DUF4550 domain-containing protein

Overview
NameDUF4550 domain-containing protein
Smed IDSMED30015887
Uniprot Best hitUncharacterized protein FLJ43738 OS=Homo sapiens OX=9606 PE=2 SV=1 (E=9.7009e-20)
Length (bp)3548
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of DUF4550 domain-containing protein (SMED30015887) t-SNE clustered cells

Violin plots show distribution of expression levels for DUF4550 domain-containing protein (SMED30015887) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of DUF4550 domain-containing protein (SMED30015887) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for DUF4550 domain-containing protein (SMED30015887) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30015887

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 12

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
headSMED30015887SMESG000000883.1 SmedASXL_016731SmedAsxl_ww_GCZZ01PMID:27034770
Currie et al., 2016
whole organism asexual adult RNA-sequencing evidence
headSMED30015887SMESG000000883.1 SmedASXL_016730SmedAsxl_ww_GCZZ01PMID:27034770
Currie et al., 2016
whole organism asexual adult RNA-sequencing evidence
pharynxSMED30015887SMESG000000883.1 dd_Smed_v4_10058_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
protonephridiaSMED30015887SMESG000000883.1 dd_Smed_v4_10058_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
neuronSMED30015887SMESG000000883.1 dd_Smed_v4_10058_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
neuronSMED30015887SMESG000000883.1 dd_Smed_v4_10058_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult colorimetric in situ hybridization evidence
epidermal cellSMED30015887SMESG000000883.1 dd_Smed_v4_10058_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
headSMED30015887SMESG000000883.1 dd_Smed_v6_10058_0_1dd_Smed_v6PMID:28171748
Stückemann et al., 2017
whole organism asexual adult RNA-sequencing evidence
epidermisSMED30015887SMESG000000883.1 dd_Smed_v4_10058_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
dorsal region of the epidermisSMED30015887SMESG000000883.1 dd_Smed_v4_10058_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
ventral epidermisSMED30015887SMESG000000883.1 dd_Smed_v4_10058_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult colorimetric in situ hybridization evidence
ciliated epithelial cellSMED30015887SMESG000000883.1 dd_Smed_v4_10058_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of DUF4550 domain-containing protein vs. Ensembl Human
Match: KIAA1257 (KIAA1257 [Source:HGNC Symbol;Acc:HGNC:29231])

HSP 1 Score: 120.168 bits (300), Expect = 9.569e-27
Identity = 112/468 (23.93%), Postives = 205/468 (43.80%), Query Frame = 3
Query: 1200 LSRIGNSFNSIEDMFCQVFIESDILSSSQRKRLNPLVIKIKNLNNLPISIDKISEINEKYQPAFFEYQFSDFPKYRTLSRLNNRKMHFDDVNIILLGDTQEIKIREQFLNSFFVIEFFNRIK------QEPTLNIDTEEIISNIKKGQNIGDVNLTNSCKMVTSSTAPKPQGESKINLSDILNKNLKFFELTVPIVP-----------------VSMLALKDDNENGTKLYDEDQNNFLEAETTIKVSFQLSESLNIDLNKKD---NCEYFTKIVVINTDINSGFLHEKLSEIILKYNCDKLNFMDRDTLKMQTFLYS----VRNSPNELRDILTGFYLIDSKSEILCIESL-ENSLRIIYENISELLNIYQKTNESVNLKVLYNDTLKFNEKEYPNILTMIPLV-LSKDIDFFAAQPLLYVRDIVPKNCVEGICRLKNLLLVES--MQVVIRNNLIPTNQMIEDLSQ 2501
            +SR      +I D    +  E  I++  Q++ LNPL IKIK  + LP     I E+     P + +YQF   P ++T    +   ++F D+N+I LG      +RE       V+E  +R +      Q+P L    E+ + +    Q +     T +    + +    P G ++++ +D+L  + K+  L VPI                   V +   +D +++G       + N+LEA++ +K+   ++  L       D       F +I+ +        LH  L +I +  N   L         +Q  L +    VR    +  D+LTGF+L+D K+ +  +E L +  LR ++EN    +      +E    KVLYN  L F  + Y ++  ++  V L +  +    Q + ++RD   +   + + R+ ++    +    V +R +L+P++ MI+DLSQ
Sbjct:  395 VSRGSEKSANILDCLLTLKTEVPIMTEEQKQDLNPLTIKIKCASCLPSQPVPIQELERLCMPVYCKYQFHKTPVHKTKGEPHGTHVYFQDINVIFLGALHPSDLREYLEGPPMVVEVHDRDRKSEECSQKPVLF--GEDPLDSYLNFQALISPRETENNPFESQNKMWYPYGIAQVSFADLLLGH-KYLNLAVPIHSCEVQPTHCGQDSRRRKVVGLGVPRDGHQHGPM----PRGNYLEADSQLKLRVDIAVPLRAGARAADPDLGGSQFGRIIFVFDFKKVSLLHSLLQDITM-INAKALGLDSYPVRTLQQILSAFKVRVRVQEQQHLDVLTGFHLLDGKTHLFILEGLADQGLRQLWENHQSWI----PRSEHRKYKVLYNSQLLFRSRLYGDLEAILYHVHLFQPTELLLQQAVFFLRDTERRRVFQALARIHDICYNSTTLWDVTVR-DLLPSSAMIKDLSQ 849          

HSP 2 Score: 67.3958 bits (163), Expect = 1.558e-10
Identity = 47/187 (25.13%), Postives = 89/187 (47.59%), Query Frame = 3
Query:   72 ISVSFQGTNNDDVDDGVKENEAFSGTNNSIFTMKVH---QKKSYLNDQSGHEVIFNVTFAIAVP-GVFTSGKFRESIST--RTSLTDQATRNVQQFYHLEFDIFSQDIVKESYKTDIGFYGTYAKIYPDKSESKVIPTWTDGGDTWISWIQQYKFWIVDSHIRDLCSHKMTVSVWDTKDKCLPKVRF 614
            I+  +Q T+  DV++ +K       +++      +    +  S  +    H V    T ++A P  +   GK+   I    +   TD +   +++FYH+E+ +   D  +E  K DI  +   AK++ + S  K +  W +G   W+SW Q +   +    ++ +  HK+T+ +W+TKDK   KVR+
Sbjct:   21 ITSFYQSTSECDVEEHLKAKARAQESDSDRPCSSIESSSEPASTFSSDVPHVVPCKFTISLAFPVNMGQKGKYASLIEKYKKHPKTDSSVTKMRRFYHIEYFLLPDD--EEPKKVDILLFPMVAKVFLE-SGVKTVKPWHEGDKAWVSWEQTFNITVTKELLKKINFHKITLRLWNTKDKMSRKVRY 204          
BLAST of DUF4550 domain-containing protein vs. Ensembl Human
Match: KIAA1257 (KIAA1257 [Source:HGNC Symbol;Acc:HGNC:29231])

HSP 1 Score: 68.9366 bits (167), Expect = 2.601e-11
Identity = 47/187 (25.13%), Postives = 89/187 (47.59%), Query Frame = 3
Query:   72 ISVSFQGTNNDDVDDGVKENEAFSGTNNSIFTMKVH---QKKSYLNDQSGHEVIFNVTFAIAVP-GVFTSGKFRESIST--RTSLTDQATRNVQQFYHLEFDIFSQDIVKESYKTDIGFYGTYAKIYPDKSESKVIPTWTDGGDTWISWIQQYKFWIVDSHIRDLCSHKMTVSVWDTKDKCLPKVRF 614
            I+  +Q T+  DV++ +K       +++      +    +  S  +    H V    T ++A P  +   GK+   I    +   TD +   +++FYH+E+ +   D  +E  K DI  +   AK++ + S  K +  W +G   W+SW Q +   +    ++ +  HK+T+ +W+TKDK   KVR+
Sbjct:   21 ITSFYQSTSECDVEEHLKAKARAQESDSDRPCSSIESSSEPASTFSSDVPHVVPCKFTISLAFPVNMGQKGKYASLIEKYKKHPKTDSSVTKMRRFYHIEYFLLPDD--EEPKKVDILLFPMVAKVFLE-SGVKTVKPWHEGDKAWVSWEQTFNITVTKELLKKINFHKITLRLWNTKDKMSRKVRY 204          
BLAST of DUF4550 domain-containing protein vs. Ensembl Human
Match: KIAA1257 (KIAA1257 [Source:HGNC Symbol;Acc:HGNC:29231])

HSP 1 Score: 68.5514 bits (166), Expect = 2.836e-11
Identity = 40/137 (29.20%), Postives = 70/137 (51.09%), Query Frame = 3
Query:  213 HEVIFNVTFAIAVP-GVFTSGKFRESIST--RTSLTDQATRNVQQFYHLEFDIFSQDIVKESYKTDIGFYGTYAKIYPDKSESKVIPTWTDGGDTWISWIQQYKFWIVDSHIRDLCSHKMTVSVWDTKDKCLPKVRF 614
            H V    T ++A P  +   GK+   I    +   TD +   +++FYH+E+ +   D  +E  K DI  +   AK++ + S  K +  W +G   W+SW Q +   +    ++ +  HK+T+ +W+TKDK   KVR+
Sbjct:   71 HVVPCKFTISLAFPVNMGQKGKYASLIEKYKKHPKTDSSVTKMRRFYHIEYFLLPDD--EEPKKVDILLFPMVAKVFLE-SGVKTVKPWHEGDKAWVSWEQTFNITVTKELLKKINFHKITLRLWNTKDKMSRKVRY 204          
BLAST of DUF4550 domain-containing protein vs. Ensembl Human
Match: KIAA1257 (KIAA1257 [Source:HGNC Symbol;Acc:HGNC:29231])

HSP 1 Score: 63.5438 bits (153), Expect = 5.744e-10
Identity = 30/95 (31.58%), Postives = 54/95 (56.84%), Query Frame = 3
Query:  330 VQQFYHLEFDIFSQDIVKESYKTDIGFYGTYAKIYPDKSESKVIPTWTDGGDTWISWIQQYKFWIVDSHIRDLCSHKMTVSVWDTKDKCLPKVRF 614
            +++FYH+E+ +   D  +E  K DI  +   AK++ + S  K +  W +G   W+SW Q +   +    ++ +  HK+T+ +W+TKDK   KVR+
Sbjct:    1 MRRFYHIEYFLLPDD--EEPKKVDILLFPMVAKVFLE-SGVKTVKPWHEGDKAWVSWEQTFNITVTKELLKKINFHKITLRLWNTKDKMSRKVRY 92          
BLAST of DUF4550 domain-containing protein vs. Ensembl Zebrafish
Match: si:dkey-57n24.6 (si:dkey-57n24.6 [Source:ZFIN;Acc:ZDB-GENE-130530-641])

