVILITASCEVAGLGTEGGGVYFIQIPSLKLLEEKTLLQDEIVKSLPEEYRCGKTLGPVESLQEHPCQRGKILIGYSRGLVVLWDQEGRKVEHLFLGNQQLESVFW---------------GRKGTSFISS------HSDGGYMVWEADSDS-----------STTSQPPEALVTSSFAKAREGLLNPYIIFSGGMPRASYGDRHCVTILQGQNL---------VTLDFTSRVVDFFTVCPLKSEDAGACFINNPTALVVLVEEELVVIDLQTPGWPTVP--TPYLAPLHSSAITCAYHISNVTTKLWERIIS-AGEQQNPQFSSVNWPIDGG----RNLAEEPAQRGLLLTGHEDGTVRFWD-ASGVALRPLYKLSTAGIFQ-TDCDHNESFNQSNDEEWPPFRKVGCFDPYSDDPRLGIQKIALCKYSGK-MLVAGTAGQVLVMDLNDEKVEHTINVATVDLLQEREGFTWKGHDRLTPRNGSLFFQPGFQTITLVQCMPPAAVTAVALHSEWN-----LVAFGTSHGFGLFDYHRRSPVLA-----RCTLHPNDSLAMEGPLSRVKSLKKSLRQSFRRIRKSRVSGKKRPNTGSPP--SRLQEANAQLAEQAGPHDLDIAPVQRRIEPRSADDSLSGVVRCLYFADTFLRDAIHHGP-----TMWAGTNSGSVFAYALEVPSREKLSDRSAEAVLGKEIQLMHRAPVVSIAVLDGRG--NPLPEPFEVSQDLAKAPDMQGTHSVLISSEEQFKVFTLPKVSAKTKFKLTAHEGCRVRKVALATFTS--ATSDDYSENCLACLTNLG 865          
BLAST of Protein lethal(2) giant larvae vs. Ensembl Mouse
Match: Llgl2 (LLGL2 scribble cell polarity complex component [Source:MGI Symbol;Acc:MGI:1918843])

HSP 1 Score: 233.802 bits (595), Expect = 9.809e-63
Identity = 223/925 (24.11%), Postives = 399/925 (43.14%), Query Frame = 1
Query:  238 EPSCIDYDHKLSLLGIASKKGLIKIFGCPGVCYSTRLEGQDEIWNIKFIPGTNFFVTLTADNKLILWLISTL--TNELFKVDVISNLNVVNSARTSAHXXXXXXXXXXXXXXXXXTAIEVNDLTSSIIMGNGSGSLIQVKLDLLKMRKQANNYKTVPPGNTIWQMPTKSDVIDR----DRIISKLPIGSQNRVIIDAVIHISARPGSRKHLLIGYRSGNSIIYNVQKD-SVDFLLSAKSTLNALSWCPPDPIVQDNFMVAPNRNEPQYYSSMKLHSCHEDGSIITWNLPQNSDEFLVLDFQI-FSPYKKDQKCLPISKILWKRYKQDY-LIVFSGGLPRSDYMTKSTITIMNNSCLDSSKANNEHLVLDLTSQLIDFTTIDDNDSGSV----EYLLVLTEEEFFIVDLTKESWPILHDRQPYLNCLHNSPITAYQFLSEVKSDWFQKLNEMSSNKEDCNISFSDWPIKGYAQKVRNDEIWQNDLLIIGHGDGTIVFWKFGMGGCMKKISTVKSSSLFKMADELHLNEVSYEDDE-IPLRRTGQFDPCCDDNRLAIQ---LIHYTGKHLLIGGYGGQIVLWGFQENKYEKHL--LDVDLTTHLSNFKWKGCQPFQHIEGSIKTGSNFQVMMSMCIFPPSQITALDILEDNNCNGYVIIACGTLHGLVIVSCPKETNLEALVLTTHCTVPRNTLASQEASLGEGWARRRTXXXXXXXXXXXXXXXXXXXXXMEHPSVSRHLSDNNDKTMRXXXXXXXXXXXXXXXXDRPKDTANDGLIRSIRINVSLIKRKGSNGPHEKLLNLFAGCYGGLLLWFQSDYSVENILKNSPINLRLIKQYQFQHRAPILHFNMLSPESGLSKLNENPDAGFDL--DPNRKPDH-LVVLTEEQVRLYAFPSFTLKCKIRVTAHDGFRLKNGSLIVFSDDR 2946
            +PS + Y   L +L I ++ G +K++G PGV +    +  + +  I F+PG    VTL  DN L LW +      +EL + +  +      +A                      +A +V +     I+ + SG       +LL +  ++ N   V       Q+P    + DR    D ++  LP  +++R + + V  +   P     +LIGY  G  +I+++Q   ++   LS++   NA SW       +D  ++                +CH DGS   W +  ++     L   I + P+     C  I+KI W   +Q     +F GG+PR+ Y  +  I++++N          +    D TS++IDFT + + D  +       L+VL EEE  ++DL    WP +  + PYL  LH S IT    +S +    ++++    S +++ + S  +WPI G           Q DLL+ GH DGT+ FW    G C++ +  + +  +F    +   N ++  +DE  PLR+ G FDP  DD RL IQ   L  Y+G +L + G  GQ+++    +   E  +  ++ DL      ++WKG +      G +   + FQ  + +   PP+ +T+L +  +     + ++A GT HG  +    +        +   CT+  +   + E  L    + +++           R    +       P+        N K  R  L   E+   +R IE R  + +  G +R++    + ++    + P     +L+AG  GG +  F           + P+     K+ Q  HRAP++   +L   +    L E  +   DL   P+ +  H L+V++EEQ +++  P  + K K+++TA +G R++   +  F   R
Sbjct:   34 QPSALGYSPSLRILAIGTRSGAVKLYGAPGVEFMGLHKENNAVLQIHFLPGQCQLVTLLDDNSLHLWSLKVKGGVSELQEEESFTLRGPPGAA---------------------PSATQVTE-----ILPHSSG-------ELLYLGTESGNVFVV-------QLPGFRTLHDRTICSDEVLQWLPEEARHRRVFEMVEALQEHPRDPNQILIGYSRGLVVIWDLQGSRALSHFLSSQQLENA-SW------QRDGCLIV---------------TCHSDGSHCQWPVSSDTQNPEPLRSSIPYGPFP----CKAITKIFWLTTRQGLPFTIFQGGMPRASYGDRHCISVVHN---------GQQTAFDFTSRVIDFTVLSEADPAAAFDDPYALVVLAEEELVVIDLQTPGWPPV--QLPYLASLHCSAITCSHHVSNIPLKLWERIIAAGS-RQNSHFSTMEWPIDGGTSLAPPPP--QRDLLLTGHEDGTVRFWD-ASGVCLRLLYKLSTVRVFLTDTDPSENLIAQGEDEWPPLRKVGSFDPYSDDPRLGIQKIFLCKYSG-YLAVAGTAGQVLVLELNDEAAEHAVEQVEADLLQDQEGYRWKGHERLAARPGPVCFEAGFQPFVLVQCQPPAVVTSLALHSE-----WRLVAFGTSHGFGLFDHQQRRQ-----VFVKCTLHPSDQLALEGPLSRVKSLKKSLRQSFRRMRRSRVSSHKRRPGG--PTGEAQAQAVNIKAERTGLQNMELAPVQRKIEARSAEDSFTGFVRTLYFADTYLRDSSRHCP-----SLWAGTNGGTVYAFSLRVPPAERRTDEPVRAEQAKEIQLMHRAPVVGILVLDGHN--VPLPEPLEVAHDLSKSPDMQGSHQLLVVSEEQFKVFTLPKVSAKLKLKLTALEGSRVRRVGVAHFGSCR 857          
BLAST of Protein lethal(2) giant larvae vs. Ensembl Mouse
Match: Llgl2 (LLGL2 scribble cell polarity complex component [Source:MGI Symbol;Acc:MGI:1918843])

HSP 1 Score: 208.764 bits (530), Expect = 1.271e-54
Identity = 171/665 (25.71%), Postives = 297/665 (44.66%), Query Frame = 1
Query:  238 EPSCIDYDHKLSLLGIASKKGLIKIFGCPGVCYSTRLEGQDEIWNIKFIPGTNFFVTLTADNKLILWLISTL--TNELFKVDVISNLNVVNSARTSAHXXXXXXXXXXXXXXXXXTAIEVNDLTSSIIMGNGSGSLIQVKLDLLKMRKQANNYKTVPPGNTIWQMPTKSDVIDR----DRIISKLPIGSQNRVIIDAVIHISARPGSRKHLLIGYRSGNSIIYNVQKD-SVDFLLSAKSTLNALSWCPPDPIVQDNFMVAPNRNEPQYYSSMKLHSCHEDGSIITWNLPQNSDEFLVLDFQI-FSPYKKDQKCLPISKILWKRYKQDY-LIVFSGGLPRSDYMTKSTITIMNNSCLDSSKANNEHLVLDLTSQLIDFTTIDDNDSGSV----EYLLVLTEEEFFIVDLTKESWPILHDRQPYLNCLHNSPITAYQFLSEVKSDWFQKLNEMSSNKEDCNISFSDWPIKGYAQKVRNDEIWQNDLLIIGHGDGTIVFWKFGMGGCMKKISTVKSSSLFKMADELHLNEVSYEDDE-IPLRRTGQFDPCCDDNRLAIQ---LIHYTGKHLLIGGYGGQIVLWGFQENKYEKHL--LDVDLTTHLSNFKWKGCQPFQHIEGSIKTGSNFQVMMSMCIFPPSQITALDILEDNNCNGYVIIACGTLHGL 2175
            +PS + Y   L +L I ++ G +K++G PGV +    +  + +  I F+PG    VTL  DN L LW +      +EL + +  +      +A                      +A +V +     I+ + SG       +LL +  ++ N   V       Q+P    + DR    D ++  LP  +++R + + V  +   P     +LIGY  G  +I+++Q   ++   LS++   NA SW       +D  ++                +CH DGS   W +  ++     L   I + P+     C  I+KI W   +Q     +F GG+PR+ Y  +  I++++N          +    D TS++IDFT + + D  +       L+VL EEE  ++DL    WP +  + PYL  LH S IT    +S +    ++++    S +++ + S  +WPI G           Q DLL+ GH DGT+ FW    G C++ +  + +  +F    +   N ++  +DE  PLR+ G FDP  DD RL IQ   L  Y+G +L + G  GQ+++    +   E  +  ++ DL      ++WKG +      G +   + FQ  + +   PP+ +T+L +  +     + ++A GT HG 
Sbjct:   34 QPSALGYSPSLRILAIGTRSGAVKLYGAPGVEFMGLHKENNAVLQIHFLPGQCQLVTLLDDNSLHLWSLKVKGGVSELQEEESFTLRGPPGAA---------------------PSATQVTE-----ILPHSSG-------ELLYLGTESGNVFVV-------QLPGFRTLHDRTICSDEVLQWLPEEARHRRVFEMVEALQEHPRDPNQILIGYSRGLVVIWDLQGSRALSHFLSSQQLENA-SW------QRDGCLIV---------------TCHSDGSHCQWPVSSDTQNPEPLRSSIPYGPFP----CKAITKIFWLTTRQGLPFTIFQGGMPRASYGDRHCISVVHN---------GQQTAFDFTSRVIDFTVLSEADPAAAFDDPYALVVLAEEELVVIDLQTPGWPPV--QLPYLASLHCSAITCSHHVSNIPLKLWERIIAAGS-RQNSHFSTMEWPIDGGTSLAPPPP--QRDLLLTGHEDGTVRFWD-ASGVCLRLLYKLSTVRVFLTDTDPSENLIAQGEDEWPPLRKVGSFDPYSDDPRLGIQKIFLCKYSG-YLAVAGTAGQVLVLELNDEAAEHAVEQVEADLLQDQEGYRWKGHERLAARPGPVCFEAGFQPFVLVQCQPPAVVTSLALHSE-----WRLVAFGTSHGF 611          

HSP 2 Score: 51.9878 bits (123), Expect = 5.018e-6
Identity = 38/160 (23.75%), Postives = 74/160 (46.25%), Query Frame = 1
Query: 2476 RPKDTANDGLIRSIRINVSLIKRKGSNGPHEKLLNLFAGCYGGLLLWFQSDYSVENILKNSPINLRLIKQYQFQHRAPILHFNMLSPESGLSKLNENPDAGFDL--DPNRKPDH-LVVLTEEQVRLYAFPSFTLKCKIRVTAHDGFRLKNGSLIVFSDDR 2946
            R  + +  G +R++    + ++    + P     +L+AG  GG +  F           + P+     K+ Q  HRAP++   +L   +    L E  +   DL   P+ +  H L+V++EEQ +++  P  + K K+++TA +G R++   +  F   R
Sbjct:  729 RSAEDSFTGFVRTLYFADTYLRDSSRHCP-----SLWAGTNGGTVYAFSLRVPPAERRTDEPVRAEQAKEIQLMHRAPVVGILVLDGHN--VPLPEPLEVAHDLSKSPDMQGSHQLLVVSEEQFKVFTLPKVSAKLKLKLTALEGSRVRRVGVAHFGSCR 881          
BLAST of Protein lethal(2) giant larvae vs. Ensembl Mouse
Match: Llgl1 (LLGL1 scribble cell polarity complex component [Source:MGI Symbol;Acc:MGI:102682])

HSP 1 Score: 192.586 bits (488), Expect = 1.881e-49
Identity = 195/741 (26.32%), Postives = 327/741 (44.13%), Query Frame = 1
Query:  850 LLIGYRSGNSIIYNVQKDSVDFLLSAKSTLNALSWCPPDPIVQDNFMVAPNRNEPQYYSSMKLHSCHEDGSIITWNLPQNSDEFLVLDFQIFSPYKKDQKCLPISKILWKRYKQ-DYLIVFSGGLPRSDYMTKSTITIMNNSCLDSSKANNEHLVLDLTSQLIDFTTI----DDNDSGSVEYLLVLTEEEFFIVDLTKESWPILHDRQPYLNCLHNSPITAYQFLSEVKSD-WFQKLNEMSSNKEDCNISFSDWPIKGYAQKVRN--DEIWQNDLLIIGHGDGTIVFWKFGMGGCMKKISTVKSSSLFKMADELHLNEVS--YEDDEIPLRRTGQFDPCCDDNRLAIQ---LIHYTGKHLLIGGYGGQIVLWGFQENKYEK--HLLDVDLTTHLSNFKWKGCQPFQHIEGSIKTGSNFQVMMSMCIFPPSQITALDILEDNNCNGYVIIACGTLHGLVIVSCPKETNLEALVLTTHCTV-PRNTLASQEASLGEGWARRRTXXXXXXXXXXXXXXXXXXXXXMEHPSVSRHLSDNNDKTMRXXXXXXXXXXXXXXXXD-RPKDTANDGLIRSIRINVSLIKRKGSNGPHEKLLNLFAGCYGGLLLWFQSDYSVENI----LKNSPINLRLIKQYQFQHRAPILHFNMLSPESGLSKLNENPDAGFDL--DPNRKPDHLVVL-TEEQVRLYAFPSFTLKCKIRVTAHDGFRLKNGSLIVFSDDRLTTQNNTKEPLICATNNG 3000
            +LIGY  G  +I++    SVD +      L +L W                R+     SS      H DGS   W+    S   L     + +PY     C  I+KILW+  +  D+ I+FSGG+PR+ Y  +  ++++    L         + LD TS++IDF T+     +++  + + L VL EEE  ++DL    WP +    PYL  LH+S IT    ++ V S  W + ++           S   WPI G     RN   E  Q  LL+ GH DGT+ FW    G  ++ +  + ++ LF+  D  H + ++   EDD  P R+ G FDP  DD RL IQ   L  YT + +++ G  GQ+++    E   E    + +VDL      F WKG +      G +   + FQ  M +   PP+ +TA+ +  +     + ++A GT HG  +    +++ + A      CT+ P ++LA       EG   R     K   +S  R  + R + +   P+ S  L + N +        +      +   + R  D +  G++R +    + ++    +GP      ++AG   G +  +  +               +   L K+ Q  HRAP++   +L        L E  +A  DL   P+ +  H V++ +EEQ +++  P  + K K ++TAH+G R++  +L  F+   + +++  +  L C TN G
Sbjct:  210 ILIGYSRGLLVIWSQATQSVDNVFLGNQQLESLCW---------------GRDGSSIISS------HSDGSYAIWSTDTGSPPTLQPTV-VTTPYGPF-PCKAINKILWRSCESGDHFIIFSGGMPRASYGDRHCVSVLRAETL---------VTLDFTSRVIDFFTVHSTQPEDECDNPQALAVLLEEELVVLDLQTPGWPAV--PAPYLAPLHSSAITCSAHVANVPSKLWARIVSAGEQQSPQPASSALSWPITGG----RNLAQEPSQRGLLLTGHEDGTVRFWD-ASGVALRPLYKLSTAGLFQT-DCEHADSLAQAVEDDWPPFRKVGCFDPYSDDPRLGIQKVALCKYTAQ-MVVAGTAGQVLVLELSEVPAEHAVSVANVDLLQDREGFTWKGHERLNPHTGLLPWPAGFQPRMLIQCLPPAAVTAVTLHAE-----WSLVAFGTSHGFGLFDYQRKSPVLA-----RCTLHPNDSLAM------EGPLSRVKSLKKSLRQSFRRIRKSRVSGKKRTPAASSKLQEANAQLAEQTCPHDLEMTPVQRRIEPRSADDSLSGVVRCLYFADTFLRDATHHGP-----TMWAGTNSGSVFAYALEVPAATAGGEKRPEQAVEAVLGKEVQLMHRAPVVAIAVLDGRG--RPLPEPYEASRDLAQAPDMQGGHAVLIASEEQFKVFTLPKVSAKTKFKLTAHEGCRVRKVALATFAS--VMSEDYAETCLACLTNLG 884          
BLAST of Protein lethal(2) giant larvae vs. Ensembl Mouse
Match: Llgl1 (LLGL1 scribble cell polarity complex component [Source:MGI Symbol;Acc:MGI:102682])

HSP 1 Score: 192.2 bits (487), Expect = 2.403e-49
Identity = 195/741 (26.32%), Postives = 327/741 (44.13%), Query Frame = 1
Query:  850 LLIGYRSGNSIIYNVQKDSVDFLLSAKSTLNALSWCPPDPIVQDNFMVAPNRNEPQYYSSMKLHSCHEDGSIITWNLPQNSDEFLVLDFQIFSPYKKDQKCLPISKILWKRYKQ-DYLIVFSGGLPRSDYMTKSTITIMNNSCLDSSKANNEHLVLDLTSQLIDFTTI----DDNDSGSVEYLLVLTEEEFFIVDLTKESWPILHDRQPYLNCLHNSPITAYQFLSEVKSD-WFQKLNEMSSNKEDCNISFSDWPIKGYAQKVRN--DEIWQNDLLIIGHGDGTIVFWKFGMGGCMKKISTVKSSSLFKMADELHLNEVS--YEDDEIPLRRTGQFDPCCDDNRLAIQ---LIHYTGKHLLIGGYGGQIVLWGFQENKYEK--HLLDVDLTTHLSNFKWKGCQPFQHIEGSIKTGSNFQVMMSMCIFPPSQITALDILEDNNCNGYVIIACGTLHGLVIVSCPKETNLEALVLTTHCTV-PRNTLASQEASLGEGWARRRTXXXXXXXXXXXXXXXXXXXXXMEHPSVSRHLSDNNDKTMRXXXXXXXXXXXXXXXXD-RPKDTANDGLIRSIRINVSLIKRKGSNGPHEKLLNLFAGCYGGLLLWFQSDYSVENI----LKNSPINLRLIKQYQFQHRAPILHFNMLSPESGLSKLNENPDAGFDL--DPNRKPDHLVVL-TEEQVRLYAFPSFTLKCKIRVTAHDGFRLKNGSLIVFSDDRLTTQNNTKEPLICATNNG 3000
            +LIGY  G  +I++    SVD +      L +L W                R+     SS      H DGS   W+    S   L     + +PY     C  I+KILW+  +  D+ I+FSGG+PR+ Y  +  ++++    L         + LD TS++IDF T+     +++  + + L VL EEE  ++DL    WP +    PYL  LH+S IT    ++ V S  W + ++           S   WPI G     RN   E  Q  LL+ GH DGT+ FW    G  ++ +  + ++ LF+  D  H + ++   EDD  P R+ G FDP  DD RL IQ   L  YT + +++ G  GQ+++    E   E    + +VDL      F WKG +      G +   + FQ  M +   PP+ +TA+ +  +     + ++A GT HG  +    +++ + A      CT+ P ++LA       EG   R     K   +S  R  + R + +   P+ S  L + N +        +      +   + R  D +  G++R +    + ++    +GP      ++AG   G +  +  +               +   L K+ Q  HRAP++   +L        L E  +A  DL   P+ +  H V++ +EEQ +++  P  + K K ++TAH+G R++  +L  F+   + +++  +  L C TN G
Sbjct:  210 ILIGYSRGLLVIWSQATQSVDNVFLGNQQLESLCW---------------GRDGSSIISS------HSDGSYAIWSTDTGSPPTLQPTV-VTTPYGP-FPCKAINKILWRSCESGDHFIIFSGGMPRASYGDRHCVSVLRAETL---------VTLDFTSRVIDFFTVHSTQPEDECDNPQALAVLLEEELVVLDLQTPGWPAV--PAPYLAPLHSSAITCSAHVANVPSKLWARIVSAGEQQSPQPASSALSWPITGG----RNLAQEPSQRGLLLTGHEDGTVRFWD-ASGVALRPLYKLSTAGLFQT-DCEHADSLAQAVEDDWPPFRKVGCFDPYSDDPRLGIQKVALCKYTAQ-MVVAGTAGQVLVLELSEVPAEHAVSVANVDLLQDREGFTWKGHERLNPHTGLLPWPAGFQPRMLIQCLPPAAVTAVTLHAE-----WSLVAFGTSHGFGLFDYQRKSPVLA-----RCTLHPNDSLAM------EGPLSRVKSLKKSLRQSFRRIRKSRVSGKKRTPAASSKLQEANAQLAEQTCPHDLEMTPVQRRIEPRSADDSLSGVVRCLYFADTFLRDATHHGP-----TMWAGTNSGSVFAYALEVPAATAGGEKRPEQAVEAVLGKEVQLMHRAPVVAIAVLDGRG--RPLPEPYEASRDLAQAPDMQGGHAVLIASEEQFKVFTLPKVSAKTKFKLTAHEGCRVRKVALATFAS--VMSEDYAETCLACLTNLG 884          
BLAST of Protein lethal(2) giant larvae vs. Ensembl Mouse
Match: Stxbp5l (syntaxin binding protein 5-like [Source:MGI Symbol;Acc:MGI:2443815])

HSP 1 Score: 108.612 bits (270), Expect = 2.627e-23
Identity = 84/405 (20.74%), Postives = 173/405 (42.72%), Query Frame = 1
Query:  811 VIHISARPGSRKHLLIGYRSGNSIIYNVQKDSVDFLLSAKSTLNALSWCPPDPIVQDNFMVAPNRNEPQYYSSMKLHSCHEDGSIITWNLPQNSDEFLVLDFQIFSPYKKDQK-------CLPISKILWKRYK-QDYLIVFSGGLPRSDYMTKSTITIMNNSCLDSSKANNEHLVLDLTSQLIDFTTIDD----NDSGSVEYLLVLTEEEFFIVDLTKESWPILHDRQPYLNCLHNSPITAYQFLSEVKSDWFQKLNEMSSNKEDCNISFSDWPIKGYAQKVRNDEIWQNDLLIIGHGDGTIVFWKFGMGGCMKKISTVKSSSLFKMADELHLNEVSYEDDEIPLRRTGQFDPCC---DDNRLAIQLIHYT--GKHLLIGGYGGQIVLWGFQENKYEKHLLDVDL 1974
            V+H+S  P     LLIGY +G  + ++++    +  +     ++++ W                     ++   +    H DGS+  WNL   S       FQ   P+ K Q+       C PI K+ +K  +  +  I+FSGGL       + ++TIM+   +          VL++   +++F T+ +    N+      + VL E++  +VDLT+ ++PI  +  PY   +H SP+T   + ++   D    L  +    +    S  +WP+ G A  +        +++I GH DGTI FW       ++ +  +K+S +F+                   ++ G+    C   +++  A+Q+I++    +   + G    ++++ F  ++    ++ +++
Sbjct:  210 VVHLSDSPRDEGKLLIGYENGTVVFWDLKSKRAELRVYYDEAIHSIDW---------------------HHEGKQFMCSHSDGSLTLWNLKSPSR-----PFQTTVPHGKSQREGRKSESCKPILKVEYKTCRNSEPFIIFSGGLSYDKACRRPSLTIMHGKAIT---------VLEMDHPIVEFLTLCETPYPNEFQEPYAVAVLLEKDLIVVDLTQTNFPIFEN--PYPMDIHESPVTCTAYFADCPPDLILVLYSIGVKHKKQGYSNKEWPVSGGAWNLGAQTY--PEIIITGHADGTIKFWD-ASAMTLQMLYKLKTSKVFEK------------------QKAGEGKQTCELVEEDPFAVQMIYWCPESRIFCVSGVSAYVIIYKFSRHEVTTEIVSLEV 556          
BLAST of Protein lethal(2) giant larvae vs. UniProt/SwissProt
Match: sp|Q6P1M3|L2GL2_HUMAN (LLGL scribble cell polarity complex component 2 OS=Homo sapiens OX=9606 GN=LLGL2 PE=1 SV=2)

