Plastin 3

Overview
NamePlastin 3
Smed IDSMED30015879
Length (bp)1991
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Plastin 3 (SMED30015879) t-SNE clustered cells

Violin plots show distribution of expression levels for Plastin 3 (SMED30015879) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Plastin 3 (SMED30015879) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Plastin 3 (SMED30015879) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30015879

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 11

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
intestinal phagocyteSMED30015879SMESG000047053.1 Contig2806GPL15192PMID:23079596
Forsthoefel et al., 2012
FACS sorted cell population asexual adult cDNA to DNA expression microarray evidence
intestinal phagocyteSMED30015879SMESG000070679.1 Contig2806GPL15192PMID:23079596
Forsthoefel et al., 2012
FACS sorted cell population asexual adult cDNA to DNA expression microarray evidence
pharynxSMED30015879SMESG000070679.1 dd_Smed_v4_1678_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
parenchymal cellSMED30015879SMESG000070679.1 dd_Smed_v4_1678_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
epidermal cellSMED30015879SMESG000070679.1 dd_Smed_v4_1678_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
gutSMED30015879SMESG000070679.1 PL06021B1D11ncbi_smed_estsPMID:16344473
Zayas et al., 2005
whole organism adult hermaphrodite colorimetric in situ hybridization evidence
central nervous systemSMED30015879SMESG000070679.1 DN298751ncbi_smed_estsPMID:16344473
Zayas et al., 2005
whole organism adult hermaphrodite colorimetric in situ hybridization evidence
ovarySMED30015879SMESG000070679.1 DN298751ncbi_smed_estsPMID:16344473
Zayas et al., 2005
whole organism adult hermaphrodite colorimetric in situ hybridization evidence
testisSMED30015879SMESG000070679.1 DN298751ncbi_smed_estsPMID:16344473
Zayas et al., 2005
whole organism adult hermaphrodite colorimetric in situ hybridization evidence
body wall musculatureSMED30015879SMESG000070679.1 dd_Smed_v4_1678_0_1dd_Smed_v4PMID:30471994
Scimone et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
epidermisSMED30015879SMESG000070679.1 dd_Smed_v4_1678_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Plastin 3 vs. Ensembl Human
Match: PLS3 (plastin 3 [Source:HGNC Symbol;Acc:HGNC:9091])

HSP 1 Score: 399.823 bits (1026), Expect = 1.814e-130
Identity = 228/525 (43.43%), Postives = 336/525 (64.00%), Query Frame = 2
Query:  362 SDAEERSYSDWINQALRNEEICQKYLPIDYN--KLYEACSDGVLLCKMINYSVPDTIDMRAVNVGKKLETIFCKNENLSLAVQSASSIGCCVVNIGPIDLGNGVKHIVLGLLWQIIRIGLIGKINLANHAELVALLRDGESLEDLKQLSPEEILIRWVNYHMEKANVSRRISNFNTDIMDSEIYTYLINQIAPSECRSKMMPPNEI----LRSNDNVQRAENVLSNASAMNAKAFVEANDIAMVTQKGKNREKLNMAFVAHLFNNYPALNITEKVIQEFDIVE-ETLEEKTYRNWMNSMGVEPYLNYLYSDLRNGIALLHLIDVIQPKTVNWETVTTKFNP-----MRKLFQMQDNCLAFINYAKKLN-----LKLVGLSAENIRETETTLVLGLCFQLLRKYTFQLLQKLQPNNFNKSVEDKDIIEWANKKCQSTGKSESVIRSFKDLNIRSSKPILHLIDSIKPNSVDYSMITNNPL--DD----AKYAITVARKIGANVYALPQHVVDLNQKMILTIYACLM 1867
            S+ E+ ++ +WIN+AL N+  C+  +P++ N   L++A  DG++LCKMIN SVPDTID RA+N  KK  T F   ENL+LA+ SAS+IGC VVNIG  DL  G  H+VLGLLWQII+IGL   I L+ +  L ALLRDGE+LE+L +LSPEE+L+RW N+H+E +   ++I+NF+ DI DS+ Y +L+NQIAP + + +  P  +I        D+++RAE++L  A  +  + FV   D+           KLN+AFVA+LFN YPAL   E    ++ ++E ET EE+T+RNWMNS+GV P++N+LY+DL++ + +L L + I+   V+W  V     P     M+KL    +NC    NYA +L        LVG+  +++ +   TL L L +QL+R+YT  +L+ L      +   D  I+ W N+     GKS S I+SFKD  I SS  ++ LID+I+P  ++Y ++ +  L  DD    AKYA+++AR+IGA VYALP+ +V++  KM++T++ACLM
Sbjct:  122 SEEEKYAFVNWINKALENDPDCRHVIPMNPNTDDLFKAVGDGIVLCKMINLSVPDTIDERAIN--KKKLTPFIIQENLNLALNSASAIGCHVVNIGAEDLRAGKPHLVLGLLWQIIKIGLFADIELSRNEALAALLRDGETLEELMKLSPEELLLRWANFHLENSGW-QKINNFSADIKDSKAYFHLLNQIAP-KGQKEGEPRIDINMSGFNETDDLKRAESMLQQADKLGCRQFVTPADVV------SGNPKLNLAFVANLFNKYPALTKPENQDIDWTLLEGETREERTFRNWMNSLGVNPHVNHLYADLQDALVILQLYERIK-VPVDWSKVNKPPYPKLGANMKKL----ENC----NYAVELGKHPAKFSLVGIGGQDLNDGNQTLTLALVWQLMRRYTLNVLEDLGD---GQKANDDIIVNWVNRTLSEAGKSTS-IQSFKDKTISSSLAVVDLIDAIQPGCINYDLVKSGNLTEDDKHNNAKYAVSMARRIGARVYALPEDLVEVKPKMVMTVFACLM 623          
BLAST of Plastin 3 vs. Ensembl Human
Match: PLS3 (plastin 3 [Source:HGNC Symbol;Acc:HGNC:9091])

HSP 1 Score: 399.823 bits (1026), Expect = 1.814e-130
Identity = 228/525 (43.43%), Postives = 336/525 (64.00%), Query Frame = 2
Query:  362 SDAEERSYSDWINQALRNEEICQKYLPIDYN--KLYEACSDGVLLCKMINYSVPDTIDMRAVNVGKKLETIFCKNENLSLAVQSASSIGCCVVNIGPIDLGNGVKHIVLGLLWQIIRIGLIGKINLANHAELVALLRDGESLEDLKQLSPEEILIRWVNYHMEKANVSRRISNFNTDIMDSEIYTYLINQIAPSECRSKMMPPNEI----LRSNDNVQRAENVLSNASAMNAKAFVEANDIAMVTQKGKNREKLNMAFVAHLFNNYPALNITEKVIQEFDIVE-ETLEEKTYRNWMNSMGVEPYLNYLYSDLRNGIALLHLIDVIQPKTVNWETVTTKFNP-----MRKLFQMQDNCLAFINYAKKLN-----LKLVGLSAENIRETETTLVLGLCFQLLRKYTFQLLQKLQPNNFNKSVEDKDIIEWANKKCQSTGKSESVIRSFKDLNIRSSKPILHLIDSIKPNSVDYSMITNNPL--DD----AKYAITVARKIGANVYALPQHVVDLNQKMILTIYACLM 1867
            S+ E+ ++ +WIN+AL N+  C+  +P++ N   L++A  DG++LCKMIN SVPDTID RA+N  KK  T F   ENL+LA+ SAS+IGC VVNIG  DL  G  H+VLGLLWQII+IGL   I L+ +  L ALLRDGE+LE+L +LSPEE+L+RW N+H+E +   ++I+NF+ DI DS+ Y +L+NQIAP + + +  P  +I        D+++RAE++L  A  +  + FV   D+           KLN+AFVA+LFN YPAL   E    ++ ++E ET EE+T+RNWMNS+GV P++N+LY+DL++ + +L L + I+   V+W  V     P     M+KL    +NC    NYA +L        LVG+  +++ +   TL L L +QL+R+YT  +L+ L      +   D  I+ W N+     GKS S I+SFKD  I SS  ++ LID+I+P  ++Y ++ +  L  DD    AKYA+++AR+IGA VYALP+ +V++  KM++T++ACLM
Sbjct:  122 SEEEKYAFVNWINKALENDPDCRHVIPMNPNTDDLFKAVGDGIVLCKMINLSVPDTIDERAIN--KKKLTPFIIQENLNLALNSASAIGCHVVNIGAEDLRAGKPHLVLGLLWQIIKIGLFADIELSRNEALAALLRDGETLEELMKLSPEELLLRWANFHLENSGW-QKINNFSADIKDSKAYFHLLNQIAP-KGQKEGEPRIDINMSGFNETDDLKRAESMLQQADKLGCRQFVTPADVV------SGNPKLNLAFVANLFNKYPALTKPENQDIDWTLLEGETREERTFRNWMNSLGVNPHVNHLYADLQDALVILQLYERIK-VPVDWSKVNKPPYPKLGANMKKL----ENC----NYAVELGKHPAKFSLVGIGGQDLNDGNQTLTLALVWQLMRRYTLNVLEDLGD---GQKANDDIIVNWVNRTLSEAGKSTS-IQSFKDKTISSSLAVVDLIDAIQPGCINYDLVKSGNLTEDDKHNNAKYAVSMARRIGARVYALPEDLVEVKPKMVMTVFACLM 623          
BLAST of Plastin 3 vs. Ensembl Human
Match: LCP1 (lymphocyte cytosolic protein 1 [Source:HGNC Symbol;Acc:HGNC:6528])

HSP 1 Score: 398.282 bits (1022), Expect = 5.955e-130
Identity = 236/541 (43.62%), Postives = 339/541 (62.66%), Query Frame = 2
Query:  311 QQSSINGQDDVQAVRVVSDAEERSYSDWINQALRNEEICQKYLPID--YNKLYEACSDGVLLCKMINYSVPDTIDMRAVNVGKKLETIFCKNENLSLAVQSASSIGCCVVNIGPIDLGNGVKHIVLGLLWQIIRIGLIGKINLANHAELVALLRDGESLEDLKQLSPEEILIRWVNYHMEKANVSRRISNFNTDIMDSEIYTYLINQIAP---SECRSKMMPPNEILRSNDNVQRAENVLSNASAMNAKAFVEANDIAMVTQKGKNREKLNMAFVAHLFNNYPALNITEKVIQEFDIVE-ETLEEKTYRNWMNSMGVEPYLNYLYSDLRNGIALLHLIDVIQPKTVNWETVTTKFNP-----MRKLFQMQDNCLAFINYAKKLN-----LKLVGLSAENIRETETTLVLGLCFQLLRKYTFQLLQKLQPNNFNKSVEDKDIIEWANKKCQSTGKSESVIRSFKDLNIRSSKPILHLIDSIKPNSVDYSMITNNPLDD------AKYAITVARKIGANVYALPQHVVDLNQKMILTIYACLM 1867
            +QSS+  Q         S+ E+ ++ +WIN+AL N+  C+  +P++   N L+ A  DG++LCKMIN SVPDTID R +N  KK  T F   ENL+LA+ SAS+IGC VVNIG  DL  G  ++VLGLLWQ+I+IGL   I L+ +  L+ALLR+GESLEDL +LSPEE+L+RW NYH+E A  + +I NF+TDI DS+ Y +L+ Q+AP    E    ++     LR  D++QRAE +L  A  +  + FV A D+       +   KLN+AF+A+LFN YPAL+  E    ++  +E ET EE+T+RNWMNS+GV P +N+LYSDL + + +  L + I+   V+W  V     P     M+KL    +NC    NYA +L        LVG+  +++ E   TL L L +QL+R+YT  +L+++      + V D  I+ W N+  +   K  S I SFKD  I +S P+L LID+I+P S++Y ++    L+D      AKYAI++ARKIGA VYALP+ +V++N KM++T++ACLM
Sbjct:  108 EQSSVGTQ------HSYSEEEKYAFVNWINKALENDPDCRHVIPMNPNTNDLFNAVGDGIVLCKMINLSVPDTIDERTIN--KKKLTPFTIQENLNLALNSASAIGCHVVNIGAEDLKEGKPYLVLGLLWQVIKIGLFADIELSRNEALIALLREGESLEDLMKLSPEELLLRWANYHLENAGCN-KIGNFSTDIKDSKAYYHLLEQVAPKGDEEGVPAVVIDMSGLREKDDIQRAECMLQQAERLGCRQFVTATDVV------RGNPKLNLAFIANLFNRYPALHKPENQDIDWGALEGETREERTFRNWMNSLGVNPRVNHLYSDLSDALVIFQLYEKIK-VPVDWNRVNKPPYPKLGGNMKKL----ENC----NYAVELGKNQAKFSLVGIGGQDLNEGNRTLTLALIWQLMRRYTLNILEEI---GGGQKVNDDIIVNWVNETLREA-KKSSSISSFKDPKISTSLPVLDLIDAIQPGSINYDLLKTENLNDDEKLNNAKYAISMARKIGARVYALPEDLVEVNPKMVMTVFACLM 620          
BLAST of Plastin 3 vs. Ensembl Human
Match: LCP1 (lymphocyte cytosolic protein 1 [Source:HGNC Symbol;Acc:HGNC:6528])

HSP 1 Score: 398.282 bits (1022), Expect = 5.955e-130
Identity = 236/541 (43.62%), Postives = 339/541 (62.66%), Query Frame = 2
Query:  311 QQSSINGQDDVQAVRVVSDAEERSYSDWINQALRNEEICQKYLPID--YNKLYEACSDGVLLCKMINYSVPDTIDMRAVNVGKKLETIFCKNENLSLAVQSASSIGCCVVNIGPIDLGNGVKHIVLGLLWQIIRIGLIGKINLANHAELVALLRDGESLEDLKQLSPEEILIRWVNYHMEKANVSRRISNFNTDIMDSEIYTYLINQIAP---SECRSKMMPPNEILRSNDNVQRAENVLSNASAMNAKAFVEANDIAMVTQKGKNREKLNMAFVAHLFNNYPALNITEKVIQEFDIVE-ETLEEKTYRNWMNSMGVEPYLNYLYSDLRNGIALLHLIDVIQPKTVNWETVTTKFNP-----MRKLFQMQDNCLAFINYAKKLN-----LKLVGLSAENIRETETTLVLGLCFQLLRKYTFQLLQKLQPNNFNKSVEDKDIIEWANKKCQSTGKSESVIRSFKDLNIRSSKPILHLIDSIKPNSVDYSMITNNPLDD------AKYAITVARKIGANVYALPQHVVDLNQKMILTIYACLM 1867
            +QSS+  Q         S+ E+ ++ +WIN+AL N+  C+  +P++   N L+ A  DG++LCKMIN SVPDTID R +N  KK  T F   ENL+LA+ SAS+IGC VVNIG  DL  G  ++VLGLLWQ+I+IGL   I L+ +  L+ALLR+GESLEDL +LSPEE+L+RW NYH+E A  + +I NF+TDI DS+ Y +L+ Q+AP    E    ++     LR  D++QRAE +L  A  +  + FV A D+       +   KLN+AF+A+LFN YPAL+  E    ++  +E ET EE+T+RNWMNS+GV P +N+LYSDL + + +  L + I+   V+W  V     P     M+KL    +NC    NYA +L        LVG+  +++ E   TL L L +QL+R+YT  +L+++      + V D  I+ W N+  +   K  S I SFKD  I +S P+L LID+I+P S++Y ++    L+D      AKYAI++ARKIGA VYALP+ +V++N KM++T++ACLM
Sbjct:  108 EQSSVGTQ------HSYSEEEKYAFVNWINKALENDPDCRHVIPMNPNTNDLFNAVGDGIVLCKMINLSVPDTIDERTIN--KKKLTPFTIQENLNLALNSASAIGCHVVNIGAEDLKEGKPYLVLGLLWQVIKIGLFADIELSRNEALIALLREGESLEDLMKLSPEELLLRWANYHLENAGCN-KIGNFSTDIKDSKAYYHLLEQVAPKGDEEGVPAVVIDMSGLREKDDIQRAECMLQQAERLGCRQFVTATDVV------RGNPKLNLAFIANLFNRYPALHKPENQDIDWGALEGETREERTFRNWMNSLGVNPRVNHLYSDLSDALVIFQLYEKIK-VPVDWNRVNKPPYPKLGGNMKKL----ENC----NYAVELGKNQAKFSLVGIGGQDLNEGNRTLTLALIWQLMRRYTLNILEEI---GGGQKVNDDIIVNWVNETLREA-KKSSSISSFKDPKISTSLPVLDLIDAIQPGSINYDLLKTENLNDDEKLNNAKYAISMARKIGARVYALPEDLVEVNPKMVMTVFACLM 620          
BLAST of Plastin 3 vs. Ensembl Human
Match: PLS3 (plastin 3 [Source:HGNC Symbol;Acc:HGNC:9091])

HSP 1 Score: 391.734 bits (1005), Expect = 1.519e-127
Identity = 228/534 (42.70%), Postives = 336/534 (62.92%), Query Frame = 2
Query:  362 SDAEERSYSDWINQALRNEEICQKYLPIDYN--KLYEACSDGVLLCKMINYSVPDTIDMRAVNVGKKLETIFCKNENLSLAVQSASSIGCCVVNIGPIDLGNGVKHIVLGLLWQIIRIGLIGKINLANHAELVALLRDGESLEDLKQLSPEEILIRWVNYHMEKANVSRRISNFNTDI---------MDSEIYTYLINQIAPSECRSKMMPPNEI----LRSNDNVQRAENVLSNASAMNAKAFVEANDIAMVTQKGKNREKLNMAFVAHLFNNYPALNITEKVIQEFDIVE-ETLEEKTYRNWMNSMGVEPYLNYLYSDLRNGIALLHLIDVIQPKTVNWETVTTKFNP-----MRKLFQMQDNCLAFINYAKKLN-----LKLVGLSAENIRETETTLVLGLCFQLLRKYTFQLLQKLQPNNFNKSVEDKDIIEWANKKCQSTGKSESVIRSFKDLNIRSSKPILHLIDSIKPNSVDYSMITNNPL--DD----AKYAITVARKIGANVYALPQHVVDLNQKMILTIYACLM 1867
            S+ E+ ++ +WIN+AL N+  C+  +P++ N   L++A  DG++LCKMIN SVPDTID RA+N  KK  T F   ENL+LA+ SAS+IGC VVNIG  DL  G  H+VLGLLWQII+IGL   I L+ +  L ALLRDGE+LE+L +LSPEE+L+RW N+H+E +   ++I+NF+ DI          DS+ Y +L+NQIAP + + +  P  +I        D+++RAE++L  A  +  + FV   D+           KLN+AFVA+LFN YPAL   E    ++ ++E ET EE+T+RNWMNS+GV P++N+LY+DL++ + +L L + I+   V+W  V     P     M+KL    +NC    NYA +L        LVG+  +++ +   TL L L +QL+R+YT  +L+ L      +   D  I+ W N+     GKS S I+SFKD  I SS  ++ LID+I+P  ++Y ++ +  L  DD    AKYA+++AR+IGA VYALP+ +V++  KM++T++ACLM
Sbjct:  100 SEEEKYAFVNWINKALENDPDCRHVIPMNPNTDDLFKAVGDGIVLCKMINLSVPDTIDERAIN--KKKLTPFIIQENLNLALNSASAIGCHVVNIGAEDLRAGKPHLVLGLLWQIIKIGLFADIELSRNEALAALLRDGETLEELMKLSPEELLLRWANFHLENSGW-QKINNFSADIKLIDFSNSVKDSKAYFHLLNQIAP-KGQKEGEPRIDINMSGFNETDDLKRAESMLQQADKLGCRQFVTPADVV------SGNPKLNLAFVANLFNKYPALTKPENQDIDWTLLEGETREERTFRNWMNSLGVNPHVNHLYADLQDALVILQLYERIK-VPVDWSKVNKPPYPKLGANMKKL----ENC----NYAVELGKHPAKFSLVGIGGQDLNDGNQTLTLALVWQLMRRYTLNVLEDLGD---GQKANDDIIVNWVNRTLSEAGKSTS-IQSFKDKTISSSLAVVDLIDAIQPGCINYDLVKSGNLTEDDKHNNAKYAVSMARRIGARVYALPEDLVEVKPKMVMTVFACLM 610          
BLAST of Plastin 3 vs. Ensembl Celegans
Match: plst-1 (PLaSTin (Actin bundling protein) homolog [Source:UniProtKB/TrEMBL;Acc:U4PMA7])

HSP 1 Score: 310.071 bits (793), Expect = 9.126e-100
Identity = 158/360 (43.89%), Postives = 231/360 (64.17%), Query Frame = 2
Query:  818 IRWVNYHMEKANVSRRISNFNTDIMDSEIYTYLINQIAPSECRSKMMPPNEILRSNDNVQRAENVLSNASAMNAKAFVEANDIAMVTQKGKNREKLNMAFVAHLFNNYPALNITEKVIQEF--DIVEETLEEKTYRNWMNSMGVEPYLNYLYSDLRNGIALLHLIDVIQPKTVNWETVTTKFNPMRKLFQMQDNCLAFINYAKKLNLKLVGLSAENIRETETTLVLGLCFQLLRKYTFQLLQKLQPNNFNKSVEDKDIIEWANKKCQSTGKSESVIRSFKDLNIRSSKPILHLIDSIKPNSVDYSMITN-----NPLDDAKYAITVARKIGANVYALPQHVVDLNQKMILTIYACLMLVD 1876
            +RWVNYH+E+A   RR+ NF +DI+DSEIYT+L++QIAP+     + P    L  + NV RA  +L  A  ++ + FV A D+A          KLN+AFVA+LFN +P  N+ +    E   D++EET EEKTYRNWMNSMGV+PY+N+LY+DL+NG+ +  L D+I+P  V W+ V   F+ +R +     NC   +   K+L   LVG+  ++I +   TL L L +QL+R YT  +L +   +  +    DKDI+ W N+K +++GKS S IRSF+D  I   K +L LID+IKPN +D+S++ +     + + +AKYAIT  RKIGA +YALP+ +V++  KM+LT++ACLM  D
Sbjct:    1 MRWVNYHLERAGTQRRLHNFTSDIVDSEIYTHLLHQIAPNGSGVTLSP----LGVHGNVPRAGAMLDEAEKLDCREFVTATDVA------AGNYKLNLAFVANLFNKHP--NLPDPGADEVVEDVIEETREEKTYRNWMNSMGVDPYVNWLYADLQNGVVIFQLYDIIRPGMVTWKRVVRTFHKLRGMMDQIQNCNYAVELGKQLRFSLVGIQGKDIYDGNQTLTLALVWQLMRAYTLSVLAQCTQSG-DSLPADKDIVAWVNEKLKNSGKSTS-IRSFQDPAISDGKVVLDLIDAIKPNVIDHSLVKSGKSNEDKMSNAKYAITCGRKIGAKIYALPEDIVEVKPKMVLTVFACLMARD 346          