HSP 1 Score: 117.087 bits (292), Expect = 5.129e-26
Identity = 109/463 (23.54%), Postives = 222/463 (47.95%), Query Frame = 3
Query: 1152 VNLENNLAELFQNSRSLSR-IGNSFNSIEDMFCQVFIESDILSSSQRKRLNPLVIKIKNLNNLPISIDKISEINEKYQPAFFEYQFSDFPKYRTLSRLNNRKMHFDDVNIILLGDTQEIKIREQFLNSFFVIEFFNR-IKQEPTLNIDTEEIISNIKKGQNIGDVNLTNSCKMVTSSTAPKPQGESKINLSDILNKNLKFFELTVPIVPVSMLALKDDNENGTKLYDEDQ----NNFLEAETTIKVSFQLSESLNI-DLNKKDNCEYFTKIVVINTDINSGFLHEKLSEIILKYNCD--KLNFMDRDTLK--MQTFLYSVRNSPNELRDILTGFYLIDSKSEILCIESLEN-SLRIIYENISELLNIYQKTNESVNLKVLYNDTLKFNEKEYPNI-LTMIPLVLSKDIDFFAAQPLLYVRDIVPKNCVEGICRLKNLLLVESMQVVIRNNLIPTNQMIEDLSQ 2501
             +LE +   L   S  L+  +G     +++ F  V ++  ++S   +  LNPLVI++ +  +LP              P   +Y+F + P +R+    ++  + F DVN+I  G     K+ E        IE  +R  K E      T  +         I  V+L  +   + +     P G +K++LSD+L +  ++ +LT+PI   +   ++       K+ + D      ++LEA   +KV  +++  L+  D N  ++C  F +I+ +    N+  L  KL+  IL+ N +  +L+    +T++  +   + S +   N+  ++LTGF+L+D    +  +E L++ +++ ++  +   L+     +E   + VLYN    F+E+ Y  + + + P+ L K ++    +PL+++R+ VP  C+E + R+ ++   +++Q  + NNL P   M+  L++
Sbjct:  259 ASLELSFTPLLAGSTMLTDFLGFCSGGVKEGFWNVTLDQQLISEELKVELNPLVIRVLSACSLP-------------SPPI-QYKFDNMPIHRSKGYDHSANICFRDVNVIFTGLMSHGKLVEFLRGPPIEIEVHDRDRKNEKRFTKPT--VFGTDPNDARIATVDLWTTAFNLDTEHDDHPHGIAKLDLSDLL-QGCRYLKLTLPIKCSASKHIEQ------KVINSDTAIPVGHYLEANAQLKVQVEIAYPLHSEDENDCEDCP-FGRIIYVFRYNNTPILF-KLTSEILQINAEAFQLHHYPEETIQRVLSGHIISTKERENKRMNVLTGFHLMDKALHLFVLEGLKDQAVKRLWSAVPMKLD----GDEKEQVTVLYNSDFGFSERLYDTLDVGLSPICLFKPLETIMREPLVFIRNAVPHACLEAMKRISHIRQAKTLQEAVHNNLFPLANMVLSLNK 692          

HSP 2 Score: 70.4774 bits (171), Expect = 1.057e-11
Identity = 45/148 (30.41%), Postives = 78/148 (52.70%), Query Frame = 3
Query:  186 KSYLNDQSGHEVIFNVTFAIAV----PGVFTSGKFRESISTRTSLTDQATRNVQQFYHLEFDIFSQDIVKESYKTDIGFYGTYAKIYPDKSESKVIPTWTDGGDTWISWIQQYKFWIVDSHIRDLCSHKMTVSVWDTKDKCLPKVRFD 617
            +S+  D S H V   V+ A+A+       FT  + + + +  ++   +A R  + +Y +E+++   D   E  + D+  +G+ AK+Y   SE+KV+  W +G   W+SW Q  K  +    +  + SHK+TV VWD+K+K   K R D
Sbjct:   47 QSFTTD-SSHTVSCTVSIALAIFKEHEECFTEKRKKGTKNETSNEVVEAPR-AEGYYCIEYNMLPDD--PEPTRVDLVMFGSAAKLY-MASETKVLKPWREGNQVWVSWSQTLKLKVSKELLIKMASHKITVKVWDSKEKLSFKARND 189          
BLAST of DUF4550 domain-containing protein vs. Ensembl Xenopus
Match: fbxl22 (F-box and leucine-rich repeat protein 22 [Source:Xenbase;Acc:XB-GENE-940223])

HSP 1 Score: 84.3445 bits (207), Expect = 1.363e-16
Identity = 63/230 (27.39%), Postives = 112/230 (48.70%), Query Frame = 3
Query: 1836 NNFLEAETTIKVSFQLSESLNIDLNKKDNCEYFTKIVVINTDINSGFLHEKLSEIILKYNCDKLNFMD------RDTLKMQTFLYSVRNSPNELRDILTGFYLIDSKSEILCIESL-ENSLRIIYENISELLNIYQKTNESVNLKVLYNDTLKFNEKEYPNILTMIPLV-LSKDIDFFAAQPLLYVRDIVPKNCVEGICRLKNLLLVESMQVVIRNNLIPTNQMIEDLSQ 2501
              +L+A++ +KV   ++  L +     D C  F  IV I    +  FL EKL   I + N   LN         ++ L +       R+ P+   D++TGF+L+D +  +  +E L E  +R ++E +            +  L++LYN  L F ++ Y ++  ++  + L   +     QPLLYVRD+VP  C   + RL  L   ++++  ++ +L+P+  MIE LS+
Sbjct:   45 GRYLDAQSLLKVRVDIAVPLALQPGGSD-CP-FGLIVYIFHYKDGRFL-EKLLLQIGQINAKALNLGGSPDGPTQEALSLLALRDDQRDDPS--LDVITGFHLMDGEMHLFVLEGLREKGVRELWETLP---------TRAAELEILYNSQLAFRQRRYRDLGVLLCHIQLHAPLSAIVRQPLLYVRDMVPTPCFHALSRLDFLRGAKTLRRALQRDLLPSADMIELLSR 260          
BLAST of DUF4550 domain-containing protein vs. Ensembl Mouse
Match: 1810020O05Rik (Riken cDNA 1810020O05 gene [Source:MGI Symbol;Acc:MGI:3586838])

HSP 1 Score: 100.523 bits (249), Expect = 8.624e-21
Identity = 110/462 (23.81%), Postives = 207/462 (44.81%), Query Frame = 3
Query: 1230 IEDMFCQVFIESDILSSSQRKRLNPLVIKIKNLNNLPISIDKISEINEKYQPAFFEYQFSDFPKYRTLSRLNNRKMHFDDVNIILLGDTQEIKIREQFLNSFFVIEFFNRIK------QEPTLNIDTEEIISNIKKGQNIGDVNLTNSCKMVTSSTAPKPQGESKINLSDILNKNLKFFELTVPI---VPVSMLALKDDNEN---GTKLYDE-------DQNNFLEAETTIKVSFQLSESLN-------IDLNKKDNCEYFTKIVVINTDINSGFLHEKLSEI------ILKYNCDKLNFMDRDTLKMQTFLYSVRNSPNELRDILTGFYLIDSKSEILCIESL-ENSLRIIYENISELLNIYQKTNESVN---LKVLYNDTLKFNEKEYPNILTMIPLV-LSKDIDFFAAQPLLYVRDIVPKNCVEGICRLKNLLLVES-MQVVIRNNLIPTNQMIEDLSQ 2501
            I D F  +  E  I++  Q++ LNPL IKI+ ++ LPI    I ++     P +  YQF   P + T    +   + F D+N++ LG      +RE       V+E  +R +      ++P L    E+++ +    Q       T +    + +    P G ++++ +D+L    K+  L VPI    P S    +D       G ++  +        + N+LEA + +K+   ++  L+       +DL       +F +I+ +        L   L +I       L+ +C  L  + +    +  F   V+    +  D+LTGF+L+D K  +  +E L +  LR ++E+       YQ +  + N    KVLY+  L F  + Y ++ T++  V L + +      P LYVR  V +   + + R+ ++    + ++ V+  +L+P++ MI++LSQ
Sbjct:  393 ILDCFLTLKTEVPIMTEQQKQDLNPLTIKIRCVSCLPIQPVSIHDLERLCSPVYCRYQFHKTPVHETKREPHGTHVFFRDINVVFLGAMNPSDVREYLEGPPMVVEVHDRDRKLEEYSRKPALF--GEDLMDSYFNLQAFVSHRDTETNPYESQNKIWDPYGIARVSFADLL-LGYKYLNLIVPIHNCEPKSPNWSQDSRNRRTMGVQVPTDVLQHSSIPKGNYLEANSLLKLRVDIAVPLSGWSRAPQLDLMGT----HFGRIIFVFHAKKLSLLQSLLQDITMINAKALELDCYPLQNIQQ---ILSAFKVRVKIQEQQDLDVLTGFHLLDGKIHLFILEGLADRGLRQLWES-------YQSSVTASNRAACKVLYDSRLLFCHRLYADLETILYHVHLFRPVSVLLRYPALYVRGAVSRMAFKALSRIHDICQSSTRLKEVVMRDLLPSSSMIKELSQ 837          

HSP 2 Score: 62.7734 bits (151), Expect = 2.718e-9
Identity = 32/106 (30.19%), Postives = 56/106 (52.83%), Query Frame = 3
Query:  297 RTSLTDQATRNVQQFYHLEFDIFSQDIVKESYKTDIGFYGTYAKIYPDKSESKVIPTWTDGGDTWISWIQQYKFWIVDSHIRDLCSHKMTVSVWDTKDKCLPKVRF 614
            +++ T+  T   +QFYH+E+     DI  E    DI  +   AK++ + S +K +  W D    W+SW Q +   +    ++ L  HK+T+ +WDTKD+   + R+
Sbjct:   96 KSAKTETRTGKARQFYHIEYFFLPDDI--EPKIVDIVVFPNVAKVFLE-SGTKTVKPWRDDDKVWVSWSQTFHVNVTKELLKKLNFHKITLRLWDTKDRVSKRARY 198          
BLAST of DUF4550 domain-containing protein vs. Ensembl Mouse
Match: 1810020O05Rik (Riken cDNA 1810020O05 gene [Source:MGI Symbol;Acc:MGI:3586838])