HSP 1 Score: 241.891 bits (616), Expect = 1.551e-64
Identity = 232/921 (25.19%), Postives = 396/921 (43.00%), Query Frame = 1
Query:  238 EPSCIDYDHKLSLLGIASKKGLIKIFGCPGVCYSTRLEGQDEIWNIKFIPGTNFFVTLTADNKLILWLISTL--TNELFKVDVISNLNVVNSARTSAHXXXXXXXXXXXXXXXXXTAIEVNDLTSSIIMGNGSGSLIQVKLDLLKMRKQANNYKTVPPGNTIWQMPTKSDVIDRDRIISKLPIGSQNRVIIDAVIHISARPGSRKHLLIGYRSGNSIIYNVQKDSVDFLLSAKSTLNALSWCPPDPIVQDNFMVAPNRNEPQYYSSMKLHSCHEDGSIITWNLPQNSDEFLVLDFQIFSPYKKDQKCLPISKILWKRYKQDY-LIVFSGGLPRSDYMTKSTITIMNNSCLDSSKANNEHLVLDLTSQLIDFTTIDDNDSGSV----EYLLVLTEEEFFIVDLTKESWPILHDRQPYLNCLHNSPITAYQFLSEVKSDWFQKLNEMSSNKEDCNISFSDWPIKGYAQKVRNDEIWQNDLLIIGHGDGTIVFWKFGMGGCMKKISTVKSSSLFKMADELHLN-EVSYEDDEIPLRRTGQFDPCCDDNRLAIQ---LIHYTGKHLLIGGYGGQIVLWGFQENKYEKHL--LDVDLTTHLSNFKWKGCQPFQHIEGSIKTGSNFQVMMSMCIFPPSQITALDILEDNNCNGYVIIACGTLHGLVIVSCPKETNLEALVLTTHCTV-PRNTLASQEASLGEGWARRRTXXXXXXXXXXXXXXXXXXXXXMEHPS-VSRHLSDNNDKTMRXXXXXXXXXXXXXXXXDRPKDTANDGLIRSIRINVSLIKRKGSNGPHEKLLNLFAGCYGGLLLWFQSDYSVENILKNSPINLRLIKQYQFQHRAPILHFNMLSPESGLSKLNENPDAGFDL--DPNRKPDH-LVVLTEEQVRLYAFPSFTLKCKIRVTAHDGFRLKNGSLIVFSDDR 2946
            +PS + Y   L +L I ++ G IK++G PGV +    +  + +  I  +PG    VTL  DN L LW +      +EL + D    L     A  SA                 IT +  +     + +G  SG++  V+L   +                      +   I  D ++ +LP  +++R + + V  +   P     +LIGY  G  +I+++Q   V +   +   L  + W       +D  +               L SCH DGS   W  P +S+       +   PY     C  I++ILW   +Q     +F GG+PR+ Y  +  I++++         + +    D TS++I FT + + D  +       L+VL EEE  ++DL    WP +  + PYL  LH S IT    +S +    ++++    S +++ + S  +WPI G           Q DLL+ GH DGT+ FW    G C++ +  + +  +F    + + N     ED+  PLR+ G FDP  DD RL IQ   L  Y+G +L + G  GQ+++    +   E+ +  ++ DL      ++WKG +      G ++    FQ  + +   PP+ +T+L +  +     + ++A GT HG  +    +        +   CT+ P + LA       EG   R     K   +S  R  R R + R  HP+       + + K  R  L   E+   +R IE R  + +  G +R++    + +K    + P     +L+AG  GG +  F           + P+     K+ Q  HRAP++   +L   S    L E  +   DL   P+ +  H L+V++EEQ +++  P  + K K+++TA +G R++  S+  F   R
Sbjct:   34 QPSALGYSPSLRILAIGTRSGAIKLYGAPGVEFMGLHQENNAVTQIHLLPGQCQLVTLLDDNSLHLWSLKVKGGASEL-QEDESFTLRGPPGAAPSA---------------TQITVVLPHSSCELLYLGTESGNVFVVQLPAFRA--------------------LEDRTISSDAVLQRLPEEARHRRVFEMVEALQEHPRDPNQILIGYSRGLVVIWDLQGSRVLYHFLSSQQLENIWW------QRDGRL---------------LVSCHSDGSYCQW--PVSSEAQQPEPLRSLVPYGPF-PCKAITRILWLTTRQGLPFTIFQGGMPRASYGDRHCISVIH---------DGQQTAFDFTSRVIGFTVLTEADPAATFDDPYALVVLAEEELVVIDLQTAGWPPV--QLPYLASLHCSAITCSHHVSNIPLKLWERIIAAGS-RQNAHFSTMEWPIDGGTSLTPAPP--QRDLLLTGHEDGTVRFWD-ASGVCLRLLYKLSTVRVFLTDTDPNENFSAQGEDEWPPLRKVGSFDPYSDDPRLGIQKIFLCKYSG-YLAVAGTAGQVLVLELNDEAAEQAVEQVEADLLQDQEGYRWKGHERLAARSGPVRFEPGFQPFVLVQCQPPAVVTSLALHSE-----WRLVAFGTSHGFGLFDHQQRRQ-----VFVKCTLHPSDQLAL------EGPLSRVKSLKKSLRQSFRRMRRSRVSSRKRHPAGPPGEAQEGSAKAERPGLQNMELAPVQRKIEARSAEDSFTGFVRTLYFADTYLKDSSRHCP-----SLWAGTNGGTIYAFSLRVPPAERRMDEPVRAEQAKEIQLMHRAPVVGILVLDGHS--VPLPEPLEVAHDLSKSPDMQGSHQLLVVSEEQFKVFTLPKVSAKLKLKLTALEGSRVRRVSVAHFGSRR 855          
BLAST of Protein lethal(2) giant larvae vs. UniProt/SwissProt
Match: sp|Q3TJ91|L2GL2_MOUSE (LLGL scribble cell polarity complex component 2 OS=Mus musculus OX=10090 GN=Llgl2 PE=1 SV=2)

HSP 1 Score: 212.231 bits (539), Expect = 5.992e-55
Identity = 202/845 (23.91%), Postives = 359/845 (42.49%), Query Frame = 1
Query:  238 EPSCIDYDHKLSLLGIASKKGLIKIFGCPGVCYSTRLEGQDEIWNIKFIPGTNFFVTLTADNKLILWLISTL--TNELFKVDVISNLNVVNSARTSAHXXXXXXXXXXXXXXXXXTAIEVNDLTSSIIMGNGSGSLIQVKLDLLKMRKQANNYKTVPPGNTIWQMPTKSDVIDR----DRIISKLPIGSQNRVIIDAVIHISARPGSRKHLLIGYRSGNSIIYNVQKD-SVDFLLSAKSTLNALSWCPPDPIVQDNFMVAPNRNEPQYYSSMKLHSCHEDGSIITWNLPQNSDEFLVLDFQI-FSPYKKDQKCLPISKILWKRYKQDY-LIVFSGGLPRSDYMTKSTITIMNNSCLDSSKANNEHLVLDLTSQLIDFTTIDDNDSGSV----EYLLVLTEEEFFIVDLTKESWPILHDRQPYLNCLHNSPITAYQFLSEVKSDWFQKLNEMSSNKEDCNISFSDWPIKGYAQKVRNDEIWQNDLLIIGHGDGTIVFWKFGMGGCMKKISTVKSSSLFKMADELHLNEVSYEDDE-IPLRRTGQFDPCCDDNRLAIQ---LIHYTGKHLLIGGYGGQIVLWGFQENKYEKHL--LDVDLTTHLSNFKWKGCQPFQHIEGSIKTGSNFQVMMSMCIFPPSQITALDILEDNNCNGYVIIACGTLHGLVIVSCPKETNLEALVLTTHCTVPRNTLASQEASLGEGWARRRTXXXXXXXXXXXXXXXXXXXXXMEHPSVSRHLSDNNDKTMRXXXXXXXXXXXXXXXXDRPKDTANDGLIRSIRINVSLIKRKGSNGPHEKLLNLFAGCYGGLLLWFQSDYSVENILKNSPINLRLIKQYQFQHRAPIL 2715
            +PS + Y   L +L I ++ G +K++G PGV +    +  + +  I F+PG    VTL  DN L LW +      +EL + +  +      +A                      +A +V +     I+ + SG       +LL +  ++ N   V       Q+P    + DR    D ++  LP  +++R + + V  +   P     +LIGY  G  +I+++Q   ++   LS++   NA SW       +D  ++                +CH DGS   W +  ++     L   I + P+     C  I+KI W   +Q     +F GG+PR+ Y  +  I++++N          +    D TS++IDFT + + D  +       L+VL EEE  ++DL    WP +  + PYL  LH S IT    +S +    ++++    S +++ + S  +WPI G           Q DLL+ GH DGT+ FW    G C++ +  + +  +F    +   N ++  +DE  PLR+ G FDP  DD RL IQ   L  Y+G +L + G  GQ+++    +   E  +  ++ DL      ++WKG +      G +   + FQ  + +   PP+ +T+L +  +     + ++A GT HG  +    +        +   CT+  +   + E  L    + +++           R    +       P+        N K  R  L   E+   +R IE R  + +  G +R++    + ++    + P     +L+AG  GG +  F           + P+     K+ Q  HRAP++
Sbjct:   34 QPSALGYSPSLRILAIGTRSGAVKLYGAPGVEFMGLHKENNAVLQIHFLPGQCQLVTLLDDNSLHLWSLKVKGGVSELQEEESFTLRGPPGAA---------------------PSATQVTE-----ILPHSSG-------ELLYLGTESGNVFVV-------QLPGFRTLHDRTICSDEVLQWLPEEARHRRVFEMVEALQEHPRDPNQILIGYSRGLVVIWDLQGSRALSHFLSSQQLENA-SW------QRDGCLIV---------------TCHSDGSHCQWPVSSDTQNPEPLRSSIPYGPFP----CKAITKIFWLTTRQGLPFTIFQGGMPRASYGDRHCISVVHN---------GQQTAFDFTSRVIDFTVLSEADPAAAFDDPYALVVLAEEELVVIDLQTPGWPPV--QLPYLASLHCSAITCSHHVSNIPLKLWERIIAAGS-RQNSHFSTMEWPIDGGTSLAPPPP--QRDLLLTGHEDGTVRFWD-ASGVCLRLLYKLSTVRVFLTDTDPSENLIAQGEDEWPPLRKVGSFDPYSDDPRLGIQKIFLCKYSG-YLAVAGTAGQVLVLELNDEAAEHAVEQVEADLLQDQEGYRWKGHERLAARPGPVCFEAGFQPFVLVQCQPPAVVTSLALHSE-----WRLVAFGTSHGFGLFDHQQRRQ-----VFVKCTLHPSDQLALEGPLSRVKSLKKSLRQSFRRMRRSRVSSHKRRPGG--PTGEAQAQAVNIKAERTGLQNMELAPVQRKIEARSAEDSFTGFVRTLYFADTYLRDSSRHCP-----SLWAGTNGGTVYAFSLRVPPAERRTDEPVRAEQAKEIQLMHRAPVV 779          
BLAST of Protein lethal(2) giant larvae vs. UniProt/SwissProt
Match: sp|Q7SZE3|L2GL2_DANRE (LLGL scribble cell polarity complex component 2 OS=Danio rerio OX=7955 GN=llgl2 PE=1 SV=1)

HSP 1 Score: 211.075 bits (536), Expect = 1.537e-54
Identity = 237/957 (24.76%), Postives = 406/957 (42.42%), Query Frame = 1
Query:  193 EFYKKQSIEDFGSIPEPSCIDYDHKLSLLGIASKKGLIKIFGCPGVCYSTRLEGQDEIWNIKFIPGTNFFVTLTADNKLILWLISTLTN--ELFKVDVISNLNVVNSARTSAHXXXXXXXXXXXXXXXXXTAIEVNDLTSSIIMGNGSGSLIQVKLDLLKMRKQANNYKTVPPGNTIWQMPTKSDVIDRDRIISKLPIGSQNRVIIDAVIHISARPGSRKHLLIGYRSGNSIIYNVQKDSVDFLLSAKSTLNALSWCPPDPIVQDNFMVAPNRNEPQYYSSMKLHSCHEDGSIITWNL----PQNSDEFLVLDFQIFSPYKKDQKCLPISKILWKRYKQDY-LIVFSGGLPRSDYMTKSTITIMNNSCLDSSKANNEHLVLDLTSQLIDFTTI--DDNDSGSVEYLLVLTEEEFFIVDLTKESWPILHDRQPYLNCLHNSPITAYQFLSEVKSDWFQKLNEMSSNKEDCNISFSDWPIKGYAQKVRNDEIWQNDLLIIGHGDGTIVFWKFGMGGCMKKISTVKSSSLFKM-ADELHLNEVSYEDDEIPLRRTGQFDPCCDDNRLAIQLIH---YTGKHLLIGGYGGQIVLWGFQENKYEKHLLD--VDLTTHLSNFKWKGCQPFQHIEGSIKTGSNFQVMMSMCIFPPSQITALDILEDNNCNGYVIIACGTLHGLVIVSCPKETNLEALVLTTHCTV-PRNTLASQEASLGEGWARRRTXXXXXXXXXXXXXXXXXXXXXMEHPSVSRHLSDNNDKTMRXXXXXXXXXXXXXXXXDRPKDTANDGLIRSIRINVSLIKRKGSNGPHEKLLNLFAGCYGGLLLWFQSDYSVENILKNSPINLRLIKQYQFQHRAPILHFNMLSPESGLSKLNENPDAGFDLDPNRKPD-----HLVVLTEEQVRLYAFPSFTLKCKIRVTAHDGFRLKNGSLIVFSDDRLTTQNNTKEPLICATNNG 3000
            + Y+     + G   +PS + +   L LL I ++ G IK++G PGV +    +    +  + F+P     VTL  DN L +W +    +  EL ++   + L+    A  S                  +TA+  +     +++G   G +  V++   +  ++ N                    I  + + +++P     R  +++V  +   P + + +LIGY  G  +++++ +            L ++ W      ++D   +                S H DGS   W +    PQ   E     +  F        C  ISKI+    KQ    ++FSGG+PR+ Y  +  I+++++           H  LD TS++IDF  I   +N  G    L+VL EEE  +VDL  E WP++  + PYL  LH S IT    +S +    ++++    ++ ++ + S   WPI G  + +  D   Q DLL+ GH DGT+ FW    G C+  +  + ++ +F   AD         E +  P R+ G FDP  DD RL IQ IH   Y+G +L + G  GQI++    +   E+ +    VDL      F+WKG       E  +     FQ    +   PP+ +TA+ +  +     + ++  GT HG  +    +  N     +   CT+ P + +A       EG   R     K   +S  R  R R + R  H + +  L + N +     L E E+   +R IE R  D +  GL+R++    + +     + P     +L+AG  GG +  +      +      P+     K+ Q  HRAP++   +L  +   + L E  +   DL   R P+     HL+V++EEQ +L+  P  + K K+++TA DG R++   +  F      T    +  L+  TN G
Sbjct:   19 DLYQFNKTVEHGFPHQPSALGFSPSLELLAIGTRSGAIKLYGAPGVEFMGLHDENAAVTQVHFLPNQVELVTLLEDNSLHMWTLRAHNSMCELLEIGRFT-LSGPPGAIPSV---------------TRVTAVLAHSSGELLLLGTEGGHVFVVEVPGFRELEENN--------------------ISVEDVQNRVPEDYVGRRNLESVETLHENPLNPRQVLIGYSRGLMVLWDLDRQRPVQHFLGTQQLESVWW------MEDGESIL---------------SSHSDGSYCQWTVTGEDPQTEPEKQETPYGAFP-------CKAISKIIQLPSKQGPPFLIFSGGMPRASYGDRHCISVIHSKT---------HEALDFTSRIIDFFVIREGENHKGEPSALVVLVEEELVVVDLQTEGWPVI--QTPYLVPLHCSAITCSHHVSSIPLKLWERVQAAGAH-QNTHYSRKPWPING-GKNLAPDPP-QRDLLLTGHEDGTVRFWD-ASGVCLYPMYKLSTAGVFHTDADPNDNMNQGSEGEWPPFRKVGCFDPYSDDPRLGIQKIHLCKYSG-YLTVAGTAGQILVLELNDEAAEQMVEATVVDLLQGQEGFRWKGQARLDVREEPVLFPPGFQPFALVQCQPPAVVTAIALHSE-----WKLVGFGTSHGFGLYDYNQRNN-----IMVKCTLNPSDQMAM------EGPLSRVKSIKKSLRQSFRRIRRSRVSMRKHHTNNAAKLQEINARLEAEALQEMELAPVQRKIEARSSDDSFTGLVRTLYFADTFVSDSSHSTP-----SLWAGTNGGAVFAYVLRVPPQERRAEDPVTAHAAKEIQLMHRAPVVGLVVLDGKG--APLPEPLEVAHDL--ARSPEMHGSHHLLVVSEEQFKLFTLPKVSSKSKLKLTAVDGSRVRRVGVAWFGS---RTDEQLESCLVVLTNQG 867          
BLAST of Protein lethal(2) giant larvae vs. UniProt/SwissProt
Match: sp|Q5RCX2|L2GL2_PONAB (LLGL scribble cell polarity complex component 2 OS=Pongo abelii OX=9601 GN=LLGL2 PE=2 SV=1)

HSP 1 Score: 210.69 bits (535), Expect = 2.105e-54
Identity = 168/659 (25.49%), Postives = 287/659 (43.55%), Query Frame = 1
Query:  238 EPSCIDYDHKLSLLGIASKKGLIKIFGCPGVCYSTRLEGQDEIWNIKFIPGTNFFVTLTADNKLILWLISTL--TNELFKVDVISNLNVVNSARTSAHXXXXXXXXXXXXXXXXXTAIEVNDLTSSIIMGNGSGSLIQVKLDLLKMRKQANNYKTVPPGNTIWQMPTKSDVIDRDRIISKLPIGSQNRVIIDAVIHISARPGSRKHLLIGYRSGNSIIYNVQKDSVDFLLSAKSTLNALSWCPPDPIVQDNFMVAPNRNEPQYYSSMKLHSCHEDGSIITWNLPQNSDEFLVLDFQIFSPYKKDQKCLPISKILWKRYKQDY-LIVFSGGLPRSDYMTKSTITIMNNSCLDSSKANNEHLVLDLTSQLIDFTTIDDNDSGSV----EYLLVLTEEEFFIVDLTKESWPILHDRQPYLNCLHNSPITAYQFLSEVKSDWFQKLNEMSSNKEDCNISFSDWPIKGYAQKVRNDEIWQNDLLIIGHGDGTIVFWKFGMGGCMKKISTVKSSSLFKMADELHLNEVSYEDDE-IPLRRTGQFDPCCDDNRLAIQ---LIHYTGKHLLIGGYGGQIVLWGFQENKYEKHL--LDVDLTTHLSNFKWKGCQPFQHIEGSIKTGSNFQVMMSMCIFPPSQITALDILEDNNCNGYVIIACGTLHGL 2175
            +PS + Y   L +L I ++ G IK++G PGV +       + +  I  +PG    VTL  DN L LW +      +EL + D    L     A  SA                 IT +  +     + +G  SG++  V+L   +                      +   I  D ++ +LP  +++R + + V  +   P     +LIGY  G  +I+++Q   V +   +   L  + W       +D  ++                SCH DGS   W  P +S+       +   PY     C  I+KILW   +Q     +F GG+PR+ Y  +   ++++         + +    D TS++IDFT + + D  +       L+VL EEE  ++DL    WP +  + PYL  LH S IT    +S +    ++++    S +++ + S  +WPI G           Q DLL+ GH DGT+ FW    G C++ +  + +  +F    + + N  ++ +DE  PLR+ G FDP  DD RL IQ   L  Y+G +L + G  GQ+++    +   E+ +  ++ DL      ++WKG +      G ++    FQ  + +   PP+ +T+L +  +     + ++A GT HG 
Sbjct:   34 QPSALGYSPSLRILAIGTRSGAIKLYGAPGVEFMGLHRENNAVTQIHLLPGQCQLVTLLDDNSLHLWSLKVKGGASEL-QEDESFTLRGPPGAAPSA---------------TQITVVLPHSSCELLYLGTESGNVFVVQLPAFRA--------------------LEDRTISSDAVLQRLPEEARHRRVFEMVEALQEHPRDPNQILIGYSRGLVVIWDLQGSRVLYHFLSSQQLENIWW------QRDGRLLV---------------SCHSDGSYCQW--PMSSEAQQPEPLRSLVPYGPF-PCKAITKILWLTTRQGLPFTIFQGGMPRASYGDRHCTSVIH---------DGQQTAFDFTSRVIDFTVLTEADPAAAFDDPYALVVLAEEELVVIDLQTAGWPPV--QLPYLASLHCSAITCSHHVSNIPLKLWERIIAAGS-RQNAHFSTMEWPIDGGTSLTPAPP--QRDLLLTGHEDGTVRFWD-ASGVCLRLLYKLSTVRVFLTDTDPNENLSAHGEDEWPPLRKVGSFDPYSDDPRLGIQKIFLCKYSG-YLAVAGTAGQVLVLELNDEAAEQAVEQVEADLLQDQEGYRWKGHERLAAHSGPVRFEPGFQPFVLVQCQPPAVVTSLALHSE-----WRLVAFGTSHGF 611          
BLAST of Protein lethal(2) giant larvae vs. UniProt/SwissProt
Match: sp|Q15334|L2GL1_HUMAN (Lethal(2) giant larvae protein homolog 1 OS=Homo sapiens OX=9606 GN=LLGL1 PE=1 SV=3)