HSP 2 Score: 51.6026 bits (122), Expect = 1.077e-6
Identity = 55/254 (21.65%), Postives = 109/254 (42.91%), Query Frame = 2
Query:  329 GQDDVQAVRVVSDAEERSYSDWINQALRNEEICQKYLPIDYNKLYEACSDGVLLCKMINYSVPDTIDM-RAVNVGKKLETIFCKNENLSLAVQSASSIGCCVVNIGPIDLGNGVKHIVLGLLWQIIRIGLIGKINLANHAELVALLRDGESLEDLKQLSPEEILIRWVNYHMEKANVSRRISNF-NTDIMDSEIYTYLINQIAPSECRSKMMPPNEILRSNDNVQRAENVLSNASAMNAKAFVEANDIAMVTQK 1084
            G D+V    +    EE++Y +W+N    +  +         N LY    +GV++ ++ +   P  +   R V    KL  +  + +N + AV+    +   +V I   D+ +G + + L L+WQ++R   +        + L    + G+SL   K       ++ WVN  ++ +  S  I +F +  I D ++   LI+ I P+     ++   +   + D +  A+  ++    + AK +    DI  V  K
Sbjct:  105 GADEVVEDVIEETREEKTYRNWMNSMGVDPYV---------NWLYADLQNGVVIFQLYDIIRPGMVTWKRVVRTFHKLRGMMDQIQNCNYAVELGKQLRFSLVGIQGKDIYDGNQTLTLALVWQLMRAYTL--------SVLAQCTQSGDSLPADKD------IVAWVNEKLKNSGKSTSIRSFQDPAISDGKVVLDLIDAIKPNVIDHSLVKSGK--SNEDKMSNAKYAITCGRKIGAKIYALPEDIVEVKPK 333          
BLAST of Plastin 3 vs. Ensembl Celegans
Match: plst-1 (PLaSTin (Actin bundling protein) homolog [Source:UniProtKB/TrEMBL;Acc:U4PMA7])

HSP 1 Score: 310.071 bits (793), Expect = 1.094e-99
Identity = 158/361 (43.77%), Postives = 229/361 (63.43%), Query Frame = 2
Query:  818 IRWVNYHMEKANVSRRISNFNTDIMDSEIYTYLINQIAPSECRSKMMPPNEILRSNDNVQRAENVLSNASAMNAKAFVEANDIAMVTQKGKNREKLNMAFVAHLFNNYPAL---NITEKVIQEFDIVEETLEEKTYRNWMNSMGVEPYLNYLYSDLRNGIALLHLIDVIQPKTVNWETVTTKFNPMRKLFQMQDNCLAFINYAKKLNLKLVGLSAENIRETETTLVLGLCFQLLRKYTFQLLQKLQPNNFNKSVEDKDIIEWANKKCQSTGKSESVIRSFKDLNIRSSKPILHLIDSIKPNSVDYSMITN-----NPLDDAKYAITVARKIGANVYALPQHVVDLNQKMILTIYACLMLVD 1876
            +RWVNYH+E+A   RR+ NF +DI+DSEIYT+L++QIAP+     + P    L  + NV RA  +L  A  ++ + FV A D+A          KLN+AFVA+LFN +P L      E      D++EET EEKTYRNWMNSMGV+PY+N+LY+DL+NG+ +  L D+I+P  V W+ V   F+ +R +     NC   +   K+L   LVG+  ++I +   TL L L +QL+R YT  +L +   +  +    DKDI+ W N+K +++GKS S IRSF+D  I   K +L LID+IKPN +D+S++ +     + + +AKYAIT  RKIGA +YALP+ +V++  KM+LT++ACLM  D
Sbjct:    1 MRWVNYHLERAGTQRRLHNFTSDIVDSEIYTHLLHQIAPNGSGVTLSP----LGVHGNVPRAGAMLDEAEKLDCREFVTATDVA------AGNYKLNLAFVANLFNKHPNLPDPGADEVGFSVEDVIEETREEKTYRNWMNSMGVDPYVNWLYADLQNGVVIFQLYDIIRPGMVTWKRVVRTFHKLRGMMDQIQNCNYAVELGKQLRFSLVGIQGKDIYDGNQTLTLALVWQLMRAYTLSVLAQCTQSG-DSLPADKDIVAWVNEKLKNSGKSTS-IRSFQDPAISDGKVVLDLIDAIKPNVIDHSLVKSGKSNEDKMSNAKYAITCGRKIGAKIYALPEDIVEVKPKMVLTVFACLMARD 349          
BLAST of Plastin 3 vs. Ensembl Celegans
Match: Y73B3B.1 (pep chromosome:WBcel235:X:209108:211241:-1 gene:WBGene00022223.1 transcript:Y73B3B.1.1 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:Y73B3B.1)

HSP 1 Score: 124.79 bits (312), Expect = 9.702e-31
Identity = 64/147 (43.54%), Postives = 95/147 (64.63%), Query Frame = 2
Query: 1451 AENIRETETTLVLGLCFQLLRKYTFQLLQKLQPNNFNKSVEDKDIIEWANKKCQSTGKSESVIRSFKDLNIRSSKPILHLIDSIKPNSVDYSMITN-----NPLDDAKYAITVARKIGANVYALPQHVVDLNQKMILTIYACLMLVD 1876
              +I +    L L L +QL+R YT  +L +   +  +    DKDI+ W N+K +++GKS S IRSF+D  I   K +L LIDSIKPN +D+S++ +     + + +AKYAIT  RKIGA +YALP+ +V++  KM+LT++ACLM  D
Sbjct:  211 GRHIYDGNQILTLALVWQLMRAYTLSVLAQYTQSG-DSLPTDKDIVAWVNEKLKNSGKSTS-IRSFQDPAISDGKVVLDLIDSIKPNVIDHSLVKSGKSNEDKMSNAKYAITCGRKIGAKIYALPEDIVEVKPKMVLTVFACLMARD 355          
BLAST of Plastin 3 vs. Ensembl Celegans
Match: M116.5 (pep chromosome:WBcel235:IV:8414293:8421061:-1 gene:WBGene00019792.1 transcript:M116.5.1 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:M116.5)

HSP 1 Score: 52.373 bits (124), Expect = 9.909e-7
Identity = 33/124 (26.61%), Postives = 68/124 (54.84%), Query Frame = 2
Query: 1175 EFDIVEETLEEKTYRNWMNS--MGVEPYLNYLYSDLRNGIALLHLIDVIQPKTVNWETVTTKFNPMRKLFQMQDNCLAFINYAKKLNLKLVGLSAENIRETETTLVLGLCFQLLRKYTFQLLQK 1540
            +F+ V +T+++KT+  W+N      +  +  L+ DLR+G AL+ L++ +  + +  E   T+F+ ++ +      CL F+   K  N+KLV +  E+I E    L LGL + ++  +   ++++
Sbjct:   32 KFNDVRDTMQKKTFTKWVNKHLTKTDHTIVDLFVDLRDGFALIALLEALTGERIQRENGYTRFHRIQNV----QYCLDFL---KMKNIKLVNIRPEDIVEGNGKLTLGLIWTIILNFQVSVIRQ 148          
BLAST of Plastin 3 vs. Ensembl Celegans
Match: anc-1 (Nuclear anchorage protein 1 [Source:UniProtKB/Swiss-Prot;Acc:Q9N4M4])

HSP 1 Score: 50.447 bits (119), Expect = 4.960e-6
Identity = 33/112 (29.46%), Postives = 53/112 (47.32%), Query Frame = 2
Query:  368 AEERSYSDWINQALRNEEICQKYLPIDYNKLYEACSDGVLLCKMINYSVPDTIDMRAVNVGKKLETIFCKNENLSLAVQSASSIGCCVVNIGPIDLGNGVKHIVLGLLWQII 703
            A++ +++ WIN  L       +        L+E   DGVLLC +I     + + +    V K++  I     NL+ A+      G  ++N    D+ +G   IVLGL+WQII
Sbjct:   17 AQKNTFTRWINFHLEEHSSSGRI-----EDLFEDIRDGVLLCHLIEVLTGEALAVHKGRVSKRVHHIA----NLTTALTVLRRRGLELINNNAADIADGNPRIVLGLIWQII 119          
BLAST of Plastin 3 vs. Ensembl Fly
Match: Fim (gene:FBgn0024238 transcript:FBtr0074442)

HSP 1 Score: 450.284 bits (1157), Expect = 1.290e-150
Identity = 233/527 (44.21%), Postives = 347/527 (65.84%), Query Frame = 2
Query:  317 SSINGQDDVQAVRVVSDAEERSYSDWINQALRNEEICQKYLPIDY--NKLYEACSDGVLLCKMINYSVPDTIDMRAVNVGKKLETIFCKNENLSLAVQSASSIGCCVVNIGPIDLGNGVKHIVLGLLWQIIRIGLIGKINLANHAELVALLRDGESLEDLKQLSPEEILIRWVNYHMEKANVSRRISNFNTDIMDSEIYTYLINQIAPSECRSKMMPPNEILRSNDNVQRAENVLSNASAMNAKAFVEANDIAMVTQKGKNREKLNMAFVAHLFNNYPALNITEKVIQEFDIVEETLEEKTYRNWMNSMGVEPYLNYLYSDLRNGIALLHLIDVIQPKTVNWETVTTKFNPMRKLFQMQDNCLAFINYAKKLNLKLVGLSAENIRETETTLVLGLCFQLLRKYTFQLLQKLQPNNFNKSVEDKDIIEWANKKCQSTGKSESVIRSFKDLNIRSSKPILHLIDSIKPNSVDYSMITNNP-----LDDAKYAITVARKIGANVYALPQHVVDLNQKMILTIYACLMLVD 1876
            SSI+ +    +VR+    E+ ++SDWIN  L +++  Q  LPID    +LY +  DG+LLCK+IN+S PDTID RA+N  KK  T++ + ENL+LA+ S+ +IGC +VNI   DL  G  H+VLGLLWQIIRIGL   I L +   L  LL D E LEDL ++SPE IL+RWVN+H+E+A +SRR +NF +DI+DSEIY++L+ QIA ++    +    + LR +D   RAE +L  A+ +N ++F+   D+           KLN+AFVA+LFNN+P L+  E+ I+  + +EET EEKTYRNWMNSMGV P++N+LYSDL +G+ +  L DVI+P  VNW  V  +F+P+RK  +  +NC   ++  K+L   LVG++ +++ +   TL L L +QL+R YT  +L +L   N    + +K+I++W N +    GK +S +R+F D  I   K ++ LID+IK  S++Y ++  +      L +AKYAI++ARKIGA VYALP+ + ++  KM++T++AC+M +D
Sbjct:   88 SSISSEGTTHSVRL---EEQLAFSDWINSNLGHDKDLQHLLPIDSEGKRLYLSIKDGILLCKIINHSCPDTIDERAIN--KKNLTVYREFENLTLALVSSQAIGCNIVNIDAHDLAKGKPHLVLGLLWQIIRIGLFSHITLDSCPGLAGLLFDNERLEDLMKMSPEAILLRWVNHHLERAGISRRCTNFQSDIVDSEIYSHLLKQIAGNDADVNL----DALRESDLQSRAEIMLQQAAKLNCRSFLTPQDVV------NGVYKLNLAFVANLFNNHPGLDKPEQ-IEGLESIEETREEKTYRNWMNSMGVAPHVNWLYSDLADGLVIFQLFDVIKPGIVNWSRVHKRFSPLRKFMEKLENCNYAVDLGKQLKFSLVGIAGQDLNDGNATLTLALIWQLMRAYTLSILSRLA--NTGNPIIEKEIVQWVNNRLSEAGK-QSQLRNFNDPAIADGKIVIDLIDAIKEGSINYELVRTSGTQEDNLANAKYAISMARKIGARVYALPEDITEVKPKMVMTVFACMMALD 595          
BLAST of Plastin 3 vs. Ensembl Fly
Match: Fim (gene:FBgn0024238 transcript:FBtr0074441)

HSP 1 Score: 450.669 bits (1158), Expect = 2.139e-150
Identity = 233/527 (44.21%), Postives = 347/527 (65.84%), Query Frame = 2
Query:  317 SSINGQDDVQAVRVVSDAEERSYSDWINQALRNEEICQKYLPIDY--NKLYEACSDGVLLCKMINYSVPDTIDMRAVNVGKKLETIFCKNENLSLAVQSASSIGCCVVNIGPIDLGNGVKHIVLGLLWQIIRIGLIGKINLANHAELVALLRDGESLEDLKQLSPEEILIRWVNYHMEKANVSRRISNFNTDIMDSEIYTYLINQIAPSECRSKMMPPNEILRSNDNVQRAENVLSNASAMNAKAFVEANDIAMVTQKGKNREKLNMAFVAHLFNNYPALNITEKVIQEFDIVEETLEEKTYRNWMNSMGVEPYLNYLYSDLRNGIALLHLIDVIQPKTVNWETVTTKFNPMRKLFQMQDNCLAFINYAKKLNLKLVGLSAENIRETETTLVLGLCFQLLRKYTFQLLQKLQPNNFNKSVEDKDIIEWANKKCQSTGKSESVIRSFKDLNIRSSKPILHLIDSIKPNSVDYSMITNNP-----LDDAKYAITVARKIGANVYALPQHVVDLNQKMILTIYACLMLVD 1876
            SSI+ +    +VR+    E+ ++SDWIN  L +++  Q  LPID    +LY +  DG+LLCK+IN+S PDTID RA+N  KK  T++ + ENL+LA+ S+ +IGC +VNI   DL  G  H+VLGLLWQIIRIGL   I L +   L  LL D E LEDL ++SPE IL+RWVN+H+E+A +SRR +NF +DI+DSEIY++L+ QIA ++    +    + LR +D   RAE +L  A+ +N ++F+   D+           KLN+AFVA+LFNN+P L+  E+ I+  + +EET EEKTYRNWMNSMGV P++N+LYSDL +G+ +  L DVI+P  VNW  V  +F+P+RK  +  +NC   ++  K+L   LVG++ +++ +   TL L L +QL+R YT  +L +L   N    + +K+I++W N +    GK +S +R+F D  I   K ++ LID+IK  S++Y ++  +      L +AKYAI++ARKIGA VYALP+ + ++  KM++T++AC+M +D
Sbjct:  112 SSISSEGTTHSVRL---EEQLAFSDWINSNLGHDKDLQHLLPIDSEGKRLYLSIKDGILLCKIINHSCPDTIDERAIN--KKNLTVYREFENLTLALVSSQAIGCNIVNIDAHDLAKGKPHLVLGLLWQIIRIGLFSHITLDSCPGLAGLLFDNERLEDLMKMSPEAILLRWVNHHLERAGISRRCTNFQSDIVDSEIYSHLLKQIAGNDADVNL----DALRESDLQSRAEIMLQQAAKLNCRSFLTPQDVV------NGVYKLNLAFVANLFNNHPGLDKPEQ-IEGLESIEETREEKTYRNWMNSMGVAPHVNWLYSDLADGLVIFQLFDVIKPGIVNWSRVHKRFSPLRKFMEKLENCNYAVDLGKQLKFSLVGIAGQDLNDGNATLTLALIWQLMRAYTLSILSRLA--NTGNPIIEKEIVQWVNNRLSEAGK-QSQLRNFNDPAIADGKIVIDLIDAIKEGSINYELVRTSGTQEDNLANAKYAISMARKIGARVYALPEDITEVKPKMVMTVFACMMALD 619          
BLAST of Plastin 3 vs. Ensembl Fly
Match: Fim (gene:FBgn0024238 transcript:FBtr0074443)

HSP 1 Score: 450.284 bits (1157), Expect = 3.432e-150
Identity = 233/527 (44.21%), Postives = 347/527 (65.84%), Query Frame = 2
Query:  317 SSINGQDDVQAVRVVSDAEERSYSDWINQALRNEEICQKYLPIDY--NKLYEACSDGVLLCKMINYSVPDTIDMRAVNVGKKLETIFCKNENLSLAVQSASSIGCCVVNIGPIDLGNGVKHIVLGLLWQIIRIGLIGKINLANHAELVALLRDGESLEDLKQLSPEEILIRWVNYHMEKANVSRRISNFNTDIMDSEIYTYLINQIAPSECRSKMMPPNEILRSNDNVQRAENVLSNASAMNAKAFVEANDIAMVTQKGKNREKLNMAFVAHLFNNYPALNITEKVIQEFDIVEETLEEKTYRNWMNSMGVEPYLNYLYSDLRNGIALLHLIDVIQPKTVNWETVTTKFNPMRKLFQMQDNCLAFINYAKKLNLKLVGLSAENIRETETTLVLGLCFQLLRKYTFQLLQKLQPNNFNKSVEDKDIIEWANKKCQSTGKSESVIRSFKDLNIRSSKPILHLIDSIKPNSVDYSMITNNP-----LDDAKYAITVARKIGANVYALPQHVVDLNQKMILTIYACLMLVD 1876
            SSI+ +    +VR+    E+ ++SDWIN  L +++  Q  LPID    +LY +  DG+LLCK+IN+S PDTID RA+N  KK  T++ + ENL+LA+ S+ +IGC +VNI   DL  G  H+VLGLLWQIIRIGL   I L +   L  LL D E LEDL ++SPE IL+RWVN+H+E+A +SRR +NF +DI+DSEIY++L+ QIA ++    +    + LR +D   RAE +L  A+ +N ++F+   D+           KLN+AFVA+LFNN+P L+  E+ I+  + +EET EEKTYRNWMNSMGV P++N+LYSDL +G+ +  L DVI+P  VNW  V  +F+P+RK  +  +NC   ++  K+L   LVG++ +++ +   TL L L +QL+R YT  +L +L   N    + +K+I++W N +    GK +S +R+F D  I   K ++ LID+IK  S++Y ++  +      L +AKYAI++ARKIGA VYALP+ + ++  KM++T++AC+M +D
Sbjct:  113 SSISSEGTTHSVRL---EEQLAFSDWINSNLGHDKDLQHLLPIDSEGKRLYLSIKDGILLCKIINHSCPDTIDERAIN--KKNLTVYREFENLTLALVSSQAIGCNIVNIDAHDLAKGKPHLVLGLLWQIIRIGLFSHITLDSCPGLAGLLFDNERLEDLMKMSPEAILLRWVNHHLERAGISRRCTNFQSDIVDSEIYSHLLKQIAGNDADVNL----DALRESDLQSRAEIMLQQAAKLNCRSFLTPQDVV------NGVYKLNLAFVANLFNNHPGLDKPEQ-IEGLESIEETREEKTYRNWMNSMGVAPHVNWLYSDLADGLVIFQLFDVIKPGIVNWSRVHKRFSPLRKFMEKLENCNYAVDLGKQLKFSLVGIAGQDLNDGNATLTLALIWQLMRAYTLSILSRLA--NTGNPIIEKEIVQWVNNRLSEAGK-QSQLRNFNDPAIADGKIVIDLIDAIKEGSINYELVRTSGTQEDNLANAKYAISMARKIGARVYALPEDITEVKPKMVMTVFACMMALD 620          
BLAST of Plastin 3 vs. Ensembl Fly
Match: kst (gene:FBgn0004167 transcript:FBtr0300017)

HSP 1 Score: 51.2174 bits (121), Expect = 3.398e-6
Identity = 73/299 (24.41%), Postives = 129/299 (43.14%), Query Frame = 2
Query:  956 MPPNEILRSNDNVQRAENVLSNASAMNAKAFVEANDIAMVTQKGKNREKLNMAFVAHL--FNNYPALNITEKVIQEFDIVEETLEEKTYRNWMNSMGVEPYLNY--LYSDLRNGIALLHLIDVIQPKTVNWETVTTKFNPMRKLFQMQDN---CLAFINYAKKLNLKLVGLSAENIRETETTLVLGLCFQLLRKYTFQLLQKLQPNNFNKSVEDKD----IIEWANKKCQSTGKSESVIRSFKDLNIRSSKPILHLIDSIKPNSVDYSMITNNP---LDDAKYAITVARKIGANVYALP 1810
            M  N +LRSN +       +S      A  +      A+ T    NR   NM     +  F N     + E+ +         +++KT+  WMNS  ++  +    L++DL +GI LL L+++I  + +       K N  R      +N    LAF++      ++L  + AE+I +    L+LGL + ++ ++  Q ++ +  +  N+S E +     ++ W  +K    G     I  F + + RS      LI S +P+  +YS I N+    LD+  +A   A    AN   +P
Sbjct:    1 MEYNSVLRSNFSRNEYRRYISYERQSLASQYEPGGYSALQTPTPSNRNSANMTQRDGIIKFENERIKTLQEERLH--------IQKKTFTKWMNSFLIKAKMEVEDLFTDLADGIKLLKLLEIISSEKLG------KPNSGRMRVHKIENVNKSLAFLH----TKVRLESIGAEDIVDGNPRLILGLIWTIILRFQIQEIE-IDVDEENESSEKRSAKDALLLWCQRKTH--GYPGVNITDFTN-SWRSGLGFNALIHSHRPDLFEYSTIVNSKNSNLDNLNHAFDTA----ANELGIP 273          
BLAST of Plastin 3 vs. Ensembl Fly
Match: kst (gene:FBgn0004167 transcript:FBtr0332056)