HSP 1 Score: 61.6178 bits (148), Expect = 3.255e-9
Identity = 41/139 (29.50%), Postives = 76/139 (54.68%), Query Frame = 3
Query: 2103 DILTGFYLIDSKSEILCIESL-ENSLRIIYENISELLNIYQKTNESVN---LKVLYNDTLKFNEKEYPNILTMIPLV-LSKDIDFFAAQPLLYVRDIVPKNCVEGICRLKNLLLVES-MQVVIRNNLIPTNQMIEDLSQ 2501
            D+LTGF+L+D K  +  +E L +  LR ++E+       YQ +  + N    KVLY+  L F  + Y ++ T++  V L + +      P LYVR  V +   + + R+ ++    + ++ V+  +L+P++ MI++LSQ
Sbjct:   97 DVLTGFHLLDGKIHLFILEGLADRGLRQLWES-------YQSSVTASNRAACKVLYDSRLLFCHRLYADLETILYHVHLFRPVSVLLRYPALYVRGAVSRMAFKALSRIHDICQSSTRLKEVVMRDLLPSSSMIKELSQ 228          
BLAST of DUF4550 domain-containing protein vs. UniProt
Match: sp|Q6ZUG5|YC006_HUMAN (Uncharacterized protein FLJ43738 OS=Homo sapiens OX=9606 PE=2 SV=1)

HSP 1 Score: 98.5969 bits (244), Expect = 9.701e-20
Identity = 92/406 (22.66%), Postives = 176/406 (43.35%), Query Frame = 3
Query: 1383 PAFFEYQFSDFPKYRTLSRLNNRKMHFDDVNIILLGDTQEIKIREQFLNSFFVIEFFNRIK------QEPTLNIDTEEIISNIKKGQNIGDVNLTNSCKMVTSSTAPKPQGESKINLSDILNKNLKFFELTVPIVP-----------------VSMLALKDDNENGTKLYDEDQNNFLEAETTIKVSFQLSESLNIDLNKKD---NCEYFTKIVVINTDINSGFLHEKLSEIILKYNCDKLNFMDRDTLKMQTFLYS----VRNSPNELRDILTGFYLIDSKSEILCIESL-ENSLRIIYENISELLNIYQKTNESVNLKVLYNDTLKFNEKEYPNILTMIPLV-LSKDIDFFAAQPLLYVRDIVPKNCVEGICRLKNLLL-VESMQVVIRNNLIPTNQMIEDLSQ 2501
            P + +YQF   P ++T    +   ++F D+N+I LG      +RE       V+E  +R +      Q+P L    E+ + +    Q +     T +    + +    P G ++++ +D+L  + K+  L VPI                   V +   +D +++G       + N+LEA++ +K+   ++  L       D       F +I+ +        LH  L +I +  N   L         +Q  L +    VR    +  D+LTGF+L+D K+ +  +E L +  LR ++EN    +      +E    KVLYN  L F  + Y ++  ++  V L +  +    Q + ++RD   +   + + R+ ++     ++  V   +L+P++ MI+DLSQ
Sbjct:    2 PVYCKYQFHKTPVHKTKGEPHGTHVYFQDINVIFLGALHPSDLREYLEGPPMVVEVHDRDRKSEECSQKPVLF--GEDPLDSYLNFQALISPRETENNPFESQNKMWYPYGIAQVSFADLLLGH-KYLNLAVPIHSCEVQPTHCGQDSRRRKVVGLGVPRDGHQHGPM----PRGNYLEADSQLKLRVDIAVPLRAGARAADPDLGGSQFGRIIFVFDFKKVSLLHSLLQDITM-INAKALGLDSYPVRTLQQILSAFKVRVRVQEQQHLDVLTGFHLLDGKTHLFILEGLADQGLRQLWENHQSWI----PRSEHRKYKVLYNSQLLFRSRLYGDLEAILYHVHLFQPTELLLQQAVFFLRDTERRRVFQALARIHDICYNSTTLWDVTVRDLLPSSAMIKDLSQ 395          
BLAST of DUF4550 domain-containing protein vs. UniProt
Match: sp|Q9ULG3|K1257_HUMAN (Uncharacterized protein KIAA1257 OS=Homo sapiens OX=9606 GN=KIAA1257 PE=2 SV=2)

HSP 1 Score: 68.9366 bits (167), Expect = 1.249e-10
Identity = 47/187 (25.13%), Postives = 89/187 (47.59%), Query Frame = 3
Query:   72 ISVSFQGTNNDDVDDGVKENEAFSGTNNSIFTMKVH---QKKSYLNDQSGHEVIFNVTFAIAVP-GVFTSGKFRESIST--RTSLTDQATRNVQQFYHLEFDIFSQDIVKESYKTDIGFYGTYAKIYPDKSESKVIPTWTDGGDTWISWIQQYKFWIVDSHIRDLCSHKMTVSVWDTKDKCLPKVRF 614
            I+  +Q T+  DV++ +K       +++      +    +  S  +    H V    T ++A P  +   GK+   I    +   TD +   +++FYH+E+ +   D  +E  K DI  +   AK++ + S  K +  W +G   W+SW Q +   +    ++ +  HK+T+ +W+TKDK   KVR+
Sbjct:   21 ITSFYQSTSECDVEEHLKAKARAQESDSDRPCSSIESSSEPASTFSSDVPHVVPCKFTISLAFPVNMGQKGKYASLIEKYKKHPKTDSSVTKMRRFYHIEYFLLPDD--EEPKKVDILLFPMVAKVFLE-SGVKTVKPWHEGDKAWVSWEQTFNITVTKELLKKINFHKITLRLWNTKDKMSRKVRY 204          
BLAST of DUF4550 domain-containing protein vs. TrEMBL
Match: gnl|BL_ORD_ID|23534626 (tr|A0A210QWT6|A0A210QWT6_MIZYE DUF4550 domain-containing protein OS=Mizuhopecten yessoensis OX=6573 GN=KP79_PYT11530 PE=4 SV=1)

HSP 1 Score: 199.134 bits (505), Expect = 7.743e-48
Identity = 218/876 (24.89%), Postives = 377/876 (43.04%), Query Frame = 3
Query:  141 SGTNNSIFTMKVHQKKSYLNDQSGHEVIFNVTFAIAVPGVFTSGKFRESISTRTSLTDQATRNVQQFYHLEFDIFSQDIVKESYKTDIGFYGTYAKIYPDKSESKVIPTWTDGGDTWISWIQQYKFWIVDSHIRDLCSHKMTVSVWDTKDK--------C---------------LPKVRFDXXXXXXXXXX-XXXTNENLSWIKQTVLMISKGFSVTSSYKENSDRILPHQIVASQTFKKTDEXXXXXXXXXXXXXXXXXXPELKIKETESLVLFAEPKLDSNSRMESYGQLEKLL--EPSQVSSAFKRQSAHFISN-----EKSNISTTKPLENNLFPPT------------------ESKILPQSRRSFMIPPDNDNYS----KTGRVNLENNLAELFQNSRSL-SRIGNSFNSIEDMFCQVFIESDILSSSQRKRLNPLVIKIKNLNNLPISIDKISEINEKYQPAFFEYQFSDFPKYRTLSRLNNRKMHFDDVNIILLGDTQEIKIREQFLNSFFVIEFFNRIKQE------PTLNID--TEEIISNIKKGQNIGDVNLTNSCKMVTSSTAP-KPQGESKINLSDILNKNLKFFELTVPIVPVSMLALKDDNE-------------NGTKLYDEDQNNFLEAETTIKVSFQLSESLNIDLNKKDN--------CEYFTKIVVINTDINSGFLHEKLSEIILKYNCDKLNFMDRD----TLKMQTFLYSVRNSPNELRDILTGFYLIDSKSEILCIESLENSLRIIYENISELLNIYQKTNESVNLKVLYNDTLKFNEKEY-PNILTMIPLVLSKDIDFFAAQPLLYVRDIVPKNCVEGICRLKNLLLVESMQVVIRNNLIPTNQMIEDLSQ 2501
            S +     + K  +KK  + D + H V   VT ++AVP        ++ +     + ++     Q++YHLE+ +   +   E  K+D+  YG   KI+  + +S+V+ TW +G  TWISWI+     +    +  L +H + + +WD  DK        C               LP  + ++           K + E    +K  VL  SK ++     K    R +P Q+    T +K  EK+      S   ++   +P+       +LV  +  KLDS     S+ +L +L   +P+  SS   R+S H   +     +KS+ S  K  E+    P+                  E + L + ++S          +    K G   +   +A  F   +S+ SR+      +ED F  + ++  I+S  QR  LNP++IKI +  NLP S     E+  + +PA+ +Y+F   P + +  R + R +++DDVN++L G     ++R+        IE  +R ++E      PTL  D   +E ISN+  G       L N     T    P  P G +K++LS++L  + K+  + VP+       +    E             +G         +++ + T +K+  +L+  L       D         C  F +IV I    N+  LH+ L  ++   N + L   D         + T+  S+    +   +I+TGF ++DS   +  +E L N        I  L N+  K  +S ++KVLYN  + F+E+ Y P  + +  + L + +     QPLLYVRD+VPK C E + R+  L  ++ M+ V+RN+L P   M+  +S+
Sbjct:   93 SDSRGVFVSAKGKRKKKMIVDPNTHIVTITVTISMAVPTDEDQPDIKDMVKKEKRMIEKP--RPQRWYHLEYYLLPDE--DELIKSDVVSYGPAVKIF-TEHDSRVLRTWQEGDLTWISWIENNTVNVSRDLLMKLFNHTVELRIWDETDKMKTNSKVNCKLSTSARWDRPLNFKLPSTKPEQAMKYDEKENFMKMSEEEKKGVKGIVLRQSKSYTKMQPKKCQDTRAIPTQVTFC-TKRKEAEKNDAEKPPSPRGRAESPTPK-------TLVGVSNKKLDSQDGRGSFSRLGRLAGADPAPSSSPRGRESVHSKMSSDKMSQKSHTSKKKAKEDKNASPSGRNVKSAESAGSRIEALKEVQRLKRQKKSEAAHQAAQQAAEQIFKFGTCMIPVRMANFFTGVKSITSRLTEPVMGVEDCFISLKVDGPIMSEKQRLELNPMIIKIHSCTNLPDSPITYPELKMRCKPAYCKYEFFKQPVHSSEGREHARNIYWDDVNVVLTGTLDPSELRQYLNGPPLEIEVHDRDRREEDVNLKPTLFGDDLEDEKISNV--GTITSRRTLHNP---FTGRNKPWDPYGTAKVDLSELLLGH-KYLHIKVPLHSCGTPEVLGSAEGSDGKLVGFPGAVDGPVDRPISGGHYVSSNTMMKIKVELAHPLTTPDKVADGKPIESTRECP-FGRIVFIFDYKNTTLLHQ-LQNLVTDVNAEALELDDMPQHVINAALSTYKLSMEQQQSRTLNIITGFQVMDSVMHLFMLEGLHNRA------IKTLWNLLPKQEKS-DVKVLYNSDMNFSERLYGPLDVDLCRVKLHESLTQIIQQPLLYVRDMVPKACFEALIRIYELTKLDQMRSVVRNDLFPKADMVISMSK 940          