HSP 1 Score: 185.652 bits (470), Expect = 1.773e-46
Identity = 185/741 (24.97%), Postives = 327/741 (44.13%), Query Frame = 1
Query:  850 LLIGYRSGNSIIYNVQKDSVDFLLSAKSTLNALSWCPPDPIVQDNFMVAPNRNEPQYYSSMKLHSCHEDGSIITWNLPQNSDEFLVLDFQIFSPYKKDQKCLPISKILWKRYKQD-YLIVFSGGLPRSDYMTKSTITIMNNSCLDSSKANNEHLVLDLTSQLIDFTTI----DDNDSGSVEYLLVLTEEEFFIVDLTKESWPILHDRQPYLNCLHNSPITAYQFLSEVKSDWFQKLNEMSSNKEDCNISFS-DWPIKGYAQKVRN--DEIWQNDLLIIGHGDGTIVFWKFGMGGCMKKISTVKSSSLFKMADELHLNEVS--YEDDEIPLRRTGQFDPCCDDNRLAIQ---LIHYTGKHLLIGGYGGQIVLWGFQENKYEK--HLLDVDLTTHLSNFKWKGCQPFQHIEGSIKTGSNFQVMMSMCIFPPSQITALDILEDNNCNGYVIIACGTLHGLVIVSCPKETNLEALVLTTHCTV-PRNTLASQEASLGEGWARRRTXXXXXXXXXXXXXXXXXXXXXMEHPSVSRHLSDNNDKTMRXXXXXXXXXXXXXXXXD-RPKDTANDGLIRSIRINVSLIKRKGSNGPHEKLLNLFAGCYGGLLLWFQSDYSVENI----LKNSPINLRLIKQYQFQHRAPILHFNMLSPESGLSKLNENPDAGFDL--DPNRKPDHLVVL-TEEQVRLYAFPSFTLKCKIRVTAHDGFRLKNGSLIVFSDDRLTTQNNTKEPLICATNNG 3000
            +LIGY  G  +I+N     VD +      L +L W                R+      S  + S H DGS   W++  ++  F  L   + +       C  I+KILW+  +   + I+FSGG+PR+ Y  +  ++++    L         + LD TS++IDF T+     +++    + L VL EEE  ++DL    WP +    PYL  LH+S IT    ++ V +  + ++      +    +S +  WPI G     RN   E  Q  LL+ GH DGT+ FW    G  ++ +  + ++ LF+  D  H + ++   EDD  P R+ G FDP  DD RL +Q   L  YT + +++ G  GQ+++    +   E+   +  +DL      F WKG +      G +   + FQ  + +   PP+ +TA+ +  +     + ++A GT HG  +    +++ + A      CT+ P ++LA       EG   R     K   +S  R  + R + +    + S  L + N +        +      +   + R  D +  G++R +    + ++    +GP      ++AG   G +  +  +     +         +   L K+ Q  HRAP++   +L        L E  +A  DL   P+ +  H V++ +EEQ +++  P  + K K ++TAH+G R++  +L  F+   +  ++  +  L C TN G
Sbjct:  211 ILIGYSRGLLVIWNQASQCVDHIFLGNQQLESLCW---------------GRD------SSTVVSSHSDGSYAVWSV--DAGSFPTLQPTVATTPYGPFPCKAINKILWRNCESGGHFIIFSGGMPRASYGDRHCVSVLRAETL---------VTLDFTSRIIDFFTVHSTRPEDEFDDPQALAVLLEEELVVLDLQTPGWPAVP--APYLAPLHSSAITCSAHVASVPAKLWARIVSAGEQQSPQPVSSALSWPITGG----RNLAQEPSQRGLLLTGHEDGTVRFWD-ASGVALRPLYKLSTAGLFQT-DCEHADSLAQAAEDDWPPFRKVGCFDPYSDDPRLGVQKVALCKYTAQ-MVVAGTAGQVLVLELSDVPVEQAVSVAIIDLLQDREGFTWKGHERLSPRTGPLPWPAGFQPRVLVQCLPPAAVTAVTLHTE-----WSLVAFGTSHGFGLFDYQRKSPVLA-----RCTLHPNDSLAM------EGPLSRVKSLKKSLRQSFRRIRKSRVSGKKRAANASSKLQEANAQLAEQACPHDVEMTPVQRRIEPRSADDSLSGVVRCLYFADTFLRDGAHHGP-----TMWAGTNSGSVFAYALEVPAAAVGGEKRPEQAVEAVLGKEVQLMHRAPVVAIAVLDGRG--RPLPEPYEASRDLAQAPDMQGGHAVLIASEEQFKVFTLPKVSAKTKFKLTAHEGCRVRKVALATFAS--VACEDYAETCLACLTNLG 885          
BLAST of Protein lethal(2) giant larvae vs. TrEMBL
Match: A0A087VX44 (Lethal2 giant larvae protein 2 OS=Echinococcus multilocularis OX=6211 GN=EmuJ_000060600 PE=4 SV=1)

HSP 1 Score: 322.013 bits (824), Expect = 2.215e-88
Identity = 233/837 (27.84%), Postives = 369/837 (44.09%), Query Frame = 1
Query:  106 MTQSIFNSVRKL--NFYNFKTKYINQNESIGEFYKKQSIEDFGSIPEPSCIDYDHKLSLLGIASKKGLIKIFGCPGVCYSTRLEGQDEIWNIKFIPGTNFFVTLTADNKLILWLISTLTNELFKVDVISNLNVVNSARTSAHXXXXXXXXXXXXXXXXXTAIEVNDLTSSIIMGNGSGSLIQVKLDLLKMRKQANNYKTVPPGNTIWQMPTKSDVIDRDRIISKLPIGSQNRVIIDAVIHISARPGSRKHLLIGYRSGNSIIYNVQKDSVDFLLSAKSTLNALSWCPPDPIVQDNFMVAPNRNEPQYYSSMKLHSCHEDGSIITWNLP------QNSDEFLVLDFQIFS----PYKKDQKCLPISKILWKRYKQDYLIVFSGGLPRSDYMTKSTITIMNNS-----------------------CLDSSKANN------------------------------EHLVLDLTSQLIDFTTIDDNDSGSVEYLLVLTEEEFFIVDLTKESWPILHDRQPYLNCLHNSPITAYQFLSEVKSDWFQKLNEMSSNKEDCNI-------SFSDWPIKGYAQKVRNDE----IWQNDLLIIGHGDGTIVFWKFGMGGCMKKISTVKSSSLFK------MADELHLNEVSYEDDEIPLRRTGQFDPCCDDNRLAIQLIHYTGKHLLIGGYGGQIVLWGFQENKYEKHLLDVDLTTHLSNFKWKGCQPFQ------HIEGSIKTGSNFQVMMSMCIFPPSQITALDILEDNNCNGY---------------VIIACGTLHGLVIVS-CPKETNLEALVLTTHCTVPRNTLASQEASLGEGWARRRT 2304
            M Q IF S R+L     + + K  +  E +G  YK     + G   +PS + YD  L +  +A++ G++ +FG PGV Y    +G  EI  + F  G    +TL+ D+ + LW I +       +  I  L+ V+ A  S H + D   +  + I    TA+ V+   SSI++G   G++  ++ +     KQ  +       NT+W MP+K  +I   R +  +    + R+ +DAV+ +  RP     LLIGY SG  ++Y++Q + V  LL  +  L A +WC    +     +  P    P      ++ + + +GS+  W +P        + E      Q+      PY     C  ISK+ W    +  + +F+GG+PRS Y  ++T++I+  S                       C  S+                                  EH+ LDL S ++D   +     G V  LL+L EEE   +DL    WP+L    PYLNCLH S +T Y   ++V   + + L  +    +   +       S   WPI+G     RN+     +  NDLLI GH +GT+ FW+   GGC +KI ++ + SLF+       A + H       +   P RR G FDP  DD R AI++IH     L++GG  GQ+ +W     K     LDV +   +  F+WKG  P        +    +   S F + +++C  PPS +T L + E ++ +                 V++  GT HG  ++     E    + +L  H T+P N  A +EA++GEGWARRRT
Sbjct:    1 MAQRIFQSFRRLPSQLTSVRKKQ-DTVEVVGSHYKINVCSNVGFPAKPSSLAYDQSLDVFALATRDGILYVFGKPGVVYYGSHKGALEIIKVLFFTGMGKLLTLSVDDMIYLWEIVSPNGNQPGLQNIGQLSGVSDALESKHLEVDPIGDITSHI----TALIVSSSNSSILVGTDQGNVAPIRRN--THVKQGVDQDE----NTMWIMPSKDKIITPHRALQSISPEKRTRLRLDAVVVLLERPSYPSQLLIGYSSGICLLYDLQGERVLALLPCQYELEAATWCGGSGLPVRGTVTNPTATPPHL--GTRVLTAYGNGSLGVWQIPLFATGPGLATELGTQTLQMMESPSMPYGPF-PCKLISKVFWLPSYEGGITIFTGGMPRSIYGNRNTVSILRGSNLDQAAAANLAAALRADSEGDADCERSTAGQEFYDGGANADILLPSGLVPGAPVHVFDSDAPEHVCLDLPSLVVDVCPLGPA-GGPVTGLLILCEEELIAIDLLTPGWPLLE--LPYLNCLHASSLTTYGLFTQVNPAFLEGLEAIGGGADAVGLVPRATGLSTRTWPIQGGELGRRNEVSEPVVPSNDLLITGHENGTLQFWRLAAGGCARKIFSLFTGSLFEGDFGPDAAGDTHQTCEEESEPWPPFRRAGLFDPFMDDVRAAIKVIHLVDSTLVVGGAAGQVSVWQLAPTKPTMATLDVPIAPEVPGFRWKGYAPLTLRRNQLNQPKRLAGASLFPMAVALCQ-PPSPVTCLSVCELSDFSAMDKSLQPSPQSSPTIGVLVGMGTAHGFALMHISASEGGFASHLLLHHSTIPSNAEALEEAAVGEGWARRRT 819          

HSP 2 Score: 102.449 bits (254), Expect = 3.927e-18
Identity = 77/274 (28.10%), Postives = 130/274 (47.45%), Query Frame = 1
Query: 2473 DRPKDTANDGLIRSIRINVSLIKR------------KGSNGPHEKLLNLFAGCYGGLLLWFQSDYSVENILKNSPINLRLIKQYQFQHRAPILHFNMLSPESGLSKLNEN------PDAGFDLDPNRKPDHLVVLTEEQVRLYAFPSFTLKCKIRVTAHDGFRLKNGSLIVFSDDRLTTQNNTK----EPLICATNNGGQFLLLNCVNLKRKDVVQFVDKTDLMALNFMSLAKNANLSNTRTLCP-YGICYSGQGQVTLFEII---SKTKTIGT 3216
            DRP  TAN  L+R +     L  R              +    + L + FA   GG    F      +N+ + S + LR   Q Q QHRAPI+   ++  ++    L  +               +  P HL+V++EEQVRL++ PS +L+ K R+TA DGFR+K G+++ F   +L+ + N      E     TNNGGQ ++L+   L+R+D +  +   D++ +N +  A  A+        P  G+  +  GQ+ +F+++    ++  +GT
Sbjct:  936 DRPATTANTALVRCMAFGPPLHHRLRPPAAGITASTSATIETSQLLGSFFAATAGGATFVFA--LYTDNVRRPSHLALRQATQMQLQHRAPIVALRLIDTKTHCPLLTSSVYLPQFSSPLVPPHHHPLPPHLMVISEEQVRLFSLPSISLRQKARITAKDGFRIKTGNIMAFG--QLSNERNMGIYGVEFNCVFTNNGGQAVVLSVPYLRRRDTIALLGGADVLEINSIVFATAASTRPKVIAAPSLGVYQTAPGQLAIFDMVLAGQRSSALGT 1205          
BLAST of Protein lethal(2) giant larvae vs. TrEMBL
Match: A0A068WQJ7 (Lethal2 giant larvae protein 2 OS=Echinococcus granulosus OX=6210 GN=EgrG_000060600 PE=4 SV=1)

HSP 1 Score: 316.235 bits (809), Expect = 2.736e-86
Identity = 233/841 (27.71%), Postives = 371/841 (44.11%), Query Frame = 1
Query:  106 MTQSIFNSVRKL--NFYNFKTKYINQNESIGEFYKKQSIEDFGSIPEPSCIDYDHKLSLLGIASKKGLIKIFGCPGVCYSTRLEGQDEIWNIKFIPGTNFFVTLTADNKLILWLISTLTNELFKVDVISNLNVVNSARTSAHXXXXXXXXXXXXXXXXXTAIEVNDLTSSIIMGNGSGSLIQVKLDLLKMRKQANNYKTVPPGNTIWQMPTKSDVIDRDRIISKLPIGSQNRVIIDAVIHISARPGSRKHLLIGYRSGNSIIYNVQKDSVDFLLSAKSTLNALSWCPPDPIVQDNFMVAPNRNEPQYYSSMKLHSCHEDGSIITWNLP------QNSDEFLVLDFQIFS----PYKKDQKCLPISKILWKRYKQDYLIVFSGGLPRSDYMTKSTITIMNNS-----------------------CLDSSKANN------------------------------EHLVLDLTSQLIDFTTIDDNDSGSVEYLLVLTEEEFFIVDLTKESWPILHDRQPYLNCLHNSPITAYQFLSEVKSDWFQKLNEMSSNKEDCN-------ISFSDWPIKGYAQKVRNDE----IWQNDLLIIGHGDGTIVFWKFGMGGCMKKISTVKSSSLFKM---ADELHLNEVSYEDDE---IPLRRTGQFDPCCDDNRLAIQLIHYTGKHLLIGGYGGQIVLWGFQENKYEKHLLDVDLTTHLSNFKWKGCQPF----------QHIEGSIKTGSNFQVMMSMCIFPPSQITALDILEDNNCNGY---------------VIIACGTLHGLVIVS-CPKETNLEALVLTTHCTVPRNTLASQEASLGEGWARRRT 2304
            M Q IF S R+L     + + K  +  E +G  YK     + G   +PS + YD  L +  +A++ G++ +FG PGV Y    +G  EI  + F  G    +TL+ D+ + +W I +       +  I  L+ V+ A  S H + D   +  + I    TA+ V+   SSI++G   G++  ++ +     KQ  +       NT+W MP+K  +I   R +  +    + R+ +DAV+ +  RP     LLIGY SG  ++Y++Q + V  LL  +  L A +WC    +     +  P    P      ++ + + +GS+  W +P        + E      Q+      PY     C  ISK+ W    +  + +F+GG+PRS Y  ++T++I+  S                       C  S+                                  EH+ LDL S ++D   +     G V  LL+L EEE   +DL    WP+L    PYLNCLH S +T Y   ++V   + + L  +    +          +S   WPI+G     RN+     +  +DLLI GH +GT+ FW+   GGC +KI  + + SLF+     D +     + E++     P RR G FDP  DD R AI++IH     L++GG  GQ+ +W     K     LDV +   +  F+WKG  P           Q + G+    S F + +++C  PPS +T L   E ++ +                 V++  GT HG  ++     E    + +L  H T+P N  A +EA++GEGWARRRT
Sbjct:    1 MAQRIFQSFRRLPSQLTSVRKKQ-DTVEVVGSHYKINVCSNVGFPAKPSSLAYDQSLDIFALATRDGILYVFGKPGVVYYGSHKGALEIIKVLFFTGMGKLLTLSVDDIIYVWEIVSPNGNQPGLQNIGQLSGVSDALESKHLEVDPIGDITSHI----TALIVSSSNSSILVGTDQGNVAPIRRN--THVKQGVDQDE----NTMWIMPSKDKIITPHRALQSISPEKRTRLRLDAVVVLLERPSYPSQLLIGYSSGICLLYDLQGERVLALLPCQYELEAATWCGGSGLPVRGAVANPTATPPHL--GTRVLTAYGNGSLGVWQIPLFATGPGLATELGTQTLQMMESPSMPYGPF-PCKLISKVFWLPSHEGGITIFTGGMPRSIYGDRNTVSILRGSNLDQAAAANLAAALRADSEGDADCERSTAGQEFYDGGANADILLPSGLVPGAPVHVFDSDAPEHVCLDLPSLVVDVCPLGPA-GGPVTGLLILCEEELIAIDLLTPGWPLLE--LPYLNCLHASSLTTYGLFTQVNPAFLEGLEAIGGGADAVGPVPRATGLSTRTWPIQGGELGRRNEVSEPVVPSDDLLITGHENGTLQFWRLAAGGCARKIFCLFTGSLFEGDFGPDAVGDTHRACEEESEPWPPFRRVGLFDPFMDDVRAAIKVIHLVDSTLVVGGAAGQVSVWQLAPTKPTMATLDVPVAPEVPGFRWKGYAPLTLRRNQLDQPQRLAGA----SLFPMAVALCQ-PPSPVTCLSACELSDFSAMDKSLQPSPQPSPTIGVLVGMGTAHGFALMHISASEGGFASHLLLHHSTIPSNAEALEEAAVGEGWARRRT 819          

HSP 2 Score: 105.531 bits (262), Expect = 5.237e-19
Identity = 81/274 (29.56%), Postives = 134/274 (48.91%), Query Frame = 1
Query: 2473 DRPKDTANDGLIRSIRINVSLIKR------------KGSNGPHEKLLNLFAGCYGGLLLWFQSDYSVENILKNSPINLRLIKQYQFQHRAPILHFNMLSPESGLSKLNEN---PDAGFDL---DPNRKPDHLVVLTEEQVRLYAFPSFTLKCKIRVTAHDGFRLKNGSLIVFSDDRLTTQNNTKEPLI---CA-TNNGGQFLLLNCVNLKRKDVVQFVDKTDLMALNFMSLAKNANLSNTRTLCP-YGICYSGQGQVTLFEII---SKTKTIGT 3216
            DRP  TAN  L+R +     L  R              +    + L + FA   GG    F      +N+ + S + LR   Q Q QHRAPI+   ++  ++    L  +   P     L     +  P HL+V++EEQVRL++ PS +L+ K R+TA DGFR+K G+++ F   +L+ + N     I   C  TNNGGQ ++L+   L+R+D +  +   D++ +N +  A  A+     T  P  G+  +  GQ+ +F+++    ++  +GT
Sbjct:  936 DRPAATANTALVRCMAFGPPLHHRLRPPAAGITASTSATIETSQLLGSFFAATAGGATFVFA--LYTDNVRRPSHLALRQATQMQLQHRAPIVALRLIDTKTHCPLLTSSVYLPQFSSPLVPSHHHPLPPHLMVISEEQVRLFSLPSISLRQKARITAKDGFRIKTGNIMAFG--QLSNERNMGIYGIEFNCVFTNNGGQAVVLSVPYLRRRDTIALLGGADVLEINSIVFATAASTRPKVTAAPSLGVYQTAPGQLAIFDMVLAGQRSSALGT 1205          
BLAST of Protein lethal(2) giant larvae vs. TrEMBL
Match: A0A0X3Q0S6 (LLGL domain-containing protein OS=Schistocephalus solidus OX=70667 GN=TR123718 PE=4 SV=1)

HSP 1 Score: 311.612 bits (797), Expect = 1.341e-84
Identity = 225/846 (26.60%), Postives = 374/846 (44.21%), Query Frame = 1
Query:  106 MTQSIFNSVRKL-NFYNFKTKYINQNESIGEFYKKQSIEDFGSIPEPSCIDYDHKLSLLGIASKKGLIKIFGCPGVCYSTRLEGQDEIWNIKFIPGTNFFVTLTADNKLILWLISTLTNELFKVDVISNLNVVNSA--RTSAHXXXXXXXXXXXXXXXXXTAIEVNDLTSSIIMGNGSGSLIQVKLDLLKMRKQANNYKTVPPGNTIWQMPTKSDVIDRDRIISKLPIGSQNRVIIDAVIHISARPGSRKHLLIGYRSGNSIIYNVQKDSVDFLLSAKSTLNALSWCPPDPIVQDNFMVAPNRNEPQYYSSMKLHSCHEDGSIITWNLP-------QNSDEFLVLDFQIFSPYKKDQKCLPISKILWKRYKQDYLIVFSGGLPRSDYMTKSTITIMNNSCLDSSKANNEHLVLD----------------------------LTSQLIDFTTIDDNDSGSVEYL------------------------LVLTEEEFFIVDLTKESWPILHDRQPYLNCLHNSPITAYQFLSEVKSDWFQKLNEMSS---------NKEDCNISFSDWPIKG---------------YAQKVRNDEIWQNDLLIIGHGDGTIVFWKFGMGGCMKKISTVKSSSLF--KMADELHLNEVSYEDDE----IPLRRTGQFDPCCDDNRLAIQLIHYTGKHLLIGGYGGQIVLWGFQENKYEKHLLDVDLTTHLSNFKWKGCQP--FQHIEGSIKTGSNFQVMMSMCIFPPSQITALDILE--------------DNNCNGYVIIACGTLHGLVIVS-CPKETNLEA----LVLTTHCTVPRNTLASQEASLGEGWARRRT 2304
            M Q IF S R+L    +   +  +  E +G  YK     + G   +P+ + YDH L++  + +K GLI ++G PG+ Y    +   EI N+ F+ GT   +TL+  + + +W + +       V  + +L+ V     +       +   N    +  ++TA+  N   +SI  G  +G +       L  +   N +  +P  + +W +PT  + I   R++  +P   ++R+ +DAV+ +S RPG    LLIGY SG S+IY++  D V  +L  +  L A +WC    +   N    P    PQ     +L + H DGS+  W +P           + L ++     PY     C  ISK+ W    +  + +F+GG+PRS Y  +ST++++  S LD + A N    +                             L S L+    +   D+ + E++                        L+L EEE   VDL    WP+L    PYL+CLH S I+AY   + V + + ++L+ ++           + +   S   WP++G                +    +  +   DLL+ GH +GT+ FW+ G GGC +K+ T+ + SLF  +   +   +     DDE     P RR G FDP  DD R A++ I      L++GG  GQ+ +W F + K     +DV +   +  F+WKG  P   + +  S   G +   +      PP+QIT+L + E              +    G V++  GT HG  +V   P+ ++  A     ++    T+P N+ A +EA++GEGWARRRT
Sbjct:    1 MAQRIFQSFRRLPGQLSAMRRKQDSIEVVGNHYKINMFSNVGFPAKPASLAYDHALNIFALVTKDGLIYVYGKPGIVYVGSHQNASEIINVMFLSGTGKLLTLSDRDDIYIWQLESEDGTQPCVKQVCHLSAVTQGLEQRRVVVDQNSTENTFADVASHVTALYANTNGTSIYFGTENGHVA------LIHKNAQNKHGNLPHCHEVWTLPTYDESISPQRVLQTIPSEKRSRLRLDAVVVLSERPGFVGQLLIGYNSGLSLIYDLHADCVLAILPWQYGLEAATWCGGSGLPLRNASSRPMMQSPQL--GTRLLTAHADGSLGVWRVPVFSRIMGDQPAQTLSMEEAPSMPYGPF-PCKLISKVFWVPSHRGGITIFAGGMPRSTYGDRSTVSLLRGSNLDQAAAANLAAAVRLAHADGDLEDEDEEEEEADFEDEDQQNLLASGLVPGAPVHVFDADAPEHVCLDLPSPLVDVCPLGPAGGPATGVLILCEEELVAVDLLTPGWPLL--TLPYLSCLHTSAISAYNLFTHVNAVFLERLDAVAGCGKGDALGLGRRETGYSKRPWPVQGGQCILPGSGSPSRGALSIDPAHSLVTSTDLLVTGHENGTVNFWRLGPGGCARKVFTLYTGSLFDGEFGPDAGGDARRNGDDENDPWPPFRRAGLFDPFMDDPRAAVKCIQLVENTLVVGGAAGQVTVWQFADEKPVLQTVDVPIVQEIPGFRWKGHAPLKLRALGPSRSPGMSLYPVGIALTQPPAQITSLAVCELPATTAATPVAASPEPAKPGVVLVGFGTPHGFGLVHWAPRSSDGGADSPPTLILAQSTIPLNSEALEEAAVGEGWARRRT 835          

HSP 2 Score: 109.383 bits (272), Expect = 3.121e-20
Identity = 73/270 (27.04%), Postives = 129/270 (47.78%), Query Frame = 1
Query: 2473 DRPKDTANDGLIRSIRINVSLIKRKGSNGPHEKLLNLFAGCYGGLLLWFQSDYSVENILKNSP--INLRLIKQYQFQHRAPILHFNMLSPESGLSKLNENPDAGFDLDPNRKPDHLVVLTEEQVRLYAFPSFTLKCKIRVTAHDGFRLKNGSLIVFSD----------------DRLTTQNNTKEPL------------ICATNNGGQFLLLNCVNLKRKDVVQFVDKTDLMALNFMSLAKNANLSNTRTLCPYGICYSGQGQVTLFEII 3192
            DRP +TA+  ++R +    +L + +   G    + + FA   GG      + Y++     N P  + +R   +    HRAP++   ++  ++ +     +  +   +  N  P HLVV++EEQVRL++ PS  L+ K+R+TA DGFR+K  S++ F                  D  T+ +    P+            +  TNNGGQ ++L+   L+RKD +  +   DL+A+N ++ A NA  + T      G+     GQ+ LF+++
Sbjct:  942 DRPAETASTAVVRCVAFGPALHRIRAPAGTAVLVGSFFASTTGGA----TNVYALFADRANQPSQLAVRHASELVLHHRAPVIALRLIDTKTHIPFSPNSIGSSSLVSSNSPPPHLVVVSEEQVRLFSLPSLHLRQKVRITAKDGFRIKAASIVTFQQTAQFDGCFDKMAGSLGDGSTSHHQPSPPIGLVRGSLGPEFGLVFTNNGGQAVVLSIPYLRRKDTIALLGPLDLLAVNSVAFAANATSACTALAPSLGVYQLAHGQLALFDVV 1207          
BLAST of Protein lethal(2) giant larvae vs. TrEMBL
Match: W6V053 (Lethal(2) giant larvae protein OS=Echinococcus granulosus OX=6210 GN=EGR_05828 PE=4 SV=1)