HSP 1 Score: 51.2174 bits (121), Expect = 3.545e-6
Identity = 73/299 (24.41%), Postives = 129/299 (43.14%), Query Frame = 2
Query:  956 MPPNEILRSNDNVQRAENVLSNASAMNAKAFVEANDIAMVTQKGKNREKLNMAFVAHL--FNNYPALNITEKVIQEFDIVEETLEEKTYRNWMNSMGVEPYLNY--LYSDLRNGIALLHLIDVIQPKTVNWETVTTKFNPMRKLFQMQDN---CLAFINYAKKLNLKLVGLSAENIRETETTLVLGLCFQLLRKYTFQLLQKLQPNNFNKSVEDKD----IIEWANKKCQSTGKSESVIRSFKDLNIRSSKPILHLIDSIKPNSVDYSMITNNP---LDDAKYAITVARKIGANVYALP 1810
            M  N +LRSN +       +S      A  +      A+ T    NR   NM     +  F N     + E+ +         +++KT+  WMNS  ++  +    L++DL +GI LL L+++I  + +       K N  R      +N    LAF++      ++L  + AE+I +    L+LGL + ++ ++  Q ++ +  +  N+S E +     ++ W  +K    G     I  F + + RS      LI S +P+  +YS I N+    LD+  +A   A    AN   +P
Sbjct:    1 MEYNSVLRSNFSRNEYRRYISYERQSLASQYEPGGYSALQTPTPSNRNSANMTQRDGIIKFENERIKTLQEERLH--------IQKKTFTKWMNSFLIKAKMEVEDLFTDLADGIKLLKLLEIISSEKLG------KPNSGRMRVHKIENVNKSLAFLH----TKVRLESIGAEDIVDGNPRLILGLIWTIILRFQIQEIE-IDVDEENESSEKRSAKDALLLWCQRKTH--GYPGVNITDFTN-SWRSGLGFNALIHSHRPDLFEYSTIVNSKNSNLDNLNHAFDTA----ANELGIP 273          
BLAST of Plastin 3 vs. Ensembl Zebrafish
Match: lcp1 (lymphocyte cytosolic protein 1 (L-plastin) [Source:NCBI gene;Acc:30583])

HSP 1 Score: 409.068 bits (1050), Expect = 2.067e-134
Identity = 231/531 (43.50%), Postives = 339/531 (63.84%), Query Frame = 2
Query:  362 SDAEERSYSDWINQALRNEEICQKYLPID--YNKLYEACSDGVLLCKMINYSVPDTIDMRAVNVGKKLETIFCKNENLSLAVQSASSIGCCVVNIGPIDLGNGVKHIVLGLLWQIIRIGLIGKINLANHAELVALLRDGESLEDLKQLSPEEILIRWVNYHMEKANVSRRISNFNTDIMDSEIYTYLINQIAPSECRSKMMP--PNEI--LRSNDNVQRAENVLSNASAMNAKAFVEANDIAMVTQKGKNREKLNMAFVAHLFNNYPALNITEKVIQEFDIVE-ETLEEKTYRNWMNSMGVEPYLNYLYSDLRNGIALLHLIDVIQPKTVNWETVTTKFNP-----MRKLFQMQDNCLAFINYAKKLNLK-----LVGLSAENIRETETTLVLGLCFQLLRKYTFQLLQKLQPNNFNKSVEDKDIIEWANKKCQSTGKSESVIRSFKDLNIRSSKPILHLIDSIKPNSVDYSMITNNPLDD------AKYAITVARKIGANVYALPQHVVDLNQKMILTIYACLMLVDLQK 1885
            S+ E+ ++ +W+N+AL  +  CQ  LP+D   + L+ A  DG++LCKMIN SVPDTID R +N  KK  T F   ENL+LA+ SAS+IGC VVNIG  DL  G +H+VLGLLWQ+I+IGL   I ++ +  L+ALLRDGESLEDL +LSPEE+L+RW NYH+E+A    +I+NF++DI DS+ Y  ++NQ+AP +   + +P  P +I  +R  D+++RAE +L  A  +  + FV A D+       +   KLN+A+VA+LFN YPAL   E    ++  +E ET EE+T+RNWMNS+GV P +N+LY DL + + +  L + I+   V+W+ V     P     M+KL    +NC    NYA +L  K     LVG++ +++ E   TL L L +QL+R+YT  +L+ L      + + D+ I++W N+     GK    I  FKD +I SS P+L LID+I+P S+ Y ++    L D      AKYAI++ARKIGA VYALP+ +V++  KM++T++ACLM   +++
Sbjct:  117 SEEEKVAFVNWVNKALEKDPDCQHVLPMDPSTDDLFTAVGDGIVLCKMINLSVPDTIDERTIN--KKKLTPFTIQENLNLALNSASAIGCHVVNIGAEDLKEGRQHLVLGLLWQVIKIGLFADIEISRNEALIALLRDGESLEDLVKLSPEELLLRWANYHLEEAGCP-KINNFSSDIKDSKAYYNILNQVAP-KGDEEGIPAIPIDISGIREKDDLKRAECMLEQADRLGCRQFVTATDVV------RGNPKLNLAYVANLFNKYPALKKPENQDIDWSSIEGETREERTFRNWMNSLGVNPRVNHLYVDLADALVIFQLYEKIK-VPVDWDKVNKPPYPKLGSNMKKL----ENC----NYAVELGKKEAKFSLVGIAGQDLNEGNRTLTLALLWQLMRRYTLNILEDL---GDGQKIIDETIVQWVNETLTQAGK--GTISGFKDGSISSSMPVLDLIDAIQPGSIRYDLLKAEDLTDEEKLNNAKYAISMARKIGARVYALPEDLVEVKPKMVMTVFACLMARGMRR 623          
BLAST of Plastin 3 vs. Ensembl Zebrafish
Match: pls3 (plastin 3 (T isoform) [Source:ZFIN;Acc:ZDB-GENE-040718-10])

HSP 1 Score: 407.912 bits (1047), Expect = 8.561e-134
Identity = 229/518 (44.21%), Postives = 329/518 (63.51%), Query Frame = 2
Query:  362 SDAEERSYSDWINQALRNEEICQKYLPIDYN--KLYEACSDGVLLCKMINYSVPDTIDMRAVNVGKKLETIFCKNENLSLAVQSASSIGCCVVNIGPIDLGNGVKHIVLGLLWQIIRIGLIGKINLANHAELVALLRDGESLEDLKQLSPEEILIRWVNYHMEKANVSRRISNFNTDIMDSEIYTYLINQIAP---SECRSKMMPPNEILRSNDNVQRAENVLSNASAMNAKAFVEANDIAMVTQKGKNREKLNMAFVAHLFNNYPALNITEKVIQEFDIVE-ETLEEKTYRNWMNSMGVEPYLNYLYSDLRNGIALLHLIDVIQPKTVNWETVTTKFNPMRKL---FQMQDNCLAFINYAK-KLNLKLVGLSAENIRETETTLVLGLCFQLLRKYTFQLLQKLQPNNFNKSVEDKDIIEWANKKCQSTGKSESVIRSFKDLNIRSSKPILHLIDSIKPNSVDYSMIT------NNPLDDAKYAITVARKIGANVYALPQHVVDLNQKMILTIYACLM 1867
            S+ E  ++ +WIN AL ++  C+  LP++ N   L++A  DG++LCKMIN SVPDTID R +N  KK  T F   ENL+LA+ SAS+IGC VVNIG +DL  G  H+VLGLLWQII+IGL   I L+ +  L ALLRDGE+LEDL +LSPEE+L+RW N+H+E A  S +I+NF+ DI DS  Y +L+NQIAP    +  S++          D+++RAE +L  A  +  + FV + D+           KLN+AFVA+LFN YPAL   E     + ++E ET EE+T+RNWMNS+GV P++N+LY DL++ + +L L + I+   V+W     K  P  KL    +  +NC   +   K K N  LVG+  +++ +   TL L L +QL+R+YT  +L+ L      + V D  I+ W NK     GKS + I +FKD  I SS  +L LID+I+P+S++Y ++        + LD+AKYA+++ARKIGA VYALP+ +V++  KM++T++ACLM
Sbjct:  118 SEEERFAFVNWINTALEHDPDCKHKLPMNPNTDALFKAVGDGIVLCKMINLSVPDTIDERTIN--KKKLTPFTIQENLNLALNSASAIGCHVVNIGALDLREGKPHLVLGLLWQIIKIGLFADIELSRNEALAALLRDGETLEDLMKLSPEELLLRWANFHLENAGWS-KINNFSHDIKDSRAYFHLLNQIAPKGQKDGESRIDIDMSGFTEKDDLKRAECMLLQADKLGCRQFVTSTDVM------SGNPKLNLAFVANLFNKYPALTKPENQDINWGLLEGETREERTFRNWMNSLGVNPHVNHLYGDLQDALVILQLYEKIKV-PVDWNNKVNK-PPYPKLGANMKKLENCNYAVELGKTKANFSLVGIGGQDLNDGNPTLTLALVWQLMRRYTLNVLENLGD---GQKVNDDVIVSWVNKTLSQAGKS-TKISNFKDKEISSSLAVLDLIDAIQPSSINYDLVKRGSLSDGDKLDNAKYAVSMARKIGARVYALPEDLVEVKPKMVMTVFACLM 620          
BLAST of Plastin 3 vs. Ensembl Zebrafish
Match: pls3 (plastin 3 (T isoform) [Source:ZFIN;Acc:ZDB-GENE-040718-10])

HSP 1 Score: 407.912 bits (1047), Expect = 8.561e-134
Identity = 229/518 (44.21%), Postives = 329/518 (63.51%), Query Frame = 2
Query:  362 SDAEERSYSDWINQALRNEEICQKYLPIDYN--KLYEACSDGVLLCKMINYSVPDTIDMRAVNVGKKLETIFCKNENLSLAVQSASSIGCCVVNIGPIDLGNGVKHIVLGLLWQIIRIGLIGKINLANHAELVALLRDGESLEDLKQLSPEEILIRWVNYHMEKANVSRRISNFNTDIMDSEIYTYLINQIAP---SECRSKMMPPNEILRSNDNVQRAENVLSNASAMNAKAFVEANDIAMVTQKGKNREKLNMAFVAHLFNNYPALNITEKVIQEFDIVE-ETLEEKTYRNWMNSMGVEPYLNYLYSDLRNGIALLHLIDVIQPKTVNWETVTTKFNPMRKL---FQMQDNCLAFINYAK-KLNLKLVGLSAENIRETETTLVLGLCFQLLRKYTFQLLQKLQPNNFNKSVEDKDIIEWANKKCQSTGKSESVIRSFKDLNIRSSKPILHLIDSIKPNSVDYSMIT------NNPLDDAKYAITVARKIGANVYALPQHVVDLNQKMILTIYACLM 1867
            S+ E  ++ +WIN AL ++  C+  LP++ N   L++A  DG++LCKMIN SVPDTID R +N  KK  T F   ENL+LA+ SAS+IGC VVNIG +DL  G  H+VLGLLWQII+IGL   I L+ +  L ALLRDGE+LEDL +LSPEE+L+RW N+H+E A  S +I+NF+ DI DS  Y +L+NQIAP    +  S++          D+++RAE +L  A  +  + FV + D+           KLN+AFVA+LFN YPAL   E     + ++E ET EE+T+RNWMNS+GV P++N+LY DL++ + +L L + I+   V+W     K  P  KL    +  +NC   +   K K N  LVG+  +++ +   TL L L +QL+R+YT  +L+ L      + V D  I+ W NK     GKS + I +FKD  I SS  +L LID+I+P+S++Y ++        + LD+AKYA+++ARKIGA VYALP+ +V++  KM++T++ACLM
Sbjct:  118 SEEERFAFVNWINTALEHDPDCKHKLPMNPNTDALFKAVGDGIVLCKMINLSVPDTIDERTIN--KKKLTPFTIQENLNLALNSASAIGCHVVNIGALDLREGKPHLVLGLLWQIIKIGLFADIELSRNEALAALLRDGETLEDLMKLSPEELLLRWANFHLENAGWS-KINNFSHDIKDSRAYFHLLNQIAPKGQKDGESRIDIDMSGFTEKDDLKRAECMLLQADKLGCRQFVTSTDVM------SGNPKLNLAFVANLFNKYPALTKPENQDINWGLLEGETREERTFRNWMNSLGVNPHVNHLYGDLQDALVILQLYEKIKV-PVDWNNKVNK-PPYPKLGANMKKLENCNYAVELGKTKANFSLVGIGGQDLNDGNPTLTLALVWQLMRRYTLNVLENLGD---GQKVNDDVIVSWVNKTLSQAGKS-TKISNFKDKEISSSLAVLDLIDAIQPSSINYDLVKRGSLSDGDKLDNAKYAVSMARKIGARVYALPEDLVEVKPKMVMTVFACLM 620          
BLAST of Plastin 3 vs. Ensembl Zebrafish
Match: pls1 (plastin 1 (I isoform) [Source:ZFIN;Acc:ZDB-GENE-030131-6205])

HSP 1 Score: 389.037 bits (998), Expect = 1.568e-126
Identity = 227/529 (42.91%), Postives = 323/529 (61.06%), Query Frame = 2
Query:  362 SDAEERSYSDWINQALRNEEICQKYLPID--YNKLYEACSDGVLLCKMINYSVPDTIDMRAVNVGKKLETIFCKNENLSLAVQSASSIGCCVVNIGPIDLGNGVKHIVLGLLWQIIRIGLIGKINLANHAELVALLRDGESLEDLKQLSPEEILIRWVNYHMEKANVSRRISNFNTDIMDSEIYTYLINQIAP-SECRSKMMPPNEI--LRSNDNVQRAENVLSNASAMNAKAFVEANDIAMVTQKGKNREKLNMAFVAHLFNNYPALNITEKVIQEFDIVEETLEEKTYRNWMNSMGVEPYLNYLYSDLRNGIALLHLIDVIQPKTVNWETVTTKFNP-----MRKLFQMQDNCLAFINYA-----KKLNLKLVGLSAENIRETETTLVLGLCFQLLRKYTFQLLQKLQPNNFNKSVEDKDIIEWANKKCQSTGKSESVIRSFKDLNIRSSKPILHLIDSIKPNSVDYSMITN------NPLDDAKYAITVARKIGANVYALPQHVVDLNQKMILTIYACLMLVDLQK 1885
            SD E+ ++ +W+N+AL N+  C+  +P+D   + L+++  DG+LLCKMIN S PDTID R +N   K  T F   ENL LA+ SAS+IGC VVNI   D+  G  H+VLGLLWQII+IGL   I ++ +  L+ALL + E L+ L  +SPE++L+RWVNYH+ KA   ++I NF+ DI DS  Y +L+NQI+P  +   +M    ++  L   D+  RAE +L  A+ ++ + FV   D+           KLNMAFVA+LFN YPALN       ++ I  ET E++T+RNWMNS+GV PY+N+LYSDL +G+ +L L + IQ   V+W  V     P     M+KL    +NC    NYA     K+    LVG+  ENI E      L L +QL+R+YT ++L  L      + V D+ II W N   +  G   S I SFKD +I +S P++ LID+I P ++ Y M+ +      + L++AKYAI+VARKIG  VYALP  +V++  KM++T++ACLM   L+K
Sbjct:  120 SDEEKVAFVNWVNKALANDPDCKHLIPMDPGTDSLFKSVKDGILLCKMINLSQPDTIDERVIN---KKCTPFTMTENLMLALNSASAIGCTVVNIDAQDMKAGTPHLVLGLLWQIIKIGLFADIEISRNEALIALLDESEELDHLMSMSPEDLLLRWVNYHL-KAAGWKQIRNFSEDIKDSRAYFHLLNQISPKGDLDDQMRIDIDMLGLTERDDEMRAELMLRQAARLDCRQFVTPKDVV------AGNHKLNMAFVANLFNMYPALNRPTDNGIDYAIEGETREDRTFRNWMNSLGVSPYVNHLYSDLHDGLIILQLYERIQ-IPVDWPRVNKPPYPVLGSNMKKL----ENC----NYAVALGKKEAKFSLVGIGGENINEGSPMHTLALVWQLMRRYTLKVLSDLGD---GEKVSDQIIINWVNSTLKQ-GDKNSSISSFKDKSISTSLPVIDLIDTIVPKAIKYEMVKSGDMTAEDKLNNAKYAISVARKIGVKVYALPDDLVEVKPKMVMTVFACLMGRGLKK 625          
BLAST of Plastin 3 vs. Ensembl Zebrafish
Match: pls1 (plastin 1 (I isoform) [Source:ZFIN;Acc:ZDB-GENE-030131-6205])

HSP 1 Score: 389.037 bits (998), Expect = 3.813e-126
Identity = 227/529 (42.91%), Postives = 323/529 (61.06%), Query Frame = 2
Query:  362 SDAEERSYSDWINQALRNEEICQKYLPID--YNKLYEACSDGVLLCKMINYSVPDTIDMRAVNVGKKLETIFCKNENLSLAVQSASSIGCCVVNIGPIDLGNGVKHIVLGLLWQIIRIGLIGKINLANHAELVALLRDGESLEDLKQLSPEEILIRWVNYHMEKANVSRRISNFNTDIMDSEIYTYLINQIAP-SECRSKMMPPNEI--LRSNDNVQRAENVLSNASAMNAKAFVEANDIAMVTQKGKNREKLNMAFVAHLFNNYPALNITEKVIQEFDIVEETLEEKTYRNWMNSMGVEPYLNYLYSDLRNGIALLHLIDVIQPKTVNWETVTTKFNP-----MRKLFQMQDNCLAFINYA-----KKLNLKLVGLSAENIRETETTLVLGLCFQLLRKYTFQLLQKLQPNNFNKSVEDKDIIEWANKKCQSTGKSESVIRSFKDLNIRSSKPILHLIDSIKPNSVDYSMITN------NPLDDAKYAITVARKIGANVYALPQHVVDLNQKMILTIYACLMLVDLQK 1885
            SD E+ ++ +W+N+AL N+  C+  +P+D   + L+++  DG+LLCKMIN S PDTID R +N   K  T F   ENL LA+ SAS+IGC VVNI   D+  G  H+VLGLLWQII+IGL   I ++ +  L+ALL + E L+ L  +SPE++L+RWVNYH+ KA   ++I NF+ DI DS  Y +L+NQI+P  +   +M    ++  L   D+  RAE +L  A+ ++ + FV   D+           KLNMAFVA+LFN YPALN       ++ I  ET E++T+RNWMNS+GV PY+N+LYSDL +G+ +L L + IQ   V+W  V     P     M+KL    +NC    NYA     K+    LVG+  ENI E      L L +QL+R+YT ++L  L      + V D+ II W N   +  G   S I SFKD +I +S P++ LID+I P ++ Y M+ +      + L++AKYAI+VARKIG  VYALP  +V++  KM++T++ACLM   L+K
Sbjct:  157 SDEEKVAFVNWVNKALANDPDCKHLIPMDPGTDSLFKSVKDGILLCKMINLSQPDTIDERVIN---KKCTPFTMTENLMLALNSASAIGCTVVNIDAQDMKAGTPHLVLGLLWQIIKIGLFADIEISRNEALIALLDESEELDHLMSMSPEDLLLRWVNYHL-KAAGWKQIRNFSEDIKDSRAYFHLLNQISPKGDLDDQMRIDIDMLGLTERDDEMRAELMLRQAARLDCRQFVTPKDVV------AGNHKLNMAFVANLFNMYPALNRPTDNGIDYAIEGETREDRTFRNWMNSLGVSPYVNHLYSDLHDGLIILQLYERIQ-IPVDWPRVNKPPYPVLGSNMKKL----ENC----NYAVALGKKEAKFSLVGIGGENINEGSPMHTLALVWQLMRRYTLKVLSDLGD---GEKVSDQIIINWVNSTLKQ-GDKNSSISSFKDKSISTSLPVIDLIDTIVPKAIKYEMVKSGDMTAEDKLNNAKYAISVARKIGVKVYALPDDLVEVKPKMVMTVFACLMGRGLKK 662          
BLAST of Plastin 3 vs. Ensembl Xenopus
Match: snx5 (sorting nexin 5 [Source:Xenbase;Acc:XB-GENE-947018])