HSP 2 Score: 80.1073 bits (196), Expect = 3.017e-11
Identity = 72/225 (32.00%), Postives = 107/225 (47.56%), Query Frame = 2
Query: 2717 NSISSALTKIRNSM--DPKRRYTFSRDYLFSGSVDPIDLNEF--FVSEERKL--KSEPKWITKTIKTEVE------DLNNQRKENLKEPWIENELHANFMQPTLPER-----DKTDKKFDNYIRPLSLLERNPLSIMPSYFIQKQDEKYKRQIEYSNWKSKICVSNPNFNVHRLLTQSELTEGGPKSSNQIFKMQGLRKDNLNVINAIVRKYG-DSNDIPSLNVL 3337
            NS   A  K+R  +   P  RYT+ +DY  S +V P+++        EE K   K++  WI   +KT  E        N  R E L EPW EN LH   +QP L ER     D      + Y RP  L    P++I  +    K++     + ++  W+SK  V +     HR L ++EL + G    NQ+ K+QGL KDN   ++  +R+ G    ++P LNV+
Sbjct: 1048 NSTELAKEKLRQMLAEHPDTRYTYCQDYHHSMTVVPVNVEALKKQAQEEAKARWKTDSGWIYPGMKTMQECNVHPGRPNTARVEELTEPWRENILHVGMLQPPL-ERDCFPWDARQLDMELYRRPKHLFGDEPVTIHLAGQKLKKERLDDLRKDFEKWRSKQVVDDTRQYFHRCLMETELNDKG---QNQVDKLQGLLKDNPEKLS--LRRSGLRLRNVPPLNVV 1266          
BLAST of DUF4550 domain-containing protein vs. TrEMBL
Match: gnl|BL_ORD_ID|172506835 (tr|A0A401RUN1|A0A401RUN1_CHIPU DUF4550 domain-containing protein OS=Chiloscyllium punctatum OX=137246 GN=chiPu_0000220 PE=4 SV=1)

HSP 1 Score: 189.504 bits (480), Expect = 6.524e-45
Identity = 200/795 (25.16%), Postives = 369/795 (46.42%), Query Frame = 3
Query:  219 VIFNVTFAIAVPGVFTSGKFRESISTRTSLTDQATRNVQQFYHLEFDIFSQDIVKESYKTDIGFYGTYAKIYPDKSESKVIPTWTDGGDTWISWIQQYKFWIVDSHIRDLCSHKMTVSVWDTKDKCLPKVRFDXXXXXXXXXXXXXTNENLSWIKQTVLMISKGFSVTSSYKENSDRILPHQIVASQTFKKTDEXXXXXXXXXXXXXXXXXXPELKIKETESLVLFAEPKLDSNSRMESYGQLEKLLEPSQVSSAFKRQSAHFISNEKSNISTTKPLENNLFPPTESKILPQSRRSFMIPPDNDNYSKTGRVNLENNLAELFQNSRSLS-RIGNSFNSIEDMFCQVFIESDILSSSQRKRLNPLVIKIKNLNNLPISIDKISEINEKYQPAFFEYQFSDFPKYRTLSRLNNRKMHFDDVNIILLGDTQEIKIREQFLNSFFVIEFFNR-----IKQEPTLNIDTEEIISNIKKGQNIGDVNLTNSCKMV-----TSSTAPKPQGESKINLSDILNKNLKFFELTVPI---VPVSMLALKDDNENGT--------KLYDE---DQNNFLEAETT----IKVSFQLSESLNIDLNKKDNCEYFTKIVVINTDINSGFLHEKLSEI-ILKYNCDKLNFMDRDTLKMQTFLYSVRNSPNE--LRDILTGFYLIDSKSEILCIESLEN-SLRIIYENISELLNIYQKTNESVNLKVLYNDTLKFNEKEYPNI-LTMIPLVLSKDIDFFAAQPLLYVRDIVPKNCVEGICRLKNLLLVESMQVVIRNNLIPTNQMIEDLSQ 2501
            V F VT  +A+P  F  G+ R+S+    S+         ++YH+E+ +       E  K DI  + T AK Y   ++S+V+ +W DG   W+ +    +  +    +  L S+ MT+ +WD+KD+   K +FDRPK  R   +SK+ +E    +++ + ++ K   + ++YKE       H I      +K  E    S   ++      +     ++E +S     E +  ++ R     + +K L  S    + K ++   I+ E    S +K L      P++ K +                 K   + L+  L  L    +S++ +I +    I D    V +++ ++S    + LNP+VI+I + +++P +   I  + EK  P + +YQF D P +RT +R +  ++ F DVN+IL G  +  K++E  L     IE  +R     ++ EP     TE    +IK    + +V+L +S + V     T++ +  P G +K+  SD++    K   L V I           K D  +G          + DE    + ++LE+ +     I++++ L  + ++ L   + C+ F +I+ I    N+ FL+E L  I  +      L+    D  +    +  V     E  ++DILTGF+L+D K  +  +E L N  LR +++N+     I     E   +K+LYN    F+++ Y N+   +  L L + +     QPLLY+RD+ P++C + +CRL+++   + ++ V++ +L P   M++ LS+
Sbjct:  130 VKFTVTLTLAIPEGFEGGR-RKSLKKSKSMRSLEATKPLKYYHIEWTLLPNG---EVTKLDIVTFATAAKAYVG-NDSQVLKSWYDGEQMWLVFSHSVELPVTKEILLKLSSYVMTLHIWDSKDRVSSKAKFDRPKALRLFMESKNMDEEKHLVQEQLKLL-KDSPLLTTYKET------HDIHPEDLSEKLGEGPVTSSDQANLEHLESAG---HVQEQQS-----EEEPCAHLRQNKLMKKKKTLTSSAKGVSLKTETEDVIAAESKTKSKSKILHEAPKKPSQKKKM---------------LEKYTSIKLDMRL--LLAGHKSVTNKIDDRMPGIRDAIFTVSVDNSLMSEEMERELNPMVIRIISASSMPSTPVPIHVLEEKCGPVYCQYQFYDMPCHRTKARGHGSEISFKDVNVILTGTIKPDKLKEYLLGPPLEIEIHDRDRRLVLQSEPPALFGTE--AEDIK----LSNVSLASSKRTVHDPFTTTNKSWDPYGIAKLAFSDLVYGE-KCLNLAVSIQNSTTPDPTGYKTDGLDGRIVNVSGAIDVPDECPLPKGDYLESNSVLNIRIELAYPLMRTTDVPLETGE-CQ-FGRIIYIFDYKNTKFLNELLGTINSVNSAALCLDSFSNDGSEAADTVLKVEPELKESSIQDILTGFHLMDGKMHLFVLEGLRNEGLRKLWKNVP----IRSVAPEEERIKILYNSNFSFHQRLYANMDDNVYHLHLREPVHDIIKQPLLYIRDMTPQDCFQALCRLQHMCSAKKLRQVVQADLFPAADMLKILSR 874          
BLAST of DUF4550 domain-containing protein vs. TrEMBL
Match: gnl|BL_ORD_ID|17235027 (tr|A0A433SND3|A0A433SND3_ELYCH DUF4550 domain-containing protein OS=Elysia chlorotica OX=188477 GN=EGW08_021530 PE=4 SV=1)

HSP 1 Score: 175.252 bits (443), Expect = 2.150e-40
Identity = 198/822 (24.09%), Postives = 357/822 (43.43%), Query Frame = 3
Query:  213 HEVIFNVTFAIAVPGVFT---------SGKFRESISTRTSLTDQATRNVQQFYHLEFDIFSQDIV-------KESYKTDIGFYGTYAKIYPDKSESKVIPTWTDGGDTWISWIQQYKFWIVDSHIRDLCSHKMTVSVWDTKDKCLPKVRFDXXXX-XXXXXXXXXTNENLSWIKQTVLMISKGFSVTSSYKENSDRILPHQIVASQTFKKTDEXXXXXXXXXXXXXXXXXXPELKIKETESLVLFAEPKLDSN--------SRMESYGQLEKLLEPSQVSSAFKRQSAHFISNEKSNISTTKPLENNLFPPTESKILPQSRRSFMIPPDNDNY-SKTGRVNLENNLAELFQNSRSL-SRIGNSFNSIEDMFCQVFIESDILSSSQRKRLNPLVIKIKNLNNLPISIDKISEINEKYQPAFFEYQFSDFPKYRTLSRLNNRKMHFDDVNIILLGDTQEIKIREQFLNSFFV-IEFFNRIKQEPTLNIDTEEIISNI--KKGQNIGDV--NLTNSCKMVTSSTAPKPQGESKINLSDILNKNLKFFELTVPI----VPVSMLALKDDNEN----------GTKLYDEDQNNFLEAETTIKVSFQLSESLNIDLNKKDNCEY--------FTKIVVINTDINSGFLHEKLSEIILKYNCDKLNF--MDRDTL--KMQTFLYSVRNSPNELRDILTGFYLIDSKSEILCIESLENSLRIIYENISELLNIYQKTNESVNLKVLYNDTLKFNEKEY-PNILTMIPLVLSKDIDFFAAQPLLYVRDIVPKNCVEGICRLKNLLLVESMQVVIRNNLIPTNQMIEDLSQ 2501
            H+V   V  A+AVP V               +E +  R     +A    Q +YHLE+ +   +         +E  KTD+  YG   K+Y D+ +++V+ TW +G  TW SW   +   +    +  + +H + + VWDTKDKC  + RFDRPK       K     E++  +K  V+   K +      K    R LP +I        T           S  +S  S          S VL A P  D+          ++    +LE+   P    S           ++KS    +   E +L    + +I  +++        N  Y  K G   +   LA LF   +++ SR+      I D+F  V     +LS+SQ++ LNP++I++K+   LP +    +++  K  P + +Y+F   P+Y T  + ++R ++++D +++LLG     ++RE FLN   + IE  +R ++   +++       ++  +K  N+G V    T             P G  +++LS++L  + ++ EL +PI    +P  +     D+ N          G          +++    +KV  +++  L     K    EY        F +IV I    N   L+  L  +++  N   L    M +  +   + T+  SV    +   DI+TGF+++D    +  +E L +      + I+ L ++  + + S +++VLYN  L F+++ Y P  + +  + L + +     Q LLY+RD+V + C + + +L  +   + M+ V+RN L PT +MI  +S+
Sbjct:   62 HDVTITVNIAMAVPTVHDECSDTEHDDQPDLKEMLKKRLIEAPRA----QNYYHLEYRLLPPEAPGPGTTGDEELSKTDVVTYGVACKVYMDRYDARVVKTWQEGDITWFSWAHSHTITVTKELLLRMFNHTVELRVWDTKDKCSTRARFDRPKAFRLPQPKPGEKPEDIGGVKAMVIKQMKNYIAQQPRKGVPIRPLPSEI-------PTPHFMDHRKHSMSALESRRSRSGRISSSAASKVLVAVPNKDARDGKTFDRLGQLAGAQRLEERSSPRSKKSKATTPPKSVSGDDKSLRKASSKEERDL----KKQIAEKAKA-------NAEYIKKNGICMIPLRLALLFGERKNVTSRLEEPLAGIGDIFFSVSTNVPLLSASQKQDLNPMMIEVKSATALPSTPLSYADLRLKCHPVYCKYKFFKEPEYITPGKEHDRNIYWEDTSVVLLGTMVPSELRE-FLNGPGMQIEVHDRDRKPEEVSLKPMLFGDDLEDEKIANVGTVESRRTTHNPFKGRDKPWDPYGVVQVDLSELLLGH-RYLELKLPIHNCPLPDVLGHAPVDSSNRLVGIAGAVDGPVERPLSAGQYVQDTAMLKVKIEVAHPLTTP-TKLAAKEYIPTSKECPFNRIVFIFGYSNVELLN-NLQTVVMGINARALGLDSMPQHVIDAALSTYKLSVIQQCSLDLDIVTGFHILDGHHHLFVLEGLRD------KAINVLWDVLPRPDNS-DVRVLYNSDLSFSKRLYGPLDVDLCRVKLHEPLSVIVQQSLLYIRDMVFRPCFDALMKLDQVTRTQKMKDVVRNELFPTAEMIVSMSR 850          