HSP 1 Score: 309.301 bits (791), Expect = 5.265e-84
Identity = 233/841 (27.71%), Postives = 369/841 (43.88%), Query Frame = 1
Query:  106 MTQSIFNSVRKL--NFYNFKTKYINQNESIGEFYKKQSIEDFGSIPEPSCIDYDHKLSLLGIASKKGLIKIFGCPGVCYSTRLEGQDEIWNIKFIPGTNFFVTLTADNKLILWLISTLTNELFKVDVISNLNVVNSARTSAHXXXXXXXXXXXXXXXXXTAIEVNDLTSSIIMGNGSGSLIQVKLDLLKMRKQANNYKTVPPGNTIWQMPTKSDVIDRDRIISKLPIGSQNRVIIDAVIHISARPGSRKHLLIGYRSGNSIIYNVQKDSVDFLLSAKSTLNALSWCPPDPIVQDNFMVAPNRNEPQYYSSMKLHSCHEDGSIITWNLP------QNSDEFLVLDFQIFS----PYKKDQKCLPISKILWKRYKQDYLIVFSGGLPRSDYMTKSTITIMNNS-----------------------CLDSSKANN------------------------------EHLVLDLTSQLIDFTTIDDNDSGSVEYLLVLTEEEFFIVDLTKESWPILHDRQPYLNCLHNSPITAYQFLSEVKSDWFQKLNEMSSNKEDCN-------ISFSDWPIKGYAQKVRNDE----IWQNDLLIIGHGDGTIVFWKFGMGGCMKKISTVKSSSLFKM---ADELHLNEVSYEDDE---IPLRRTGQFDPCCDDNRLAIQLIHYTGKHLLIGGYGGQIVLWGFQENKYEKHLLDVDLTTHLSNFKWKGCQPF----------QHIEGSIKTGSNFQVMMSMCIFPPSQITALDILEDNNCNGY---------------VIIACGTLHGLVIVS-CPKETNLEALVLTTHCTVPRNTLASQEASLGEGWARRRT 2304
            M Q IF S R+L     + + K  +  E +G  YK     + G   +PS + YD  L +  +A++ G+   FG PGV Y    +G  EI  + F  G    +TL+ D+ + +W I +       +  I  L+ V+ A  S H + D   +  + I    TA+ V+   SSI++G   G++  ++ +     KQ  +       NT+W MP+K  +I   R +  +    + R+ +DAV+ +  RP     LLIGY SG  ++Y++Q + V  LL  +  L A +WC    +     +  P    P      ++ + + +GS+  W +P        + E      Q+      PY     C  ISK+ W    +  + +F+GG+PRS Y  ++T++I+  S                       C  S+                                  EH+ LDL S ++D   +     G V  LL+L EEE   +DL    WP+L    PYLNCLH S +T Y   ++V   + + L  +    +          +S   WPI+G     RN+     +  +DLLI GH +GT+ FW+   GGC +KI  + + SLF+     D +     + E++     P RR G FDP  DD R AI++IH     L++GG  GQ+ +W     K     LDV +   +  F+WKG  P           Q + G+    S F + +++C  PPS +T L   E ++ +                 V++  GT HG  ++     E    + +L  H T+P N  A +EA++GEGWARRRT
Sbjct:    1 MAQRIFQSFRRLPSQLTSVRKKQ-DTVEVVGSHYKINVCSNVGFPAKPSSLAYDQSLDIFALATRDGIF--FGKPGVVYYGSHKGALEIIKVLFFTGMGKLLTLSVDDIIYVWEIVSPNGNQPGLQNIGQLSGVSDALESKHLEVDPIGDITSHI----TALIVSSSNSSILVGTDQGNVAPIRRN--THVKQGVDQDE----NTMWIMPSKDKIITPHRALQSISPEKRTRLRLDAVVVLLERPSYPSQLLIGYSSGICLLYDLQGERVLALLPCQYELEAATWCGGSGLPVRGAVANPTATPPHL--GTRVLTAYGNGSLGVWQIPLFATGPGLATELGTQTLQMMESPSMPYGPF-PCKLISKVFWLPSHEGGITIFTGGMPRSIYGDRNTVSILRGSNLDQAAAANLAAALRADSEGDADCERSTAGQEFYDGGANADILLPSGLVPGAPVHVFDSDAPEHVCLDLPSLVVDVCPLGPA-GGPVTGLLILCEEELIAIDLLTPGWPLLE--LPYLNCLHASSLTTYGLFTQVNPAFLEGLEAIGGGADAVGPVPRATGLSTRTWPIQGGELGRRNEVSEPVVPSDDLLITGHENGTLQFWRLAAGGCARKIFCLFTGSLFEGDFGPDAVGDTHRACEEESEPWPPFRRVGLFDPFMDDVRAAIKVIHLVDSTLVVGGAAGQVSVWQLAPTKPTMATLDVPVAPEVPGFRWKGYAPLTLRRNQLDQPQRLAGA----SLFPMAVALCQ-PPSPVTCLSACELSDFSAMDKSLQPSPQPSPTIGVLVGMGTAHGFALMHISASEGGFASHLLLHHSTIPSNAEALEEAAVGEGWARRRT 817          

HSP 2 Score: 105.145 bits (261), Expect = 6.046e-19
Identity = 80/274 (29.20%), Postives = 133/274 (48.54%), Query Frame = 1
Query: 2473 DRPKDTANDGLIRSIRINVSLIKR------------KGSNGPHEKLLNLFAGCYGGLLLWFQSDYSVENILKNSPINLRLIKQYQFQHRAPILHFNMLSPESGLSKLNEN---PDAGFDL---DPNRKPDHLVVLTEEQVRLYAFPSFTLKCKIRVTAHDGFRLKNGSLIVFSDDRLTTQNNTK----EPLICATNNGGQFLLLNCVNLKRKDVVQFVDKTDLMALNFMSLAKNANLSNTRTLCP-YGICYSGQGQVTLFEII---SKTKTIGT 3216
            DRP  TAN  L+R +     L  R              +    + L + FA   GG    F      +N+ + S + LR   Q Q QHRAPI+   ++  ++    L  +   P     L     +  P HL+V++EEQVRL++ PS +L+ K R+TA DGFR+K G+++ F   +L+ + N      E     TNNGGQ ++L+   L+R+D +  +   D++ +N +  A  A+     T  P  G+  +  GQ+ +F+++    ++  +GT
Sbjct:  934 DRPAATANTALVRCMAFGPPLHHRLRPPAAGITASTSATIETSQLLGSFFAATAGGATFVFA--LYTDNVRRPSHLALRQATQMQLQHRAPIVALRLIDTKTHCPLLTSSVYLPQFSSPLVPSHHHPLPPHLMVISEEQVRLFSLPSISLRQKARITAKDGFRIKTGNIMAFG--QLSNERNMGIYGIEFNCVFTNNGGQAVVLSVPYLRRRDTIALLGGADVLEINSIVFATAASTRPKVTAAPSLGVYQTAPGQLAIFDMVLAGQRSSALGT 1203          
BLAST of Protein lethal(2) giant larvae vs. TrEMBL
Match: A0A5K4F378 (Uncharacterized protein OS=Schistosoma mansoni OX=6183 PE=4 SV=1)

HSP 1 Score: 300.056 bits (767), Expect = 1.207e-80
Identity = 231/854 (27.05%), Postives = 375/854 (43.91%), Query Frame = 1
Query:  106 MTQSIFNSVRKL--NFYNFKTKYINQNESIGEFYKKQSIEDFGSIPEPSCIDYDHKLSLLGIASKKGLIKIFGCPGVCYSTRLEGQDEIWNIKFIPGTNFFVTLTADNKLILWLISTLTNELFKVDVISNLNVVNSARTSAHXXXXXXXXXXXXXXXXXTAIEVNDLTSSIIMGNGSGSLIQVKLDLLKMRKQANNYKTVPPGNTIWQMPTKSDVIDRDRIISKLPIGSQNRVIIDAVIHISARPGSRKHLLIGYRSGNSIIYNVQKDSVDFLLSAKSTLNALSWCPPDPIVQDNFMVAPNRN-----EPQYYSSMKLHSCHEDGSIITWNLPQNS----------DEFLVLDFQIFSPYKKDQKCLPISKILWKRYKQDYLIVFSGGLPRSDYMTKSTITIMNNSCLDSSKANN--------------------------------------EHLVLDLTSQLIDFTTIDDNDSGSVEYLLVLTEEEFFIVDLTKESWPILHDRQPYLNCLHNSPITAYQFLSEVKSDW----------------FQKLNEMSSNKEDCNISFSDWPIKGYAQKVRNDEI----------WQNDLLIIGHGDGTIVFWKFGMGGCMKKISTVKSSSLFKMADEL-HLNEVSYEDDE-IPLRRTGQFDPCCDDNRLAIQLIHYTGKHLLIGGYGGQIVLWGFQENKYEKHLLDVDLTTHLSNFKWKGCQPF-----------QHIEGSIKTGSNFQVMMSMCIFPPSQITALDILE-------------DNNCNG-----YVIIACGTLHGLVIVSCPK---------ETNLEALVLTTHCTVPRNTLASQEASLGEGWARRRT 2304
            M Q IF S R++  +F  F+ K     +  G  Y+     D+G   +P+ + YD  + +L + ++ G I I+G PG+ +S   E   +   + F+ G+   VTLT  + + LW +++++    ++   S L  + S   S  +    ++NN             +D   SI++G  +G +  V+L+          +         W +P+  D I+  RI+  +    + R+  DAV+ +S RPG    LLIGY SG S++++++ D V  LL  +  L A +WC             PNR+     +PQ    M+L + H DGS+  W+L +               L ++     PY     C  ISK+ W       + VF GG+PR+ Y  + T++I+  S +D + AN                                       EH+ LDL S L+D   +   D G V+ L++L EEE  ++DL    WP +  R PYL CLH + +T Y  +++V S                  F +   ++ N      S   WPI+G    +    +          + +DLL+ GH DG++ FW+   GGC+++I T+ ++ LF+   +L H N V  + D   P R+ G FDP  DD+R+AIQ I+     L++GG  GQ++++ F           V +   +  F+WKG  P             + E +    +  Q    + + PP++IT+L + E              NN +G      +++A GT HG  +V  PK         +  L    L    T+P N  A QEA+ GEGWARRRT
Sbjct:    1 MAQKIFQSFRRIPGHFPAFRKKE-EPCDVQGSRYRVAVCSDYGFPSKPTSVAYDPVIDMLAVLTRDGNIYIYGKPGISFSAVHETNAQYIQVVFLTGSRKLVTLTDSDDMYLWELTSVSQTSSQLTQRSCLKRITSQLKSLPSGVPSSSNNNEETSHVTALCYASD-GRSILIGTDNGWVASVRLNTNTATDDFTKF---------WCLPSADDAINPSRILDGISPDRRQRLRADAVVVLSERPGFPGQLLIGYNSGLSLLFDLRSDRVMALLPWQHGLEAAAWC--------GGSGQPNRSNQTPHQPQL--GMRLLTAHSDGSLGVWSLREIGFGTTTISPIQPPLLQMEEAPSMPYGP-FPCKLISKVFWLPSALGGITVFVGGMPRATYGERHTVSILRGSNIDQA-ANASVVAARLAVAAEAEDDDEIPEESSLSAPPIHVFDSDAPEHVCLDLPSSLVDLVPVGSVD-GPVQILVLLCEEEMVVIDLITSGWPFM--RPPYLTCLHTTSLTTYNLITQVSSTLLSNLEAAGAYYGPEGRFGRGGAIADNPSGGGWSSLPWPIQGGHALINGSRLSTSSLGGNILYTDDLLLTGHEDGSVAFWRLSAGGCLRRIYTLYTAILFEDVSQLDHPNGVDDDGDAWPPFRQAGVFDPFMDDSRVAIQFIYLVDNTLVVGGAAGQVIVYQFLNFTPCIEPAIVTIKKSMPGFQWKGHAPLTLRKCFSDKFTANPEQTTPLPAQLQATGVIFVQPPARITSLLLSEFELTHLKEFSQNQTNNISGDGGGLQILLALGTPHGFGVVFVPKPLPNNDSNTKKPLPPQPLLAVSTIPDNIDALQEAAAGEGWARRRT 828          

HSP 2 Score: 75.8702 bits (185), Expect = 6.314e-10
Identity = 72/279 (25.81%), Postives = 123/279 (44.09%), Query Frame = 1
Query: 2473 DRPKDTANDGLIRSIRINVSLIKRKGSNGPH--EKLLNLFAGCYGGLLLWFQ--SDYSVENILKNSPINLRLIKQYQFQHRAPILHFNMLSPESGLS-KLNENPDAGFDLDPNRKPDHLVVLTEEQVRLYAFPSFTLKCKIRVTAHDGFRLKNGSLIVFSDDRLTTQNNTKEPLI---CA--------------------------TNNGGQFLLLNCVNLKRKDVVQFVDKTDLMALNFMSLAKNANLSNTRTLC-----PYGICYSGQGQVTLFEII 3192
            DR +DTAN  +I        L K   SN       +  LF G   G +  +    D +  N      + L   ++   QHRAP+L   ++  +S +   L++      D   +     L V++EEQ+RL+  P+  LK K R+TA DG+R+K+ S++ F     T+ + +KE  +   C                           TN GGQ +LL+   L+R D +  +D  D++A++ +  ++  + +N    C       G+     GQ+TLF+++
Sbjct:  917 DRVQDTANVAIISCFAFGPPLFKSSPSNARPTLHPVATLFIGTKAGTVKLYSIFVDKTTLNSSVLPKLQLYYSRELILQHRAPVLSLRLIDAKSNMPYSLSDYKHYISDSGKSHNLPVLSVVSEEQIRLFNLPNLHLKFKARITAIDGYRIKSASVVGFRIHGKTSSSLSKESTVDSACGDLERSNTSGISVTSQTNQNCEYSFVFTNVGGQAVLLSMPQLRRMDTLHLLDSHDVVAVSSVVFSQPGS-TNVNNSCYVHGPALGLYQLAPGQLTLFDVV 1194          
BLAST of Protein lethal(2) giant larvae vs. Ensembl Cavefish
Match: llgl1 (LLGL scribble cell polarity complex component 1 [Source:NCBI gene;Acc:103037820])

HSP 1 Score: 235.728 bits (600), Expect = 1.970e-63
Identity = 247/944 (26.17%), Postives = 435/944 (46.08%), Query Frame = 1
Query:  238 EPSCIDYDHKLSLLGIASKKGLIKIFGCPGVCYSTRLEGQDEIWNIKFIPGTNFFVTLTADNKLILWLISTLTNELFKVDVISNLNVVNSARTSAHXXXXXXXXXXXXXXXXXTAIEVNDLTSSIIMGNGSGSLIQVKLDLLKMRKQANNYKTVPPGNTIWQMPTKSDVIDR----DRIISKLPIGSQNRVIIDAVIHISARPGSRKHLLIGYRSGNSIIYNVQKDSVDFLLSAKSTLNALSWCPPDPIVQDNFMVAPNRNEPQYYSSMKLHSCHEDGSIITWNLPQNS--DEFLVLDFQIFSPYKKDQKCLPISKILWKRYKQDY-LIVFSGGLPRSDYMTKSTITIMNNSCLDSSKANNEHLVLDLTSQLIDFTTIDDNDSGS----VEYLLVLTEEEFFIVDLTKESWPILHDRQPYLNCLHNSPITAYQFLSEVKSDWFQKLNEMSSNKEDCNI-SFSDWPIKGYAQKVRNDEIWQNDLLIIGHGDGTIVFWKFGMGGCMKKISTVKSSSLFKMADELHLNEVSYEDDE--IPLRRTGQFDPCCDDNRLAIQ---LIHYTGKHLLIGGYGGQIVLWGFQENKYEKHLLD---VDLTTHLSNFKWKGCQPFQHIEGSIKTGSNFQVMMSMCIFPPSQITALDILEDNNCNGYVIIACGTLHGLVIVSCPKETNLEALVLTTHCTVPRNTLASQEASLGEGWARRRTXXXXXXXXXXXXXXXXXXXXXMEHPSVSRHLSDNNDKTMRXXXXXXXXXXXXXXXXDRPKDTANDGLIRSIRINVSLIKRKGSNGPHEKLLNLFAGCYGGLLLWFQSDYSVENILKNSPINLRLIKQYQFQHRAPILHFNMLSPESGLSKLNENPDAGFDL--DPNRKPDHLVVL-TEEQVRLYAFPSFTLKCKIRVTAHDGFRLKNGSLIVFSDDRLTTQNNTKEPLICATNNG 3000
            +PS + YD KL L+ I +K G IK++G PGV ++   +    +  + F+ G    ++L  DN L LW       E+ + +  S+L  V S                       T IE    T   ++      L ++  DLL +  +         G    ++P+ + ++D+    D I+  +P   +    +  V  +   P     +LIGY  G  +++++Q   VD L   K  L +L W                R+   + SS      H DG  + W++  ++      V     + P+     C  ++KILW+  +    L++FSGG+PR+ Y  +  +TI+ +S         +H+ LD TS++IDF T+   D+ S       L+VL EEE  ++DL    WP +    PYL  LH+S IT    +S V +  ++++  + + ++  ++ + ++WPI G      + +  Q +L++ GH DGT+ FW    G  ++ +  + ++++F+  D  H + ++   +E   P R+ G FDP  DD RL IQ   L  Y+GK L++ G  GQ+++    + K + H++D   VDL      F WKG        GS+     FQ ++ +   PP+ +TA+ +  + N     +IA GT HG  +    + + + A      CT+  N   + E  L       R + LKKSLR SFRR+R+      +   VS   S   +    +   + EV   +R IE R  D +  G++R +    + ++    +GP      ++AG   G +  +  D  ++       +   L K+ Q  HRAP++   +L      + L E  +   DL   P+ +  H V++ +EEQ +++  P  + K K ++TAH+G R++  +L+ FS   + +++ ++  L+C TN G
Sbjct:   36 QPSALAYDPKLQLMAIGTKSGAIKVYGSPGVEFTGLHKDTATVTQMHFLHGQGRILSLLDDNTLHLW-------EIGQREQCSSLEEVCSFTIPCR-----------------TVIESTSATRVTVL------LPKLSCDLLAVGTEGG-------GVHFLELPSLT-LLDKSLFQDEIMQSVPDEYKCGKSLGPVESLQEHPQHPDKILIGYSRGLVVLWDLQTRHVDNLFLGKQQLESLVW---------------ERSGNSFVSS------HSDGGYMVWSVSSSTPCTNEPVSSTITYGPF----PCKAVNKILWRTAESGAPLVLFSGGMPRASYGDRHCLTILQDS---------QHVTLDFTSRVIDFFTVHCTDAHSEFDDPSALVVLLEEELVVIDLQTAGWPTI--PAPYLAPLHSSAITCSYHISNVPTKLWERV--VGAGQQQGSLQTHTNWPICGGKNLAPDPK--QQELMLTGHEDGTVRFWD-ASGVSLRPLYKLSTANIFQ-TDCDHNDSLTQAGEEEWPPFRKVGCFDPYSDDPRLGIQKICLCKYSGK-LVVAGTAGQVIVLYLSDEKSD-HMIDVATVDLLQDREGFTWKGHDRLPPKSGSVVFAPGFQPVVLVQCMPPAAVTAVTLHAEWN-----LIAFGTSHGFGLFDYHRRSPVLA-----RCTLHPNDSLAMEGPLS------RVKSLKKSLRQSFRRIRKSRVSGKKRVLVSSPSSKVQEANAHLAEQDAEVTPVQRRIEPRSADDSLSGVVRCLCFADTFLRDGTHHGP-----TMWAGTNSGSVYAYALDVPLQEKFSEQSVEALLGKEIQLMHRAPVVSIAVLDGRG--NPLPEPYEVSRDLAKAPDMQGSHSVLIASEEQFKVFMLPKVSAKTKFKLTAHEGCRVRKVALVNFSS--VASEDYSENGLVCLTNLG 872          
BLAST of Protein lethal(2) giant larvae vs. Ensembl Cavefish
Match: llgl1 (LLGL scribble cell polarity complex component 1 [Source:NCBI gene;Acc:103037820])

HSP 1 Score: 234.958 bits (598), Expect = 3.048e-63
Identity = 247/944 (26.17%), Postives = 435/944 (46.08%), Query Frame = 1
Query:  238 EPSCIDYDHKLSLLGIASKKGLIKIFGCPGVCYSTRLEGQDEIWNIKFIPGTNFFVTLTADNKLILWLISTLTNELFKVDVISNLNVVNSARTSAHXXXXXXXXXXXXXXXXXTAIEVNDLTSSIIMGNGSGSLIQVKLDLLKMRKQANNYKTVPPGNTIWQMPTKSDVIDR----DRIISKLPIGSQNRVIIDAVIHISARPGSRKHLLIGYRSGNSIIYNVQKDSVDFLLSAKSTLNALSWCPPDPIVQDNFMVAPNRNEPQYYSSMKLHSCHEDGSIITWNLPQNSD--EFLVLDFQIFSPYKKDQKCLPISKILWKRYKQDY-LIVFSGGLPRSDYMTKSTITIMNNSCLDSSKANNEHLVLDLTSQLIDFTTIDDNDSGS----VEYLLVLTEEEFFIVDLTKESWPILHDRQPYLNCLHNSPITAYQFLSEVKSDWFQKLNEMSSNKEDCNI-SFSDWPIKGYAQKVRNDEIWQNDLLIIGHGDGTIVFWKFGMGGCMKKISTVKSSSLFKMADELHLNEVSYEDDE--IPLRRTGQFDPCCDDNRLAIQ---LIHYTGKHLLIGGYGGQIVLWGFQENKYEKHLLD---VDLTTHLSNFKWKGCQPFQHIEGSIKTGSNFQVMMSMCIFPPSQITALDILEDNNCNGYVIIACGTLHGLVIVSCPKETNLEALVLTTHCTVPRNTLASQEASLGEGWARRRTXXXXXXXXXXXXXXXXXXXXXMEHPSVSRHLSDNNDKTMRXXXXXXXXXXXXXXXXDRPKDTANDGLIRSIRINVSLIKRKGSNGPHEKLLNLFAGCYGGLLLWFQSDYSVENILKNSPINLRLIKQYQFQHRAPILHFNMLSPESGLSKLNENPDAGFDL--DPNRKPDHLVVL-TEEQVRLYAFPSFTLKCKIRVTAHDGFRLKNGSLIVFSDDRLTTQNNTKEPLICATNNG 3000
            +PS + YD KL L+ I +K G IK++G PGV ++   +    +  + F+ G    ++L  DN L LW       E+ + +  S+L  V S                       T IE    T   ++      L ++  DLL +  +         G    ++P+ + ++D+    D I+  +P   +    +  V  +   P     +LIGY  G  +++++Q   VD L   K  L +L W                R+   + SS      H DG  + W++  ++      V     + P+     C  ++KILW+  +    L++FSGG+PR+ Y  +  +TI+ +S         +H+ LD TS++IDF T+   D+ S       L+VL EEE  ++DL    WP +    PYL  LH+S IT    +S V +  ++++  + + ++  ++ + ++WPI G      + +  Q +L++ GH DGT+ FW    G  ++ +  + ++++F+  D  H + ++   +E   P R+ G FDP  DD RL IQ   L  Y+GK L++ G  GQ+++    + K + H++D   VDL      F WKG        GS+     FQ ++ +   PP+ +TA+ +  + N     +IA GT HG  +    + + + A      CT+  N   + E  L       R + LKKSLR SFRR+R+      +   VS   S   +    +   + EV   +R IE R  D +  G++R +    + ++    +GP      ++AG   G +  +  D  ++       +   L K+ Q  HRAP++   +L      + L E  +   DL   P+ +  H V++ +EEQ +++  P  + K K ++TAH+G R++  +L+ FS   + +++ ++  L+C TN G
Sbjct:   10 QPSALAYDPKLQLMAIGTKSGAIKVYGSPGVEFTGLHKDTATVTQMHFLHGQGRILSLLDDNTLHLW-------EIGQREQCSSLEEVCSFTIPCR-----------------TVIESTSATRVTVL------LPKLSCDLLAVGTEGG-------GVHFLELPSLT-LLDKSLFQDEIMQSVPDEYKCGKSLGPVESLQEHPQHPDKILIGYSRGLVVLWDLQTRHVDNLFLGKQQLESLVW---------------ERSGNSFVSS------HSDGGYMVWSVSSSTPCTNEPVSSTITYGPF----PCKAVNKILWRTAESGAPLVLFSGGMPRASYGDRHCLTILQDS---------QHVTLDFTSRVIDFFTVHCTDAHSEFDDPSALVVLLEEELVVIDLQTAGWPTI--PAPYLAPLHSSAITCSYHISNVPTKLWERV--VGAGQQQGSLQTHTNWPICGGKNLAPDPK--QQELMLTGHEDGTVRFWD-ASGVSLRPLYKLSTANIFQ-TDCDHNDSLTQAGEEEWPPFRKVGCFDPYSDDPRLGIQKICLCKYSGK-LVVAGTAGQVIVLYLSDEKSD-HMIDVATVDLLQDREGFTWKGHDRLPPKSGSVVFAPGFQPVVLVQCMPPAAVTAVTLHAEWN-----LIAFGTSHGFGLFDYHRRSPVLA-----RCTLHPNDSLAMEGPLS------RVKSLKKSLRQSFRRIRKSRVSGKKRVLVSSPSSKVQEANAHLAEQDAEVTPVQRRIEPRSADDSLSGVVRCLCFADTFLRDGTHHGP-----TMWAGTNSGSVYAYALDVPLQEKFSEQSVEALLGKEIQLMHRAPVVSIAVLDGRG--NPLPEPYEVSRDLAKAPDMQGSHSVLIASEEQFKVFMLPKVSAKTKFKLTAHEGCRVRKVALVNFSS--VASEDYSENGLVCLTNLG 846          
BLAST of Protein lethal(2) giant larvae vs. Ensembl Cavefish
Match: llgl2 (LLGL scribble cell polarity complex component 2 [Source:NCBI gene;Acc:103026969])