HSP 1 Score: 401.749 bits (1031), Expect = 1.798e-132
Identity = 222/519 (42.77%), Postives = 334/519 (64.35%), Query Frame = 2
Query:  362 SDAEERSYSDWINQALRNEEICQKYLPI--DYNKLYEACSDGVLLCKMINYSVPDTIDMRAVNVGKKLETIFCKNENLSLAVQSASSIGCCVVNIGPIDLGNGVKHIVLGLLWQIIRIGLIGKINLANHAELVALLRDGESLEDLKQLSPEEILIRWVNYHMEKANVSRRISNFNTDIMDSEIYTYLINQIAPSECRSKMMPPNEI----LRSNDNVQRAENVLSNASAMNAKAFVEANDIAMVTQKGKNREKLNMAFVAHLFNNYPALNITEKVIQEFDIVE-ETLEEKTYRNWMNSMGVEPYLNYLYSDLRNGIALLHLIDVIQPKTVNWETVTTKFNPMRKL---FQMQDNCLAFINYAK-KLNLKLVGLSAENIRETETTLVLGLCFQLLRKYTFQLLQKLQPNNFNKSVEDKDIIEWANKKCQSTGKSESVIRSFKDLNIRSSKPILHLIDSIKPNSVDYSMITNNPLDD------AKYAITVARKIGANVYALPQHVVDLNQKMILTIYACLM 1867
            S+ E  ++ +W+N+AL  ++ C+  +P+  D + L++A  DG++LCKMIN SV +TID RA+N  KK  T F   ENL+LA+ SAS+IGC VVNIG  DL  G  H+VLGLLWQ+I+IGL   I L+ +  L+ALL+DGESLEDL +LSPEE+L+RW NYH+E A  + +I+NF++DI DS+ Y +L+NQ+AP +   + +P  +I    LR  ++++RAE +L     +  + FV A D+       +   KLN+AF+A+LFN YPAL+  E    ++  +E ET EE+T+RNWMNS+GV P +N+LYSDL + + +  L + I+   V+W  V     P  KL    +  +NC   ++  K K    LVG++ ++++E   TL L L +QL+R+YT  +L+ +      + V D+ I+ W N+  +   K  S I SFKD  I +S P+L LID+I+P  ++Y ++    LD+      AKYAI++ARK+GA VYALP  +V++  KM++T++ACLM
Sbjct:   37 SEEENYAFVNWVNKALEKDQDCKHVIPMNPDTDDLFKAVGDGIVLCKMINLSVAETIDERAIN--KKKLTPFTIQENLNLALNSASAIGCHVVNIGAEDLKEGKPHLVLGLLWQVIKIGLFADIELSRNEALIALLKDGESLEDLMKLSPEELLLRWANYHLENAGCN-KINNFSSDIKDSKAYYHLLNQVAP-KGDEEGIPAIDIDMTGLREKEDLKRAECMLLQTEKLGCRQFVTATDVV------RGNPKLNLAFIANLFNKYPALHKPENQDIDWSSIEGETREERTFRNWMNSLGVNPRVNHLYSDLSDALVIFQLYEKIKV-PVDWNRVNKP--PYSKLGENMKKIENCNYAVDLGKNKAKFSLVGIAGQDLKEGNHTLTLALLWQLMRRYTLNILEDI---GGGQKVNDETILTWVNETLKEAEKCSS-ISSFKDPKISTSMPVLDLIDAIQPGCINYDLLKTEDLDETEKLNNAKYAISMARKVGARVYALPDDLVEVKPKMVMTVFACLM 538          
BLAST of Plastin 3 vs. Ensembl Xenopus
Match: snx5 (sorting nexin 5 [Source:Xenbase;Acc:XB-GENE-947018])

HSP 1 Score: 402.134 bits (1032), Expect = 1.564e-131
Identity = 222/519 (42.77%), Postives = 334/519 (64.35%), Query Frame = 2
Query:  362 SDAEERSYSDWINQALRNEEICQKYLPI--DYNKLYEACSDGVLLCKMINYSVPDTIDMRAVNVGKKLETIFCKNENLSLAVQSASSIGCCVVNIGPIDLGNGVKHIVLGLLWQIIRIGLIGKINLANHAELVALLRDGESLEDLKQLSPEEILIRWVNYHMEKANVSRRISNFNTDIMDSEIYTYLINQIAPSECRSKMMPPNEI----LRSNDNVQRAENVLSNASAMNAKAFVEANDIAMVTQKGKNREKLNMAFVAHLFNNYPALNITEKVIQEFDIVE-ETLEEKTYRNWMNSMGVEPYLNYLYSDLRNGIALLHLIDVIQPKTVNWETVTTKFNPMRKL---FQMQDNCLAFINYAK-KLNLKLVGLSAENIRETETTLVLGLCFQLLRKYTFQLLQKLQPNNFNKSVEDKDIIEWANKKCQSTGKSESVIRSFKDLNIRSSKPILHLIDSIKPNSVDYSMITNNPLDD------AKYAITVARKIGANVYALPQHVVDLNQKMILTIYACLM 1867
            S+ E  ++ +W+N+AL  ++ C+  +P+  D + L++A  DG++LCKMIN SV +TID RA+N  KK  T F   ENL+LA+ SAS+IGC VVNIG  DL  G  H+VLGLLWQ+I+IGL   I L+ +  L+ALL+DGESLEDL +LSPEE+L+RW NYH+E A  + +I+NF++DI DS+ Y +L+NQ+AP +   + +P  +I    LR  ++++RAE +L     +  + FV A D+       +   KLN+AF+A+LFN YPAL+  E    ++  +E ET EE+T+RNWMNS+GV P +N+LYSDL + + +  L + I+   V+W  V     P  KL    +  +NC   ++  K K    LVG++ ++++E   TL L L +QL+R+YT  +L+ +      + V D+ I+ W N+  +   K  S I SFKD  I +S P+L LID+I+P  ++Y ++    LD+      AKYAI++ARK+GA VYALP  +V++  KM++T++ACLM
Sbjct:  120 SEEENYAFVNWVNKALEKDQDCKHVIPMNPDTDDLFKAVGDGIVLCKMINLSVAETIDERAIN--KKKLTPFTIQENLNLALNSASAIGCHVVNIGAEDLKEGKPHLVLGLLWQVIKIGLFADIELSRNEALIALLKDGESLEDLMKLSPEELLLRWANYHLENAGCN-KINNFSSDIKDSKAYYHLLNQVAP-KGDEEGIPAIDIDMTGLREKEDLKRAECMLLQTEKLGCRQFVTATDVV------RGNPKLNLAFIANLFNKYPALHKPENQDIDWSSIEGETREERTFRNWMNSLGVNPRVNHLYSDLSDALVIFQLYEKIKV-PVDWNRVNKP--PYSKLGENMKKIENCNYAVDLGKNKAKFSLVGIAGQDLKEGNHTLTLALLWQLMRRYTLNILEDI---GGGQKVNDETILTWVNETLKEAEKCSS-ISSFKDPKISTSMPVLDLIDAIQPGCINYDLLKTEDLDETEKLNNAKYAISMARKVGARVYALPDDLVEVKPKMVMTVFACLM 621          
BLAST of Plastin 3 vs. Ensembl Xenopus
Match: snx5 (sorting nexin 5 [Source:Xenbase;Acc:XB-GENE-947018])

HSP 1 Score: 401.364 bits (1030), Expect = 1.871e-131
Identity = 222/519 (42.77%), Postives = 334/519 (64.35%), Query Frame = 2
Query:  362 SDAEERSYSDWINQALRNEEICQKYLPI--DYNKLYEACSDGVLLCKMINYSVPDTIDMRAVNVGKKLETIFCKNENLSLAVQSASSIGCCVVNIGPIDLGNGVKHIVLGLLWQIIRIGLIGKINLANHAELVALLRDGESLEDLKQLSPEEILIRWVNYHMEKANVSRRISNFNTDIMDSEIYTYLINQIAPSECRSKMMPPNEI----LRSNDNVQRAENVLSNASAMNAKAFVEANDIAMVTQKGKNREKLNMAFVAHLFNNYPALNITEKVIQEFDIVE-ETLEEKTYRNWMNSMGVEPYLNYLYSDLRNGIALLHLIDVIQPKTVNWETVTTKFNPMRKL---FQMQDNCLAFINYAK-KLNLKLVGLSAENIRETETTLVLGLCFQLLRKYTFQLLQKLQPNNFNKSVEDKDIIEWANKKCQSTGKSESVIRSFKDLNIRSSKPILHLIDSIKPNSVDYSMITNNPLDD------AKYAITVARKIGANVYALPQHVVDLNQKMILTIYACLM 1867
            S+ E  ++ +W+N+AL  ++ C+  +P+  D + L++A  DG++LCKMIN SV +TID RA+N  KK  T F   ENL+LA+ SAS+IGC VVNIG  DL  G  H+VLGLLWQ+I+IGL   I L+ +  L+ALL+DGESLEDL +LSPEE+L+RW NYH+E A  + +I+NF++DI DS+ Y +L+NQ+AP +   + +P  +I    LR  ++++RAE +L     +  + FV A D+       +   KLN+AF+A+LFN YPAL+  E    ++  +E ET EE+T+RNWMNS+GV P +N+LYSDL + + +  L + I+   V+W  V     P  KL    +  +NC   ++  K K    LVG++ ++++E   TL L L +QL+R+YT  +L+ +      + V D+ I+ W N+  +   K  S I SFKD  I +S P+L LID+I+P  ++Y ++    LD+      AKYAI++ARK+GA VYALP  +V++  KM++T++ACLM
Sbjct:  100 SEEENYAFVNWVNKALEKDQDCKHVIPMNPDTDDLFKAVGDGIVLCKMINLSVAETIDERAIN--KKKLTPFTIQENLNLALNSASAIGCHVVNIGAEDLKEGKPHLVLGLLWQVIKIGLFADIELSRNEALIALLKDGESLEDLMKLSPEELLLRWANYHLENAGCN-KINNFSSDIKDSKAYYHLLNQVAP-KGDEEGIPAIDIDMTGLREKEDLKRAECMLLQTEKLGCRQFVTATDVV------RGNPKLNLAFIANLFNKYPALHKPENQDIDWSSIEGETREERTFRNWMNSLGVNPRVNHLYSDLSDALVIFQLYEKIKV-PVDWNRVNKP--PYSKLGENMKKIENCNYAVDLGKNKAKFSLVGIAGQDLKEGNHTLTLALLWQLMRRYTLNILEDI---GGGQKVNDETILTWVNETLKEAEKCSS-ISSFKDPKISTSMPVLDLIDAIQPGCINYDLLKTEDLDETEKLNNAKYAISMARKVGARVYALPDDLVEVKPKMVMTVFACLM 601          
BLAST of Plastin 3 vs. Ensembl Xenopus
Match: snx5 (sorting nexin 5 [Source:Xenbase;Acc:XB-GENE-947018])

HSP 1 Score: 401.749 bits (1031), Expect = 1.985e-131
Identity = 222/519 (42.77%), Postives = 334/519 (64.35%), Query Frame = 2
Query:  362 SDAEERSYSDWINQALRNEEICQKYLPI--DYNKLYEACSDGVLLCKMINYSVPDTIDMRAVNVGKKLETIFCKNENLSLAVQSASSIGCCVVNIGPIDLGNGVKHIVLGLLWQIIRIGLIGKINLANHAELVALLRDGESLEDLKQLSPEEILIRWVNYHMEKANVSRRISNFNTDIMDSEIYTYLINQIAPSECRSKMMPPNEI----LRSNDNVQRAENVLSNASAMNAKAFVEANDIAMVTQKGKNREKLNMAFVAHLFNNYPALNITEKVIQEFDIVE-ETLEEKTYRNWMNSMGVEPYLNYLYSDLRNGIALLHLIDVIQPKTVNWETVTTKFNPMRKL---FQMQDNCLAFINYAK-KLNLKLVGLSAENIRETETTLVLGLCFQLLRKYTFQLLQKLQPNNFNKSVEDKDIIEWANKKCQSTGKSESVIRSFKDLNIRSSKPILHLIDSIKPNSVDYSMITNNPLDD------AKYAITVARKIGANVYALPQHVVDLNQKMILTIYACLM 1867
            S+ E  ++ +W+N+AL  ++ C+  +P+  D + L++A  DG++LCKMIN SV +TID RA+N  KK  T F   ENL+LA+ SAS+IGC VVNIG  DL  G  H+VLGLLWQ+I+IGL   I L+ +  L+ALL+DGESLEDL +LSPEE+L+RW NYH+E A  + +I+NF++DI DS+ Y +L+NQ+AP +   + +P  +I    LR  ++++RAE +L     +  + FV A D+       +   KLN+AF+A+LFN YPAL+  E    ++  +E ET EE+T+RNWMNS+GV P +N+LYSDL + + +  L + I+   V+W  V     P  KL    +  +NC   ++  K K    LVG++ ++++E   TL L L +QL+R+YT  +L+ +      + V D+ I+ W N+  +   K  S I SFKD  I +S P+L LID+I+P  ++Y ++    LD+      AKYAI++ARK+GA VYALP  +V++  KM++T++ACLM
Sbjct:  115 SEEENYAFVNWVNKALEKDQDCKHVIPMNPDTDDLFKAVGDGIVLCKMINLSVAETIDERAIN--KKKLTPFTIQENLNLALNSASAIGCHVVNIGAEDLKEGKPHLVLGLLWQVIKIGLFADIELSRNEALIALLKDGESLEDLMKLSPEELLLRWANYHLENAGCN-KINNFSSDIKDSKAYYHLLNQVAP-KGDEEGIPAIDIDMTGLREKEDLKRAECMLLQTEKLGCRQFVTATDVV------RGNPKLNLAFIANLFNKYPALHKPENQDIDWSSIEGETREERTFRNWMNSLGVNPRVNHLYSDLSDALVIFQLYEKIKV-PVDWNRVNKP--PYSKLGENMKKIENCNYAVDLGKNKAKFSLVGIAGQDLKEGNHTLTLALLWQLMRRYTLNILEDI---GGGQKVNDETILTWVNETLKEAEKCSS-ISSFKDPKISTSMPVLDLIDAIQPGCINYDLLKTEDLDETEKLNNAKYAISMARKVGARVYALPDDLVEVKPKMVMTVFACLM 616          
BLAST of Plastin 3 vs. Ensembl Xenopus
Match: snx5 (sorting nexin 5 [Source:Xenbase;Acc:XB-GENE-947018])

HSP 1 Score: 402.134 bits (1032), Expect = 2.506e-131
Identity = 222/519 (42.77%), Postives = 334/519 (64.35%), Query Frame = 2
Query:  362 SDAEERSYSDWINQALRNEEICQKYLPI--DYNKLYEACSDGVLLCKMINYSVPDTIDMRAVNVGKKLETIFCKNENLSLAVQSASSIGCCVVNIGPIDLGNGVKHIVLGLLWQIIRIGLIGKINLANHAELVALLRDGESLEDLKQLSPEEILIRWVNYHMEKANVSRRISNFNTDIMDSEIYTYLINQIAPSECRSKMMPPNEI----LRSNDNVQRAENVLSNASAMNAKAFVEANDIAMVTQKGKNREKLNMAFVAHLFNNYPALNITEKVIQEFDIVE-ETLEEKTYRNWMNSMGVEPYLNYLYSDLRNGIALLHLIDVIQPKTVNWETVTTKFNPMRKL---FQMQDNCLAFINYAK-KLNLKLVGLSAENIRETETTLVLGLCFQLLRKYTFQLLQKLQPNNFNKSVEDKDIIEWANKKCQSTGKSESVIRSFKDLNIRSSKPILHLIDSIKPNSVDYSMITNNPLDD------AKYAITVARKIGANVYALPQHVVDLNQKMILTIYACLM 1867
            S+ E  ++ +W+N+AL  ++ C+  +P+  D + L++A  DG++LCKMIN SV +TID RA+N  KK  T F   ENL+LA+ SAS+IGC VVNIG  DL  G  H+VLGLLWQ+I+IGL   I L+ +  L+ALL+DGESLEDL +LSPEE+L+RW NYH+E A  + +I+NF++DI DS+ Y +L+NQ+AP +   + +P  +I    LR  ++++RAE +L     +  + FV A D+       +   KLN+AF+A+LFN YPAL+  E    ++  +E ET EE+T+RNWMNS+GV P +N+LYSDL + + +  L + I+   V+W  V     P  KL    +  +NC   ++  K K    LVG++ ++++E   TL L L +QL+R+YT  +L+ +      + V D+ I+ W N+  +   K  S I SFKD  I +S P+L LID+I+P  ++Y ++    LD+      AKYAI++ARK+GA VYALP  +V++  KM++T++ACLM
Sbjct:  128 SEEENYAFVNWVNKALEKDQDCKHVIPMNPDTDDLFKAVGDGIVLCKMINLSVAETIDERAIN--KKKLTPFTIQENLNLALNSASAIGCHVVNIGAEDLKEGKPHLVLGLLWQVIKIGLFADIELSRNEALIALLKDGESLEDLMKLSPEELLLRWANYHLENAGCN-KINNFSSDIKDSKAYYHLLNQVAP-KGDEEGIPAIDIDMTGLREKEDLKRAECMLLQTEKLGCRQFVTATDVV------RGNPKLNLAFIANLFNKYPALHKPENQDIDWSSIEGETREERTFRNWMNSLGVNPRVNHLYSDLSDALVIFQLYEKIKV-PVDWNRVNKP--PYSKLGENMKKIENCNYAVDLGKNKAKFSLVGIAGQDLKEGNHTLTLALLWQLMRRYTLNILEDI---GGGQKVNDETILTWVNETLKEAEKCSS-ISSFKDPKISTSMPVLDLIDAIQPGCINYDLLKTEDLDETEKLNNAKYAISMARKVGARVYALPDDLVEVKPKMVMTVFACLM 629          
BLAST of Plastin 3 vs. Ensembl Mouse
Match: Lcp1 (lymphocyte cytosolic protein 1 [Source:MGI Symbol;Acc:MGI:104808])

HSP 1 Score: 414.846 bits (1065), Expect = 1.702e-136
Identity = 236/538 (43.87%), Postives = 341/538 (63.38%), Query Frame = 2
Query:  311 QQSSINGQDDVQAVRVVSDAEERSYSDWINQALRNEEICQKYLPIDYNK--LYEACSDGVLLCKMINYSVPDTIDMRAVNVGKKLETIFCKNENLSLAVQSASSIGCCVVNIGPIDLGNGVKHIVLGLLWQIIRIGLIGKINLANHAELVALLRDGESLEDLKQLSPEEILIRWVNYHMEKANVSRRISNFNTDIMDSEIYTYLINQIAPSECRSKMMPPNEI----LRSNDNVQRAENVLSNASAMNAKAFVEANDIAMVTQKGKNREKLNMAFVAHLFNNYPALNITEKVIQEFDIVE-ETLEEKTYRNWMNSMGVEPYLNYLYSDLRNGIALLHLIDVIQPKTVNWETVTTKFNP-----MRKLFQMQDNCLAFINYAK-KLNLKLVGLSAENIRETETTLVLGLCFQLLRKYTFQLLQKLQPNNFNKSVEDKDIIEWANKKCQSTGKSESVIRSFKDLNIRSSKPILHLIDSIKPNSVDYSMITNNPLDD------AKYAITVARKIGANVYALPQHVVDLNQKMILTIYACLM 1867
            +QSS+  Q         S+ E+ ++ +WIN+AL N+  C+  +P++ N   L+ A  DG++LCKMIN SVPDTID R +N  KK  T F   ENL+LA+ SAS+IGC VVNIG  DL  G  ++VLGLLWQ+I+IGL   I L+ +  L+ALLR+GESLEDL +LSPEE+L+RW NYH+E A  + +I+NF+TDI DS+ Y +L+ Q+AP +   + +P   I    LR  D++QRAE +L  A  +  + FV A D+       +   KLN+AF+A+LFN YPAL+  E    ++  +E ET EE+T+RNWMNS+GV P +N+LYSDL + + +  L + I+   V+W  V     P     M+KL    +NC   ++  K +    LVG++ +++ E   TL L L +QL+R+YT  +L+ +      + V D  I+ W N   +   KS S I SFKD  I +S P+L LID+I+P S++Y ++    LDD      AKYAI++ARKIGA VYALP+ +V++N KM++T++ACLM
Sbjct:  108 EQSSVGTQ------HSYSEEEKYAFVNWINKALENDPDCRHVIPMNPNTDDLFNAVGDGIVLCKMINLSVPDTIDERTIN--KKKLTPFTIQENLNLALNSASAIGCHVVNIGAEDLKEGKPYLVLGLLWQVIKIGLFADIELSRNEALIALLREGESLEDLMKLSPEELLLRWANYHLENAGCT-KITNFSTDIKDSKAYYHLLEQVAP-KGDEEGIPAVVIDMSGLREKDDIQRAECMLQQAERLGCRQFVTATDVV------RGNPKLNLAFIANLFNKYPALHKPENQDIDWGALEGETREERTFRNWMNSLGVNPRVNHLYSDLSDALVIFQLYEKIK-VPVDWNRVNKPPYPKLGGNMKKL----ENCNYAVDLGKNQAKFSLVGIAGQDLNEGNRTLTLALVWQLMRRYTLNILEDI---GGGQKVNDDIIVNWVNTTLKEAQKSSS-IASFKDPKISTSLPVLDLIDAIQPGSINYDLLKTENLDDEEKLNNAKYAISMARKIGARVYALPEDLVEVNPKMVMTVFACLM 620          
BLAST of Plastin 3 vs. Ensembl Mouse
Match: Lcp1 (lymphocyte cytosolic protein 1 [Source:MGI Symbol;Acc:MGI:104808])