HSP 2 Score: 79.337 bits (194), Expect = 5.328e-11
Identity = 70/227 (30.84%), Postives = 116/227 (51.10%), Query Frame = 2
Query: 2717 NSISSALTKIR---NSMDPKRRYTFSRDYLFSGSVDPIDLNE----FFVSEERKLKSEPKWITKTIKTEVEDLNNQRK------ENLKEPWIENELHANFMQPTL-----PERDKTDKKFDNYIRP-LSLLERNPLSIMPSYFIQKQDEKYKRQIE-YSNWKSKICVSNPNFNVHRLLTQSELTEGGPKSSNQIFKMQGLRKDNLNVINAIVRKYGDSNDIPSLNVL 3337
            NS+  A  K+R   NS+DP+ RY F+++Y+ S    P++L +       +E  K KS   W+   +K+  E   + +K      + L   WIEN LH+N  +  L     P   + D   + Y +P        PLSI  +  +QK+ E+   +++ Y +WKS+I V + N + HR+L  +EL   G   +NQI K+ GL KD    ++ +++     N IP+L+V+
Sbjct:  964 NSMELAREKLRKYLNSLDPEGRYAFNQEYM-SAMFCPVNLKQEEKDLAAAERAKWKSAEGWVYPGVKSTRESNYHSKKPDPARLDELNNDWIENILHSNIFKSPLSRGPFPWPLRHDD-VNLYTKPPQDFGNTEPLSIQ-TTGVQKEAERLSVKMQQYEDWKSRIVVDDTNQHFHRVLPATELLMKGSNCNNQIDKLCGLLKDPPKKLSLMIQD-PTPNIIPALSVV 1186          
BLAST of DUF4550 domain-containing protein vs. TrEMBL
Match: gnl|BL_ORD_ID|22034991 (tr|A0A369S8V9|A0A369S8V9_9METZ DUF4550 domain-containing protein OS=Trichoplax sp. H2 OX=287889 GN=TrispH2_004889 PE=4 SV=1)

HSP 1 Score: 105.531 bits (262), Expect = 2.014e-37
Identity = 125/549 (22.77%), Postives = 243/549 (44.26%), Query Frame = 3
Query: 1140 KTGRVNLENNLAELFQNSRSLS-RIGNSFNSIEDMFCQV-FIESDILSSSQRKRLNPLVIKIKNLNNLPISIDKISEINEKYQPAFFEYQFSDFPKYRTLSRLNNRKMHFDDVNIILLGDTQEIKIREQFLNSFFVIEFFNRIKQEPTLNIDTEEIISNIKKGQNIGDVNLTNS---------CKMVTSSTAPKPQGESKINLSDILNKNLKFFELTVPI-VPVSMLALKDDNEN-------GTKLYDE-DQNNFLEAET----TIKVSFQLSESLNID-------LNKKDNCEYFTKIVVINTDINSGFLHEKLSEIILKYNCDKLNFMDR----DTLKMQTFLYSVRNSPNELRDILTGFYLIDSKSEILCIESL-ENSLRIIYENISELLNIYQKTNESVNLKVLYNDTLKFNEKEYPNILTMIPLVLSKDI--DFFAAQPLLYVRDIVPKNCVEGICRLKN----LLLVESMQVVIRNNLIPTNQMIEDLSQYLCSHVKLKTVNVPSQNLIKAKTERKLIKTAPVKSERKLIENDKLTRTKTQMS 2660
            K+G  ++  +++  F    S++ RI N  + + DMF  V  ++ +++S  Q++RLNP+ I+I   +++P      ++I E+  P++  Y F + P + +  R  +R + +++  +IL+G   +  + +       VIE  +R  +    N D   +       +NI  VN   S         CK+   S    P GE++ NLSD+L    +  +L  PI    S+     +NE        G+  Y      ++LE  +    TI +++ L  +L  D       L    +C  FT++V I +  N  FLH+ L E I   N + L             + T+  +     +   DI+TGF ++DS+ ++  +E L E  ++ +++++  L       ++  N KVLY+ ++ F+++ Y  +       L + I  D+F               CV+ +  +       L  + +++V+ N +  +   +E+L +      K+  ++ P+++     T  +L      +  R+  END+L   K  MS
Sbjct:  378 KSGNASISIDMSAFFGGKISVTKRIDNPTDGVLDMFVTVSIVDGELMSDKQKRRLNPMTIQINTASSMPDRPLSCNDIRERCIPSYTSYGFYNQPNFTSSGRPYDRDVTWNETQVILMGTLDKGGLLQYLTGPPLVIEIHDRDAKPIETNEDDLVVFGQAPDDENIHRVNTLASRKTTYNPFKCKLKPWS----PYGEARYNLSDLLLGE-RVIKLAAPIQCCASIDPTAAENEQNIRRSIRGSAKYKPIPAGHYLEFNSELSITINIAYPLEATLLKDATVIEPLLKSLQDCP-FTRVVYIFSYENKKFLHQ-LFESISAVNANALELTQLPQKIKEAALSTYKLNEEQRCSHTLDIITGFQILDSEYQVFILEGLAEGGIKTLWQSLPHL------QHDDPNFKVLYDSSVIFDKRLYAKLDLTECKTLREAIRNDYFP--------------CVKMVLSMSREFGMPLTDKDLEIVVNNEVTESQDGLEELKR-----DKIGEIDYPTRSRSPLLTRNELF----AEHLRERQENDRLNFIKLNMS 890          

HSP 2 Score: 82.8037 bits (203), Expect = 2.014e-37
Identity = 72/235 (30.64%), Postives = 122/235 (51.91%), Query Frame = 2
Query: 2705 LSKQNSISSALTKIRNSMDP---KRRYTFSRDYLFSGSVDPIDLNEFFVSEERKLKSEPKW------ITKTIKTEVEDLNNQRK-------ENLKEPWIENELHANFMQPTLPERDKT-------DKKFDNYIRPLSLLERNPLSI-MPSYFIQKQDEKYKRQIEYSNWKSKICVSNPNFNVHRLLTQSELTEGGPKSSNQIFKMQGLRKDNLNVINAIVRKYGDSNDIPSLNVL 3337
            +  +NS    L KIR S++    +  +T+S ++  S +  P++  E    EER+L S  KW      +   +KT   D N+ +K       E LK+PWIENELHAN ++PTL   D+T          FD Y RP     R P++I +    ++ + +++ +  +   W+ K+ V +     HR  T +E  + GPK+S Q+ K++GL KD    ++  + K G+ + +P+L+V+
Sbjct:  931 IQSRNSNDQVLQKIRRSLNKEMNRNLFTYSTEF-HSATFAPVNCGEL-SKEERQL-SRQKWRSSHDFVYPGVKTS-RDSNSCKKKPTPNRLEELKKPWIENELHANILKPTL---DRTFYSWPNRSDDFDLYRRPDPYFNRQPVTIHLAGDSLRAESQRFLKD-DQKVWEEKLVVKDTRQRFHRCNTAAEQHDRGPKASCQLDKLKGLLKDEPAKLSLRLGK-GNFHKVPALSVV 1156          

HSP 3 Score: 71.633 bits (174), Expect = 1.177e-8
Identity = 43/135 (31.85%), Postives = 68/135 (50.37%), Query Frame = 3
Query:  213 HEVIFNVTFAIAVPGVFTSGKFRESISTRTSLTDQATRNVQQFYHLEFDIFSQDIVKESYKTDIGFYGTYAKIYPDKSESKVIPTWTDGGDTWISWIQQYKFWIVDSHIRDLCSHKMTVSVWDTKDKCLPKVRFD 617
            H+V F VT + A+P   T     +  S R  + +  +   + +YH  +++F    + +  K D+  YG   KIY + +ESKV  TW +   TWI+W Q     +    +  L  H+M + +WD+KDK   K RFD
Sbjct:   69 HKVTFTVTVSQAIPRTKTD---LDPFSNRKKVYE--SPKAESYYHYCYNLFPN--LDDQGKVDVVAYGPAVKIYTE-NESKVQKTWQELDQTWIAWTQSQTVNVDTEFLLKLFEHQMVLRMWDSKDKVSAKARFD 195          
BLAST of DUF4550 domain-containing protein vs. TrEMBL
Match: gnl|BL_ORD_ID|173539666 (tr|A0A3P8Y9T7|A0A3P8Y9T7_ESOLU Si:dkey-57n24.6 OS=Esox lucius OX=8010 PE=4 SV=1)