HSP 1 Score: 197.978 bits (502), Expect = 2.664e-51
Identity = 231/923 (25.03%), Postives = 391/923 (42.36%), Query Frame = 1
Query:  193 EFYKKQSIEDFGSIPEPSCIDYDHKLSLLGIASKKGLIKIFGCPGVCYSTRLEGQDEIWNIKFIPGTNFFVTLTADNKLILWLISTL--TNELFKVDVISNLNVVNSARTSAHXXXXXXXXXXXXXXXXXTAIEVNDLTSSIIMGNGSGSLIQVKLDLLKMRKQANNYKTVPPGNTIWQMPTKSDVIDRDRIISKLPIGSQNRVIIDAVIHISARPGSRKHLLIGYRSGNSIIYNVQKDSVDFLLSAKSTLNALSWCPPDPIVQDNFMVAPNRNEPQYYSSMKLHSCHEDGSIITWNL----PQNSDEFLVLDFQIFSPYKKDQKCLPISKILWKRYKQDY-LIVFSGGLPRSDYMTKSTITIMNNSCLDSSKANNEHLVLDLTSQLIDFTTIDDNDS--GSVEYLLVLTEEEFFIVDLTKESWPILHDRQPYLNCLHNSPITAYQFLSEVKSDWFQKLNEMSSNKEDCNISFSDWPIKGYAQKVRNDEIWQNDLLIIGHGDGTIVFWKFGMGGCMKKISTVKSSSLFKM-ADELHLNEVSYEDDEIPLRRTGQFDPCCDDNRLAIQLIH---YTGKHLLIGGYGGQIVLWGFQENKYEKHLLD--VDLTTHLSNFKWKGCQPFQHIEGSIKTGSNFQVMMSMCIFPPSQITALDILEDNNCNGYVIIACGTLHGLVIVSCPKETNLEALVLTTHCTVPRNTLASQEASLGEGWARRRTXXXXXXXXXXXXXXXXXXXXXMEHPSVSRHLSDNNDKTMRXXXXXXXXXXXXXXXXDRPKDTANDGLIRSIRINVSLIKRKGSNGPHEKLLNLFAGCYGGLLLWFQSDYSVENILKNSPINLRL--------IKQYQFQHRAPILHFNMLSPESGLSKLNENPDAGFDLDPNRKPD-----HLVVLTEEQVRLYAFPSFTLKCK 2877
            E Y+     + G   +PS + +   L LL I ++ G IK++G PGV +    +    +  + F+P     VTL  DN L +W +      +EL ++   + L     A  S                  +TA+  +     +++G   G +  V++   +  ++ N                    I  + + S++P     R  ++ V  +   P + + +LIGY  G  +++++ +            L ++ W      ++D   +                S H DGS   W +    PQ   E     +  F        C  ISKIL    +Q    ++FSGG+PR+ Y  +  I+++++           H+ LD TS++IDF  I D +   G    L+VL EEE  +VDL  E WP++  + PYL  LH S IT    +S +    ++++ + +   ++ + S   WPI G  Q +  D   Q DLL+ GH DGT+ FW    G C+  +  + ++ +F   AD         E +  P R+ G FDP  DD RL IQ IH   Y+G +L + G  GQI++    + + E+ +    VDL      F+WKG       E  +     FQ    +   PP+ +TA+ +  +     + ++A GT HG  +    ++ N     +   CT+  N   + E  L      R     K   +S  R  R R + R  +P+ +  L + N +     L E E+   +R IE R  D +  GL+R++    + +     + P     +L+AG  GG +  +        +L+  P+  R+         K+ Q  HRAP++   +L      + L E  +   DL   R PD      L+V++EEQ++L+  P  + K K
Sbjct:   19 ELYQFNKTVEHGFPHQPSALGFSPSLELLAIGTRSGAIKLYGAPGVEFMGLHDENAAVTQVHFLPRQVELVTLLDDNSLHMWTLRAHKGVSELLEIGRFT-LTGPPGAIPSV---------------TRVTAVLAHSSGELLLLGTEGGHVFVVEVPGFRELEENN--------------------ISVEDVQSRVPEEYVGRRNLECVEALQENPLNPRQVLIGYSRGLMVLWDLDRRCAIQHFLGTQQLESVWW------MEDGGNIL---------------SSHSDGSYCHWTVTGKDPQTEPEKQETPYGSFP-------CKAISKILQISTRQGPPFLIFSGGMPRASYGDRHCISVIHSKT---------HVALDFTSRIIDFFVIRDGERHRGDPSALVVLVEEELVVVDLQSEGWPVI--QTPYLVPLHCSAITCSHHVSSIPLKLWERV-QAAGKVQNTHYSKKPWPING-GQNLAPDPP-QRDLLLTGHEDGTVRFWD-ASGVCLYPMYKLSTAMVFHTDADPNDNMNQGTEGEWPPFRKVGCFDPYSDDPRLGIQKIHLCKYSG-YLTVAGTAGQILVLEINDEEAEQTVEATVVDLLQGQEGFRWKGQARLDLREEPVTFPPGFQPFALVQCQPPAVVTAIALHSE-----WKLVAFGTSHGFGVYDYQQKNN-----VMVKCTLNPNDQVALEGPLS-----RVKSIKKSLRQSFRRIRRSRVSMRKHNPTNAAKLHEINARLEAEALQEMELAPVQRKIEARSADDSFTGLVRTLYFADTFLSDSSQSTP-----SLWAGTNGGAVYAY--------MLRLPPVERRMDDQLTAYAAKEIQLMHRAPVVGLVVLDGRG--APLPEPLEVAHDL--ARSPDMQGSHQLLVISEEQLKLFNLPKVSSKAK 829          
BLAST of Protein lethal(2) giant larvae vs. Ensembl Cavefish
Match: llgl2 (LLGL scribble cell polarity complex component 2 [Source:NCBI gene;Acc:103026969])

HSP 1 Score: 197.593 bits (501), Expect = 3.365e-51
Identity = 231/923 (25.03%), Postives = 391/923 (42.36%), Query Frame = 1
Query:  193 EFYKKQSIEDFGSIPEPSCIDYDHKLSLLGIASKKGLIKIFGCPGVCYSTRLEGQDEIWNIKFIPGTNFFVTLTADNKLILWLISTL--TNELFKVDVISNLNVVNSARTSAHXXXXXXXXXXXXXXXXXTAIEVNDLTSSIIMGNGSGSLIQVKLDLLKMRKQANNYKTVPPGNTIWQMPTKSDVIDRDRIISKLPIGSQNRVIIDAVIHISARPGSRKHLLIGYRSGNSIIYNVQKDSVDFLLSAKSTLNALSWCPPDPIVQDNFMVAPNRNEPQYYSSMKLHSCHEDGSIITWNL----PQNSDEFLVLDFQIFSPYKKDQKCLPISKILWKRYKQDY-LIVFSGGLPRSDYMTKSTITIMNNSCLDSSKANNEHLVLDLTSQLIDFTTIDDNDS--GSVEYLLVLTEEEFFIVDLTKESWPILHDRQPYLNCLHNSPITAYQFLSEVKSDWFQKLNEMSSNKEDCNISFSDWPIKGYAQKVRNDEIWQNDLLIIGHGDGTIVFWKFGMGGCMKKISTVKSSSLFKM-ADELHLNEVSYEDDEIPLRRTGQFDPCCDDNRLAIQLIH---YTGKHLLIGGYGGQIVLWGFQENKYEKHLLD--VDLTTHLSNFKWKGCQPFQHIEGSIKTGSNFQVMMSMCIFPPSQITALDILEDNNCNGYVIIACGTLHGLVIVSCPKETNLEALVLTTHCTVPRNTLASQEASLGEGWARRRTXXXXXXXXXXXXXXXXXXXXXMEHPSVSRHLSDNNDKTMRXXXXXXXXXXXXXXXXDRPKDTANDGLIRSIRINVSLIKRKGSNGPHEKLLNLFAGCYGGLLLWFQSDYSVENILKNSPINLRL--------IKQYQFQHRAPILHFNMLSPESGLSKLNENPDAGFDLDPNRKPD-----HLVVLTEEQVRLYAFPSFTLKCK 2877
            E Y+     + G   +PS + +   L LL I ++ G IK++G PGV +    +    +  + F+P     VTL  DN L +W +      +EL ++   + L     A  S                  +TA+  +     +++G   G +  V++   +  ++ N                    I  + + S++P     R  ++ V  +   P + + +LIGY  G  +++++ +            L ++ W      ++D   +                S H DGS   W +    PQ   E     +  F        C  ISKIL    +Q    ++FSGG+PR+ Y  +  I+++++           H+ LD TS++IDF  I D +   G    L+VL EEE  +VDL  E WP++  + PYL  LH S IT    +S +    ++++ + +   ++ + S   WPI G  Q +  D   Q DLL+ GH DGT+ FW    G C+  +  + ++ +F   AD         E +  P R+ G FDP  DD RL IQ IH   Y+G +L + G  GQI++    + + E+ +    VDL      F+WKG       E  +     FQ    +   PP+ +TA+ +  +     + ++A GT HG  +    ++ N     +   CT+  N   + E  L      R     K   +S  R  R R + R  +P+ +  L + N +     L E E+   +R IE R  D +  GL+R++    + +     + P     +L+AG  GG +  +        +L+  P+  R+         K+ Q  HRAP++   +L      + L E  +   DL   R PD      L+V++EEQ++L+  P  + K K
Sbjct:   19 ELYQFNKTVEHGFPHQPSALGFSPSLELLAIGTRSGAIKLYGAPGVEFMGLHDENAAVTQVHFLPRQVELVTLLDDNSLHMWTLRAHKGVSELLEIGRFT-LTGPPGAIPSV---------------TRVTAVLAHSSGELLLLGTEGGHVFVVEVPGFRELEENN--------------------ISVEDVQSRVPEEYVGRRNLECVEALQENPLNPRQVLIGYSRGLMVLWDLDRRCAIQHFLGTQQLESVWW------MEDGGNIL---------------SSHSDGSYCHWTVTGKDPQTEPEKQETPYGSFP-------CKAISKILQISTRQGPPFLIFSGGMPRASYGDRHCISVIHSKT---------HVALDFTSRIIDFFVIRDGERHRGDPSALVVLVEEELVVVDLQSEGWPVI--QTPYLVPLHCSAITCSHHVSSIPLKLWERV-QAAGKVQNTHYSKKPWPING-GQNLAPDPP-QRDLLLTGHEDGTVRFWD-ASGVCLYPMYKLSTAMVFHTDADPNDNMNQGTEGEWPPFRKVGCFDPYSDDPRLGIQKIHLCKYSG-YLTVAGTAGQILVLEINDEEAEQTVEATVVDLLQGQEGFRWKGQARLDLREEPVTFPPGFQPFALVQCQPPAVVTAIALHSE-----WKLVAFGTSHGFGVYDYQQKNN-----VMVKCTLNPNDQVALEGPLS-----RVKSIKKSLRQSFRRIRRSRVSMRKHNPTNAAKLHEINARLEAEALQEMELAPVQRKIEARSADDSFTGLVRTLYFADTFLSDSSQSTP-----SLWAGTNGGAVYAY--------MLRLPPVERRMDDQLTAYAAKEIQLMHRAPVVGLVVLDGRG--APLPEPLEVAHDL--ARSPDMQGSHQLLVISEEQLKLFNLPKVSSKAK 829          
BLAST of Protein lethal(2) giant larvae vs. Ensembl Cavefish
Match: stxbp5l (syntaxin binding protein 5-like [Source:NCBI gene;Acc:567605])

HSP 1 Score: 114.775 bits (286), Expect = 2.420e-25
Identity = 84/390 (21.54%), Postives = 170/390 (43.59%), Query Frame = 1
Query:  811 VIHISARPGSRKHLLIGYRSGNSIIYNVQKDSVDFLLSAKSTLNALSWCPPDPIVQDNFMVAPNRNEPQYYSSMKLHSCHEDGSIITWNLPQNSDEFLVLDFQIFSPYKKDQK------CLPISKILWKRYK-QDYLIVFSGGLPRSDYMTKSTITIMNNSCLDSSKANNEHLVLDLTSQLIDFTTIDD----NDSGSVEYLLVLTEEEFFIVDLTKESWPILHDRQPYLNCLHNSPITAYQFLSEVKSDWFQKLNEMSSNKEDCNISFSDWPIKGYAQKVRNDEIWQNDLLIIGHGDGTIVFWKFGMGGCMKKISTVKSSSLFKMADELHLNEVSYEDDEIPLRRTGQFDPCCDDNRLAIQLIHYT--GKHLLIGGYGGQIVLWGFQEN 1941
            V+H+S  P     LLIG+ SG  ++++++    DF +     ++++SW                     ++   +    H DGS+  WNL   +       FQ+  P+ K Q+      C PI K+ +K  +  +  ++FSGGL       + T+TIM+   +          VL++   +++F  + +    N+      ++VL E++F +VDLT+ ++PI  +  P    +H SP+T   + ++   D    L  + +  +    S  +WP+ G    V +      +++I GH DG+I FW       ++ +  +K+S +F+                     TG+     +++  A+Q++ +    +   + G    ++L+ F ++
Sbjct:  204 VVHLSDSPKDEGKLLIGFESGTIVMWDLRAKRTDFRIYYDEAIHSVSW---------------------HHEGRQFMCSHSDGSLSMWNLRNTAKP-----FQVTFPHGKSQRDGRKESCKPILKVEYKTCRNSEPFVIFSGGLSYDKAGRRPTLTIMHGKAIT---------VLEMDHPIVEFIVLCETPYLNEVQEPYAVVVLLEKDFIVVDLTQSNFPIFENAYPMD--IHESPVTCTAYFADCPPDIIPVLYSIGAKHKKTGYSHKEWPVSGGTWTVGSQTY--PEIIITGHADGSIKFWD-ATAITLQMLYKLKTSKVFEKPKGAE---------------TGRSAELVEEDPYAVQMVSWCPQSRIFCVVGISAHVILYRFSKH 538          
BLAST of Protein lethal(2) giant larvae vs. Ensembl Sea Lamprey
Match: ENSPMAT00000003125.1 (pep scaffold:Pmarinus_7.0:GL479844:12808:29279:-1 gene:ENSPMAG00000002854.1 transcript:ENSPMAT00000003125.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 135.961 bits (341), Expect = 7.750e-33
Identity = 163/634 (25.71%), Postives = 275/634 (43.38%), Query Frame = 1
Query: 1198 LIVFSGGLPRSDYMTKSTITIMNNSCLDSSKANNEHLVLDLTSQLIDFTTIDDNDSGSVEYLLVLTEEE-------FFIVDLTKESWPILHDRQPYLNCLHNSPITAYQFLSEVKSDWFQKLNEMSSNKE----DCNISFSDWPIKGYAQKVRN--DEIWQNDLLIIGHGDGTIVFWKFGMGGCMKKISTVKSSSLFKMADELHLNEVSYEDDE-IPLRRTGQFDPCCDDNRLAIQ---LIHYTGKHLLIGGYGGQIVL---WGFQENKYEKHLLDVDLTTHLSNFKWKGCQPFQHIEGSIKTGSNFQVMMSMCIFPPSQITALDILEDNNCNGYVIIACGTLHGLVIVSCPKETNLEALVLTTHCTV-PRNTLASQEASLGEGWARRRTXXXXXXXXXXXXXXXXXXXXXMEHP-SVSRHLSDNNDKTMRXXXXXXXXXXXXXXXXDR---PK--DTANDGLIRSIRINVSLIKRKGS---NGPHEKLLNLFAGCYGGLLLWFQSDYSVENILKNSPINLRLIKQYQFQHRAPILHFNMLSPESGLSKLNENPDAGFDL--DPNRKPDH-LVVLTEEQVRLYAFPSFTLKCKIRVTAHDGFRLKNGSLIVFSDDRLTTQNNTKEPLICATNNG 3000
            L+VF GG+PR+ +  +  +T+         +    H   D TS+++DF T+  + +                      ++DL  + WP +    PYL+ LH+S IT    ++ V    +++++     +         S S WPI G     RN   E  + +LL+ GH DGT+ FW    G  +  +  + ++ LF+   E         DDE  P  + G FDP  DD RL IQ   L  ++G+ LL+ G  GQ+VL    G +    E  ++ VDL      F WKG +      G     + ++  + + + PP+ +TAL +  +     + ++A GT HG  +    K     A V+   CT+ P  TLA  E  L    +R ++ +          R  R S K+   P S +  + + N +    +  E      + A   R   P+  D +  GL+R +    + + R G+   +GP      L+ G   G +  +  D    +      I+  L K+ Q  HRAP++   +L        L E  +A  DL      +  H L++ +EEQ ++++ P  T K K ++TAH+G R++  +L   +  R   + + +  L+C TN G
Sbjct:    1 LLVFGGGMPRASFGDRHCVTV--------RRGGGRHAAFDFTSRVVDFFTVHGDATAGGAGSGGDATALVVLVEEELVVLDLATDGWPTVP--PPYLSPLHSSAITCSCHVAAVPLRLWERVSATGRAQRALAPSAVSSASSWPILGG----RNLLPEPSERNLLLTGHEDGTVRFWD-ASGAGLTPLYILSTAPLFQTDGEHSEGLGPASDDEWPPFVKVGCFDPYSDDPRLGIQKISLCKFSGR-LLVAGTAGQVVLIMELGDEAAVQEIAVVTVDLLKEREGFAWKGHERLVVRPGPRTLPAGYRPGLLLQVLPPAAVTALVLHAE-----WRLLAFGTSHGFGLFDYQK-----AHVVFARCTLHPSETLA-LEGPL----SRVKSLKKSLRQSFRRIRKSRVSGKKRADPGSPATKVQEANARLAEQQQEEAAARDADVAPVQRRVEPRSLDDSLSGLVRCLYFADTFL-RDGTLAHSGP-----TLWVGTNAGTVFAYSLDVPSPDRRSELAIHALLAKEIQLMHRAPVVSVWVLDGRG--RPLPEPLEASHDLARAAEMQGGHSLLIASEEQFKVFSLPKVTAKTKFKLTAHEGARVRKVALCDAAGQR--DEWHGRSLLLCLTNLG 593          
BLAST of Protein lethal(2) giant larvae vs. Ensembl Sea Lamprey
Match: ENSPMAT00000003126.1 (pep scaffold:Pmarinus_7.0:GL479844:18893:28646:-1 gene:ENSPMAG00000002854.1 transcript:ENSPMAT00000003126.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 121.709 bits (304), Expect = 7.204e-29
Identity = 147/589 (24.96%), Postives = 245/589 (41.60%), Query Frame = 1
Query: 1459 PYLNCLHNSPITAYQFLSEVKSDWFQKLNEMSSNKEDCNISFSDWPIKGYAQKVRN--DEIWQNDLLIIGHGDGTIVFWKFGMGGCMKKISTVKSSSLFKMADELHLNEVSYEDDE-IPLRRTGQFDPCCDDNRLAIQ---LIHYTGKHLLIGGYGGQIVL---WGFQENKYEKHLLDVDLTTHLSNFKWKGCQPFQHIEGSIKTGSNFQVMMSMCIFPPSQITALDILEDNNCNGYVIIACGTLHGLVIVSCPKETNLEALVLTTHCTV-PRNTLA---------SQEASLGEGWARRRTXXXXXXXXXXXXXXXXXXXXXMEHPSVSRHLSDNNDKTMRXXXXXXXXXXXXXXXXDR---PK--DTANDGLIRSIRINVSLIKRKGSNGPHEKLLNLFAGCYGGLLLWFQSDYSVENILKNSPINLRLIKQYQFQHRAPILHFNMLSPESGLSKLNENPDAGFDL--DPNRKPDH-LVVLTEEQVRLYAFPSFTLKCKIRVTAHDGFRLKNGSLIVFSDDRLTTQNNTKEPLICATNNGGQFLLLNCVNLKRKDVVQFVDKTDLMALNFMSLAKNANLSNTRTLCPY 3144
            PYL+ LH+S IT    ++ V    +++++     +     S S WPI G     RN   E  + +LL+ GH DGT+ FW    G  +  +  + ++ LF+   E         DDE  P  + G FDP  DD RL IQ   L  ++G+ LL+ G  GQ+VL    G +    E  ++ VDL      F WKG +      G     + ++  + + + PP+ +TAL +  +     + ++A GT HG  +    K     A V+   CT+ P  TLA         S + SL + + R R   +    R                  V   + + N +    +  E      + A   R   P+  D +  GL+R +    + ++      P      L+ G   G +  +  D    +      I+  L K+ Q  HRAP++   +L        L E  +A  DL      +  H L++ +EEQ ++++ P  T K K ++TAH+G R++  +L   +  R   + + +  L+C TN  G    ++   L+       V K D+ A++       A     R   P+
Sbjct:    6 PYLSPLHSSAITCSCHVAAVPLRLWERVSATGRAQRALAPSAS-WPILGG----RNLLPEPSERNLLLTGHEDGTVRFWD-ASGAGLTPLYILSTAPLFQTDGEHSEGLGPASDDEWPPFVKVGCFDPYSDDPRLGIQKISLCKFSGR-LLVAGTAGQVVLIMELGDEAAVQEIAVVTVDLLKEREGFAWKGHERLVVRPGPRTLPAGYRPGLLLQVLPPAAVTALVLHAE-----WRLLAFGTSHGFGLFDYQK-----AHVVFARCTLHPSETLALEGPLSRVKSLKKSLRQSFRRIRKSRVSGKKRDPPPPP-----------PVGAQVQEANARLAEQQQEEAAARDADVAPVQRRVEPRSLDDSLSGLVRCLYFADTFLRDGTRQCP-----TLWVGTNAGTVFAYSLDVPSPDRRSELAIHALLAKEIQLMHRAPVVSVWVLDGRG--RPLPEPLEASHDLARAAEMQGGHSLLIASEEQFKVFSLPKVTAKTKFKLTAHEGARVRKVALCDAAGQR--DEWHGRSLLLCLTNL-GDVHTVSVPGLRPLSRHACVRKEDISAVSSCLFTATAQGVGVRCPSPW 556          
BLAST of Protein lethal(2) giant larvae vs. Ensembl Sea Lamprey
Match: ENSPMAT00000003932.1 (pep scaffold:Pmarinus_7.0:GL482330:1953:13145:-1 gene:ENSPMAG00000003602.1 transcript:ENSPMAT00000003932.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 50.8322 bits (120), Expect = 4.251e-8
Identity = 32/89 (35.96%), Postives = 46/89 (51.69%), Query Frame = 1
Query:  208 QSIEDFGSIPEPSCIDYDHKLSLLGIASKKGLIKIFGCPGVCYSTRLEGQDEIWNIKFIPGTNFFVTLTADNKLILWLI------STLT 456
            Q++E  G   +PS + YD  L L+ I +K G +KI+G PGV ++        +  + F+PG    V+L  D  L LW I      STLT
Sbjct:    1 QTVEH-GFPHQPSALAYDPDLRLMAIGTKSGAVKIYGAPGVEFTGLHRDIAIVTQLHFLPGQARVVSLLDDGSLHLWEIVEKDGYSTLT 88          
BLAST of Protein lethal(2) giant larvae vs. Ensembl Nematostella
Match: EDO48036 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RKR7])