HSP 1 Score: 414.846 bits (1065), Expect = 1.702e-136
Identity = 236/538 (43.87%), Postives = 341/538 (63.38%), Query Frame = 2
Query:  311 QQSSINGQDDVQAVRVVSDAEERSYSDWINQALRNEEICQKYLPIDYNK--LYEACSDGVLLCKMINYSVPDTIDMRAVNVGKKLETIFCKNENLSLAVQSASSIGCCVVNIGPIDLGNGVKHIVLGLLWQIIRIGLIGKINLANHAELVALLRDGESLEDLKQLSPEEILIRWVNYHMEKANVSRRISNFNTDIMDSEIYTYLINQIAPSECRSKMMPPNEI----LRSNDNVQRAENVLSNASAMNAKAFVEANDIAMVTQKGKNREKLNMAFVAHLFNNYPALNITEKVIQEFDIVE-ETLEEKTYRNWMNSMGVEPYLNYLYSDLRNGIALLHLIDVIQPKTVNWETVTTKFNP-----MRKLFQMQDNCLAFINYAK-KLNLKLVGLSAENIRETETTLVLGLCFQLLRKYTFQLLQKLQPNNFNKSVEDKDIIEWANKKCQSTGKSESVIRSFKDLNIRSSKPILHLIDSIKPNSVDYSMITNNPLDD------AKYAITVARKIGANVYALPQHVVDLNQKMILTIYACLM 1867
            +QSS+  Q         S+ E+ ++ +WIN+AL N+  C+  +P++ N   L+ A  DG++LCKMIN SVPDTID R +N  KK  T F   ENL+LA+ SAS+IGC VVNIG  DL  G  ++VLGLLWQ+I+IGL   I L+ +  L+ALLR+GESLEDL +LSPEE+L+RW NYH+E A  + +I+NF+TDI DS+ Y +L+ Q+AP +   + +P   I    LR  D++QRAE +L  A  +  + FV A D+       +   KLN+AF+A+LFN YPAL+  E    ++  +E ET EE+T+RNWMNS+GV P +N+LYSDL + + +  L + I+   V+W  V     P     M+KL    +NC   ++  K +    LVG++ +++ E   TL L L +QL+R+YT  +L+ +      + V D  I+ W N   +   KS S I SFKD  I +S P+L LID+I+P S++Y ++    LDD      AKYAI++ARKIGA VYALP+ +V++N KM++T++ACLM
Sbjct:  108 EQSSVGTQ------HSYSEEEKYAFVNWINKALENDPDCRHVIPMNPNTDDLFNAVGDGIVLCKMINLSVPDTIDERTIN--KKKLTPFTIQENLNLALNSASAIGCHVVNIGAEDLKEGKPYLVLGLLWQVIKIGLFADIELSRNEALIALLREGESLEDLMKLSPEELLLRWANYHLENAGCT-KITNFSTDIKDSKAYYHLLEQVAP-KGDEEGIPAVVIDMSGLREKDDIQRAECMLQQAERLGCRQFVTATDVV------RGNPKLNLAFIANLFNKYPALHKPENQDIDWGALEGETREERTFRNWMNSLGVNPRVNHLYSDLSDALVIFQLYEKIK-VPVDWNRVNKPPYPKLGGNMKKL----ENCNYAVDLGKNQAKFSLVGIAGQDLNEGNRTLTLALVWQLMRRYTLNILEDI---GGGQKVNDDIIVNWVNTTLKEAQKSSS-IASFKDPKISTSLPVLDLIDAIQPGSINYDLLKTENLDDEEKLNNAKYAISMARKIGARVYALPEDLVEVNPKMVMTVFACLM 620          
BLAST of Plastin 3 vs. Ensembl Mouse
Match: Lcp1 (lymphocyte cytosolic protein 1 [Source:MGI Symbol;Acc:MGI:104808])

HSP 1 Score: 414.846 bits (1065), Expect = 1.702e-136
Identity = 236/538 (43.87%), Postives = 341/538 (63.38%), Query Frame = 2
Query:  311 QQSSINGQDDVQAVRVVSDAEERSYSDWINQALRNEEICQKYLPIDYNK--LYEACSDGVLLCKMINYSVPDTIDMRAVNVGKKLETIFCKNENLSLAVQSASSIGCCVVNIGPIDLGNGVKHIVLGLLWQIIRIGLIGKINLANHAELVALLRDGESLEDLKQLSPEEILIRWVNYHMEKANVSRRISNFNTDIMDSEIYTYLINQIAPSECRSKMMPPNEI----LRSNDNVQRAENVLSNASAMNAKAFVEANDIAMVTQKGKNREKLNMAFVAHLFNNYPALNITEKVIQEFDIVE-ETLEEKTYRNWMNSMGVEPYLNYLYSDLRNGIALLHLIDVIQPKTVNWETVTTKFNP-----MRKLFQMQDNCLAFINYAK-KLNLKLVGLSAENIRETETTLVLGLCFQLLRKYTFQLLQKLQPNNFNKSVEDKDIIEWANKKCQSTGKSESVIRSFKDLNIRSSKPILHLIDSIKPNSVDYSMITNNPLDD------AKYAITVARKIGANVYALPQHVVDLNQKMILTIYACLM 1867
            +QSS+  Q         S+ E+ ++ +WIN+AL N+  C+  +P++ N   L+ A  DG++LCKMIN SVPDTID R +N  KK  T F   ENL+LA+ SAS+IGC VVNIG  DL  G  ++VLGLLWQ+I+IGL   I L+ +  L+ALLR+GESLEDL +LSPEE+L+RW NYH+E A  + +I+NF+TDI DS+ Y +L+ Q+AP +   + +P   I    LR  D++QRAE +L  A  +  + FV A D+       +   KLN+AF+A+LFN YPAL+  E    ++  +E ET EE+T+RNWMNS+GV P +N+LYSDL + + +  L + I+   V+W  V     P     M+KL    +NC   ++  K +    LVG++ +++ E   TL L L +QL+R+YT  +L+ +      + V D  I+ W N   +   KS S I SFKD  I +S P+L LID+I+P S++Y ++    LDD      AKYAI++ARKIGA VYALP+ +V++N KM++T++ACLM
Sbjct:  108 EQSSVGTQ------HSYSEEEKYAFVNWINKALENDPDCRHVIPMNPNTDDLFNAVGDGIVLCKMINLSVPDTIDERTIN--KKKLTPFTIQENLNLALNSASAIGCHVVNIGAEDLKEGKPYLVLGLLWQVIKIGLFADIELSRNEALIALLREGESLEDLMKLSPEELLLRWANYHLENAGCT-KITNFSTDIKDSKAYYHLLEQVAP-KGDEEGIPAVVIDMSGLREKDDIQRAECMLQQAERLGCRQFVTATDVV------RGNPKLNLAFIANLFNKYPALHKPENQDIDWGALEGETREERTFRNWMNSLGVNPRVNHLYSDLSDALVIFQLYEKIK-VPVDWNRVNKPPYPKLGGNMKKL----ENCNYAVDLGKNQAKFSLVGIAGQDLNEGNRTLTLALVWQLMRRYTLNILEDI---GGGQKVNDDIIVNWVNTTLKEAQKSSS-IASFKDPKISTSLPVLDLIDAIQPGSINYDLLKTENLDDEEKLNNAKYAISMARKIGARVYALPEDLVEVNPKMVMTVFACLM 620          
BLAST of Plastin 3 vs. Ensembl Mouse
Match: Pls1 (plastin 1 (I-isoform) [Source:MGI Symbol;Acc:MGI:104809])

HSP 1 Score: 402.519 bits (1033), Expect = 1.187e-131
Identity = 233/525 (44.38%), Postives = 330/525 (62.86%), Query Frame = 2
Query:  362 SDAEERSYSDWINQALRNEEICQKYLPIDYN--KLYEACSDGVLLCKMINYSVPDTIDMRAVNVGKKLETIFCKNENLSLAVQSASSIGCCVVNIGPIDLGNGVKHIVLGLLWQIIRIGLIGKINLANHAELVALLRDGESLEDLKQLSPEEILIRWVNYHMEKANVSRRISNFNTDIMDSEIYTYLINQIAPSECRSKMMPPNEI----LRSNDNVQRAENVLSNASAMNAKAFVEANDIAMVTQKGKNREKLNMAFVAHLFNNYPALNITEKVIQEFDIVE-ETLEEKTYRNWMNSMGVEPYLNYLYSDLRNGIALLHLIDVIQPKTVNWETVTTKFNP-----MRKLFQMQDNCLAFINYAKKLN-----LKLVGLSAENIRETETTLVLGLCFQLLRKYTFQLLQKLQPNNFNKSVEDKDIIEWANKKCQSTGKSESVIRSFKDLNIRSSKPILHLIDSIKPNSVDYSMITNNPLDD------AKYAITVARKIGANVYALPQHVVDLNQKMILTIYACLM 1867
            S+ E+ ++ +WIN+AL N+  C   LP++ N   L+++ +DG+LLCKMIN S PDTID RA+N  KK  T F  +ENL+LA+ SAS+IGC VVNIG  DL  G  H+VLGLLWQII++GL   I ++ +  L+ALL+DGE LE+L +LSPEE+L+RWVNYH+  A   R I+NF+ DI DS+ Y +L+NQIAP   R    P   I        ++++RA  +L  A  +  + FV   D+           KLN+AFVA+LFN YP L+  +    + +++E E+ EE+T+RNWMNS+GV PY+N+LYSDL + + +  L ++I+   VNW  V     P     M+K+    +NC    NYA +L        LVG++ +++ E   TL L L +QL+R+YT ++L  L      + V D  II+W N+  +S  KS S I SFKD +I +S P+L LID+I PN+V   MI    L D      AKYAI+VARKIGA +YALP  +V++  KM++T++ACLM
Sbjct:  121 SEEEKVAFVNWINKALENDADCSHLLPMNPNDGSLFKSLADGILLCKMINLSEPDTIDERAIN--KKKLTPFTVSENLNLALNSASAIGCTVVNIGAQDLKEGKPHLVLGLLWQIIKVGLFADIEISRNEALIALLKDGEDLEELMKLSPEELLLRWVNYHLTNAGW-RTINNFSQDIKDSKAYFHLLNQIAPKGDRDD-GPAVAIDLSGFNEKNDLKRAGFMLQEADKLGCRQFVTPADVV------SGNPKLNLAFVANLFNTYPCLHKPDNNDIDLNLLEGESKEERTFRNWMNSLGVNPYINHLYSDLADALVIFQLYEMIR-VPVNWSQVNKPPYPALGGNMKKI----ENC----NYAVELGKNEAKFSLVGIAGQDLNEGNATLTLALVWQLMRRYTLKVLSDLGE---GEKVTDDIIIKWVNQTLKSANKSTS-ISSFKDKSISTSLPVLDLIDAIAPNAVRQEMIKREHLTDEDKLNNAKYAISVARKIGARIYALPDDLVEVKPKMVMTVFACLM 622          
BLAST of Plastin 3 vs. Ensembl Mouse
Match: Pls3 (plastin 3 (T-isoform) [Source:MGI Symbol;Acc:MGI:104807])

HSP 1 Score: 398.282 bits (1022), Expect = 4.660e-130
Identity = 227/525 (43.24%), Postives = 336/525 (64.00%), Query Frame = 2
Query:  362 SDAEERSYSDWINQALRNEEICQKYLPIDYN--KLYEACSDGVLLCKMINYSVPDTIDMRAVNVGKKLETIFCKNENLSLAVQSASSIGCCVVNIGPIDLGNGVKHIVLGLLWQIIRIGLIGKINLANHAELVALLRDGESLEDLKQLSPEEILIRWVNYHMEKANVSRRISNFNTDIMDSEIYTYLINQIAPSECRSKMMPPNEI----LRSNDNVQRAENVLSNASAMNAKAFVEANDIAMVTQKGKNREKLNMAFVAHLFNNYPALNITEKVIQEFDIVE-ETLEEKTYRNWMNSMGVEPYLNYLYSDLRNGIALLHLIDVIQPKTVNWETVTTKFNP-----MRKLFQMQDNCLAFINYAKKLN-----LKLVGLSAENIRETETTLVLGLCFQLLRKYTFQLLQKLQPNNFNKSVEDKDIIEWANKKCQSTGKSESVIRSFKDLNIRSSKPILHLIDSIKPNSVDYSMITNNPL--DD----AKYAITVARKIGANVYALPQHVVDLNQKMILTIYACLM 1867
            S+ E+ ++ +WIN+AL N+  C+  +P++ N   L++A  DG++LCKMIN SVPDTID RA+N  KK  T F   ENL+LA+ SAS+IGC VVNIG  DL  G  H+VLGLLWQII+IGL   I L+ +  L ALLRDGE+LE+L +LSPEE+L+RW N+H+E +   ++I+NF+ DI DS+ Y +L+NQIAP + + +  P  +I        D+++RAE++L  A  +  + FV   D+           KLN+AFVA+LFN YPAL   E    ++ ++E ET EE+T+RNWMNS+GV P++N+LY+DL++ + +L L + I+   V+W  V     P     M+KL    +NC    NYA +L        LVG+  +++ +   TL L + +QL+R+YT  +L+ L      +   D  I+ W N+     GKS S I+SFKD  I SS  ++ LID+I+P  ++Y ++ +  L  DD    AKYA+++AR+IGA VYALP+ +V++  KM++T++ACLM
Sbjct:  122 SEEEKYAFVNWINKALENDPDCRHVIPMNPNTDDLFKAVGDGIVLCKMINLSVPDTIDERAIN--KKKLTPFIIQENLNLALNSASAIGCHVVNIGAEDLRAGKPHLVLGLLWQIIKIGLFADIELSRNEALAALLRDGETLEELMKLSPEELLLRWANFHLENSGW-QKINNFSADIKDSKAYFHLLNQIAP-KGQKEGEPRIDINMSGFNETDDLKRAESMLQQADKLGCRQFVTPADVV------SGNPKLNLAFVANLFNKYPALTKPENQDIDWTLLEGETREERTFRNWMNSLGVNPHVNHLYADLQDALVILQLYERIK-VPVDWSKVNKPPYPKLGANMKKL----ENC----NYAVELGKNPAKFSLVGIGGQDLNDGNPTLTLAVVWQLMRRYTLNVLEDLGE---GQKANDDIIVNWVNRTLSEAGKSTS-IQSFKDKTISSSLAVVDLIDAIQPGCINYDLVKSGNLTEDDKHNNAKYAVSMARRIGARVYALPEDLVEVKPKMVMTVFACLM 623          
BLAST of Plastin 3 vs. UniProt/SwissProt
Match: sp|Q61233|PLSL_MOUSE (Plastin-2 OS=Mus musculus OX=10090 GN=Lcp1 PE=1 SV=4)

HSP 1 Score: 414.846 bits (1065), Expect = 1.191e-135
Identity = 236/538 (43.87%), Postives = 341/538 (63.38%), Query Frame = 2
Query:  311 QQSSINGQDDVQAVRVVSDAEERSYSDWINQALRNEEICQKYLPIDYNK--LYEACSDGVLLCKMINYSVPDTIDMRAVNVGKKLETIFCKNENLSLAVQSASSIGCCVVNIGPIDLGNGVKHIVLGLLWQIIRIGLIGKINLANHAELVALLRDGESLEDLKQLSPEEILIRWVNYHMEKANVSRRISNFNTDIMDSEIYTYLINQIAPSECRSKMMPPNEI----LRSNDNVQRAENVLSNASAMNAKAFVEANDIAMVTQKGKNREKLNMAFVAHLFNNYPALNITEKVIQEFDIVE-ETLEEKTYRNWMNSMGVEPYLNYLYSDLRNGIALLHLIDVIQPKTVNWETVTTKFNP-----MRKLFQMQDNCLAFINYAK-KLNLKLVGLSAENIRETETTLVLGLCFQLLRKYTFQLLQKLQPNNFNKSVEDKDIIEWANKKCQSTGKSESVIRSFKDLNIRSSKPILHLIDSIKPNSVDYSMITNNPLDD------AKYAITVARKIGANVYALPQHVVDLNQKMILTIYACLM 1867
            +QSS+  Q         S+ E+ ++ +WIN+AL N+  C+  +P++ N   L+ A  DG++LCKMIN SVPDTID R +N  KK  T F   ENL+LA+ SAS+IGC VVNIG  DL  G  ++VLGLLWQ+I+IGL   I L+ +  L+ALLR+GESLEDL +LSPEE+L+RW NYH+E A  + +I+NF+TDI DS+ Y +L+ Q+AP +   + +P   I    LR  D++QRAE +L  A  +  + FV A D+       +   KLN+AF+A+LFN YPAL+  E    ++  +E ET EE+T+RNWMNS+GV P +N+LYSDL + + +  L + I+   V+W  V     P     M+KL    +NC   ++  K +    LVG++ +++ E   TL L L +QL+R+YT  +L+ +      + V D  I+ W N   +   KS S I SFKD  I +S P+L LID+I+P S++Y ++    LDD      AKYAI++ARKIGA VYALP+ +V++N KM++T++ACLM
Sbjct:  108 EQSSVGTQ------HSYSEEEKYAFVNWINKALENDPDCRHVIPMNPNTDDLFNAVGDGIVLCKMINLSVPDTIDERTIN--KKKLTPFTIQENLNLALNSASAIGCHVVNIGAEDLKEGKPYLVLGLLWQVIKIGLFADIELSRNEALIALLREGESLEDLMKLSPEELLLRWANYHLENAGCT-KITNFSTDIKDSKAYYHLLEQVAP-KGDEEGIPAVVIDMSGLREKDDIQRAECMLQQAERLGCRQFVTATDVV------RGNPKLNLAFIANLFNKYPALHKPENQDIDWGALEGETREERTFRNWMNSLGVNPRVNHLYSDLSDALVIFQLYEKIK-VPVDWNRVNKPPYPKLGGNMKKL----ENCNYAVDLGKNQAKFSLVGIAGQDLNEGNRTLTLALVWQLMRRYTLNILEDI---GGGQKVNDDIIVNWVNTTLKEAQKSSS-IASFKDPKISTSLPVLDLIDAIQPGSINYDLLKTENLDDEEKLNNAKYAISMARKIGARVYALPEDLVEVNPKMVMTVFACLM 620          
BLAST of Plastin 3 vs. UniProt/SwissProt
Match: sp|Q6P698|PLSL_DANRE (Plastin-2 OS=Danio rerio OX=7955 GN=lcp1 PE=2 SV=1)

HSP 1 Score: 409.453 bits (1051), Expect = 1.106e-133
Identity = 230/530 (43.40%), Postives = 336/530 (63.40%), Query Frame = 2
Query:  362 SDAEERSYSDWINQALRNEEICQKYLPID--YNKLYEACSDGVLLCKMINYSVPDTIDMRAVNVGKKLETIFCKNENLSLAVQSASSIGCCVVNIGPIDLGNGVKHIVLGLLWQIIRIGLIGKINLANHAELVALLRDGESLEDLKQLSPEEILIRWVNYHMEKANVSRRISNFNTDIMDSEIYTYLINQIAPSECRSKMMP-PNEI--LRSNDNVQRAENVLSNASAMNAKAFVEANDIAMVTQKGKNREKLNMAFVAHLFNNYPALNITEKVIQEFDIVE-ETLEEKTYRNWMNSMGVEPYLNYLYSDLRNGIALLHLIDVIQPKTVNWETVTTKFNP-----MRKLFQMQDNCLAFINYAKKLNLK-----LVGLSAENIRETETTLVLGLCFQLLRKYTFQLLQKLQPNNFNKSVEDKDIIEWANKKCQSTGKSESVIRSFKDLNIRSSKPILHLIDSIKPNSVDYSMITNNPLDD------AKYAITVARKIGANVYALPQHVVDLNQKMILTIYACLMLVDLQK 1885
            S+ E+ ++ +W+N+AL  +  CQ  LP+D   + L+ A  DG++LCKMIN SVPDTID R +N  KK  T F   ENL+LA+ SAS+IGC VVNIG  DL  G +H+VLGLLWQ+I+IGL   I ++ +  L+ALLRDGESLEDL +LSPEE+L+RW NYH+E+A    +I+NF++DI DS+ Y  ++NQ+AP      +   P +I  +R  D+++RAE +L  A  +  + FV A D+       +   KLN+A+VA+LFN YPAL   E    ++  +E ET EE+T+RNWMNS+GV P +N+LY DL + + +  L + I+   V+W+ V     P     M+KL    +NC    NYA +L  K     LVG++ +++ E   TL L L +QL+R+YT  +L+ L      + + D+ I++W N+     GK    I  FKD +I SS P+L LID+I+P S+ Y ++    L D      AKYAI++ARKIGA VYALP+ +V++  KM++T++ACLM   +++
Sbjct:  117 SEEEKVAFVNWVNKALEKDPDCQHVLPMDPSTDDLFTAVGDGIVLCKMINLSVPDTIDERTIN--KKKLTPFTIQENLNLALNSASAIGCHVVNIGAEDLKEGRQHLVLGLLWQVIKIGLFADIEISRNEALIALLRDGESLEDLVKLSPEELLLRWANYHLEEAGCP-KINNFSSDIKDSKAYYNILNQVAPKRDEEGIPAIPIDISGIREKDDLKRAECMLEQADRLGCRQFVTATDVV------RGNPKLNLAYVANLFNKYPALKKPENQDIDWSSIEGETREERTFRNWMNSLGVNPRVNHLYVDLADALVIFQLYEKIK-VPVDWDKVNKPPYPKLGSNMKKL----ENC----NYAVELGKKEAKFSLVGIAGQDLNEGNRTLTLALLWQLMRRYTLNILEDL---GDGQKIIDETIVQWVNETLTQAGK--GTISGFKDGSISSSMPVLDLIDAIQPGSIRYDLLKAEDLTDEKKLNNAKYAISMARKIGARVYALPEDLVEVKPKMVMTVFACLMARGMRR 623          
BLAST of Plastin 3 vs. UniProt/SwissProt
Match: sp|Q3V0K9|PLSI_MOUSE (Plastin-1 OS=Mus musculus OX=10090 GN=Pls1 PE=1 SV=1)