HSP 1 Score: 158.688 bits (400), Expect = 1.811e-35
Identity = 185/762 (24.28%), Postives = 332/762 (43.57%), Query Frame = 3
Query:  408 FYGTYAKIYPDKSESKVIPTWTDGGDTWISWIQQYKFWIVDSHIRDLCSHKMTVSVWDTKDKCLPKVRFDXXXXXXXXXXXXXTNENLSWIKQTVLMISKGFSVTSSYKENSDRILP--HQIVASQTFKKTDEXXXXXXXXXXXXXXXXXXPELKIKETESLVLFAEPKL-----------------DSNSRMESYGQLEKLLEPSQVSSAFKRQSA---HFISNEKSNISTTKPLE-----NNLFPPTESKILPQSRRSFMIPPDNDNYSKTGRVNLENNLAELFQNSRSLSRIGNSFNS-IEDMFCQVFIESDILSSSQRKRLNPLVIKIKNLNNLPISIDKISEINEKYQPAFFEYQFSDFPKYRTLSRLNNRKMHFDDVNIILLGDTQEIKIREQFLNSFFVIEFFNRIKQEPTLNIDTEEIISNIKK--------GQNIGDVNL----------TNSCKMVTSSTAPKPQGESKINLSDILNKNLKF---FELTVPIVPVS-----------MLALKDDNE-NGTKLYDEDQNNFLEAETTIKVSFQLSESLNIDLNKKDNCEYFTKIVVI--NTDINSGFLHEKLSEIILKYNCDKLNFMDR--DTLKMQTFLYSVRNSPNELR--DILTGFYLIDSKSEILCIESLEN-SLRIIYENISELLNIYQKTNESVNLKVLYNDTLKFNEKEYPNI-LTMIPLVLSKDIDFFAAQPLLYVRDIVPKNCVEGICRLKNLLLVESMQVVIRNNLIPTNQMI 2486
             +G  AK+Y  +SE+KV+  W DG   W+ W Q  K  +    +  L SHK+T  +WDTKD    K R+D PK  R        +  L  IK  V  +  GF      KE +   LP   Q   S  FKK  E    + +   +T    +    K+  + +L L     +                 D     + +G ++K  E S +S   +++SA    F + ++++ +T  P++       L  P ++  L   + S       ++  K G  ++E  L  L      L+    S +S +   FC + +   ++S   +  LNPLVI + + ++LP S   +  + EK  P + +Y+F + P +RT  + ++  ++F DVN+I+ G           L+   +++F     Q P + I+  +  S ++K        G    D  L          TN       +    P G +K+NLSD+L+          +  P  P             M AL      +G K       ++ +A + +KV  +++  L +  +       F +I+ +   T+I++  L   L   +L+ N       D+  +T++     Y +     E R  D++TGF+L+D +  +  +E L++ ++R ++E +     I    +E   + VLYN +L F  + Y  + ++  P+ L K ++    QPL+Y+RD+VP  C + + RL  L+ +  ++ V++NNL P+ +MI
Sbjct:    1 MFGVAAKMY-TESETKVLKPWHDGDQLWLGWSQSIKVRVTKELLIKLVSHKITFRIWDTKDMMSAKARYDCPKVLRIPQAKPGEDHELGGIKSMVYKLRSGFD-----KEKTRTRLPSKRQDTISTDFKKLSELHCSTVEPKMSTVDLSTI--AKVLSSTALTLNTGSGVNDVEQCGVRSVAQDLFSDDVKSTKLHGPVDK--EESTLSKPLQKKSALDQSFKATKETHKTTISPMKSVSVKGKLLVPRKNATLKIIQESAA---HTEHIRKNGVASVELCLVYLLAGDCCLTDTFVSCSSRVYQGFCNITLNRPLISEELKAELNPLVITVLSASSLPSSPVPLHVLEEKCLPVYCQYRFHNMPMHRTKGQKHSANVYFQDVNVIMTG----------LLSPGELMDFL----QGPPVEIEVHDRDSKLEKALTTPALFGTEPNDDRLSSVVLVSGKQTNQNPFRERTKRYNPYGIAKLNLSDLLHGQCSLKVNLPIRGPQPPQQLDSERSNWKRKMAALPGTGGVDGQKQPAMPMGHYFDANSQLKVHVEIACPLKVGCDDGKTGCPFGRIIYLFKYTNISAMSL---LRSELLRINALAFQLEDQSEETVERALSCYKMAVMERESRDLDVVTGFHLLDKQIHLFVLEGLKHKAIRRLWEAVP----IKLTGSEEDQVIVLYNSSLSFYNRLYDLLDISFTPIHLHKPLETIMRQPLVYIRDMVPYPCFQAMSRLSLLVQLRMLKDVVQNNLFPSAEMI 728          
BLAST of DUF4550 domain-containing protein vs. Ensembl Nematostella
Match: EDO32777 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SU51])

HSP 1 Score: 92.8189 bits (229), Expect = 2.540e-19
Identity = 106/440 (24.09%), Postives = 196/440 (44.55%), Query Frame = 3
Query: 1380 QPAFFEYQFSDFPKYRTLSRLNNRKMHFDDVNIILLGDTQEIKIREQFLNSFFVIEFFNR------IKQEPTLNIDT--EEIISNIKKGQNIGDVNLTNSCKMVTSSTAPKPQGESKINLSDILNKNLKFFELTVPI--VPVSMLALKDDNENG---TKLYDED--------QNNFLEAETTIKVSFQLSESLNIDLNKKDN--------CEYFTKIVVINTDINSGFLHEKLSEIILKYNCDKLNF--MDRDTLK--MQTFLYSVRNSPNELRDILTGFYLIDSKSEILCIESLENSLRIIYENISELLNIYQKTNESVNLK--VLYNDTLKFNEKEY-PNILTMIPLVLSKDIDFFAAQPLLYVRDIVPKNCVEGI-----CRLKNLLLVESMQVVIRNNLIPTNQMIEDLSQYLCSHVKLKTVNVPSQNLIKAKTER 2576
            QP   +Y F   P + +  R + R++++ D N++LLG   +  + E        IE   R       K +P L  +   +E+I+N+     I     T++       T   P G ++ +LS +L    K  +L  PI   P+  + +  + ++G    +L + D          N+LEA + +K+  +L+  +N     K +        C  F +IV I    N+ FL + L   +   N + L    + +  ++  + T+  S     N+  DI+TGF ++D +  I  +E L +        + +L     +  E  +LK  VLYN  ++F+ + Y P  + +  + L + +      PLLYVRD+VP+ C + +      RL ++L V  ++   R++L P+  M+  +S+     V L T +    NL +  ++R
Sbjct:    1 QPVRVQYNFFKEPTHNSRGRDHGREVYWQDTNVVLLGTIDKEVLAEYLRGPPLEIEVHERDRKAEDKKTKPVLFGENPEDEMINNVAL---IAGRRTTHNPFEGRGKTW-DPYGIARFDLSGLL-LGQKMLQLRSPIQSCPIPEINIGHEKQDGPIVGQLGNVDGPEDSPNPAANYLEAGSELKIKVELAYPINASTQDKTSITERTTSECP-FGRIVYIFEYSNAKFLRQ-LQNQVTDINAEALELGTLPQHVIEAALSTYKLSEEQRKNKTLDIITGFQVLDGQFHIFVLEGLAD------HGVKKLWGSLTRPEEPDSLKFNVLYNSEMRFSNRLYAPLDVDLCRVRLHEPLTVIVQNPLLYVRDLVPRPCFDALSKLDKVRLNSMLRVTKLREATRSDLFPSADMVISMSREFG--VPLTTEDFGDTNLYQIHSKR 425          
BLAST of DUF4550 domain-containing protein vs. Planmine SMEST
Match: SMESG000000883.1 (SMESG000000883.1)