HSP 1 Score: 211.846 bits (538), Expect = 1.646e-56
Identity = 218/904 (24.12%), Postives = 381/904 (42.15%), Query Frame = 1
Query:  238 EPSCIDYDHKLSLLGIASKKGLIKIFGCPGVCYSTRLEGQDEIWNIKFIPGTNFFVTLTAD---NKLILWLISTLTNELFKVDVISNLNVVNSARTSAHXXXXXXXXXXXXXXXXXTAIEVNDLTSSIIMGNGSGSLIQVKLDLLKMRKQANNYKTVPPGNTIWQMPTKSDVIDRDRIISKLPIGSQNRVIIDAVIHISARPGSRKHLLIGYRSGNSIIYNVQKDSVDFLLSAKSTLNALSWCPPDPIVQDNFMVAPNRNEPQYYSSMKLHSCHEDGSIITWNLPQNSDEFLVLDFQIFSPYKKDQKCLPISKILWKRYKQDYLIVFSGGLPRSDYMTKSTITIMNNSCLDSSKANNEHLVLDLTSQLIDFTTIDDNDS----GSVEYLLVLTEEEFFIVDL-TKE-SWPILHDRQPYLNCLHNSPITAYQFLSEVKSDWFQKLNEMSSNKEDCNISFSDWPIKGYAQKVRNDEIWQNDLLIIGHGDGTIVFWKFGMGGCMKKISTVKSSSLFKMADELHLNEVSYEDDE--IPLRRTGQFDPCCDDNRLAIQ--LIHYTGKHLLIGGYGGQIVLWGF--QENKYEKHLLDVDLTTHLSNFKWKGCQPFQHIEGSIKTGSNFQVMMSMCIFPPSQITALDILEDNNCNGYVIIACGTLHGLVIVSCPKETNLEALVLTTHCTVPRNTLASQEASLGEGWARRRTXXXXXXXXXXXXXXXXXXXXXMEHPSVSRHLSDNNDKTMRXXXXXXXXXXXXXXXXDRPK-DTANDGLIRSIRINVSLIKRKGSNGPHEKLLNLFAGCYGGLLLWFQSDYSVENILKNSPINLRLIKQYQFQHRAPILHFNMLSPESGLSKLNENPDAGFDLDPNRKPDHLVVLTEEQVRLYAFPSFTLKCKIRVTAHDG 2901
            +PS +  D KL+LL I ++ G ++IFG PGV  +   + Q  I  + F+P     +++  D   N + LW       E+ K D  S L  V +       ++       +              T+ +++G   G++  + ++  ++++                      VI +D ++  +   S+      +V  I   P     +LIGY+ G ++++N +  SV         L +LSW                     ++   K  S H DGS+  + +  +S E        F P+     C  I+KI W     D  + F+GG+PR+ Y  K+ I+++  S           +V D TS++IDF T+    +         L VL E+E  ++DL TKE  +P     +PYL CLH+SPIT         S  + ++     ++     S   WPI G    V + E    D+LI GH DG++ FW       M+ + T+ +S +F    E H N     ++E   P ++ G FDP  DD R A+Q  L+      L I G GGQI+++    QE   E  + ++DL       +WKG  P    EG++ T   FQ +  +   P + I++L +     C  +  +A GT HG  ++    +TN +  V+TT CTV    L    ++ GE  +R+++ +          R  R+ T++ + P   R   +    T              + +    + D     ++R I    + +K    +G H           G + +++ +    EN  K+  +   + K+ + +H+API+   ++  +      +   D G D+        LV+ +EEQ ++++ P    + K ++TA DG
Sbjct:   39 KPSALAQDPKLNLLAIGTEDGTLRIFGRPGVQLTACHDNQTRIQELHFLPEQGRVISVCDDGEQNSIHLW-------EVNKKDGKSVLEEVKTCTLEGRCEARICICCLSMK------------TNRLLLGTEGGNIYLLDINSFELQEY---------------------VIYQDVVMQSVQEDSKTNA--GSVEAIQEHPNDSNKILIGYKKGLTVLWNHESCSVQQTFPNSIDLESLSW---------------------HHGGDKFISAHADGSLTEYTIVSDS-ETTGETSTPFGPFP----CKAITKIEW----HDNSVFFAGGMPRASYGDKNCISLVQGS--------TTQVVFDFTSRVIDFITVIPLTTVGFLAEPACLAVLCEQELVVIDLKTKEQGYPTF--MKPYLTCLHSSPITTSYHCHGCPSQLWNQICAAGKDQIQSEYSHESWPITGGKTLVEDAET--KDILITGHEDGSVQFWDVSQVE-MQLMYTLSTSKMFISDHEGHDNGTQEVEEEGWPPFKKVGNFDPFSDDPRFAVQKILLSTENNMLTIAGNGGQILVYEINDQEKDIELQVTEIDLVEDKEKLQWKGHGPLAVKEGAVCTPRGFQPVQGVQFIPAAAISSLAV-----CPKWGALAAGTCHGFALL----DTNTKK-VVTTKCTVSSEEL----SATGEPISRKKSLKKSIRDSFRRLRRSRKGTRKGDTP---RKEGEAGAATPPQSPAAAPQSPPVQRLVHESRVDETVLSMVRCIYFVETFVK----DGVHHSPSMWVGTNAGHIYVYYITLPDEEN--KDHGLEAEVGKEIKLKHKAPIVAIFVVDKDGSPILADSENDKGVDMSGQHS---LVICSEEQFKVFSLPHLKARQKEKLTAIDG 831          
BLAST of Protein lethal(2) giant larvae vs. Ensembl Nematostella
Match: EDO30312 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7T154])

HSP 1 Score: 57.3806 bits (137), Expect = 3.177e-8
Identity = 32/109 (29.36%), Postives = 51/109 (46.79%), Query Frame = 1
Query: 1381 LLVLTEEEFFIVDLTK--ESWPILHDRQPYLNCLHNSPITAYQFLSEVKSDWFQKLNEMSSNKE----DCNISFSDWPIKGYAQKVRNDEIWQNDLLIIGHGDGTIVFW 1689
            ++ +T     + D+     S P+  D  PY   +H SP+T  Q+++E   D  + L E+    +        S   WPI G A   R  +   ++L+I GH DGT+ FW
Sbjct:  155 IIAITPARLLVFDVASALSSKPVTFD-VPYAFEIHESPVTCTQYITECPPDLIRALREVGGRPKKKLLQREASRQPWPITGGAINDRETDDESSELIITGHADGTVRFW 262          
BLAST of Protein lethal(2) giant larvae vs. Ensembl Medaka
Match: llgl2 (LLGL scribble cell polarity complex component 2 [Source:NCBI gene;Acc:101172480])

HSP 1 Score: 219.935 bits (559), Expect = 2.112e-58
Identity = 244/951 (25.66%), Postives = 412/951 (43.32%), Query Frame = 1
Query:  193 EFYKKQSIEDFGSIPEPSCIDYDHKLSLLGIASKKGLIKIFGCPGVCYSTRLEGQDEIWNIKFIPGTNFFVTLTADNKLILWLISTLTNELFKVDVISNLNVVNSARTSAHXXXXXXXXXXXXXXXXXTAIEVNDLTSSIIMGNGSGSLIQVKLDLLKMRKQANNYKTVPPGNTIWQMPTKSDVIDRDRIISKLPIGSQNRVIIDAVIHISARPGSRKHLLIGYRSGNSIIYNVQKDSVDFLLSAKSTLNALSWCPPDPIVQDNFMVAPNRNEPQYYSSMKLHSCHEDGSIITWNLPQNSDEFLVLDFQIFSPYKKDQKCLPISKIL-WKRYKQDYLIVFSGGLPRSDYMTKSTITIMNNSCLDSSKANNEHLVLDLTSQLIDFTTIDD--NDSGSVEYLLVLTEEEFFIVDLTKESWPILHDRQPYLNCLHNSPITAYQFLSEVKSDWFQKLNEMSSNKEDCNISFSDWPIKGYAQKVRNDEIWQNDLLIIGHGDGTIVFWKFGMGGCMKKISTVKSSSLFKM-ADELHLNEVSYEDDEIPLRRTGQFDPCCDDNRLAIQLIH---YTGKHLLIGGYGGQIVLWGFQENKYEKHLLD--VDLTTHLSNFKWKGCQPFQHIEGSIKTGSNFQVMMSMCIFPPSQITALDILEDNNCNGYVIIACGTLHGLVIVSCPKETNLEALVLTTHCTV-PRNTLASQEASLGEGWARRRTXXXXXXXXXXXXXXXXXXXXXMEHPSVSRHLSDNNDKTMRXXXXXXXXXXXXXXXXDRPKDTANDGLIRSIRINVSLIKRKGSNGPHEKLLNLFAGCYGGLLLWFQSDYSVENILKNSPINLRLIKQYQFQHRAPILHFNMLSPESGLSKLNENPDAGFDLDPNRKPD-----HLVVLTEEQVRLYAFPSFTLKCKIRVTAHDGFRLKNGSLIVFSDDRLTTQNNTKEPLICATNNG 3000
            E ++     + G   +PS + +   L LL I ++ G IK++G PGV +    +    +  + F+P     VTL  DN L +W   TL       +++     V +    A                 ITA+  +     +++G   G +  V++   +  ++ N                    I  +++ S++P     R  ++ V  +   P     ++IGY  G  ++++++K S+   +     L ++ W       +D   +                S H DGS   W + +        D    +PY     C  ISKI+     +    ++FSGG+PR+ Y  +  IT+++            H+ LD TS++IDF  I +  +  G    L+VL EEE  ++DL  E WP++  + PYL  LH+S IT    +S +    +++++   +  +  + S   WPI+G  Q +  D   Q DLL+ GH DGT+ FW    G C+  +  + ++++F   AD       S E +  P R+ G FDP  DD RL IQ IH   Y+G +L + G  GQI++    +   E+ +    VDL      F+WKG       E  ++    FQ    +   PP+ +TAL +  +     + ++A GT HG  +    ++ N     +   CT+ P + LA       EG   R     K   +S  R  R R + R  H + S  L + N + +  EL E E+   +R IE R  D +  GL+R +    + +     N P     +L+AG  GG +  +              I  +  K+ Q  HRAP++   +L      + L E  +   DL   R PD     HL+V++EEQ +++  P  + K K+++TA DG R++   +  F  +R  T++  +  L+  TN G
Sbjct:   39 ELFQFSKTVEHGFPHQPSALGHSSSLQLLAIGTRSGAIKLYGAPGVEFMGLHDENAAVTQVHFLPHQVELVTLLDDNSLHMW---TLKGHKGVSELLEIGRFVLTGPPGA-----------LPSVTRITAVLAHSSGELLLLGTEGGHVFVVEVPGFRELEERN--------------------ISLEQVTSRVPDNYIGRRNLEHVEALQENPADANQVVIGYGRGVLVVWDLKKHSLLQCICPSQALESVWW------TEDGGCIL---------------SSHTDGSYCRWTVGETDGNEEKSD----TPYGTF-PCKAISKIMQLPTAEGPPFLLFSGGMPRASYGDRHCITVIHG---------KSHVALDFTSRIIDFFVIREGPHHKGDPSALVVLVEEELVVIDLQAEGWPVV--QTPYLVPLHSSAITCSHHVSAIPLKLWERISAAGA-LQSTHYSKKLWPIRG-GQNLAPDPP-QRDLLLTGHEDGTVRFWD-ASGVCLSPVYKLSTAAVFHTDADPNDNMNHSTEGEWPPFRKVGCFDPYSDDPRLGIQKIHLCKYSG-YLTVAGTAGQIMVLELNDEAAEQTVEAQVVDLLQGQEGFRWKGHTQLDVREDPVQFPPGFQPFTLVQCQPPAVVTALILHSE-----WKLVAFGTSHGFGLFDYQQKKN-----VLVKCTLNPSDQLAM------EGPLSRVKSIKKSLRQSFRRIRRSRVSLRKHHVNSSAKLQEANAR-LEAELAEMELAPVQRKIEARSSDDSFTGLVRVLYFADTFLTDSTHNTP-----SLWAGTNGGCVFAYILHLPTMEHRGEELITAQPAKEIQLMHRAPVVGVVVLDGHG--TPLPEPLEVAHDL--ARSPDMHGSHHLLVVSEEQFKVFTLPKVSAKTKLKLTAIDGSRVRKVGVAWFGSNR--TEDYGESGLLVLTNQG 885          
BLAST of Protein lethal(2) giant larvae vs. Ensembl Medaka
Match: llgl2 (LLGL scribble cell polarity complex component 2 [Source:NCBI gene;Acc:101172480])

HSP 1 Score: 219.164 bits (557), Expect = 3.748e-58
Identity = 244/951 (25.66%), Postives = 412/951 (43.32%), Query Frame = 1
Query:  193 EFYKKQSIEDFGSIPEPSCIDYDHKLSLLGIASKKGLIKIFGCPGVCYSTRLEGQDEIWNIKFIPGTNFFVTLTADNKLILWLISTLTNELFKVDVISNLNVVNSARTSAHXXXXXXXXXXXXXXXXXTAIEVNDLTSSIIMGNGSGSLIQVKLDLLKMRKQANNYKTVPPGNTIWQMPTKSDVIDRDRIISKLPIGSQNRVIIDAVIHISARPGSRKHLLIGYRSGNSIIYNVQKDSVDFLLSAKSTLNALSWCPPDPIVQDNFMVAPNRNEPQYYSSMKLHSCHEDGSIITWNLPQNSDEFLVLDFQIFSPYKKDQKCLPISKIL-WKRYKQDYLIVFSGGLPRSDYMTKSTITIMNNSCLDSSKANNEHLVLDLTSQLIDFTTIDD--NDSGSVEYLLVLTEEEFFIVDLTKESWPILHDRQPYLNCLHNSPITAYQFLSEVKSDWFQKLNEMSSNKEDCNISFSDWPIKGYAQKVRNDEIWQNDLLIIGHGDGTIVFWKFGMGGCMKKISTVKSSSLFKM-ADELHLNEVSYEDDEIPLRRTGQFDPCCDDNRLAIQLIH---YTGKHLLIGGYGGQIVLWGFQENKYEKHLLD--VDLTTHLSNFKWKGCQPFQHIEGSIKTGSNFQVMMSMCIFPPSQITALDILEDNNCNGYVIIACGTLHGLVIVSCPKETNLEALVLTTHCTV-PRNTLASQEASLGEGWARRRTXXXXXXXXXXXXXXXXXXXXXMEHPSVSRHLSDNNDKTMRXXXXXXXXXXXXXXXXDRPKDTANDGLIRSIRINVSLIKRKGSNGPHEKLLNLFAGCYGGLLLWFQSDYSVENILKNSPINLRLIKQYQFQHRAPILHFNMLSPESGLSKLNENPDAGFDLDPNRKPD-----HLVVLTEEQVRLYAFPSFTLKCKIRVTAHDGFRLKNGSLIVFSDDRLTTQNNTKEPLICATNNG 3000
            E ++     + G   +PS + +   L LL I ++ G IK++G PGV +    +    +  + F+P     VTL  DN L +W   TL       +++     V +    A                 ITA+  +     +++G   G +  V++   +  ++ N                    I  +++ S++P     R  ++ V  +   P     ++IGY  G  ++++++K S+   +     L ++ W       +D   +                S H DGS   W + +        D    +PY     C  ISKI+     +    ++FSGG+PR+ Y  +  IT+++            H+ LD TS++IDF  I +  +  G    L+VL EEE  ++DL  E WP++  + PYL  LH+S IT    +S +    +++++   +  +  + S   WPI+G  Q +  D   Q DLL+ GH DGT+ FW    G C+  +  + ++++F   AD       S E +  P R+ G FDP  DD RL IQ IH   Y+G +L + G  GQI++    +   E+ +    VDL      F+WKG       E  ++    FQ    +   PP+ +TAL +  +     + ++A GT HG  +    ++ N     +   CT+ P + LA       EG   R     K   +S  R  R R + R  H + S  L + N + +  EL E E+   +R IE R  D +  GL+R +    + +     N P     +L+AG  GG +  +              I  +  K+ Q  HRAP++   +L      + L E  +   DL   R PD     HL+V++EEQ +++  P  + K K+++TA DG R++   +  F  +R  T++  +  L+  TN G
Sbjct:   39 ELFQFSKTVEHGFPHQPSALGHSSSLQLLAIGTRSGAIKLYGAPGVEFMGLHDENAAVTQVHFLPHQVELVTLLDDNSLHMW---TLKGHKGVSELLEIGRFVLTGPPGA-----------LPSVTRITAVLAHSSGELLLLGTEGGHVFVVEVPGFRELEERN--------------------ISLEQVTSRVPDNYIGRRNLEHVEALQENPADANQVVIGYGRGVLVVWDLKKHSLLQCICPSQALESVWW------TEDGGCIL---------------SSHTDGSYCRWTVGETDGNEEKSD----TPYGTF-PCKAISKIMQLPTAEGPPFLLFSGGMPRASYGDRHCITVIHG---------KSHVALDFTSRIIDFFVIREGPHHKGDPSALVVLVEEELVVIDLQAEGWPVV--QTPYLVPLHSSAITCSHHVSAIPLKLWERISAAGA-LQSTHYSKKLWPIRG-GQNLAPDPP-QRDLLLTGHEDGTVRFWD-ASGVCLSPVYKLSTAAVFHTDADPNDNMNHSTEGEWPPFRKVGCFDPYSDDPRLGIQKIHLCKYSG-YLTVAGTAGQIMVLELNDEAAEQTVEAQVVDLLQGQEGFRWKGHTQLDVREDPVQFPPGFQPFTLVQCQPPAVVTALILHSE-----WKLVAFGTSHGFGLFDYQQKKN-----VLVKCTLNPSDQLAM------EGPLSRVKSIKKSLRQSFRRIRRSRVSLRKHHVNSSAKLQEANAR-LEAELAEMELAPVQRKIEARSSDDSFTGLVRVLYFADTFLTDSTHNTP-----SLWAGTNGGCVFAYILHLPTMEHRGEELITAQPAKEIQLMHRAPVVGVVVLDGHG--TPLPEPLEVAHDL--ARSPDMHGSHHLLVVSEEQFKVFTLPKVSAKTKLKLTAIDGSRVRKVGVAWFGSNR--TEDYGESGLLVLTNQG 885          
BLAST of Protein lethal(2) giant larvae vs. Ensembl Medaka
Match: LLGL1 (LLGL scribble cell polarity complex component 1 [Source:NCBI gene;Acc:101167542])

HSP 1 Score: 213.386 bits (542), Expect = 2.549e-56
Identity = 257/1034 (24.85%), Postives = 443/1034 (42.84%), Query Frame = 1
Query:  148 YNFKTKYIN-QNESIGE--FYKKQSIEDFGSIPEPSCIDYDHKLSLLGIASKKGLIKIFGCPGVCYSTRLEGQDEIWNIKFIPGTNFFVTLTADNKLILW-LISTLTNEL--FKVDVISNLNVVNSARTSAHXXXXXXXXXXXXXXXXXTAIEVNDLTSSIIMGNGSGSLIQVKLDLLKMRKQANNYKTVPPGNTIWQMPTKSDVIDRDRIISKLPIGSQNRVIIDAVIHISARPGSRKHLLIGYRSGNSIIYNVQKDSVDFLLSAKSTLNALSWCPPDPIVQDNFMVAPNRNEPQYYSSMKLHSCHEDGSIITWNLPQNSDEFLVLDFQIFS---PYKKDQKCLPISKILWKRYKQDYLIVFSGGLPRSDYMTKSTITIMNNSCLDSSKANNEHLVLDLTSQLIDFTTI----DDNDSGSVEYLLVLTEEEFFIVDLTKESWPILHDRQPYLNCLHNSPITAYQFLSEVKSDWFQKLNEMSSNKEDCNISFSDWPIKGYAQKVRNDEIWQNDLLIIGHGDGTIVFWKFGMGGCMKKISTVKSSSLFKMADELHLNEVSYEDDEIPLRRTGQFDPCCDDNRLAIQ---LIHYTGKHLLIGGYGGQIVLWGFQENKYEKHLLDV---DLTTHLSNFKWKGCQPFQHIEGSIKTG---SNFQVMMSMCIFPPSQITALDILEDNNCNGYVIIACGTLHGLVIVSCPKETNLEALVLTTHCTVPRNTLASQEASLGEGWARRRTXXXXXXXXXXXXXXXXXXXXXMEHPSVSRHLSDNNDKTMRXXXXXXXXXXXXXXXXDRPKDTANDGLIRSIRINVSLIKRKGSNGPHEKLLNLFAGCYGGLLLWF-------------------QSDYSVENILKNSPINLRLIKQYQFQHRAPILHFNMLSPESGLSKLNENP-DAGFDLD--PNRKPDHLVVL-TEEQVRLYAFPSFTLKCKIRVTAHDGFRLKNGSLIVFSDDRLTTQNNTKEPLICATNNGGQFLLLNCVNLKRKDVVQFVDKTDLMALNFMSLAKNAN 3114
            + F+ +  + Q E I +  F  K+++E  G   +PS + +D KL L+ I +K G IKI+G PGV ++   +    +  I F+PG    +++  DN +  W L++  T E+   K + + +L  V+S         + ++          T + +      + MG   G +  ++L  L +++            T+ Q          D +   LP   +    +  V  +   P     +LIGY  G  +++++     D L   K  L +L W                R+   + SS      H DG    W +   +    + + Q  S   PY     C  I+KILW R     +I++SGG+PR+ Y  +  +TI         + + EH+ LD TS++IDF T+    +D +      L+VL EEE  ++DL    WP L    PYL  LH+S IT    ++ V +  +++L      ++    +   WPI G   K       Q +LL+ GH DGT+ FW    G  +  +  + ++++F   +     E   E++  P R+ G FDP  DD RL IQ   L  Y+ K L++ G  GQ+++ G  + + + HL+DV   DL      F WKG      +E  +K       FQ ++ +   PP+ +TA+ +  + N     ++A GT HG  +    +   + A      CT+  N   + E  L    +R ++ +          R  R S K+    + +  + + N         + EV   +R IE R  D +  G++R      + ++    +GP      L+AG   G +  +                   +S   VE +L          K+ Q  HRAP++   +L    G  K   +P +A  DL   P+    H V++ +EEQ+++++ P  + K K ++TAH+G R++  +L++FS      +  ++  L+C TN  G   L N   L+ +     + K D+  +      KN  
Sbjct:    4 FRFRRQSTDPQREKIKQELFAFKKTVE-HGFPHQPSALAFDPKLQLMAIGTKSGAIKIYGAPGVEFTGLHKDTTAVTQILFLPGRGCLLSVLDDNTIHRWELVAESTREVGGVKKEGVVSLREVDSYSLPGRPGIESSSATRV------TVLLLLKSCDLLCMGTEGGGVYVLELPRLSLKEN----------QTLLQ----------DHVTQSLPDDYRCGKSLGPVESLQEHPQQAGKILIGYSRGLVVLWDLSSRHADQLFLGKQQLESLVW---------------ERSGNLFVSS------HNDGGYSVWAVTNGN----IYNHQPVSSTIPYGP-FPCKAITKILW-RTTHSPVILYSGGMPRASYGDRHCLTI---------QQDKEHVTLDFTSRVIDFFTVHNMDNDKEFDDPSALVVLLEEELVVIDLLTPGWPSL--PTPYLAPLHSSAITCSCHVTNVSTKLWERLINAGKAQQSRRHTHRKWPICG--GKNLAPPPRQQELLLTGHEDGTVRFWD-ASGVALTPLYKLSTANVFHTDEMQQQQEEEEEEEWPPFRKVGCFDPYSDDPRLGIQKISLCKYSNK-LVVAGTAGQVIVLGLNDERSD-HLVDVSVMDLLQDREGFTWKG---HDRLEPRLKPAPFLPGFQPLVLLQCLPPASVTAVALHTEWN-----LVAFGTSHGFGLFDYHRRNAVLA-----RCTLHPNDSLAMEGPL----SRVKSLKKSLRQSFRRIRKSRVSGKKRAVITTTSKVQEANAALAE----QEEVAPVQRRIEPRSADDSLSGVVRCFCFADTFLRDGTHHGP-----TLWAGTNSGSVYAYALEVPGVDSGRTCERGGASESSMCVEAVLG---------KEIQLMHRAPVVSICVL---DGRGKPLPDPYEASQDLSIAPDMTNAHSVLIASEEQLKVFSLPKVSAKTKFKLTAHEGCRVRKVALVLFSS--AVQEEYSEHTLVCLTNM-GDMHLFNMPGLRPQVRFDCIRKEDISGIASCVFTKNGQ 926          
BLAST of Protein lethal(2) giant larvae vs. Ensembl Medaka
Match: llgl2 (LLGL scribble cell polarity complex component 2 [Source:NCBI gene;Acc:101172480])