HSP 1 Score: 402.519 bits (1033), Expect = 8.306e-131
Identity = 233/525 (44.38%), Postives = 330/525 (62.86%), Query Frame = 2
Query:  362 SDAEERSYSDWINQALRNEEICQKYLPIDYN--KLYEACSDGVLLCKMINYSVPDTIDMRAVNVGKKLETIFCKNENLSLAVQSASSIGCCVVNIGPIDLGNGVKHIVLGLLWQIIRIGLIGKINLANHAELVALLRDGESLEDLKQLSPEEILIRWVNYHMEKANVSRRISNFNTDIMDSEIYTYLINQIAPSECRSKMMPPNEI----LRSNDNVQRAENVLSNASAMNAKAFVEANDIAMVTQKGKNREKLNMAFVAHLFNNYPALNITEKVIQEFDIVE-ETLEEKTYRNWMNSMGVEPYLNYLYSDLRNGIALLHLIDVIQPKTVNWETVTTKFNP-----MRKLFQMQDNCLAFINYAKKLN-----LKLVGLSAENIRETETTLVLGLCFQLLRKYTFQLLQKLQPNNFNKSVEDKDIIEWANKKCQSTGKSESVIRSFKDLNIRSSKPILHLIDSIKPNSVDYSMITNNPLDD------AKYAITVARKIGANVYALPQHVVDLNQKMILTIYACLM 1867
            S+ E+ ++ +WIN+AL N+  C   LP++ N   L+++ +DG+LLCKMIN S PDTID RA+N  KK  T F  +ENL+LA+ SAS+IGC VVNIG  DL  G  H+VLGLLWQII++GL   I ++ +  L+ALL+DGE LE+L +LSPEE+L+RWVNYH+  A   R I+NF+ DI DS+ Y +L+NQIAP   R    P   I        ++++RA  +L  A  +  + FV   D+           KLN+AFVA+LFN YP L+  +    + +++E E+ EE+T+RNWMNS+GV PY+N+LYSDL + + +  L ++I+   VNW  V     P     M+K+    +NC    NYA +L        LVG++ +++ E   TL L L +QL+R+YT ++L  L      + V D  II+W N+  +S  KS S I SFKD +I +S P+L LID+I PN+V   MI    L D      AKYAI+VARKIGA +YALP  +V++  KM++T++ACLM
Sbjct:  121 SEEEKVAFVNWINKALENDADCSHLLPMNPNDGSLFKSLADGILLCKMINLSEPDTIDERAIN--KKKLTPFTVSENLNLALNSASAIGCTVVNIGAQDLKEGKPHLVLGLLWQIIKVGLFADIEISRNEALIALLKDGEDLEELMKLSPEELLLRWVNYHLTNAGW-RTINNFSQDIKDSKAYFHLLNQIAPKGDRDD-GPAVAIDLSGFNEKNDLKRAGFMLQEADKLGCRQFVTPADVV------SGNPKLNLAFVANLFNTYPCLHKPDNNDIDLNLLEGESKEERTFRNWMNSLGVNPYINHLYSDLADALVIFQLYEMIR-VPVNWSQVNKPPYPALGGNMKKI----ENC----NYAVELGKNEAKFSLVGIAGQDLNEGNATLTLALVWQLMRRYTLKVLSDLGE---GEKVTDDIIIKWVNQTLKSANKSTS-ISSFKDKSISTSLPVLDLIDAIAPNAVRQEMIKREHLTDEDKLNNAKYAISVARKIGARIYALPDDLVEVKPKMVMTVFACLM 622          
BLAST of Plastin 3 vs. UniProt/SwissProt
Match: sp|A7E3Q8|PLST_BOVIN (Plastin-3 OS=Bos taurus OX=9913 GN=PLS3 PE=2 SV=1)

HSP 1 Score: 400.593 bits (1028), Expect = 3.575e-130
Identity = 228/525 (43.43%), Postives = 336/525 (64.00%), Query Frame = 2
Query:  362 SDAEERSYSDWINQALRNEEICQKYLPIDYN--KLYEACSDGVLLCKMINYSVPDTIDMRAVNVGKKLETIFCKNENLSLAVQSASSIGCCVVNIGPIDLGNGVKHIVLGLLWQIIRIGLIGKINLANHAELVALLRDGESLEDLKQLSPEEILIRWVNYHMEKANVSRRISNFNTDIMDSEIYTYLINQIAPSECRSKMMPPNEI----LRSNDNVQRAENVLSNASAMNAKAFVEANDIAMVTQKGKNREKLNMAFVAHLFNNYPALNITEKVIQEFDIVE-ETLEEKTYRNWMNSMGVEPYLNYLYSDLRNGIALLHLIDVIQPKTVNWETVTTKFNP-----MRKLFQMQDNCLAFINYAKKLN-----LKLVGLSAENIRETETTLVLGLCFQLLRKYTFQLLQKLQPNNFNKSVEDKDIIEWANKKCQSTGKSESVIRSFKDLNIRSSKPILHLIDSIKPNSVDYSMITNNPL--DD----AKYAITVARKIGANVYALPQHVVDLNQKMILTIYACLM 1867
            S+ E+ ++ +WIN+AL N+  C+  +P++ N   L++A  DG++LCKMIN SVPDTID RA+N  KK  T F   ENL+LA+ SAS+IGC VVNIG  DL  G  H+VLGLLWQII+IGL   I L+ +  L ALLRDGE+LE+L +LSPEE+L+RW N+H+E +   ++I+NF+ DI DS+ Y +L+NQIAP + + +  P  +I        D+++RAE++L  A  +  + FV   D+           KLN+AFVA+LFN YPAL   E    ++ ++E ET EE+T+RNWMNS+GV P++N+LY+DL++ + +L L + I+   V+W  V     P     M+KL    +NC    NYA +L        LVG+  +++ +   TL L L +QL+R+YT  +L+ L      +   D  I+ W N+     GKS S I+SFKD  I SS  ++ LID+I+P  ++Y ++ +  L  DD    AKYA+++AR+IGA VYALP+ +V++  KM++T++ACLM
Sbjct:  122 SEEEKYAFVNWINKALENDPDCRHVIPMNPNTDDLFKAVGDGIVLCKMINLSVPDTIDERAIN--KKKLTPFIIQENLNLALNSASAIGCHVVNIGAEDLRAGKPHLVLGLLWQIIKIGLFADIELSRNEALAALLRDGETLEELMKLSPEELLLRWANFHLENSGW-QKINNFSADIKDSKAYFHLLNQIAP-KGQKEGEPRIDINMSGFNETDDLKRAESMLQQADKLGCRQFVTPADVV------SGNPKLNLAFVANLFNKYPALTKPENQDIDWTLLEGETREERTFRNWMNSLGVNPHVNHLYADLQDALVILQLYERIK-VPVDWSKVNKPPYPKLGANMKKL----ENC----NYAVELGKHPAKFSLVGIGGQDLNDGNQTLTLALVWQLMRRYTLNVLEDLGD---GQKANDDIIVSWVNRTLNEAGKSTS-IQSFKDKTISSSLAVVDLIDAIQPGCINYDLVKSGTLTEDDKHNNAKYAVSMARRIGARVYALPEDLVEVKPKMVMTVFACLM 623          
BLAST of Plastin 3 vs. UniProt/SwissProt
Match: sp|P13797|PLST_HUMAN (Plastin-3 OS=Homo sapiens OX=9606 GN=PLS3 PE=1 SV=4)

HSP 1 Score: 399.823 bits (1026), Expect = 8.711e-130
Identity = 228/525 (43.43%), Postives = 336/525 (64.00%), Query Frame = 2
Query:  362 SDAEERSYSDWINQALRNEEICQKYLPIDYN--KLYEACSDGVLLCKMINYSVPDTIDMRAVNVGKKLETIFCKNENLSLAVQSASSIGCCVVNIGPIDLGNGVKHIVLGLLWQIIRIGLIGKINLANHAELVALLRDGESLEDLKQLSPEEILIRWVNYHMEKANVSRRISNFNTDIMDSEIYTYLINQIAPSECRSKMMPPNEI----LRSNDNVQRAENVLSNASAMNAKAFVEANDIAMVTQKGKNREKLNMAFVAHLFNNYPALNITEKVIQEFDIVE-ETLEEKTYRNWMNSMGVEPYLNYLYSDLRNGIALLHLIDVIQPKTVNWETVTTKFNP-----MRKLFQMQDNCLAFINYAKKLN-----LKLVGLSAENIRETETTLVLGLCFQLLRKYTFQLLQKLQPNNFNKSVEDKDIIEWANKKCQSTGKSESVIRSFKDLNIRSSKPILHLIDSIKPNSVDYSMITNNPL--DD----AKYAITVARKIGANVYALPQHVVDLNQKMILTIYACLM 1867
            S+ E+ ++ +WIN+AL N+  C+  +P++ N   L++A  DG++LCKMIN SVPDTID RA+N  KK  T F   ENL+LA+ SAS+IGC VVNIG  DL  G  H+VLGLLWQII+IGL   I L+ +  L ALLRDGE+LE+L +LSPEE+L+RW N+H+E +   ++I+NF+ DI DS+ Y +L+NQIAP + + +  P  +I        D+++RAE++L  A  +  + FV   D+           KLN+AFVA+LFN YPAL   E    ++ ++E ET EE+T+RNWMNS+GV P++N+LY+DL++ + +L L + I+   V+W  V     P     M+KL    +NC    NYA +L        LVG+  +++ +   TL L L +QL+R+YT  +L+ L      +   D  I+ W N+     GKS S I+SFKD  I SS  ++ LID+I+P  ++Y ++ +  L  DD    AKYA+++AR+IGA VYALP+ +V++  KM++T++ACLM
Sbjct:  122 SEEEKYAFVNWINKALENDPDCRHVIPMNPNTDDLFKAVGDGIVLCKMINLSVPDTIDERAIN--KKKLTPFIIQENLNLALNSASAIGCHVVNIGAEDLRAGKPHLVLGLLWQIIKIGLFADIELSRNEALAALLRDGETLEELMKLSPEELLLRWANFHLENSGW-QKINNFSADIKDSKAYFHLLNQIAP-KGQKEGEPRIDINMSGFNETDDLKRAESMLQQADKLGCRQFVTPADVV------SGNPKLNLAFVANLFNKYPALTKPENQDIDWTLLEGETREERTFRNWMNSLGVNPHVNHLYADLQDALVILQLYERIK-VPVDWSKVNKPPYPKLGANMKKL----ENC----NYAVELGKHPAKFSLVGIGGQDLNDGNQTLTLALVWQLMRRYTLNVLEDLGD---GQKANDDIIVNWVNRTLSEAGKSTS-IQSFKDKTISSSLAVVDLIDAIQPGCINYDLVKSGNLTEDDKHNNAKYAVSMARRIGARVYALPEDLVEVKPKMVMTVFACLM 623          
BLAST of Plastin 3 vs. TrEMBL
Match: A0A1I8JCX6 (Uncharacterized protein OS=Macrostomum lignano OX=282301 PE=4 SV=1)

HSP 1 Score: 524.242 bits (1349), Expect = 3.310e-176
Identity = 261/535 (48.79%), Postives = 363/535 (67.85%), Query Frame = 2
Query:  299 VIYFQQSSINGQDDVQAVRVVSDAEERSYSDWINQALRNEEICQKYLPIDYN--KLYEACSDGVLLCKMINYSVPDTIDMRAVNVGKKLE---TIFCKNENLSLAVQSASSIGCCVVNIGPIDLGNGVKHIVLGLLWQIIRIGLIGKINLANHAELVALLRDGESLEDLKQLSPEEILIRWVNYHMEKANVSRRISNFNTDIMDSEIYTYLINQIAPSECRSKMMPPNEILRSNDNVQRAENVLSNASAMNAKAFVEANDIAMVTQKGKNREKLNMAFVAHLFNNYPALNITEKVIQEFDIVEETLEEKTYRNWMNSMGVEPYLNYLYSDLRNGIALLHLIDVIQPKTVNWETVTTKFNPMRKLFQMQDNCLAFINYAKKLNLKLVGLSAENIRETETTLVLGLCFQLLRKYTFQLLQKLQPNNFNKSVEDKDIIEWANKKCQSTGKSESVIRSFKDLNIRSSKPILHLIDSIKPNSVDYSMITN--NPLDDAKYAITVARKIGANVYALPQHVVDLNQKMILTIYACLMLVDLQ 1882
             +Y Q+  I+G  +   +  + D+E R Y+ WIN+ L  +      LP+D N  +LYE   DG++LCK+IN +VPDTI  +A+N   +L+     F  +ENL LAV SA SIGCC+VNIG  D+     HI+LGL+WQIIRIGL+  I L+ H EL ALL  GE+LEDLKQLSPEE+L+RWVNY + KA   +R+ NF  DIMDSE Y +L++QIAP++ RS+M  P E+L S D ++RA+ VLSNA  ++A  FV + DIA   + G+NREKLNMAFVA+LFNNYPA+   + V  E +++EETLEEKT+RNWMNS+GV P++  LYSDLRNG+ LL L+D I+P  V W  V   F P +KLFQ Q NC   I   +K+ L +  + AE+IR+ +  L LGL FQ++R YT  LL +L      + ++D +II+WAN+K ++ GK+  V +SFKD ++     IL L D+IKP +VD S+     + LD A++ ++ +R IG  +YALP+HVV +N+ MI+T++ACLM++D Q
Sbjct:   69 TLYCQK--ISGTGNEWTLHTIGDSERRGYAGWINKMLEKDPDLSHLLPVDGNTDELYEKLGDGLVLCKLINSAVPDTIHEKAMNKLAQLKGGSAGFRMHENLVLAVNSAESIGCCIVNIGANDIKECRPHIILGLIWQIIRIGLMKDITLSQHKELAALLLPGETLEDLKQLSPEELLLRWVNYQLAKAGTDKRVHNFKDDIMDSEAYAHLLSQIAPADKRSEMRSPQEVLASADRLKRADGVLSNADKLDAAVFVVSEDIAFANEPGRNREKLNMAFVANLFNNYPAMEAVQDV--EVEVIEETLEEKTFRNWMNSLGVSPFVKDLYSDLRNGLILLTLMDHIKPGVVPWSKVCKTFVPNKKLFQWQANCNYVIECGRKIGLPMTNIGAEDIRDGDRKLTLGLVFQMMRAYTLSLLMQL--TGGTRKIDDDEIIQWANQKLEAAGKAARV-KSFKDPSLADGMVILELADAIKPKTVDTSIAAGMKDQLDRARFILSKSRMIGGRIYALPEHVVQVNKNMIMTVFACLMILDFQ 596          
BLAST of Plastin 3 vs. TrEMBL
Match: A0A1I8JAL8 (Uncharacterized protein OS=Macrostomum lignano OX=282301 GN=BOX15_Mlig000734g5 PE=4 SV=1)

HSP 1 Score: 524.242 bits (1349), Expect = 9.458e-176
Identity = 259/527 (49.15%), Postives = 359/527 (68.12%), Query Frame = 2
Query:  323 INGQDDVQAVRVVSDAEERSYSDWINQALRNEEICQKYLPIDYN--KLYEACSDGVLLCKMINYSVPDTIDMRAVNVGKKLE---TIFCKNENLSLAVQSASSIGCCVVNIGPIDLGNGVKHIVLGLLWQIIRIGLIGKINLANHAELVALLRDGESLEDLKQLSPEEILIRWVNYHMEKANVSRRISNFNTDIMDSEIYTYLINQIAPSECRSKMMPPNEILRSNDNVQRAENVLSNASAMNAKAFVEANDIAMVTQKGKNREKLNMAFVAHLFNNYPALNITEKVIQEFDIVEETLEEKTYRNWMNSMGVEPYLNYLYSDLRNGIALLHLIDVIQPKTVNWETVTTKFNPMRKLFQMQDNCLAFINYAKKLNLKLVGLSAENIRETETTLVLGLCFQLLRKYTFQLLQKLQPNNFNKSVEDKDIIEWANKKCQSTGKSESVIRSFKDLNIRSSKPILHLIDSIKPNSVDYSMITN--NPLDDAKYAITVARKIGANVYALPQHVVDLNQKMILTIYACLMLVDLQ 1882
            I+G  +   +  + D+E R Y+ WIN+ L  +      LP+D N  +LYE   DG++LCK+IN +VPDTI  +A+N   +L+     F  +ENL LAV SA SIGCC+VNIG  D+     HI+LGL+WQIIRIGL+  I L+ H EL ALL  GE+LEDLKQLSPEE+L+RWVNY + KA   +R+ NF  DIMDSE Y +L++QIAP++ RS+M  P E+L S D ++RA+ VLSNA  ++A  FV + DIA   + G+NREKLNMAFVA+LFNNYPA+   + V  E +++EETLEEKT+RNWMNS+GV P++  LYSDLRNG+ LL L+D I+P  V W  V   F P +KLFQ Q NC   I   +K+ L +  + AE+IR+ +  L LGL FQ++R YT  LL +L      + ++D +II+WAN+K ++ GK+  V +SFKD ++     IL L D+IKP +VD S+     + LD A++ ++ +R IG  +YALP+HVV +N+ MI+T++ACLM++D Q
Sbjct:  110 ISGTGNEWTLHTIGDSERRGYAGWINKMLEKDPDLSHLLPVDGNTDELYEKLGDGLVLCKLINSAVPDTIHEKAMNKLAQLKGGSAGFRMHENLVLAVNSAESIGCCIVNIGANDIKECRPHIILGLIWQIIRIGLMKDITLSQHKELAALLLPGETLEDLKQLSPEELLLRWVNYQLAKAGTDKRVHNFKDDIMDSEAYAHLLSQIAPADKRSEMRSPQEVLASADRLKRADGVLSNADKLDAAVFVVSEDIAFANEPGRNREKLNMAFVANLFNNYPAMEAVQDV--EVEVIEETLEEKTFRNWMNSLGVSPFVKDLYSDLRNGLILLTLMDHIKPGVVPWSKVCKTFVPNKKLFQWQANCNYVIECGRKIGLPMTNIGAEDIRDGDRKLTLGLVFQMMRAYTLSLLMQL--TGGTRKIDDDEIIQWANQKLEAAGKAARV-KSFKDPSLADGMVILELADAIKPKTVDTSIAAGMKDQLDRARFILSKSRMIGGRIYALPEHVVQVNKNMIMTVFACLMILDFQ 631          
BLAST of Plastin 3 vs. TrEMBL
Match: A0A1I8GSA3 (Uncharacterized protein OS=Macrostomum lignano OX=282301 GN=BOX15_Mlig000734g1 PE=4 SV=1)

HSP 1 Score: 520.776 bits (1340), Expect = 2.416e-174
Identity = 258/527 (48.96%), Postives = 357/527 (67.74%), Query Frame = 2
Query:  323 INGQDDVQAVRVVSDAEERSYSDWINQALRNEEICQKYLPIDYN--KLYEACSDGVLLCKMINYSVPDTIDMRAVNVGKKLE---TIFCKNENLSLAVQSASSIGCCVVNIGPIDLGNGVKHIVLGLLWQIIRIGLIGKINLANHAELVALLRDGESLEDLKQLSPEEILIRWVNYHMEKANVSRRISNFNTDIMDSEIYTYLINQIAPSECRSKMMPPNEILRSNDNVQRAENVLSNASAMNAKAFVEANDIAMVTQKGKNREKLNMAFVAHLFNNYPALNITEKVIQEFDIVEETLEEKTYRNWMNSMGVEPYLNYLYSDLRNGIALLHLIDVIQPKTVNWETVTTKFNPMRKLFQMQDNCLAFINYAKKLNLKLVGLSAENIRETETTLVLGLCFQLLRKYTFQLLQKLQPNNFNKSVEDKDIIEWANKKCQSTGKSESVIRSFKDLNIRSSKPILHLIDSIKPNSVDYSMITN--NPLDDAKYAITVARKIGANVYALPQHVVDLNQKMILTIYACLMLVDLQ 1882
            I+G  +   +  + D+E R Y+ WIN+ L  +      LP+D N  +LYE   DG++LCK+IN +VP TI  +A+N   +L+     F  +ENL LAV SA SIGCC+VNIG  D+     HI+LGL+WQIIRIGL+  I L+ H EL ALL  GE+LEDLKQLSPEE+L+RWVNY + KA   +R+ NF  DIMDSE Y +L++QIAP + RS+M  P E+L S D ++RA+ VLSNA  ++A  FV + DIA   + G+NREKLNMAFVA+LFNNYPA+   + V  E +++EETLEEKT+RNWMNS+GV P++  LYSDLRNG+ LL L+D I+P  V W  V   F P +KLFQ Q NC   I   +K+ L +  + AE+IR+ +  L LGL FQ++R YT  LL +L      + ++D +II+WAN+K ++ GK+  V +SFKD ++     IL L D+IKP +VD S+     + LD A++ ++ +R IG  +YALP+HVV +N+ MI+T++ACLM++D Q
Sbjct:  110 ISGTGNEWTLHTIGDSERRGYAGWINKMLEKDPDLSHLLPVDGNTDELYEKLGDGLVLCKLINSAVPGTIHEKAMNKLAQLKGGSAGFRMHENLVLAVNSAESIGCCIVNIGANDIKECRPHIILGLIWQIIRIGLMKDITLSQHKELAALLLPGETLEDLKQLSPEELLLRWVNYQLAKAGTDKRVHNFKDDIMDSEAYAHLLSQIAPVDKRSEMRSPQEVLASADRLKRADGVLSNADKLDAAVFVVSEDIAFANEPGRNREKLNMAFVANLFNNYPAMEAVQDV--EVEVIEETLEEKTFRNWMNSLGVSPFVKDLYSDLRNGLILLTLMDHIKPGVVPWSKVCKTFVPNKKLFQWQANCNYVIECGRKIGLPMTNIGAEDIRDGDRKLTLGLVFQMMRAYTLSLLMQL--TGGTRKIDDDEIIQWANQKLEAAGKAARV-KSFKDPSLADGMVILELADAIKPKTVDTSIAAGMKDQLDRARFILSKSRMIGGRIYALPEHVVQVNKNMIMTVFACLMILDFQ 631          
BLAST of Plastin 3 vs. TrEMBL
Match: A0A068WCX7 (Plastin 3 OS=Echinococcus granulosus OX=6210 GN=EgrG_000786700 PE=4 SV=1)