HSP 1 Score: 1707.58 bits (4421), Expect = 0.000e+0
Identity = 877/883 (99.32%), Postives = 881/883 (99.77%), Query Frame = 3
Query:   69 MISVSFQGTNNDDVDDGVKENEAFSGTNNSIFTMKVHQKKSYLNDQSGHEVIFNVTFAIAVPGVFTSGKFRESISTRTSLTDQATRNVQQFYHLEFDIFSQDIVKESYKTDIGFYGTYAKIYPDKSESKVIPTWTDGGDTWISWIQQYKFWIVDSHIRDLCSHKMTVSVWDTKDKCLPKVRFDXXXXXXXXXXXXXTNENLSWIKQTVLMISKGFSVTSSYKENSDRILPHQIVASQTFKKTDEXXXXXXXXXXXXXXXXXXPELKIKETESLVLFAEPKLDSNSRMESYGQLEKLLEPSQVSSAFKRQSAHFISNEKSNISTTKPLENNLFPPTESKILPQSRRSFMIPPDNDNYSKTGRVNLENNLAELFQNSRSLSRIGNSFNSIEDMFCQVFIESDILSSSQRKRLNPLVIKIKNLNNLPISIDKISEINEKYQPAFFEYQFSDFPKYRTLSRLNNRKMHFDDVNIILLGDTQEIKIREQFLNSFFVIEFFNRIKQEPTLNIDTEEIISNIKKGQNIGDVNLTNSCKMVTSSTAPKPQGESKINLSDILNKNLKFFELTVPIVPVSMLALKDDNENGTKLYDEDQNNFLEAETTIKVSFQLSESLNIDLNKKDNCEYFTKIVVINTDINSGFLHEKLSEIILKYNCDKLNFMDRDTLKMQTFLYSVRNSPNELRDILTGFYLIDSKSEILCIESLENSLRIIYENISELLNIYQKTNESVNLKVLYNDTLKFNEKEYPNILTMIPLVLSKDIDFFAAQPLLYVRDIVPKNCVEGICRLKNLLLVESMQVVIRNNLIPTNQMIEDLSQYLCSHVKLKTVNVPSQNLIKAKTERKLIKTAPVKSERKLIENDKLTRTKTQMSIKFIYPKTGLEFSYSCQSK 2717
            MISVSFQGTNNDDVDDGVKENEAFSGTNNSIFTMKVHQKKSYLNDQSGHEVIFNVTFAIAVPGVFTSGKFRESISTRTSLTDQATRNVQQFYHLEFDIFSQDIVKESYKTDIGFYGTYAKIYPDKSESKVIPTWTDGGDTWISWIQQYKFWIVDSHIRDLCSHKMTVSVWDTKDKCLPKVRFDRPKPPRSASKSKSTNENLSWIKQTVLMISKGFSVTSSYKENSDRILPHQIVASQTFKKTDEKSSKSPKHSSTTKSTISSPELKIKETESLVLFAEPKLDSNSRMESYGQLEKLLEPSQVSSAFKRQSAHFISNEKSNISTTKPLENNLFPPTESKILPQSRRSF+IPPDNDNYSKTGRVNLENNLAELFQNSRSLSRIGNSFNSIEDMFCQVFIESDILSSSQRKRLNPLVIKIK+LNNLPISIDKISEINEKYQPA+FEYQFSDFPKYRTLSRLNNRK+HFDDVNIILLGD QEIKIREQFLNSFFVIEFFNRIKQEPTLNIDTEEIISNIKKGQNIGDVNLTNSCKMVTSSTAPKPQGESKINLSDILN NLKFFELTVPIVPVSMLALKDDNENGTKLYDEDQNNFLEAETTIKVSFQLSESLNIDLNKKDNCEYFTKIVVINTDINSGFLHEKLSEIILKYNCDKLNFMDRDTLKMQTFLYSVRNSPNELRDILTGFYLIDSKSEILCIESLENSLRIIYENISELLNIYQKTNESVNLKVLYNDTLKFNEKEYPNILTMIPLVLSKDIDFFAAQPLLYVRDIVPKNCVEGICRLKNLLLVESMQVVIRNNLIPTNQMIEDLSQYLCSHVKLKTVNVPSQNLIKAKTERKLIKTAPVKSERKLIENDKLTRTKTQMSIKFIYPKTGLEFSYSCQSK
Sbjct:    1 MISVSFQGTNNDDVDDGVKENEAFSGTNNSIFTMKVHQKKSYLNDQSGHEVIFNVTFAIAVPGVFTSGKFRESISTRTSLTDQATRNVQQFYHLEFDIFSQDIVKESYKTDIGFYGTYAKIYPDKSESKVIPTWTDGGDTWISWIQQYKFWIVDSHIRDLCSHKMTVSVWDTKDKCLPKVRFDRPKPPRSASKSKSTNENLSWIKQTVLMISKGFSVTSSYKENSDRILPHQIVASQTFKKTDEKSSKSPKHSSTTKSTISSPELKIKETESLVLFAEPKLDSNSRMESYGQLEKLLEPSQVSSAFKRQSAHFISNEKSNISTTKPLENNLFPPTESKILPQSRRSFVIPPDNDNYSKTGRVNLENNLAELFQNSRSLSRIGNSFNSIEDMFCQVFIESDILSSSQRKRLNPLVIKIKSLNNLPISIDKISEINEKYQPAYFEYQFSDFPKYRTLSRLNNRKIHFDDVNIILLGDMQEIKIREQFLNSFFVIEFFNRIKQEPTLNIDTEEIISNIKKGQNIGDVNLTNSCKMVTSSTAPKPQGESKINLSDILNTNLKFFELTVPIVPVSMLALKDDNENGTKLYDEDQNNFLEAETTIKVSFQLSESLNIDLNKKDNCEYFTKIVVINTDINSGFLHEKLSEIILKYNCDKLNFMDRDTLKMQTFLYSVRNSPNELRDILTGFYLIDSKSEILCIESLENSLRIIYENISELLNIYQKTNESVNLKVLYNDTLKFNEKEYPNILTMIPLVLSKDIDFFAAQPLLYVRDIVPKNCVEGICRLKNLLLVESMQVVIRNNLIPTNQMIEDLSQYLCSHVKLKTVNVPSQNLIKAKTERKLIKTAPVKSERKLIENDKLTRTKTQMSIKFIYPKTGLEFSYSCQSK 883          

HSP 2 Score: 563.533 bits (1451), Expect = 0.000e+0
Identity = 270/273 (98.90%), Postives = 272/273 (99.63%), Query Frame = 2
Query: 2714 QNSISSALTKIRNSMDPKRRYTFSRDYLFSGSVDPIDLNEFFVSEERKLKSEPKWITKTIKTEVEDLNNQRKENLKEPWIENELHANFMQPTLPERDKTDKKFDNYIRPLSLLERNPLSIMPSYFIQKQDEKYKRQIEYSNWKSKICVSNPNFNVHRLLTQSELTEGGPKSSNQIFKMQGLRKDNLNVINAIVRKYGDSNDIPSLNVLPIEEPQNLCFTVGSEMNRNLSVNYIPLSSKDLNFRAVYNSKRDNPIYKHQIQERHAKMPPCSMSC 3532
            +NSISSALTKIRNSMDPKRRYTFSRDYLFSGSVDPIDLNEF+VSEERKLKSEPKWITKTIKTEVEDLNNQRKENLKEPWIENELHANFMQPTLPERDKTDKKFDNYIRPLSLLERNPLSIMPSYFIQKQDEKYKRQIEYSNWKSKICVSNPNFNVHRLLTQSELTEGGPKSSNQIFKMQGLRKDNLNVINAIVRKYGDSNDIPSLNVLPIEEPQN CFTVGSEMNRNLSVNYIPLSSKDLNFRAVYNSKRDNPIYKHQIQERHAKMPPCSMSC
Sbjct:  883 KNSISSALTKIRNSMDPKRRYTFSRDYLFSGSVDPIDLNEFYVSEERKLKSEPKWITKTIKTEVEDLNNQRKENLKEPWIENELHANFMQPTLPERDKTDKKFDNYIRPLSLLERNPLSIMPSYFIQKQDEKYKRQIEYSNWKSKICVSNPNFNVHRLLTQSELTEGGPKSSNQIFKMQGLRKDNLNVINAIVRKYGDSNDIPSLNVLPIEEPQNFCFTVGSEMNRNLSVNYIPLSSKDLNFRAVYNSKRDNPIYKHQIQERHAKMPPCSMSC 1155          
The following BLAST results are available for this feature:
BLAST of DUF4550 domain-containing protein vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 4
Match NameE-valueIdentityDescription
KIAA12579.569e-2723.93KIAA1257 [Source:HGNC Symbol;Acc:HGNC:29231][more]
KIAA12572.601e-1125.13KIAA1257 [Source:HGNC Symbol;Acc:HGNC:29231][more]
KIAA12572.836e-1129.20KIAA1257 [Source:HGNC Symbol;Acc:HGNC:29231][more]
KIAA12575.744e-1031.58KIAA1257 [Source:HGNC Symbol;Acc:HGNC:29231][more]
back to top
BLAST of DUF4550 domain-containing protein vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of DUF4550 domain-containing protein vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of DUF4550 domain-containing protein vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 1
Match NameE-valueIdentityDescription
si:dkey-57n24.65.129e-2623.54si:dkey-57n24.6 [Source:ZFIN;Acc:ZDB-GENE-130530-6... [more]
back to top
BLAST of DUF4550 domain-containing protein vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 1
Match NameE-valueIdentityDescription
fbxl221.363e-1627.39F-box and leucine-rich repeat protein 22 [Source:X... [more]
back to top
BLAST of DUF4550 domain-containing protein vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 2
Match NameE-valueIdentityDescription
1810020O05Rik8.624e-2123.81Riken cDNA 1810020O05 gene [Source:MGI Symbol;Acc:... [more]
1810020O05Rik3.255e-929.50Riken cDNA 1810020O05 gene [Source:MGI Symbol;Acc:... [more]
back to top
BLAST of DUF4550 domain-containing protein vs. UniProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 2
Match NameE-valueIdentityDescription
sp|Q6ZUG5|YC006_HUMAN9.701e-2022.66Uncharacterized protein FLJ43738 OS=Homo sapiens O... [more]
sp|Q9ULG3|K1257_HUMAN1.249e-1025.13Uncharacterized protein KIAA1257 OS=Homo sapiens O... [more]
back to top
BLAST of DUF4550 domain-containing protein vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
gnl|BL_ORD_ID|235346267.743e-4824.89tr|A0A210QWT6|A0A210QWT6_MIZYE DUF4550 domain-cont... [more]
gnl|BL_ORD_ID|1725068356.524e-4525.16tr|A0A401RUN1|A0A401RUN1_CHIPU DUF4550 domain-cont... [more]
gnl|BL_ORD_ID|172350272.150e-4024.09tr|A0A433SND3|A0A433SND3_ELYCH DUF4550 domain-cont... [more]
gnl|BL_ORD_ID|220349912.014e-3722.77tr|A0A369S8V9|A0A369S8V9_9METZ DUF4550 domain-cont... [more]
gnl|BL_ORD_ID|1735396661.811e-3524.28tr|A0A3P8Y9T7|A0A3P8Y9T7_ESOLU Si:dkey-57n24.6 OS=... [more]
back to top
BLAST of DUF4550 domain-containing protein vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of DUF4550 domain-containing protein vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of DUF4550 domain-containing protein vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of DUF4550 domain-containing protein vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 1
Match NameE-valueIdentityDescription
EDO327772.540e-1924.09Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of DUF4550 domain-containing protein vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of DUF4550 domain-containing protein vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 1
Match NameE-valueIdentityDescription
SMESG000000883.10.000e+099.32SMESG000000883.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30015887 ID=SMED30015887|Name=DUF4550 domain-containing protein|organism=Schmidtea mediterranea sexual|type=transcript|length=3548bp
TGAATATCTTAGCAACACGCCATATCAATTATCAGTGTGGATTTTTATTA
TTTACAAAAATCAGTAAAATGATTTCTGTTAGTTTCCAAGGGACTAATAA
TGACGATGTCGACGATGGTGTTAAAGAAAATGAGGCTTTCTCAGGAACTA
ACAATTCCATTTTCACGATGAAAGTCCATCAAAAAAAGAGTTATCTGAAC
GATCAAAGTGGGCACGAAGTAATTTTCAATGTGACATTTGCCATTGCTGT
TCCTGGTGTTTTCACAAGCGGGAAATTTCGAGAATCAATTTCCACTCGTA
CAAGTTTGACCGATCAAGCTACCAGAAACGTTCAACAGTTTTATCACTTA
GAATTTGATATATTTTCTCAAGATATTGTTAAAGAATCTTATAAAACTGA
TATCGGATTCTATGGAACATATGCCAAAATATATCCAGACAAATCCGAAT
CGAAAGTTATTCCAACATGGACGGACGGAGGAGACACTTGGATTAGTTGG
ATTCAGCAATATAAATTTTGGATCGTTGATAGTCACATAAGAGATTTATG
TTCCCATAAAATGACAGTATCAGTATGGGATACGAAAGATAAATGTCTAC
CAAAAGTGAGATTCGATAGACCTAAACCGCCTAGATCAGCAAGTAAATCC
AAATCGACCAATGAGAATTTGAGTTGGATTAAACAAACTGTTCTGATGAT
TTCAAAAGGATTTTCAGTAACGTCTTCATACAAAGAAAACAGCGATCGGA
TTTTACCGCATCAAATCGTTGCGTCACAAACTTTCAAAAAAACCGATGAA
AAATCTAGCAAGTCTCCAAAGCACAGTTCAACTACAAAGTCCACCATAAG
TTCTCCTGAATTGAAAATTAAAGAAACCGAATCTTTGGTATTATTTGCTG
AACCGAAATTAGATTCAAACTCAAGAATGGAGTCCTATGGTCAACTGGAA
AAATTATTGGAACCATCACAAGTATCCAGTGCTTTTAAAAGACAGTCAGC
ACATTTTATTTCCAACGAAAAATCCAATATTTCCACTACAAAACCTTTAG
AAAACAATTTATTTCCACCTACGGAATCAAAAATTCTGCCTCAATCACGA
AGAAGCTTCATGATACCTCCAGACAATGATAATTATAGTAAAACTGGACG
AGTAAATTTAGAAAATAACTTGGCGGAATTATTTCAAAATTCTCGCTCTC
TTAGTCGAATAGGAAACTCTTTCAATAGTATTGAAGACATGTTTTGTCAG
GTGTTCATTGAATCGGATATTCTTTCTTCTTCGCAAAGAAAACGTTTGAA
TCCTCTTGTAATAAAAATAAAAAATCTCAACAATCTTCCAATTTCCATTG
ACAAAATCAGTGAAATAAATGAAAAATATCAGCCAGCTTTTTTCGAATAT
CAGTTCTCTGATTTTCCTAAATATCGAACATTGAGTCGGTTAAATAACAG
GAAAATGCATTTCGACGATGTCAATATTATTCTTTTAGGGGACACGCAGG
AAATTAAAATTCGGGAGCAGTTTCTAAATTCATTCTTCGTTATAGAATTT
TTCAATCGAATCAAACAAGAACCAACTTTAAATATTGATACCGAAGAAAT
CATATCGAACATTAAGAAAGGACAAAATATTGGAGATGTTAATTTAACGA
ATTCCTGCAAAATGGTAACATCTTCCACAGCACCGAAACCTCAAGGTGAA
TCGAAAATCAATTTATCAGACATTTTAAATAAAAATCTCAAATTTTTCGA
ACTGACCGTCCCGATTGTTCCGGTTTCAATGTTGGCTTTGAAAGACGACA
ACGAAAATGGCACTAAACTCTATGATGAAGATCAAAATAATTTTCTTGAG
GCCGAAACAACAATAAAAGTCTCTTTCCAATTATCTGAATCACTTAACAT
CGATTTAAACAAAAAAGATAATTGTGAATATTTTACAAAAATTGTCGTAA
TTAATACCGATATTAACTCTGGTTTCCTTCACGAAAAATTGTCTGAGATA
ATATTAAAATACAATTGTGATAAATTGAATTTCATGGACAGGGACACTTT
GAAAATGCAAACCTTTCTTTATAGTGTTAGAAATTCCCCCAATGAACTCA
GAGATATTTTAACGGGGTTTTATTTAATCGACAGTAAATCGGAAATATTG
TGCATTGAAAGTCTAGAAAATTCTCTTAGAATTATTTACGAAAATATAAG
TGAACTTTTGAACATTTATCAAAAAACAAACGAATCGGTAAATTTAAAAG
TACTTTACAATGATACGTTAAAGTTTAATGAGAAAGAATATCCTAATATT
CTTACAATGATTCCATTAGTTTTATCAAAAGATATTGATTTTTTTGCTGC
TCAGCCGCTTCTATATGTCAGAGATATTGTGCCAAAGAATTGTGTAGAAG
GGATATGTCGGCTGAAAAATCTATTATTGGTCGAATCGATGCAAGTGGTT
ATACGCAATAACTTAATTCCAACCAATCAAATGATTGAAGATTTATCTCA
ATATCTATGTTCACATGTTAAATTGAAAACTGTTAATGTGCCTAGTCAAA
ATTTAATTAAAGCGAAAACTGAAAGAAAACTAATCAAAACAGCCCCTGTA
AAAAGTGAGAGAAAATTAATTGAAAATGATAAATTGACAAGAACAAAAAC
TCAAATGTCTATAAAATTTATTTACCCGAAAACCGGTCTTGAATTTTCAT
ATAGCTGTCAAAGCAAAACAGTATTTCGTCAGCTTTGACAAAAATTCGAA
ATTCAATGGATCCAAAAAGACGATATACGTTTTCACGGGACTATTTATTT
TCTGGCTCGGTTGATCCGATTGATCTCAATGAATTCTTTGTCAGTGAAGA
ACGAAAATTGAAGTCCGAACCGAAATGGATAACGAAAACTATTAAAACTG
AAGTGGAAGACTTAAATAATCAAAGAAAAGAAAATTTAAAAGAACCTTGG
ATAGAAAATGAACTCCATGCAAATTTCATGCAACCGACTTTACCCGAACG
AGACAAAACCGATAAAAAATTTGACAACTACATTCGCCCGTTGAGTCTGT
TAGAAAGAAATCCCCTTTCAATAATGCCGAGTTATTTCATTCAAAAACAG
GATGAGAAATACAAACGGCAAATTGAATATAGCAATTGGAAAAGTAAAAT
CTGCGTTTCGAATCCGAATTTTAATGTTCATCGGTTATTAACGCAGAGTG
AATTGACGGAAGGCGGCCCTAAAAGTTCAAATCAGATTTTTAAAATGCAA
GGATTAAGAAAAGATAACTTGAATGTTATAAACGCGATTGTGAGGAAATA
TGGTGATTCGAATGACATTCCGTCACTTAATGTTCTGCCGATTGAAGAAC
CTCAAAATCTTTGCTTTACAGTCGGTTCTGAAATGAATAGGAATTTATCT
GTCAATTACATTCCTCTTAGTAGCAAAGATTTAAATTTTAGAGCGGTTTA
TAATTCAAAAAGGGACAATCCAATTTATAAGCACCAGATCCAAGAAAGGC
ACGCAAAAATGCCTCCCTGTTCAATGAGCTGTTAAATGTATACTGCTG
back to top