HSP 1 Score: 189.504 bits (480), Expect = 1.240e-48
Identity = 211/777 (27.16%), Postives = 351/777 (45.17%), Query Frame = 1
Query:  745 IDRDRIISKLPIGSQNRVIIDAVIHISARPGSRKHLLIGYRSGNSIIYNVQKDSVDFLLSAKSTLNALSWCPPDPIVQDNFMVAPNRNEPQYYSSMK----------LHSCHEDGSIITWNLPQNSDEFLVLDFQIFSPYKKDQKCLPISKIL-WKRYKQDYLIVFSGGLPRSDYMTKSTITIMNNSCLDSSKANNEHLVLDLTSQLIDFTTIDD--NDSGSVEYLLVLTEEEFFIVDLTKESWPILHDRQPYLNCLHNSPITAYQFLSEVKSDWFQKLNEMSSNKEDCNISFSDWPIKGYAQKVRNDEIWQNDLLIIGHGDGTIVFWKFGMGGCMKKISTVKSSSLFKM-ADELHLNEVSYEDDEIPLRRTGQFDPCCDDNRLAIQLIH---YTGKHLLIGGYGGQIVLWGFQENKYEKHLLD--VDLTTHLSNFKWKGCQPFQHIEGSIKTGSNFQVMMSMCIFPPSQITALDILEDNNCNGYVIIACGTLHGLVIVSCPKETNLEALVLTTHCTV-PRNTLASQEASLGEGWARRRTXXXXXXXXXXXXXXXXXXXXXMEHPSVSRHLSDNNDKTMRXXXXXXXXXXXXXXXXDRPKDTANDGLIRSIRINVSLIKRKGSNGPHEKLLNLFAGCYGGLLLWFQSDYSVENILKNSPINLRLIKQYQFQHRAPILHFNMLSPESGLSKLNENPDAGFDLDPNRKPD-----HLVVLTEEQVRLYAFPSFTLKCKIRVTAHDGFRLKNGSLIVFSDDRLTTQNNTKEPLICATNNG 3000
            I  +++ S++P     R  ++ V  +   P     ++IGY  G  ++++++K S+   +         S      +    FM + N     Y+ +++          + S H DGS   W + +        D    +PY     C  ISKI+     +    ++FSGG+PR+ Y  +  IT+++            H+ LD TS++IDF  I +  +  G    L+VL EEE  ++DL  E WP++  + PYL  LH+S IT    +S +    +++++   +  +  + S   WPI+G  Q +  D   Q DLL+ GH DGT+ FW    G C+  +  + ++++F   AD       S E +  P R+ G FDP  DD RL IQ IH   Y+G +L + G  GQI++    +   E+ +    VDL      F+WKG       E  ++    FQ    +   PP+ +TAL +  +     + ++A GT HG  +    ++ N     +   CT+ P + LA       EG   R     K   +S  R  R R + R  H + S  L + N + +  EL E E+   +R IE R  D +  GL+R +    + +     N P     +L+AG  GG +  +              I  +  K+ Q  HRAP++   +L      + L E  +   DL   R PD     HL+V++EEQ +++  P  + K K+++TA DG R++   +  F  +R  T++  +  L+  TN G
Sbjct:  189 ISLEQVTSRVPDNYIGRRNLEHVEALQENPADANQVVIGYGRGVLVVWDLKKHSLLQCICPSQVRCPSSMGMILRMQLKGFMQS-NEAPLLYFQALESVWWTEDGGCILSSHTDGSYCRWTVGETDGNEEKSD----TPYGTF-PCKAISKIMQLPTAEGPPFLLFSGGMPRASYGDRHCITVIHG---------KSHVALDFTSRIIDFFVIREGPHHKGDPSALVVLVEEELVVIDLQAEGWPVV--QTPYLVPLHSSAITCSHHVSAIPLKLWERISAAGA-LQSTHYSKKLWPIRG-GQNLAPDPP-QRDLLLTGHEDGTVRFWD-ASGVCLSPVYKLSTAAVFHTDADPNDNMNHSTEGEWPPFRKVGCFDPYSDDPRLGIQKIHLCKYSG-YLTVAGTAGQIMVLELNDEAAEQTVEAQVVDLLQGQEGFRWKGHTQLDVREDPVQFPPGFQPFTLVQCQPPAVVTALILHSE-----WKLVAFGTSHGFGLFDYQQKKN-----VLVKCTLNPSDQLAM------EGPLSRVKSIKKSLRQSFRRIRRSRVSLRKHHVNSSAKLQEANAR-LEAELAEMELAPVQRKIEARSSDDSFTGLVRVLYFADTFLTDSTHNTP-----SLWAGTNGGCVFAYILHLPTMEHRGEELITAQPAKEIQLMHRAPVVGVVVLDGHG--TPLPEPLEVAHDL--ARSPDMHGSHHLLVVSEEQFKVFTLPKVSAKTKLKLTAIDGSRVRKVGVAWFGSNR--TEDYGESGLLVLTNQG 915          
BLAST of Protein lethal(2) giant larvae vs. Ensembl Medaka
Match: LLGL1 (LLGL scribble cell polarity complex component 1 [Source:NCBI gene;Acc:101167542])

HSP 1 Score: 174.096 bits (440), Expect = 9.473e-44
Identity = 183/713 (25.67%), Postives = 309/713 (43.34%), Query Frame = 1
Query:  148 YNFKTKYIN-QNESIGE--FYKKQSIEDFGSIPEPSCIDYDHKLSLLGIASKKGLIKIFGCPGVCYSTRLEGQDEIWNIKFIPGTNFFVTLTADNKLILW-LISTLTNEL--FKVDVISNLNVVNSARTSAHXXXXXXXXXXXXXXXXXTAIEVNDLTSSIIMGNGSGSLIQVKLDLLKMRKQANNYKTVPPGNTIWQMPTKSDVIDRDRIISKLPIGSQNRVIIDAVIHISARPGSRKHLLIGYRSGNSIIYNVQKDSVDFLLSAKSTLNALSWCPPDPIVQDNFMVAPNRNEPQYYSSMKLHSCHEDGSIITWNLPQNSDEFLVLDFQIFS---PYKKDQKCLPISKILWKRYK-QDYLIVFSGGLPRSDYMTKSTITIMNNSCLDSSKANNEHLVLDLTSQLIDFTTI----DDNDSGSVEYLLVLTEEEFFIVDLTKESWPILHDRQPYLNCLHNSPITAYQFLSEVKSDWFQKLNEMSSNKEDCNISFSDWPIKGYAQKVRNDEIWQNDLLIIGHGDGTIVFWKFGMGGCMKKISTVKSSSLFKMADELHLNEVSYEDDEI--------------PLRRTGQFDPCCDDNRLAIQ---LIHYTGKHLLIGGYGGQIVLWGFQENKYEKHLLDV---DLTTHLSNFKWKGCQPFQHIEGSIKTG---SNFQVMMSMCIFPPSQITALDILEDNNCNGYVIIACGTLHGL 2175
            + F+ +  + Q E I +  F  K+++E  G   +PS + +D KL L+ I +K G IKI+G PGV ++   +    +  I F+PG    +++  DN +  W L++  T E+   K + + +L  V+S         + ++          T + +      + MG   G +  ++L  L +++            T+ Q          D +   LP   +    +  V  +   P     +LIGY  G  +++++     D L   K  L +L W                R+   + SS      H DG    W +   +    + + Q  S   PY     C  I+KILW+  +    +I++SGG+PR+ Y  +  +TI         + + EH+ LD TS++IDF T+    +D +      L+VL EEE  ++DL    WP L    PYL  LH+S IT    ++ V +  +++L      ++    +   WPI G   K       Q +LL+ GH DGT+ FW    G  +  +  + ++++F    +   +     DD                P R+ G FDP  DD RL IQ   L  Y+ K L++ G  GQ+++ G  + + + HL+DV   DL      F WKG      +E  +K       FQ ++ +   PP+ +TA+ +  + N     ++A GT HG 
Sbjct:    4 FRFRRQSTDPQREKIKQELFAFKKTVE-HGFPHQPSALAFDPKLQLMAIGTKSGAIKIYGAPGVEFTGLHKDTTAVTQILFLPGRGCLLSVLDDNTIHRWELVAESTREVGGVKKEGVVSLREVDSYSLPGRPGIESSSATRV------TVLLLLKSCDLLCMGTEGGGVYVLELPRLSLKEN----------QTLLQ----------DHVTQSLPDDYRCGKSLGPVESLQEHPQQAGKILIGYSRGLVVLWDLSSRHADQLFLGKQQLESLVW---------------ERSGNLFVSS------HNDGGYSVWAVTNGN----IYNHQPVSSTIPYGP-FPCKAITKILWRTTQLSSPVILYSGGMPRASYGDRHCLTI---------QQDKEHVTLDFTSRVIDFFTVHNMDNDKEFDDPSALVVLLEEELVVIDLLTPGWPSL--PTPYLAPLHSSAITCSCHVTNVSTKLWERLINAGKAQQSRRHTHRKWPICG--GKNLAPPPRQQELLLTGHEDGTVRFWD-ASGVALTPLYKLSTANVFHTDGDPIDDPHDPCDDPEMQQQQEEEEEEEWPPFRKVGCFDPYSDDPRLGIQKISLCKYSNK-LVVAGTAGQVIVLGLNDERSD-HLVDVSVMDLLQDREGFTWKG---HDRLEPRLKPAPFLPGFQPLVLLQCLPPASVTAVALHTEWN-----LVAFGTSHGF 639          

HSP 2 Score: 59.3066 bits (142), Expect = 2.560e-8
Identity = 43/151 (28.48%), Postives = 76/151 (50.33%), Query Frame = 1
Query: 2674 LIKQYQFQHRAPILHFNMLSPESGLSKLNENP-DAGFDLD--PNRKPDHLVVL-TEEQVRLYAFPSFTLKCKIRVTAHDGFRLKNGSLIVFSDDRLTTQNNTKEPLICATNNGGQFLLLNCVNLKRKDVVQFVDKTDLMALNFMSLAKNAN 3114
            L K+ Q  HRAP++   +L    G  K   +P +A  DL   P+    H V++ +EEQ+++++ P  + K K ++TAH+G R++  +L++FS      +  ++  L+C TN  G   L N   L+ +     + K D+  +      KN  
Sbjct:  798 LGKEIQLMHRAPVVSICVLD---GRGKPLPDPYEASQDLSIAPDMTNAHSVLIASEEQLKVFSLPKVSAKTKFKLTAHEGCRVRKVALVLFSS--AVQEEYSEHTLVCLTNM-GDMHLFNMPGLRPQVRFDCIRKEDISGIASCVFTKNGQ 942          
BLAST of Protein lethal(2) giant larvae vs. Planmine SMEST
Match: SMESG000072512.1 (SMESG000072512.1)

HSP 1 Score: 2023.05 bits (5240), Expect = 0.000e+0
Identity = 1038/1044 (99.43%), Postives = 1040/1044 (99.62%), Query Frame = 1
Query:  106 MTQSIFNSVRKLNFYNFKTKYINQNESIGEFYKKQSIEDFGSIPEPSCIDYDHKLSLLGIASKKGLIKIFGCPGVCYSTRLEGQDEIWNIKFIPGTNFFVTLTADNKLILWLISTLTNELFKVDVISNLNVVNSARTSAHXXXXXXXXXXXXXXXXXTAIEVNDLTSSIIMGNGSGSLIQVKLDLLKMRKQANNYKTVPPGNTIWQMPTKSDVIDRDRIISKLPIGSQNRVIIDAVIHISARPGSRKHLLIGYRSGNSIIYNVQKDSVDFLLSAKSTLNALSWCPPDPIVQDNFMVAPNRNEPQYYSSMKLHSCHEDGSIITWNLPQNSDEFLVLDFQIFSPYKKDQKCLPISKILWKRYKQDYLIVFSGGLPRSDYMTKSTITIMNNSCLDSSKANNEHLVLDLTSQLIDFTTIDDNDSGSVEYLLVLTEEEFFIVDLTKESWPILHDRQPYLNCLHNSPITAYQFLSEVKSDWFQKLNEMSSNKEDCNISFSDWPIKGYAQKVRNDEIWQNDLLIIGHGDGTIVFWKFGMGGCMKKISTVKSSSLFKMADELHLNEVSYEDDEIPLRRTGQFDPCCDDNRLAIQLIHYTGKHLLIGGYGGQIVLWGFQENKYEKHLLDVDLTTHLSNFKWKGCQPFQHIEGSIKTGSNFQVMMSMCIFPPSQITALDILEDNNCNGYVIIACGTLHGLVIVSCPKETNLEALVLTTHCTVPRNTLASQEASLGEGWARRRTXXXXXXXXXXXXXXXXXXXXXMEHPSVSRHLSDNNDKTMRXXXXXXXXXXXXXXXXDRPKDTANDGLIRSIRINVSLIKRKGSNGPHEKLLNLFAGCYGGLLLWFQSDYSVENILKNSPINLRLIKQYQFQHRAPILHFNMLSPESGLSKLNENPDAGFDLDPNRKPDHLVVLTEEQVRLYAFPSFTLKCKIRVTAHDGFRLKNGSLIVFSDDRLTTQNNTKEPLICATNNGGQFLLLNCVNLKRKDVVQFVDKTDLMALNFMSLAKNANLSNTRTLCPYGICYSGQGQVTLFEIISKTKTIGTHSSGYFW 3237
            MTQSIFNSVRKLNFYNFKTKYINQNESIGEFYKKQSIEDFGSIPEPSCIDYDHKLSLLGIASKKGLIKIFGCPGVCYSTRLEGQDEIWNIKFIPGTNFFVTLTADNKLILWLISTLTNELFKVDVISNLNVVNSARTSAHNQSDYNNNNENSIEQNITAIEVNDLTSSIIMGNGSGSLIQVKLDLLKMRKQANNYKTVPPGNTIWQMPTKSDVIDRDRIISKLPIGSQNRVIIDAVIHISARPGSRKHLLIGYRSGNSIIYNVQKDSVDFLLSAKSTLNALSWCPPDPIVQDNFMVAPNRNEPQYYSSMKLHSCHEDGSIITWNLPQNSDEFLVLDFQIFSPYKKDQKCL ISKILWKRYKQDYLIVFSGGLPRSDYMTKSTITIMNNSCLDSSKANNEHLVLDLTSQLIDFTTIDDNDSGSVE+LLVLTEEEFFIVDLTKESWPILHDRQPYLNCLHNSPITAYQFLSEVKSDWFQKLNEMSSNKEDCNISFSDWPIKGYAQKVRNDEIWQNDLLIIGHGDGTIVFWKFGMGGCMKKISTVKSSSLFKMADELHLNEVSYEDDEIPLRRTGQFDPCCDDNRLAIQLIHYTGKHLLIGGYGGQIVLWGFQENKYEKHLLDVDLTTHLSNFKWKGCQPFQHIEGSIKTGSNFQVMMSMCIFPPSQITALDILEDNNCNGYVIIACGTLHGLVIVSCPKETNLEALVLTTHCTVPRNTLASQEASLGEGWARRRTRELKKSLRSSFRRLRRRSTKRMEHPSVSRHLSDNNDKTMRVELVENEVEFEERAIEDRPKDTANDGLIRSIRINVSLIKRK SNGPHEKLLNLFAGCYGGLLLWFQSDYSVENILKNSPINLRLIKQYQFQHRAPILHFNMLSPESGLSKLNENPDA FDLDPNRKPDHLVVLTEEQVRLYAFPSFTLKCKIRVTAHDGFRLKNGSLIVFSDDRLTTQNNTK+PLICATNNGGQFLLLNCVNLKRKDVVQFVDKTDLMALNFMSLAKNANLSN RTLCPYGICYSGQGQVTLFEIISKTKTIGTHSSGYFW
Sbjct:    1 MTQSIFNSVRKLNFYNFKTKYINQNESIGEFYKKQSIEDFGSIPEPSCIDYDHKLSLLGIASKKGLIKIFGCPGVCYSTRLEGQDEIWNIKFIPGTNFFVTLTADNKLILWLISTLTNELFKVDVISNLNVVNSARTSAHNQSDYNNNNENSIEQNITAIEVNDLTSSIIMGNGSGSLIQVKLDLLKMRKQANNYKTVPPGNTIWQMPTKSDVIDRDRIISKLPIGSQNRVIIDAVIHISARPGSRKHLLIGYRSGNSIIYNVQKDSVDFLLSAKSTLNALSWCPPDPIVQDNFMVAPNRNEPQYYSSMKLHSCHEDGSIITWNLPQNSDEFLVLDFQIFSPYKKDQKCLLISKILWKRYKQDYLIVFSGGLPRSDYMTKSTITIMNNSCLDSSKANNEHLVLDLTSQLIDFTTIDDNDSGSVEFLLVLTEEEFFIVDLTKESWPILHDRQPYLNCLHNSPITAYQFLSEVKSDWFQKLNEMSSNKEDCNISFSDWPIKGYAQKVRNDEIWQNDLLIIGHGDGTIVFWKFGMGGCMKKISTVKSSSLFKMADELHLNEVSYEDDEIPLRRTGQFDPCCDDNRLAIQLIHYTGKHLLIGGYGGQIVLWGFQENKYEKHLLDVDLTTHLSNFKWKGCQPFQHIEGSIKTGSNFQVMMSMCIFPPSQITALDILEDNNCNGYVIIACGTLHGLVIVSCPKETNLEALVLTTHCTVPRNTLASQEASLGEGWARRRTRELKKSLRSSFRRLRRRSTKRMEHPSVSRHLSDNNDKTMRVELVENEVEFEERAIEDRPKDTANDGLIRSIRINVSLIKRKCSNGPHEKLLNLFAGCYGGLLLWFQSDYSVENILKNSPINLRLIKQYQFQHRAPILHFNMLSPESGLSKLNENPDADFDLDPNRKPDHLVVLTEEQVRLYAFPSFTLKCKIRVTAHDGFRLKNGSLIVFSDDRLTTQNNTKQPLICATNNGGQFLLLNCVNLKRKDVVQFVDKTDLMALNFMSLAKNANLSNARTLCPYGICYSGQGQVTLFEIISKTKTIGTHSSGYFW 1044          
BLAST of Protein lethal(2) giant larvae vs. Planmine SMEST
Match: SMESG000025197.1 (SMESG000025197.1)

HSP 1 Score: 86.6557 bits (213), Expect = 6.118e-17
Identity = 74/309 (23.95%), Postives = 134/309 (43.37%), Query Frame = 1
Query:  808 AVIHISARPGSRKHLLIGYRSGNSIIYNVQKDSVDFLLSAKSTLNALSWCPPDPIVQDNFMVAPNRNEPQYYSSMKLHSCHEDGSIITWNLPQNSDEFLVLDFQIFSPYKKDQKC--LPISKILWKRYK-QDYLIVFSGGLPRSDYMTKSTITIMNNSCLDSSKANNEHLVLDLTSQLIDFTTIDDNDSGSVEY----LLVLTEEEFFIVDLTKESWPILHDRQPYLNCLHNSPITAYQFLSEVKSDWFQKLNEMSS-------NKEDCNISFSDWPIKGYAQKVRNDEIWQNDLLIIGHGDGTIVFWK 1692
            +++ ++  P     LLIG+ +G   ++N+++ S  F       L  L W P       NF+                 +CH  G ++TWN   N     V+  Q  +    DQK    PI KI+    K ++ ++VFSGG P+       +  + ++    +   +    +L +   +IDF  + D+ S +       + +L + +  ++DL   ++P   +  PY   LH SP+T   ++S+   D+   L    S       NK   ++S  +WPI G       +    ++++I GH DG+I FW+
Sbjct:  191 SIVQMADNPADSNKLLIGFSTGFLSLWNLREKSAKFRFKYAEVLCGLCWYPDG----KNFI-----------------TCHHGGYLVTWNSRVNQGPLTVI--QPHNRDNMDQKIGFEPIRKIVLLTTKSEESIMVFSGGTPKVPNPNSDSTEVSSSFPSVTVMKDKRLTILQMDYPVIDFAQLCDSCSQNCFTDPIGIAILLQNDLMVIDLLSPNYPSFEN--PYPIDLHVSPVTCLHYISDCPGDFVASLYTAKSRIKRPVQNKSQGSMSVHEWPINGGQWGSLLNP--HSEMIITGHADGSIRFWE 472          

HSP 2 Score: 51.6026 bits (122), Expect = 3.709e-6
Identity = 34/115 (29.57%), Postives = 55/115 (47.83%), Query Frame = 1
Query:  100 SKMTQSIFNSVRKLNFYNFKTKYINQNESI--GEFYKKQSIEDFGSIPEPSCIDYDHKLSLLGIASKKGLIKIFGCPGVCYSTRLEGQDEIWNIKFIPGTNFFVTLTADNKLILW 438
            SK  Q + + +R  N  +  +   N+ E     + +K  +I  +G   EP+CI Y+    LL I +K G  +IFG PGV +  +    + I  I F+     F+TL  D+ +  W
Sbjct:    5 SKKIQKVIDGIRAWNLSSSSSSTKNEIEETLKSDHFKFGNIVQYGFPNEPTCIAYEPVQKLLVIGTKSGSGRIFGRPGVDHQFQQPSNNSILQIIFLINQGIFLTLCDDDTIHQW 119          
BLAST of Protein lethal(2) giant larvae vs. Planmine SMEST
Match: SMESG000025197.1 (SMESG000025197.1)

HSP 1 Score: 87.0409 bits (214), Expect = 7.055e-17
Identity = 74/309 (23.95%), Postives = 134/309 (43.37%), Query Frame = 1
Query:  808 AVIHISARPGSRKHLLIGYRSGNSIIYNVQKDSVDFLLSAKSTLNALSWCPPDPIVQDNFMVAPNRNEPQYYSSMKLHSCHEDGSIITWNLPQNSDEFLVLDFQIFSPYKKDQKC--LPISKILWKRYK-QDYLIVFSGGLPRSDYMTKSTITIMNNSCLDSSKANNEHLVLDLTSQLIDFTTIDDNDSGSVEY----LLVLTEEEFFIVDLTKESWPILHDRQPYLNCLHNSPITAYQFLSEVKSDWFQKLNEMSS-------NKEDCNISFSDWPIKGYAQKVRNDEIWQNDLLIIGHGDGTIVFWK 1692
            +++ ++  P     LLIG+ +G   ++N+++ S  F       L  L W P       NF+                 +CH  G ++TWN   N     V+  Q  +    DQK    PI KI+    K ++ ++VFSGG P+       +  + ++    +   +    +L +   +IDF  + D+ S +       + +L + +  ++DL   ++P   +  PY   LH SP+T   ++S+   D+   L    S       NK   ++S  +WPI G       +    ++++I GH DG+I FW+
Sbjct:  191 SIVQMADNPADSNKLLIGFSTGFLSLWNLREKSAKFRFKYAEVLCGLCWYPDG----KNFI-----------------TCHHGGYLVTWNSRVNQGPLTVI--QPHNRDNMDQKIGFEPIRKIVLLTTKSEESIMVFSGGTPKVPNPNSDSTEVSSSFPSVTVMKDKRLTILQMDYPVIDFAQLCDSCSQNCFTDPIGIAILLQNDLMVIDLLSPNYPSFEN--PYPIDLHVSPVTCLHYISDCPGDFVASLYTAKSRIKRPVQNKSQGSMSVHEWPINGGQWGSLLNP--HSEMIITGHADGSIRFWE 472          

HSP 2 Score: 51.6026 bits (122), Expect = 3.918e-6
Identity = 34/115 (29.57%), Postives = 55/115 (47.83%), Query Frame = 1
Query:  100 SKMTQSIFNSVRKLNFYNFKTKYINQNESI--GEFYKKQSIEDFGSIPEPSCIDYDHKLSLLGIASKKGLIKIFGCPGVCYSTRLEGQDEIWNIKFIPGTNFFVTLTADNKLILW 438
            SK  Q + + +R  N  +  +   N+ E     + +K  +I  +G   EP+CI Y+    LL I +K G  +IFG PGV +  +    + I  I F+     F+TL  D+ +  W
Sbjct:    5 SKKIQKVIDGIRAWNLSSSSSSTKNEIEETLKSDHFKFGNIVQYGFPNEPTCIAYEPVQKLLVIGTKSGSGRIFGRPGVDHQFQQPSNNSILQIIFLINQGIFLTLCDDDTIHQW 119          
BLAST of Protein lethal(2) giant larvae vs. Planmine SMEST
Match: SMESG000025197.1 (SMESG000025197.1)