HSP 1 Score: 511.916 bits (1317), Expect = 3.016e-171
Identity = 258/526 (49.05%), Postives = 361/526 (68.63%), Query Frame = 2
Query:  314 QSSINGQDDVQAVRVVSDAEERSYSDWINQALRNEEICQKYLPIDY---NKLYEACSDGVLLCKMINYSVPDTIDMRAVNVGKKLETIFCKNENLSLAVQSASSIGCCVVNIGPIDLGNGVKHIVLGLLWQIIRIGLIGKINLANHAELVALLRDGESLEDLKQLSPEEILIRWVNYHMEKANVSRRISNFNTDIMDSEIYTYLINQIAPSECRSKMMPPNEILRSNDNVQRAENVLSNASAMNAKAFVEANDIAMVTQKGKNREKLNMAFVAHLFNNYPALNITEKVIQEFDIVEETLEEKTYRNWMNSMGVEPYLNYLYSDLRNGIALLHLIDVIQPKTVNWETVTTKFNPMRKLFQMQDNCLAFINYAKKLNLKLVGLSAENIRETETTLVLGLCFQLLRKYTFQLLQKLQPNNFNKSVEDKDIIEWANKKCQSTGKSESVIRSFKDLNIRSSKPILHLIDSIKPNSVDYSMITNNPLDDAKYAITVARKIGANVYALPQHVVDLNQKMILTIYACLMLVDLQ 1882
            ++ +       A   VS AEER++ DWIN+ L  +   + +LPIDY    +LYE C DG+LLCK+IN +VPDTID R +N       IF  NENL+LAV SA SIGCCVVN+GP D+    +H+VLGL+WQIIRIGL+G I++ +H+EL+ LL  GE++++L+ LSPEE+L+RWVN+H+E A  + R++NF  D++DSEIY  L+ QIAP + +S ++P   I+  ++   RAE VL NA  +NA AF+  +DI    ++G  R+KL++AFVA+LFN YP L     V      V ETLEEKTYRNWMNSMGV P++  L SDLR+G+  L L+DV++P TV W  +   F+P R++FQMQDNC   + YA  LN+ +V LS E+IR  E  L LGL FQL+R YT ++L +L    F    E KDI+EWAN+K  S G    ++ SF+D  I +  P+++LI++IKP+S+D SM+  + L + + AI+ ARKIGA VYALP+H+ D+N KM++T++ACLM +D+Q
Sbjct:   92 ETEVQENSTATAKHSVSPAEERAFIDWINRLLGPDPDLKHHLPIDYTVDGQLYERCRDGLLLCKLINAAVPDTIDERCINKTPTKPNIFKINENLTLAVNSAESIGCCVVNVGPEDIEQCARHLVLGLIWQIIRIGLLGMISIQHHSELIDLLEPGETVDNLRFLSPEELLLRWVNFHLEMAGNTHRMTNFTYDVIDSEIYATLLQQIAPEDKQSFLIPVTGIMAESNMYCRAEMVLENAEFLNAAAFISPDDIVNAAERGMARDKLHLAFVANLFNLYPGLKSKPSV-----DVPETLEEKTYRNWMNSMGVAPFVRDLSSDLRSGLIFLQLLDVLEPGTVAWNKIVRVFDPKRQIFQMQDNCAYVVEYANLLNVNVVNLSGEDIRNAERKLTLGLTFQLMRAYTMKMLSELH-QCFGHLCE-KDILEWANEKLVSVGA--PMLASFRDSTISNGVPVMNLINAIKPHSIDKSMVLKDKLANCRIAISTARKIGARVYALPEHLRDVNPKMVMTVFACLMALDIQ 608          
BLAST of Plastin 3 vs. TrEMBL
Match: A0A068YAJ7 (Plastin 3 OS=Echinococcus multilocularis OX=6211 GN=EmuJ_000786700 PE=4 SV=1)

HSP 1 Score: 511.916 bits (1317), Expect = 3.828e-171
Identity = 258/526 (49.05%), Postives = 361/526 (68.63%), Query Frame = 2
Query:  314 QSSINGQDDVQAVRVVSDAEERSYSDWINQALRNEEICQKYLPIDY---NKLYEACSDGVLLCKMINYSVPDTIDMRAVNVGKKLETIFCKNENLSLAVQSASSIGCCVVNIGPIDLGNGVKHIVLGLLWQIIRIGLIGKINLANHAELVALLRDGESLEDLKQLSPEEILIRWVNYHMEKANVSRRISNFNTDIMDSEIYTYLINQIAPSECRSKMMPPNEILRSNDNVQRAENVLSNASAMNAKAFVEANDIAMVTQKGKNREKLNMAFVAHLFNNYPALNITEKVIQEFDIVEETLEEKTYRNWMNSMGVEPYLNYLYSDLRNGIALLHLIDVIQPKTVNWETVTTKFNPMRKLFQMQDNCLAFINYAKKLNLKLVGLSAENIRETETTLVLGLCFQLLRKYTFQLLQKLQPNNFNKSVEDKDIIEWANKKCQSTGKSESVIRSFKDLNIRSSKPILHLIDSIKPNSVDYSMITNNPLDDAKYAITVARKIGANVYALPQHVVDLNQKMILTIYACLMLVDLQ 1882
            ++ +       A   VS AEER++ DWIN+ L  +   + +LPIDY    +LYE C DG+LLCK+IN +VPDTID R +N       IF  NENL+LAV SA SIGCCVVN+GP D+    +H+VLGL+WQIIRIGL+G I++ +H+EL+ LL  GE++++L+ LSPEE+L+RWVN+H+E A  + R++NF  D++DSEIY  L+ QIAP + +S ++P   I+  ++   RAE VL NA  +NA AF+  +DI    ++G  R+KL++AFVA+LFN YP L     V      V ETLEEKTYRNWMNSMGV P++  L SDLR+G+  L L+DV++P TV W  +   F+P R++FQMQDNC   + YA  LN+ +V LS E+IR  E  L LGL FQL+R YT ++L +L    F    E KDI+EWAN+K  S G    ++ SF+D  I +  P+++LI++IKP+S+D SM+  + L + + AI+ ARKIGA VYALP+H+ D+N KM++T++ACLM +D+Q
Sbjct:   92 ETEVQENSTATAKHSVSPAEERAFIDWINRLLGPDPDLKHHLPIDYTVDGQLYERCRDGLLLCKLINAAVPDTIDERCINKTPTKPNIFKINENLTLAVNSAESIGCCVVNVGPEDIEQCARHLVLGLIWQIIRIGLLGMISIQHHSELIDLLEPGETVDNLRFLSPEELLLRWVNFHLEMAGNTHRMTNFTYDVIDSEIYATLLQQIAPEDKQSFLIPVTGIMAESNMYCRAEMVLENAEFLNAAAFISPDDIVNAAERGMARDKLHLAFVANLFNLYPGLKSKPSV-----DVPETLEEKTYRNWMNSMGVAPFVRDLSSDLRSGLIFLQLLDVLEPGTVAWNKIVRVFDPKRQIFQMQDNCAYVVEYANLLNVNVVNLSGEDIRNAERKLTLGLTFQLMRAYTMKMLSELH-QCFGHLCE-KDILEWANEKLVSVGA--PMLASFRDSTISNGVPVMNLINAIKPHSIDKSMVLRDKLANCRIAISTARKIGARVYALPEHLRDVNPKMVMTVFACLMALDIQ 608          
BLAST of Plastin 3 vs. Ensembl Cavefish
Match: lcp1 (lymphocyte cytosolic protein 1 (L-plastin) [Source:NCBI gene;Acc:30583])

HSP 1 Score: 410.223 bits (1053), Expect = 6.009e-135
Identity = 232/527 (44.02%), Postives = 333/527 (63.19%), Query Frame = 2
Query:  362 SDAEERSYSDWINQALRNEEICQKYLPID--YNKLYEACSDGVLLCKMINYSVPDTIDMRAVNVGKKLETIFCKNENLSLAVQSASSIGCCVVNIGPIDLGNGVKHIVLGLLWQIIRIGLIGKINLANHAELVALLRDGESLEDLKQLSPEEILIRWVNYHMEKANVSRRISNFNTDIMDSEIYTYLINQIAPSECRSKMMPPNEI----LRSNDNVQRAENVLSNASAMNAKAFVEANDIAMVTQKGKNREKLNMAFVAHLFNNYPALNITEKVIQEFDIVE-ETLEEKTYRNWMNSMGVEPYLNYLYSDLRNGIALLHLIDVIQPKTVNWETVTTKFNP-----MRKLFQMQDNCLAFINYAKK-LNLKLVGLSAENIRETETTLVLGLCFQLLRKYTFQLLQKLQPNNFNKSVEDKDIIEWANKKCQSTGKSESVIRSFKDLNIRSSKPILHLIDSIKPNSVDYSMITNNPLDD------AKYAITVARKIGANVYALPQHVVDLNQKMILTIYACLMLVDLQK 1885
            S+ E+ ++ +WIN+AL  +  C+  LP+D   N L+ A  DG++LCKMIN SVPDTID R +N  KK  T F   ENL+LA+ S+S+IGC VVNIG  DL  G +H+VLGLLWQII+IGL+  I ++ +  L+ALLRDGESLEDL +LSPEE+L+RW NYH+E+A  S +I+NF++DI DS+ Y  ++NQ+AP +   + +PP  I    LR  ++++RAE +L  A  +  + FV   D+       +   KLN+AFVA+LFN YPAL   E    ++  +E ET EE+T+RNWMNS+GV P +N+LY DL + + +  L + I+   V+W+ V     P     M+KL    +NC   +   KK     LVG++ +++ E   TL L L +QL+R+YT  +L+ L      + V D  I+ W N   +   K    I  FKD +I SS P+L LID+I+P S+ Y +I    L D      AKYAI++ARKIGA VYALP+ +V++  KM++T++ACLM   L++
Sbjct:  115 SEEEKVAFVNWINKALEKDPDCKHVLPMDPSSNDLFTAVGDGIVLCKMINLSVPDTIDERTIN--KKKLTPFTIQENLNLALNSSSAIGCHVVNIGAEDLKEGRQHLVLGLLWQIIKIGLLADIEISRNEALIALLRDGESLEDLMKLSPEELLLRWANYHLEQAGCS-KINNFSSDIKDSKAYYNILNQVAP-KGDDEGIPPIIIDMTGLREKEDLKRAECMLDQADRLGCRQFVMPPDVV------RGNPKLNLAFVANLFNKYPALKKPENQDIDWSSIEGETREERTFRNWMNSLGVNPRVNHLYGDLADALIIFQLYEKIK-VPVDWDKVNKPPYPKLGSNMKKL----ENCNYAVELGKKEAKFSLVGIAGQDLNEGNRTLTLALLWQLMRRYTLNILEDL---GDGQKVNDDTIVGWVNDTLKQADK--KTISGFKDGSISSSMPVLDLIDAIQPGSIRYDLIKAEDLSDEEKLNNAKYAISMARKIGARVYALPEDLVEVKPKMVMTVFACLMARGLKR 621          
BLAST of Plastin 3 vs. Ensembl Cavefish
Match: pls3 (plastin 3 (T isoform) [Source:ZFIN;Acc:ZDB-GENE-040718-10])

HSP 1 Score: 358.221 bits (918), Expect = 1.727e-115
Identity = 217/527 (41.18%), Postives = 316/527 (59.96%), Query Frame = 2
Query:  362 SDAEERSYSDWINQALRNEEICQKYLPIDYN--KLYE-ACSDGVLLCKMINYSVPDTIDMRAVNVGKKLETIFCKNENLSLAVQSASSIGCCVVNIGPIDLGNGVKHIVLGLLWQIIRIGLIGKINLANHAELVALLRDGESLEDLKQLSPEEILIRWVNYHMEKANVSRRISNFNTDIMDSEIYTYLINQIAPSECRS-------KMMPPNEILRSNDNVQRAENVLSNASAMNAKAFVEANDIAMVTQKGKNREKLNMAFVAHLFNNYPALNITEKVIQEFDIVE-ETLEEKTYRNWMNSMGVEPYLNYLYSDLRNGIALLHLIDVIQPKTVNWETVTTKFNPMRKL---FQMQDNCLAFINYAKKLN-----LKLVGLSAENIRETETTLVLGLCFQLLRKYTFQLLQKLQPNNFNKSVEDKDIIEWANKKCQSTGKSESVIRSFKDLNIRSSKPILHLIDSIKPNSVDYSMITNNPLDD------AKYAITVARKIGANVYALPQHVVDLNQKMILTIYACLM 1867
            S+ E+ ++ +WIN AL  +  C+  LP++ N   L++ A  DG++   ++  ++ +T      NV  +L       ENL+LA+ SAS+IGC VVNIG +DL  G  H+VLGLLWQII+IGL   I L+ +  L ALLR+GE+LEDL +LSPEE+L+RW N+H++ A    +I+NF++DI DS+ Y +L+NQIAP   +         M   NE     D+++RAE +L  A  +  + FV   D+           KLN+AFVA+LFN YPAL   E    ++ ++E ET EE+T+RNWMNS+GV P++N+LY DL++ + +L L + I+   V+W     K  P  KL    +  +NC    NYA  L        LVG+  +++ +   TL L L +QL+R+YT  +L+ L      + V D  I+ W NK     GKS + I SFKD  I SS P+L LID+I+P SV Y ++    L D      AKYA+++ARKIGA VYALP  +V++  KM++T++ACLM
Sbjct:   62 SEEEKFAFVNWINTALEKDPDCKHVLPMNPNTDSLFKFAIFDGIVFLDIVLLNICNT------NVNFELNY-----ENLNLALNSASAIGCHVVNIGALDLREGKPHLVLGLLWQIIKIGLFADIELSRNEALAALLREGETLEDLMKLSPEELLLRWANFHLDNAGW-HKINNFSSDIKDSKAYFHLLNQIAPKGLKENEDRIDINMAGFNE----KDDLKRAEAMLVQADRLGCRQFVTPADVV------SGNPKLNLAFVANLFNKYPALTKPENQDIDWGLLEGETREERTFRNWMNSLGVNPHVNHLYGDLQDALVILQLYERIKV-PVDWNNKVNK-PPYPKLGANMKKLENC----NYAVDLGKTTAKFSLVGIGGQDLNDGNPTLTLALVWQLMRRYTLNVLEDLGD---GEKVNDDIIVNWVNKTLAGAGKS-TKISSFKDKEISSSLPVLDLIDAIQPGSVHYDLVKTGSLSDQDKLENAKYAVSMARKIGARVYALPDDLVEVKPKMVMTVFACLM 556          
BLAST of Plastin 3 vs. Ensembl Cavefish
Match: pls1 (plastin 1 (I isoform) [Source:ZFIN;Acc:ZDB-GENE-030131-6205])

HSP 1 Score: 301.982 bits (772), Expect = 2.123e-93
Identity = 193/526 (36.69%), Postives = 296/526 (56.27%), Query Frame = 2
Query:  362 SDAEERSYSDWINQALRNEEICQKYLPIDYNKLYEACSDGVLLC--KMINYSVPDTIDMRAVNVGKKLETIFCKNENLSLAVQSASSIGCCVVNIGPIDLGNGVKHIVLGLLWQIIRIGLIGKINLANHAELVALLRDGESLEDLKQLSPEEILIRWVNYHMEKANVSRRISNFNTDIMDSEIYTYLINQIAP---SECRSKMMPPNEILRSNDNVQRAENVLSNASAMNAKAFVEANDIAMVTQKGKNREKLNMAFVAHLFNNYPALNITEKVIQEFDIVE-ETLEEKTYRNWMNSMGVEPYLNYLYSDLRNGIALLHLIDVIQPKTVNWETVT-TKFNPMRKLFQMQDNCLAFINYAKKLN-----LKLVGLSAENIRETETTLVLGLCFQLLRKYTFQLLQKLQPNNFNKSVEDKDIIEWANKKCQSTGKSESVIRSFKDLNIRSSKPILHLIDSIKPNSVDYSMITN------NPLDDAKYAITVARKIGANVYALPQHVVDLNQKMILTIYACLMLVDLQK 1885
            +D E+ ++ +WIN+AL N+  C+  +P+D       C+    L   KMIN S PDTID R +N  K+  T F   ENL LA+ SAS+IGC VVNI   D+  G  H+VLGLLWQII+IGL   I ++ +        +G+ L  ++ +S       W + H  +     +         DS  Y +L++QI+P    +   ++      L   D+ +RAE +L  A+ ++ + FV   D+           KLNMAFVA+LFN +PAL+       +  ++E E+ E++T+RNWMNS+GV PY+N+LYSDL +G+ +L L + IQ   V+W  V    ++ +    +  +NC    NYA +L        LVG+  ENI E      L L +QL+R+YT ++L  +      + V D+ I++W N   Q  G+ +S I++FKD +I +S P++ LID+I P ++   M+        + L++AKYAI+V+RKIGA VYALP  +V++N KM++T++ACLM   L K
Sbjct:  120 ADEEKVAFVNWINKALANDPDCKHLIPMDPTT-DSLCAQFYTLVELKMINLSQPDTIDERVINTKKR--TTFTMTENLILALNSASAIGCTVVNIDSQDMIAGTPHLVLGLLWQIIKIGLFADIEISRN--------EGQKLTTIQHISQS---CPWGSIHDLQCLFFSQ---------DSRAYFHLLDQISPKGDGDDEMRISIDMSGLNERDDERRAELMLRQAARLDCRQFVTPQDVV------AGNHKLNMAFVANLFNMFPALSRPANNGIDLAMLEGESREDRTFRNWMNSLGVNPYVNHLYSDLMDGLIILQLYERIQV-PVDWRKVNRPPYSILGSNMKKLENC----NYAVELGKREAKFSLVGIGGENINEGSAMHTLALVWQLMRRYTVKVLADI---GHGEKVNDQIIVDWVNSTLQK-GQKDSSIKNFKDKSISTSLPVIDLIDTIAPGAIKSEMVKRGDMSPEDKLNNAKYAISVSRKIGAKVYALPDDLVEVNPKMVMTVFACLMGRSLNK 607          
BLAST of Plastin 3 vs. Ensembl Cavefish
Match: flna (filamin A, alpha (actin binding protein 280) [Source:ZFIN;Acc:ZDB-GENE-030131-2145])

HSP 1 Score: 53.1434 bits (126), Expect = 1.050e-6
Identity = 57/234 (24.36%), Postives = 109/234 (46.58%), Query Frame = 2
Query: 1157 TEKVIQEFDIVEETLEEKTYRNWMNS--MGVEPYLNYLYSDLRNGIALLHLIDVIQPKTVNWETVTTKFNPMRKLFQMQ-DNCLAFINYAKKLNLKLVGLSAENIRETETTLVLGLCFQLLRKYTFQLL---QKLQPNNFNKSVEDKDIIEWANKKCQSTGKSESVIRSFKDLNIRSSKPILHLIDSIKPN-SVDY-SMITNNPLDDAKYAITVARK-IGANVYALPQHVVDLN 1831
            TEK + E D   + +++ T+  W N     V   +  L +DL +G+ L+ L++V+  K +       K+N      QMQ +N    + +  + N+KLV + ++ I +    L+LGL + L+  Y+  +    ++   ++  +    + ++ W   K       E  I +F   + +S K +  L+DS  P    D+ S     P+D+A+ A+  A + +G      P+ +VD N
Sbjct:   32 TEKDLAE-DAPWKKIQQNTFTRWCNEHLKCVNKRIANLQTDLSDGLRLIGLLEVLSQKKM-----FRKYNQRPTFRQMQLENVSVALEFLDRENIKLVSIDSKAIVDGNLKLILGLIWTLILHYSISMPMWDEEEDTDDAKQKTPKQRLLGWIQNKL-----PELPITNFSR-DWQSGKALGALVDSCAPGLCPDWDSWDQTKPVDNAREAMQQADEWLGVPQVITPEEIVDPN 253          
BLAST of Plastin 3 vs. Ensembl Cavefish
Match: si:ch211-165e15.1 (si:ch211-165e15.1 [Source:ZFIN;Acc:ZDB-GENE-081028-59])

HSP 1 Score: 50.0618 bits (118), Expect = 3.315e-6
Identity = 31/126 (24.60%), Postives = 65/126 (51.59%), Query Frame = 2
Query: 1148 LNITEKVIQEFDIVEETLEEKTYRNWMNS--MGVEPYLNYLYSDLRNGIALLHLIDVIQPKTVNWETVTTKFNPMRKLFQMQDNCLAFINYAKKLNLKLVGLSAENIRETETTLVLGLCFQLLRKY 1519
            L+  E+ +       + +++KT+  W+N   + V  ++N LY DLR+G  L+ L++V+   T+  E    +F+ ++       N    ++Y K+  +KLV +  ++I +    L LGL + ++  +
Sbjct:   59 LDPAERAVLRIADERDRVQKKTFTKWINQHLLKVRKHVNDLYEDLRDGHNLISLLEVLSGDTLPREKGRMRFHRLQ-------NVQIALDYLKRRQVKLVNIRNDDITDGNPKLTLGLIWTIILHF 177          

HSP 2 Score: 49.2914 bits (116), Expect = 5.311e-6
Identity = 56/219 (25.57%), Postives = 98/219 (44.75%), Query Frame = 2
Query:  344 QAVRVVSDAEER----SYSDWINQALRNEEICQKYLPIDYNKLYEACSDGVLLCKMINYSVPDTIDMRAVNVGKKLETIFCKNENLSLAVQSASSIGCCVVNIGPIDLGNGVKHIVLGLLWQIIRIGLIGKINLANHAELVALLRDGESLEDLKQLSPEEILIRWVNYHMEKANVSRRISNFNTDIMDSEIYTYLINQIAPSEC----RSKMMPPNEIL 976
            +AV  ++D  +R    +++ WINQ L      +K++    N LYE   DG  L  ++     DT+        +K    F + +N+ +A+         +VNI   D+ +G   + LGL+W II    I  I++            GES ED   ++ +E L+ W +  M +  V  R  NF T   D  ++  LI++   ++     R+ + P N ++
Sbjct:   64 RAVLRIADERDRVQKKTFTKWINQHLLK---VRKHV----NDLYEDLRDGHNLISLLEVLSGDTLPR------EKGRMRFHRLQNVQIALDYLKRRQVKLVNIRNDDITDGNPKLTLGLIWTIILHFQISDIHVT-----------GES-ED---MTAKERLLLW-SQQMTEGYVGVRCDNFTTSWRDGRLFNALIHKYRMAQHAVAQRAALSPENVVI 253          
BLAST of Plastin 3 vs. Ensembl Sea Lamprey
Match: lcp1 (lymphocyte cytosolic protein 1 (L-plastin) [Source:NCBI gene;Acc:30583])