protein sequence of SMED30015887-orf-1

>SMED30015887-orf-1 ID=SMED30015887-orf-1|Name=SMED30015887-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=260bp
MDPKRRYTFSRDYLFSGSVDPIDLNEFFVSEERKLKSEPKWITKTIKTEV
EDLNNQRKENLKEPWIENELHANFMQPTLPERDKTDKKFDNYIRPLSLLE
RNPLSIMPSYFIQKQDEKYKRQIEYSNWKSKICVSNPNFNVHRLLTQSEL
TEGGPKSSNQIFKMQGLRKDNLNVINAIVRKYGDSNDIPSLNVLPIEEPQ
NLCFTVGSEMNRNLSVNYIPLSSKDLNFRAVYNSKRDNPIYKHQIQERHA
KMPPCSMSC*
back to top

protein sequence of SMED30015887-orf-2

>SMED30015887-orf-2 ID=SMED30015887-orf-2|Name=SMED30015887-orf-2|organism=Schmidtea mediterranea sexual|type=polypeptide|length=912bp
NILATRHINYQCGFLLFTKISKMISVSFQGTNNDDVDDGVKENEAFSGTN
NSIFTMKVHQKKSYLNDQSGHEVIFNVTFAIAVPGVFTSGKFRESISTRT
SLTDQATRNVQQFYHLEFDIFSQDIVKESYKTDIGFYGTYAKIYPDKSES
KVIPTWTDGGDTWISWIQQYKFWIVDSHIRDLCSHKMTVSVWDTKDKCLP
KVRFDRPKPPRSASKSKSTNENLSWIKQTVLMISKGFSVTSSYKENSDRI
LPHQIVASQTFKKTDEKSSKSPKHSSTTKSTISSPELKIKETESLVLFAE
PKLDSNSRMESYGQLEKLLEPSQVSSAFKRQSAHFISNEKSNISTTKPLE
NNLFPPTESKILPQSRRSFMIPPDNDNYSKTGRVNLENNLAELFQNSRSL
SRIGNSFNSIEDMFCQVFIESDILSSSQRKRLNPLVIKIKNLNNLPISID
KISEINEKYQPAFFEYQFSDFPKYRTLSRLNNRKMHFDDVNIILLGDTQE
IKIREQFLNSFFVIEFFNRIKQEPTLNIDTEEIISNIKKGQNIGDVNLTN
SCKMVTSSTAPKPQGESKINLSDILNKNLKFFELTVPIVPVSMLALKDDN
ENGTKLYDEDQNNFLEAETTIKVSFQLSESLNIDLNKKDNCEYFTKIVVI
NTDINSGFLHEKLSEIILKYNCDKLNFMDRDTLKMQTFLYSVRNSPNELR
DILTGFYLIDSKSEILCIESLENSLRIIYENISELLNIYQKTNESVNLKV
LYNDTLKFNEKEYPNILTMIPLVLSKDIDFFAAQPLLYVRDIVPKNCVEG
ICRLKNLLLVESMQVVIRNNLIPTNQMIEDLSQYLCSHVKLKTVNVPSQN
LIKAKTERKLIKTAPVKSERKLIENDKLTRTKTQMSIKFIYPKTGLEFSY
SCQSKTVFRQL*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000016pharynx
PLANA:0000020protonephridia
PLANA:0000034epidermis
PLANA:0000054dorsal region of the epidermis
PLANA:0000096ventral epidermis
PLANA:0000099neuron
PLANA:0000106ciliated epithelial cell
PLANA:0000418head
PLANA:0002032epidermal cell
Vocabulary: INTERPRO
TermDefinition
IPR027876DUF4550
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR027876Domain of unknown function DUF4550PFAMPF15084DUF4550coord: 112..208
e-value: 2.2E-22
score: 79.3
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 261..285
NoneNo IPR availablePANTHERPTHR33667FAMILY NOT NAMEDcoord: 98..865
NoneNo IPR availablePANTHERPTHR33667:SF7SI:DKEY-57N24.6coord: 98..865