HSP 1 Score: 86.6557 bits (213), Expect = 7.895e-17
Identity = 74/309 (23.95%), Postives = 134/309 (43.37%), Query Frame = 1
Query:  808 AVIHISARPGSRKHLLIGYRSGNSIIYNVQKDSVDFLLSAKSTLNALSWCPPDPIVQDNFMVAPNRNEPQYYSSMKLHSCHEDGSIITWNLPQNSDEFLVLDFQIFSPYKKDQKC--LPISKILWKRYK-QDYLIVFSGGLPRSDYMTKSTITIMNNSCLDSSKANNEHLVLDLTSQLIDFTTIDDNDSGSVEY----LLVLTEEEFFIVDLTKESWPILHDRQPYLNCLHNSPITAYQFLSEVKSDWFQKLNEMSS-------NKEDCNISFSDWPIKGYAQKVRNDEIWQNDLLIIGHGDGTIVFWK 1692
            +++ ++  P     LLIG+ +G   ++N+++ S  F       L  L W P       NF+                 +CH  G ++TWN   N     V+  Q  +    DQK    PI KI+    K ++ ++VFSGG P+       +  + ++    +   +    +L +   +IDF  + D+ S +       + +L + +  ++DL   ++P   +  PY   LH SP+T   ++S+   D+   L    S       NK   ++S  +WPI G       +    ++++I GH DG+I FW+
Sbjct:  191 SIVQMADNPADSNKLLIGFSTGFLSLWNLREKSAKFRFKYAEVLCGLCWYPDG----KNFI-----------------TCHHGGYLVTWNSRVNQGPLTVI--QPHNRDNMDQKIGFEPIRKIVLLTTKSEESIMVFSGGTPKVPNPNSDSTEVSSSFPSVTVMKDKRLTILQMDYPVIDFAQLCDSCSQNCFTDPIGIAILLQNDLMVIDLLSPNYPSFEN--PYPIDLHVSPVTCLHYISDCPGDFVASLYTAKSRIKRPVQNKSQGSMSVHEWPINGGQWGSLLNP--HSEMIITGHADGSIRFWE 472          

HSP 2 Score: 51.9878 bits (123), Expect = 3.543e-6
Identity = 34/115 (29.57%), Postives = 55/115 (47.83%), Query Frame = 1
Query:  100 SKMTQSIFNSVRKLNFYNFKTKYINQNESI--GEFYKKQSIEDFGSIPEPSCIDYDHKLSLLGIASKKGLIKIFGCPGVCYSTRLEGQDEIWNIKFIPGTNFFVTLTADNKLILW 438
            SK  Q + + +R  N  +  +   N+ E     + +K  +I  +G   EP+CI Y+    LL I +K G  +IFG PGV +  +    + I  I F+     F+TL  D+ +  W
Sbjct:    5 SKKIQKVIDGIRAWNLSSSSSSTKNEIEETLKSDHFKFGNIVQYGFPNEPTCIAYEPVQKLLVIGTKSGSGRIFGRPGVDHQFQQPSNNSILQIIFLINQGIFLTLCDDDTIHQW 119          
BLAST of Protein lethal(2) giant larvae vs. Planmine SMEST
Match: SMESG000025197.1 (SMESG000025197.1)

HSP 1 Score: 86.6557 bits (213), Expect = 8.499e-17
Identity = 74/309 (23.95%), Postives = 134/309 (43.37%), Query Frame = 1
Query:  808 AVIHISARPGSRKHLLIGYRSGNSIIYNVQKDSVDFLLSAKSTLNALSWCPPDPIVQDNFMVAPNRNEPQYYSSMKLHSCHEDGSIITWNLPQNSDEFLVLDFQIFSPYKKDQKC--LPISKILWKRYK-QDYLIVFSGGLPRSDYMTKSTITIMNNSCLDSSKANNEHLVLDLTSQLIDFTTIDDNDSGSVEY----LLVLTEEEFFIVDLTKESWPILHDRQPYLNCLHNSPITAYQFLSEVKSDWFQKLNEMSS-------NKEDCNISFSDWPIKGYAQKVRNDEIWQNDLLIIGHGDGTIVFWK 1692
            +++ ++  P     LLIG+ +G   ++N+++ S  F       L  L W P       NF+                 +CH  G ++TWN   N     V+  Q  +    DQK    PI KI+    K ++ ++VFSGG P+       +  + ++    +   +    +L +   +IDF  + D+ S +       + +L + +  ++DL   ++P   +  PY   LH SP+T   ++S+   D+   L    S       NK   ++S  +WPI G       +    ++++I GH DG+I FW+
Sbjct:  191 SIVQMADNPADSNKLLIGFSTGFLSLWNLREKSAKFRFKYAEVLCGLCWYPDG----KNFI-----------------TCHHGGYLVTWNSRVNQGPLTVI--QPHNRDNMDQKIGFEPIRKIVLLTTKSEESIMVFSGGTPKVPNPNSDSTEVSSSFPSVTVMKDKRLTILQMDYPVIDFAQLCDSCSQNCFTDPIGIAILLQNDLMVIDLLSPNYPSFEN--PYPIDLHVSPVTCLHYISDCPGDFVASLYTAKSRIKRPVQNKSQGSMSVHEWPINGGQWGSLLNP--HSEMIITGHADGSIRFWE 472          

HSP 2 Score: 51.6026 bits (122), Expect = 3.899e-6
Identity = 34/115 (29.57%), Postives = 55/115 (47.83%), Query Frame = 1
Query:  100 SKMTQSIFNSVRKLNFYNFKTKYINQNESI--GEFYKKQSIEDFGSIPEPSCIDYDHKLSLLGIASKKGLIKIFGCPGVCYSTRLEGQDEIWNIKFIPGTNFFVTLTADNKLILW 438
            SK  Q + + +R  N  +  +   N+ E     + +K  +I  +G   EP+CI Y+    LL I +K G  +IFG PGV +  +    + I  I F+     F+TL  D+ +  W
Sbjct:    5 SKKIQKVIDGIRAWNLSSSSSSTKNEIEETLKSDHFKFGNIVQYGFPNEPTCIAYEPVQKLLVIGTKSGSGRIFGRPGVDHQFQQPSNNSILQIIFLINQGIFLTLCDDDTIHQW 119          
The following BLAST results are available for this feature:
BLAST of Protein lethal(2) giant larvae vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
LLGL24.192e-6525.19LLGL scribble cell polarity complex component 2 [S... [more]
LLGL24.578e-6525.08LLGL scribble cell polarity complex component 2 [S... [more]
LLGL24.922e-6525.19LLGL scribble cell polarity complex component 2 [S... [more]
LLGL13.693e-4724.97LLGL scribble cell polarity complex component 1 [S... [more]
LLGL13.693e-4724.97LLGL scribble cell polarity complex component 1 [S... [more]
back to top
BLAST of Protein lethal(2) giant larvae vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
tom-11.977e-1923.08TOMosyn synaptic protein [Source:UniProtKB/TrEMBL... [more]
tom-12.058e-1923.08TOMosyn synaptic protein [Source:UniProtKB/TrEMBL... [more]
tom-12.089e-1923.08TOMosyn synaptic protein [Source:UniProtKB/TrEMBL... [more]
tom-12.569e-1923.08TOMosyn synaptic protein [Source:UniProtKB/TrEMBL... [more]
tom-12.662e-1923.08TOMosyn synaptic protein [Source:UniProtKB/TrEMBL... [more]
back to top
BLAST of Protein lethal(2) giant larvae vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
l(2)gl8.378e-3425.80gene:FBgn0002121 transcript:FBtr0330655[more]
l(2)gl8.947e-3425.80gene:FBgn0002121 transcript:FBtr0306592[more]
l(2)gl8.947e-3425.80gene:FBgn0002121 transcript:FBtr0306590[more]
l(2)gl8.947e-3425.80gene:FBgn0002121 transcript:FBtr0306589[more]
l(2)gl8.947e-3425.80gene:FBgn0002121 transcript:FBtr0306591[more]
back to top
BLAST of Protein lethal(2) giant larvae vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
llgl17.451e-6425.55LLGL scribble cell polarity complex component 1 [S... [more]
llgl17.913e-6425.55LLGL scribble cell polarity complex component 1 [S... [more]
llgl21.328e-5524.76LLGL scribble cell polarity complex component 2 [S... [more]
llgl21.328e-5524.76LLGL scribble cell polarity complex component 2 [S... [more]
llgl21.416e-5524.76LLGL scribble cell polarity complex component 2 [S... [more]
back to top
BLAST of Protein lethal(2) giant larvae vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
LLGL11.942e-5824.84LLGL1, scribble cell polarity complex component [S... [more]
LLGL14.571e-5623.65LLGL1, scribble cell polarity complex component [S... [more]
llgl21.604e-5524.63LLGL2, scribble cell polarity complex component [S... [more]
llgl21.722e-5524.95LLGL2, scribble cell polarity complex component [S... [more]
LLGL11.674e-5424.13LLGL1, scribble cell polarity complex component [S... [more]
back to top
BLAST of Protein lethal(2) giant larvae vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Llgl29.809e-6324.11LLGL2 scribble cell polarity complex component [So... [more]
Llgl21.271e-5425.71LLGL2 scribble cell polarity complex component [So... [more]
Llgl11.881e-4926.32LLGL1 scribble cell polarity complex component [So... [more]
Llgl12.403e-4926.32LLGL1 scribble cell polarity complex component [So... [more]
Stxbp5l2.627e-2320.74syntaxin binding protein 5-like [Source:MGI Symbol... [more]
back to top
BLAST of Protein lethal(2) giant larvae vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q6P1M3|L2GL2_HUMAN1.551e-6425.19LLGL scribble cell polarity complex component 2 OS... [more]
sp|Q3TJ91|L2GL2_MOUSE5.992e-5523.91LLGL scribble cell polarity complex component 2 OS... [more]
sp|Q7SZE3|L2GL2_DANRE1.537e-5424.76LLGL scribble cell polarity complex component 2 OS... [more]
sp|Q5RCX2|L2GL2_PONAB2.105e-5425.49LLGL scribble cell polarity complex component 2 OS... [more]
sp|Q15334|L2GL1_HUMAN1.773e-4624.97Lethal(2) giant larvae protein homolog 1 OS=Homo s... [more]
back to top
BLAST of Protein lethal(2) giant larvae vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A087VX442.215e-8827.84Lethal2 giant larvae protein 2 OS=Echinococcus mul... [more]
A0A068WQJ72.736e-8627.71Lethal2 giant larvae protein 2 OS=Echinococcus gra... [more]
A0A0X3Q0S61.341e-8426.60LLGL domain-containing protein OS=Schistocephalus ... [more]
W6V0535.265e-8427.71Lethal(2) giant larvae protein OS=Echinococcus gra... [more]
A0A5K4F3781.207e-8027.05Uncharacterized protein OS=Schistosoma mansoni OX=... [more]
back to top
BLAST of Protein lethal(2) giant larvae vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
llgl11.970e-6326.17LLGL scribble cell polarity complex component 1 [S... [more]
llgl13.048e-6326.17LLGL scribble cell polarity complex component 1 [S... [more]
llgl22.664e-5125.03LLGL scribble cell polarity complex component 2 [S... [more]
llgl23.365e-5125.03LLGL scribble cell polarity complex component 2 [S... [more]
stxbp5l2.420e-2521.54syntaxin binding protein 5-like [Source:NCBI gene;... [more]
back to top
BLAST of Protein lethal(2) giant larvae vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 3
Match NameE-valueIdentityDescription
ENSPMAT00000003125.17.750e-3325.71pep scaffold:Pmarinus_7.0:GL479844:12808:29279:-1 ... [more]
ENSPMAT00000003126.17.204e-2924.96pep scaffold:Pmarinus_7.0:GL479844:18893:28646:-1 ... [more]
ENSPMAT00000003932.14.251e-835.96pep scaffold:Pmarinus_7.0:GL482330:1953:13145:-1 g... [more]
back to top
BLAST of Protein lethal(2) giant larvae vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Protein lethal(2) giant larvae vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 2
Match NameE-valueIdentityDescription
EDO480361.646e-5624.12Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO303123.177e-829.36Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Protein lethal(2) giant larvae vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
llgl22.112e-5825.66LLGL scribble cell polarity complex component 2 [S... [more]
llgl23.748e-5825.66LLGL scribble cell polarity complex component 2 [S... [more]
LLGL12.549e-5624.85LLGL scribble cell polarity complex component 1 [S... [more]
llgl21.240e-4827.16LLGL scribble cell polarity complex component 2 [S... [more]
LLGL19.473e-4425.67LLGL scribble cell polarity complex component 1 [S... [more]
back to top
BLAST of Protein lethal(2) giant larvae vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000072512.10.000e+099.43SMESG000072512.1[more]
SMESG000025197.16.118e-1723.95SMESG000025197.1[more]
SMESG000025197.17.055e-1723.95SMESG000025197.1[more]
SMESG000025197.17.895e-1723.95SMESG000025197.1[more]
SMESG000025197.18.499e-1723.95SMESG000025197.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30015890 ID=SMED30015890|Name=Protein lethal(2) giant larvae|organism=Schmidtea mediterranea sexual|type=transcript|length=3417bp
GTTCTTAATAAACGAAGTCTAATTTAAAATATTTGTTAAACGGAATTAGA
CATTCTTTTGTATATTTTTAATGTCAATTTTTTAAAATTAGTTTTTTTTT
CTAAAATGACTCAATCAATATTTAACTCAGTAAGAAAATTGAATTTTTAC
AATTTTAAAACTAAATATATTAATCAAAATGAAAGTATTGGAGAATTTTA
TAAAAAACAATCAATTGAAGATTTTGGGAGTATTCCTGAACCGAGCTGCA
TCGATTACGATCATAAGCTTAGTTTATTAGGCATTGCTAGTAAAAAAGGA
TTGATTAAAATATTTGGTTGTCCTGGAGTTTGTTATTCAACACGATTGGA
AGGCCAAGATGAAATTTGGAATATTAAATTCATTCCCGGAACAAATTTTT
TCGTCACATTAACTGCCGACAACAAATTAATTTTATGGCTCATTTCAACA
TTGACAAATGAACTATTCAAAGTCGACGTGATATCAAATCTGAACGTAGT
AAATTCGGCACGTACGTCTGCTCACAACCAATCCGACTACAATAACAACA
ATGAGAATTCCATAGAACAGAATATAACGGCGATTGAAGTAAATGATCTG
ACATCGTCAATCATTATGGGCAACGGAAGTGGTTCATTGATTCAAGTGAA
ATTGGACCTATTGAAGATGAGAAAGCAAGCAAATAATTACAAGACCGTTC
CTCCCGGTAACACTATTTGGCAGATGCCCACCAAGTCAGACGTAATTGAT
CGAGATCGAATCATTTCGAAATTACCGATTGGGTCTCAAAACCGAGTGAT
CATTGATGCGGTCATTCATATCAGTGCACGTCCCGGTTCCAGGAAGCATC
TTTTAATTGGGTATCGGTCAGGAAATTCAATAATTTACAACGTACAGAAG
GATTCGGTTGATTTTCTTTTGTCGGCTAAATCCACATTGAACGCTTTATC
TTGGTGCCCACCTGATCCAATAGTCCAAGACAACTTTATGGTAGCACCTA
ATAGAAATGAGCCTCAATATTACTCTAGTATGAAACTGCACTCTTGTCAC
GAAGATGGATCTATAATCACTTGGAATCTGCCACAGAATTCTGATGAATT
TTTGGTCTTGGATTTTCAAATATTTTCCCCATACAAAAAAGATCAGAAAT
GTTTACCGATTTCGAAGATTTTATGGAAACGATATAAACAAGACTATTTG
ATCGTCTTTTCCGGAGGTCTGCCGCGATCAGATTATATGACAAAATCCAC
AATTACGATCATGAACAATAGTTGTCTTGATTCATCAAAAGCCAATAATG
AACACTTGGTGCTAGATTTGACTAGTCAACTGATTGATTTCACCACAATT
GATGATAATGACAGTGGTTCTGTTGAATACTTATTGGTGCTTACAGAAGA
GGAGTTTTTTATTGTTGATTTAACCAAAGAAAGTTGGCCGATTCTCCATG
ATCGACAGCCATATTTAAATTGTCTGCACAATTCGCCAATTACTGCATAT
CAATTTTTAAGTGAGGTAAAATCCGATTGGTTTCAGAAACTCAACGAAAT
GAGTAGCAATAAAGAAGATTGCAACATATCCTTCAGTGACTGGCCAATAA
AAGGTTATGCTCAAAAAGTGCGCAATGATGAGATTTGGCAGAATGACTTG
CTTATTATTGGACACGGTGATGGAACAATAGTATTCTGGAAATTTGGAAT
GGGAGGATGCATGAAGAAAATATCCACAGTTAAATCATCGTCTTTATTTA
AAATGGCCGATGAATTGCATTTAAACGAAGTTTCTTATGAAGACGATGAG
ATTCCTTTGAGACGAACTGGACAATTCGACCCATGTTGCGATGATAATCG
CTTGGCTATTCAATTGATTCATTACACTGGCAAACATTTACTGATTGGAG
GATATGGAGGCCAAATTGTTTTGTGGGGTTTTCAAGAGAACAAATATGAA
AAACATTTGCTTGACGTAGATCTAACAACTCATCTATCAAATTTTAAATG
GAAAGGTTGCCAACCATTTCAACACATAGAAGGATCCATCAAAACTGGAT
CCAATTTTCAAGTGATGATGTCTATGTGCATATTTCCGCCCAGTCAAATA
ACGGCTTTGGATATTTTGGAAGATAACAATTGTAACGGCTACGTTATAAT
TGCTTGTGGAACTTTGCACGGATTGGTGATTGTTTCATGTCCAAAAGAAA
CAAATTTGGAAGCTCTAGTTCTCACAACACACTGCACAGTGCCAAGGAAT
ACTCTTGCCAGTCAAGAAGCCAGTTTAGGAGAAGGATGGGCTCGCAGACG
AACTCGAGAATTAAAAAAATCTTTAAGAAGCAGTTTTCGACGACTTCGTC
GTAGATCAACAAAACGAATGGAGCATCCATCTGTCAGTCGGCATCTATCA
GATAATAATGATAAAACTATGAGGGTAGAACTTGTGGAGAATGAAGTAGA
ATTTGAAGAAAGAGCCATAGAGGATCGGCCTAAAGATACGGCAAATGATG
GATTGATACGATCTATAAGAATTAATGTATCCCTAATAAAAAGAAAAGGT
TCTAACGGACCACACGAGAAACTGTTGAATCTATTTGCTGGTTGTTATGG
TGGCTTGTTGTTGTGGTTTCAAAGCGATTATTCTGTGGAAAATATTCTGA
AAAATTCTCCTATTAATCTGCGACTCATCAAACAATATCAATTTCAACAC
AGAGCACCAATTTTGCACTTTAATATGCTTTCTCCCGAGTCAGGACTTTC
GAAATTAAACGAGAATCCTGACGCAGGTTTTGACCTGGATCCCAATCGAA
AACCCGACCATTTAGTCGTGCTTACAGAAGAACAAGTTCGACTATATGCT
TTTCCATCATTCACTTTGAAATGCAAAATCAGAGTAACCGCACATGATGG
ATTTAGGTTAAAGAATGGGAGTTTAATTGTATTCAGTGACGATCGATTGA
CAACTCAAAATAACACCAAAGAACCGCTGATTTGCGCAACAAATAACGGA
GGGCAGTTTCTGCTACTGAACTGTGTAAATTTAAAACGGAAAGATGTCGT
TCAATTTGTTGACAAAACGGATTTGATGGCTTTGAATTTTATGAGTTTGG
CTAAAAATGCTAATTTATCGAATACCAGAACACTTTGTCCTTATGGAATC
TGCTATTCTGGCCAGGGTCAAGTGACATTGTTTGAAATTATTTCGAAAAC
TAAAACAATTGGTACTCATTCTAGTGGCTACTTTTGGAGTAGAAATAATA
GTTCTTAATTCACACTTAATCTTTCAAGTAATGATTCCAAGAAGCGGGTC
TGAAACACCATGCTCACTTCACATATCATTGTTTACAATAAATCTTTCAC
AATATTTATTATTTTCTAATGAAATCTAGAACCCTATGATAAATGTGTAC
AATTTGTAATGAATCTG
back to top

protein sequence of SMED30015890-orf-1

>SMED30015890-orf-1 ID=SMED30015890-orf-1|Name=SMED30015890-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=1051bp
MTQSIFNSVRKLNFYNFKTKYINQNESIGEFYKKQSIEDFGSIPEPSCID
YDHKLSLLGIASKKGLIKIFGCPGVCYSTRLEGQDEIWNIKFIPGTNFFV
TLTADNKLILWLISTLTNELFKVDVISNLNVVNSARTSAHNQSDYNNNNE
NSIEQNITAIEVNDLTSSIIMGNGSGSLIQVKLDLLKMRKQANNYKTVPP
GNTIWQMPTKSDVIDRDRIISKLPIGSQNRVIIDAVIHISARPGSRKHLL
IGYRSGNSIIYNVQKDSVDFLLSAKSTLNALSWCPPDPIVQDNFMVAPNR
NEPQYYSSMKLHSCHEDGSIITWNLPQNSDEFLVLDFQIFSPYKKDQKCL
PISKILWKRYKQDYLIVFSGGLPRSDYMTKSTITIMNNSCLDSSKANNEH
LVLDLTSQLIDFTTIDDNDSGSVEYLLVLTEEEFFIVDLTKESWPILHDR
QPYLNCLHNSPITAYQFLSEVKSDWFQKLNEMSSNKEDCNISFSDWPIKG
YAQKVRNDEIWQNDLLIIGHGDGTIVFWKFGMGGCMKKISTVKSSSLFKM
ADELHLNEVSYEDDEIPLRRTGQFDPCCDDNRLAIQLIHYTGKHLLIGGY
GGQIVLWGFQENKYEKHLLDVDLTTHLSNFKWKGCQPFQHIEGSIKTGSN
FQVMMSMCIFPPSQITALDILEDNNCNGYVIIACGTLHGLVIVSCPKETN
LEALVLTTHCTVPRNTLASQEASLGEGWARRRTRELKKSLRSSFRRLRRR
STKRMEHPSVSRHLSDNNDKTMRVELVENEVEFEERAIEDRPKDTANDGL
IRSIRINVSLIKRKGSNGPHEKLLNLFAGCYGGLLLWFQSDYSVENILKN
SPINLRLIKQYQFQHRAPILHFNMLSPESGLSKLNENPDAGFDLDPNRKP
DHLVVLTEEQVRLYAFPSFTLKCKIRVTAHDGFRLKNGSLIVFSDDRLTT
QNNTKEPLICATNNGGQFLLLNCVNLKRKDVVQFVDKTDLMALNFMSLAK
NANLSNTRTLCPYGICYSGQGQVTLFEIISKTKTIGTHSSGYFWSRNNSS
*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: cellular component
TermDefinition
GO:0005576extracellular region
GO:0016020membrane
GO:0005737cytoplasm
GO:0005856cytoskeleton
GO:0005886plasma membrane
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000016pharynx
PLANA:0000020protonephridia
PLANA:0000034epidermis
PLANA:0000074oocyte
PLANA:0000101muscle cell
PLANA:0000231vitelline gland
Vocabulary: INTERPRO
TermDefinition
IPR036322WD40_repeat_dom_sf
IPR000664Lethal2_giant
IPR015943WD40/YVTN_repeat-like_dom_sf
IPR013577LLGL2
IPR017986WD40_repeat_dom
IPR013136WSTF_Acf1_Cbp146
Vocabulary: molecular function
TermDefinition
GO:0005515protein binding
GO:0005096GTPase activator activity
GO:0017137Rab GTPase binding
Vocabulary: biological process
TermDefinition
GO:0006887exocytosis
GO:0007010cytoskeleton organization
GO:0007049cell cycle
GO:0008285negative regulation of cell proliferation
GO:0008544epidermis development
GO:0010719negative regulation of epithelial to mesenchymal transition
GO:0017157regulation of exocytosis
GO:0030336negative regulation of cell migration
GO:0031581hemidesmosome assembly
GO:0043547positive regulation of GTPase activity
GO:0043588skin development
GO:0044458motile cilium assembly
GO:0045682regulation of epidermis development
GO:0048919posterior lateral line neuromast development
GO:0050680negative regulation of epithelial cell proliferation
GO:0050708regulation of protein secretion
GO:0070121Kupffer's vesicle development
GO:0098773skin epidermis development
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR000664Lethal(2) giant larvae proteinPRINTSPR00962LETHAL2GIANTcoord: 364..386
score: 37.89
coord: 707..726
score: 24.29
coord: 513..536
score: 35.12
coord: 780..799
score: 34.29
coord: 591..609
score: 27.82
IPR013577Lethal giant larvae homologue 2PFAMPF08366LLGLcoord: 347..445
e-value: 4.0E-21
score: 75.3
NoneNo IPR availablePANTHERPTHR10241:SF29LETHAL(2) GIANT LARVAE PROTEINcoord: 29..995
NoneNo IPR availablePANTHERPTHR10241LETHAL 2 GIANT LARVAE PROTEINcoord: 29..995
IPR036322WD40-repeat-containing domain superfamilySUPERFAMILYSSF50978WD40 repeat-likecoord: 46..693