HSP 1 Score: 216.083 bits (549), Expect = 9.954e-65
Identity = 132/350 (37.71%), Postives = 198/350 (56.57%), Query Frame = 2
Query:  884 DIMDSEIYTYLINQIAPS---ECRSKMMPPNEILRSNDNVQRAENVLSNASAMNAKAFVEANDIAMVTQKGKNREKLNMAFVAHLFNNYPALNITEKVIQEFDIVE--ETLEEKTYRNWMNSMGVEPYLNYLYSDLRNGIALLHLIDVIQPKTVNWETVTTKFNP-----MRKLFQMQDNCLAFINYAKKLNLKLVGLSAENIRETETTLVLGLCFQLLRKYTFQLLQKLQPNNFNKSVEDKDIIEWANKKCQSTGKSESVIRSFKDLNIRSSKPILHLIDSIKPNSVDYSMITNNPL------DDAKYAITVARKIGANVYALPQHVVDLNQKMILTIYACLMLVDLQK 1885
            D  DS  Y +L+NQIAP    E + ++          D ++RAE +L  A  +  + FV   D+           KLN+AFVA+LFN YPAL+       ++ ++E  E+ EE+T+RNWMNS+GV P++N+LYSDL + + ++ L + I+ + V+W  V     P     M+KL    +NC   +   K     LVG+  +++ +   TL L L +QL+RKYT Q+L+ L      + V D+ I+ W N   +  GKS S I SFK      S P   LID+I+P S+ Y ++   PL      D+AKYAI++ARKIGA VYALP  +V++  KM++T++ACLM   ++K
Sbjct:    1 DPQDSRAYFHLLNQIAPKGDKEGQPRVDIDFSGFNDKDELRRAE-MLVQADKLGCRQFVTPADVV------SGNPKLNLAFVANLFNKYPALHKPANQDIDWGLLEAGESREERTFRNWMNSLGVNPFVNHLYSDLVDALVIIQLFEKIKTR-VDWNKVNKPPYPKLGANMKKL----ENCNYAVELGKTTKFSLVGIGGQDLNDGNPTLTLALVWQLMRKYTIQVLEDL---GEGEKVNDEIIVNWVNHTLRDAGKSSS-IASFKVPPTALSTPCWDLIDAIQPGSIRYDLVKEEPLTDDDRLDNAKYAISMARKIGARVYALPDDLVEVKPKMVMTMFACLMGRGMKK 334          

HSP 2 Score: 63.929 bits (154), Expect = 2.864e-11
Identity = 60/241 (24.90%), Postives = 105/241 (43.57%), Query Frame = 2
Query:  371 EERSYSDWINQALRNEEICQKYLPIDYNKLYEACSDGVLLCKMINYSVPDTIDMRAVNVGK--KLETIFCKNENLSLAVQSASSIGCCVVNIGPIDLGNGVKHIVLGLLWQIIRIGLIGKINLANHAELVALLRDGESLEDLKQLSPEEILIRWVNYHMEKANVSRRISNFNTDIMDSEIYTY-LINQIAPSECRSKMMPPNEILRSNDNVQRAENVLSNASAMNAKAFVEANDIAMVTQK 1084
            EER++ +W+N    N  +         N LY    D +++ ++    +   +D   VN     KL     K EN + AV+   +    +V IG  DL +G   + L L+WQ++R   I         +++  L +GE + D       EI++ WVN+ +  A  S  I++F           + LI+ I P   R  ++   E L  +D +  A+  +S A  + A+ +   +D+  V  K
Sbjct:  105 EERTFRNWMNSLGVNPFV---------NHLYSDLVDALVIIQLFE-KIKTRVDWNKVNKPPYPKLGANMKKLENCNYAVELGKTTKFSLVGIGGQDLNDGNPTLTLALVWQLMRKYTI---------QVLEDLGEGEKVND-------EIIVNWVNHTLRDAGKSSSIASFKVPPTALSTPCWDLIDAIQPGSIRYDLV-KEEPLTDDDRLDNAKYAISMARKIGARVYALPDDLVEVKPK 318          
BLAST of Plastin 3 vs. Ensembl Yeast
Match: SAC6 (Fimbrin, actin-bundling protein; cooperates with Scp1p in organization and maintenance of the actin cytoskeleton; phosphorylated by Cdc28p/Clb2p in metaphase on T103, to regulate conformation, and modulate actin filament binding affinity and actin cable dynamics; relocalizes from the plasma membrane to the cytoplasm upon DNA replication stress; human homologs PLS3 and LCP1 implicated in spinocerebellar ataxia type 2 (SCA2) can each complement yeast null mutant [Source:SGD;Acc:S000002536])

HSP 1 Score: 315.079 bits (806), Expect = 5.944e-99
Identity = 178/521 (34.17%), Postives = 301/521 (57.77%), Query Frame = 2
Query:  350 VRVVSDAEERSYSDWINQALRNEEICQKYLPI--DYNKLYEACSDGVLLCKMINYSVPDTIDMRAVNVGKKLETI--FCKNENLSLAVQSASSIGCCVVNIGPIDLGNGVKHIVLGLLWQIIRIGLIGKINLANHAELVALLRDGESLEDLKQLSPEEILIRWVNYHMEKANVSRRISNFNTDIMDSEIYTYLINQIAPSECRSKMMPPNEILRSNDNVQRAENVLSNASAMNAKAFVEANDIAMVTQKGKNREKLNMAFVAHLFNNYPALNITE----KVIQEFDIVEETLEEKTYRNWMNSMGVEPYLNYLYSDLRNGIALLHLIDVIQPKTVNWETVTTKFNPMRKL--FQMQDNCLAFINYAKKLNLKLVGLSAENIRETETTLVLGLCFQLLRKYTFQLLQKLQPNNFNKSVEDKDIIEWANKKCQSTGKSESVIRSFKDLNIRSSKPILHLIDSIKPNSVDYSMITNNPLDDAKY-----AITVARKIGANVYALPQHVVDLNQKMILTIYACLM 1867
               +++ E R ++  IN  L  ++     LP   D  +L++ C DG++L K+IN SVPDTID R +N  KK + +  F  +EN ++ + SA +IGC VVN+   D+  G +H++LGL+WQIIR GL+ KI++  H EL  LL D E+LE   +L PE+IL+RW NYH+++AN +RR++NF+ D+ D E YT L+NQ+ P+ C          L++ D ++RAE VL NA  ++ + ++  + +           KLN+AFVAHLFN +P L   +      I+EFD  E   E + +  W+NS+ V+P +  L+ DL++G+ LL   + + P  V+++ V  +     ++  F+  +N    ++  +     LVG+   +I +    L LGL +QL+R+     ++ L  +   + + D  I++WA  +    GK+ S IRSFKD  + ++  +L +++ I P  VDY ++T    ++ +Y     AI++ARK+GA ++ +P+ + ++  ++I+T  A LM
Sbjct:  134 THTINEEERREFTKHINSVLAGDQDIGDLLPFPTDTFQLFDECRDGLVLSKLINDSVPDTIDTRVLNWPKKGKELNNFQASENANIVINSAKAIGCVVVNVHSEDIIEGREHLILGLIWQIIRRGLLSKIDIKLHPELYRLLEDDETLEQFLRLPPEQILLRWFNYHLKQANWNRRVTNFSKDVSDGENYTILLNQLDPALCSKAP------LQTTDLMERAEQVLQNAEKLDCRKYLTPSSLVA------GNPKLNLAFVAHLFNTHPGLEPIQEEEKPEIEEFD-AEGEREARVFTLWLNSLDVDPPVISLFDDLKDGLILLQAYEKVMPGAVDFKHVNKRPASGAEISRFKALENTNYAVDLGRAKGFSLVGIEGSDIVDGNKLLTLGLVWQLMRRNISITMKTLSSS--GRDMSDSQILKWAQDQVTKGGKN-STIRSFKDQALSNAHFLLDVLNGIAPGYVDYDLVTPGNTEEERYANARLAISIARKLGALIWLVPEDINEVRARLIITFIASLM 638          
BLAST of Plastin 3 vs. Ensembl Nematostella
Match: EDO32484 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SUX1])

HSP 1 Score: 396.741 bits (1018), Expect = 1.592e-130
Identity = 218/514 (42.41%), Postives = 324/514 (63.04%), Query Frame = 2
Query:  359 VSDAEERSYSDWINQALRNEEICQKYLPIDYNKLYEACSDGVLLCKMINYSVPDTIDMRAVNVGKKLETIFCKNENLSLAVQSASSIGCCVVNIGPIDLGNGVKHIVLGLLWQIIRIGLIGKINLANHAELVALLRDGESLEDLKQLSPEEILIRWVNYHMEKANVSRRISNFNTDIMDSEIYTYLINQIAPSECRSKMMPPNEILRSNDNVQRAENVLSNASAMNAKAFVEANDIAMVTQKGKNREKLNMAFVAHLFNNYPALNITEKVIQEFDIVEETLEEKTYRNWMNSMGVEPYLNYLYSDLRNGIALLHLIDVIQPKTVNWETVTT-KFNPMRKLFQMQDNCLAFINYAKKLNLKLVGLSAENIRETETTLVLGLCFQLLRKYTFQLLQKLQPNNFNKSVEDKDIIEWANKKCQSTGKSESVIRSFKDLNIRSSKPILHLIDSIKPNSVDYSMIT-----NNPLDDAKYAITVARKIGANVYALPQHVVDLNQKMILTIYACLMLVDLQ 1882
            ++D E   ++DWIN  L ++E  ++      + L+ A  DGV++CK+IN+SVP TID RA+N+ KKL  ++  +EN +L + SA +IGC +VNIG  DL  G  H+VLGL+WQ+IRIGL  KI + N   LV LL D E L+DL++L+PE+IL+RW N+ +E A   RR++NF++DI D+E Y+ L+N+IAP E    +  P+  +  +D  + AE VL+NA  M  + FV A D+       K   KLN+AFV +LFN +P L   E V  E   +EET EEKT+RNW+NS+G++P++  LY DL +G+ L  L D +QP  VN++ V    F  M    +  +NC   I+ A  L   LVG+  ++I +    L+L L +Q +R YT  +LQK   +   K V + +I+ W N+K  S GK+ + I   KD  I++SK +L LID+IKP +++YSM+       +   +AKYAI++ARK+GA VYALP+ +V+   KM++T++ACLM   L+
Sbjct:  102 LTDDERIGFTDWINSCLGDDEDLKEA----QDGLFNAVKDGVVMCKLINWSVPHTIDERAINM-KKL-NVYTIHENQTLVLNSAMAIGCNIVNIGAEDLIEGKPHLVLGLMWQVIRIGLFAKITIQNCPGLVQLLHDHEELDDLRRLAPEDILLRWFNFQLEDAGHHRRVNNFSSDISDAENYSVLLNKIAPPEL--GIDTPH--VSESDPTKLAELVLTNADKMACRKFVRAKDVV------KGNAKLNLAFVCNLFNTFPCL---EPVEHEMTDIEETREEKTFRNWINSLGIKPFVQNLYLDLDDGMILFQLFDQVQPGIVNYDKVNKPPFKKMGAKMKKLENCNYAISVADLLKFSLVGVGGKDINDGNKMLILALLWQTMRAYTLTVLQKCAGS--EKPVTEAEIVVWVNEKLSSAGKA-TTITGMKDPEIKTSKCVLDLIDAIKPKAINYSMVNAGECQEDAFLNAKYAISMARKVGARVYALPEDLVEGKSKMVMTVFACLMARGLK 593          
BLAST of Plastin 3 vs. Ensembl Nematostella
Match: EDO40382 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S7E1])

HSP 1 Score: 393.275 bits (1009), Expect = 2.848e-128
Identity = 231/542 (42.62%), Postives = 329/542 (60.70%), Query Frame = 2
Query:  362 SDAEERSYSDWINQALRNEEICQKYLPIDYNK----LYEACSDGVLLCKMINYSVPDTIDMRAVNVGKKLETIFCKNENLSLAVQSASSIGCCVVNIGPIDLGNGVKHIVLGLLWQIIRIGLIGKINLANHAELVALLRDGESLEDLKQLSPEEILIRWVNYHMEK--------ANVSRR--ISNFNTDIMDSEIYTYLINQIAPSECRSKMMPPNEILRSNDNVQRAENVLSNASAMNAKAFVEANDIAMVTQKGKNREKLNMAFVAHLFNNYPAL-----NITEKVIQEFDIVEETLEEKTYRNWMNSMGVEPYLNYLYSDLRNGIALLHLIDVIQPKTVNWETVTTKFNP--------MRKLFQMQDNCLAFINYAKKLNLKLVGLSAENIRETETTLVLGLCFQLLRKYTFQLLQKLQPNNFNKSVEDKDIIEWANKKCQSTGKSESVIR--SFKDLNIRSSKPILHLIDSIKPNSVDYSMITNNPLDD------AKYAITVARKIGANVYALPQHVVDLNQKMILTIYACLMLVDLQ 1882
            S  E+ +++DWIN +L+ +E   KYLPID ++    LYE   DG+LLCKMIN S P TID R +N  K    +F  +EN +L + SA +IGC +VNIG  DL  G KH+VLG+LWQ+IRIGL  KI L N   L  LL++GE++E L  LSPEE+L+RWVN+H+ K         + SRR  + NF+ DI DSE Y+ L+ QIAP    S +  P     + DN ++AE +L NA  +  + FV A D+    Q      KLNMAFVA+LF+ +P L     +  ++V  + +  EET EE TYRNW+NSMG   Y+N+LYSD  +GI L  + + I+P  V+WE    K NP        M    +  +NC   ++  K+ N  L+G+  ++I E    L LGL +Q++R YT+ LL +L P++ +   E+K I+EW NK  QS  K+  + +   FKD +I +S  +L LID I P  ++ ++I  +PL D      A+YAI++ARKIGA VYALP+ +V++  KM+LT++A LML  L+
Sbjct:  120 SKEEQVAFADWINSSLKEDESVHKYLPIDASEDSSDLYEKVKDGILLCKMINLSAPGTIDERVIN--KPPLKVFTIHENQTLVINSALAIGCNLVNIGAGDLAEGKKHLVLGVLWQVIRIGLFSKITLTNVPGLARLLQEGETIEGLHHLSPEELLLRWVNFHLGKYYDGQNYPPDDSRRKVVHNFSDDIKDSEAYSILLYQIAPQ--SSGVDHPQSYYSTTDNSKKAEKMLRNAEKIGCRKFVRAKDVVSGNQ------KLNMAFVANLFSTFPNLPELDDDEGKEVGLDEEYQEETREELTYRNWINSMGCGRYVNWLYSDFFDGIILFKMFEHIRPGCVDWE---KKVNPEGKCKNARMGGKVKCIENCNYAVDLGKQFNFSLIGIQGQDIHEGVQNLTLGLIWQMMRAYTYTLLARLSPDD-DHMTEEK-IVEWVNKTLQSKKKTHLINKGHGFKDPDISTSLAVLDLIDCISPKMINPALINPDPLSDEDKLPNAQYAISMARKIGAVVYALPEDLVEVKPKMVLTVFASLMLCALE 646          
BLAST of Plastin 3 vs. Ensembl Nematostella
Match: EDO32486 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SUX4])

HSP 1 Score: 98.2117 bits (243), Expect = 1.379e-24
Identity = 47/105 (44.76%), Postives = 71/105 (67.62%), Query Frame = 2
Query: 1583 IIEWANKKCQSTGKSESVIRSFKDLNIRSSKPILHLIDSIKPNSVDYSMITNNPLDD-----AKYAITVARKIGANVYALPQHVVDLNQKMILTIYACLMLVDLQ 1882
            I+ W N+K  S GK+ + I   KD  I++SK +L LID+IKP +++YSM+      +     AKYAI++ARK+GA VYALP+ +V+   KM++T++ACLM   L+
Sbjct:    1 IVVWVNEKLSSAGKA-TTITGMKDPEIKTSKCVLDLIDAIKPKAINYSMVNAGECQEDAFLNAKYAISMARKVGARVYALPEDLVEGKSKMVMTVFACLMARGLE 104          
BLAST of Plastin 3 vs. Ensembl Nematostella
Match: EDO27717 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7T8H0])

HSP 1 Score: 78.5666 bits (192), Expect = 7.883e-18
Identity = 40/85 (47.06%), Postives = 59/85 (69.41%), Query Frame = 2
Query: 1646 FKDLNIRSSKPILHLIDSIKPNSVDYSMITNNPLDD------AKYAITVARKIGANVYALPQHVVDLNQKMILTIYACLMLVDLQ 1882
            FKD +I +S  +L LID I P  ++ ++I  +PL D      A+YAI++ARKIGA VYALP+ +V++  KM+LT++A LML  L+
Sbjct:    1 FKDPDISTSLAVLDLIDCISPKMINPALINPDPLSDEDKLPNAQYAISMARKIGAVVYALPEDLVEVKPKMVLTVFASLMLCALE 85          
BLAST of Plastin 3 vs. Ensembl Medaka
Match: pls3 (plastin-3 [Source:NCBI gene;Acc:101161915])

HSP 1 Score: 406.757 bits (1044), Expect = 1.688e-133
Identity = 229/535 (42.80%), Postives = 333/535 (62.24%), Query Frame = 2
Query:  320 SINGQDDVQAVRV---VSDAEERSYSDWINQALRNEEICQKYLPIDYN--KLYEACSDGVLLCKMINYSVPDTIDMRAVNVGKKLETIFCKNENLSLAVQSASSIGCCVVNIGPIDLGNGVKHIVLGLLWQIIRIGLIGKINLANHAELVALLRDGESLEDLKQLSPEEILIRWVNYHMEKANVSRRISNFNTDIMDSEIYTYLINQIAPSECRSKMMPPNEI----LRSNDNVQRAENVLSNASAMNAKAFVEANDIAMVTQKGKNREKLNMAFVAHLFNNYPALNITEKVIQEFDIVE-ETLEEKTYRNWMNSMGVEPYLNYLYSDLRNGIALLHLIDVIQPKTVNWETVTTKFNPMRKL---FQMQDNCLAFINYAKKLNLKLVGLSAENIRETETTLVLGLCFQLLRKYTFQLLQKLQPNNFNKSVEDKDIIEWANKKCQSTGKSESVIRSFKDLNIRSSKPILHLIDSIKPNSVDYSMITNNPLDD------AKYAITVARKIGANVYALPQHVVDLNQKMILTIYACLM 1867
            +I G  ++ +V      S+ E  ++ +WIN AL  +  CQ  LP++ N   L+ +  DG++LCKMIN S PDTID R +N  KK  T F   ENL+LA+ SAS+IGC VVNIG +DL  G  H+VLGLLWQII+IGL   I L+ +  L ALLRDGE+LEDL +LSPEE+L+RW NYH+E A   ++I+NF++DI DS+ Y +L+NQI+P + + +  P  +I        D+++RAE +L  A  +  + FV   D+           KLN+AFVA+LFN YPAL   E    ++ ++E ET EE+T+RNWMNS+GV P++N+LY DL++ + +L L + I+   V+W     K  P  KL    +  +NC   +   +     LVG+  +++ +   TL L + +QL+R+YT  +L+ L   +    V D  I++W NK      KS + I SFKD  I +S  +L LID+I+P SV+Y +I  + L D      AKYAI++ARKIGA VYALP+ +V++  KM++T++ACLM
Sbjct:   97 AIGGTSELSSVGTQHSFSEEERFAFVNWINTALEKDPDCQHVLPMNPNTDSLFTSVGDGIVLCKMINLSAPDTIDERTIN--KKKLTPFTIQENLNLALNSASAIGCHVVNIGALDLKEGKPHLVLGLLWQIIKIGLFADIELSRNEALAALLRDGETLEDLMKLSPEELLLRWANYHLENAGY-KKINNFSSDIKDSKAYFHLLNQISP-KGKDEGQPCIDINMAGFNEKDDLKRAEAMLQQADRLGCRQFVTPTDVV------NGNPKLNLAFVANLFNKYPALTKPENQDIDWGLLEGETREERTFRNWMNSLGVNPHVNHLYGDLQDALVILQLYEKIK-IPVDWNNKVNK-PPYPKLGTNMKKLENCNYAVELGRSAKFSLVGIGGQDLNDGNPTLTLAVVWQLMRRYTLNVLEDLGDGD---KVNDDIIVKWVNKTLADAEKS-TKISSFKDKEISTSLSVLELIDAIQPGSVNYELIKTSSLSDADKLENAKYAISMARKIGARVYALPEDLVEVKPKMVMTVFACLM 615          
BLAST of Plastin 3 vs. Ensembl Medaka
Match: lcp1 (plastin-2 [Source:NCBI gene;Acc:101162720])

HSP 1 Score: 405.216 bits (1040), Expect = 5.785e-133
Identity = 228/530 (43.02%), Postives = 336/530 (63.40%), Query Frame = 2
Query:  362 SDAEERSYSDWINQALRNEEICQKYLPID--YNKLYEACSDGVLLCKMINYSVPDTIDMRAVNVGKKLETIFCKNENLSLAVQSASSIGCCVVNIGPIDLGNGVKHIVLGLLWQIIRIGLIGKINLANHAELVALLRDGESLEDLKQLSPEEILIRWVNYHMEKANVSRRISNFNTDIMDSEIYTYLINQIAP---SECRSKMMPPNEILRSNDNVQRAENVLSNASAMNAKAFVEANDIAMVTQKGKNREKLNMAFVAHLFNNYPALNITEKVIQEFDIVE-ETLEEKTYRNWMNSMGVEPYLNYLYSDLRNGIALLHLIDVIQPKTVNWETVTTKFNP-----MRKLFQMQDNCLAFINYAKKLN-----LKLVGLSAENIRETETTLVLGLCFQLLRKYTFQLLQKLQPNNFNKSVEDKDIIEWANKKCQSTGKSESVIRSFKDLNIRSSKPILHLIDSIKPNSVDYSMIT------NNPLDDAKYAITVARKIGANVYALPQHVVDLNQKMILTIYACLMLVDLQK 1885
            S+ E+ ++ +WIN+AL  +  C+  LP+D   + L+ A  DG++LCKMIN SVPDTID R +N  KK  T F   ENL+LA+ SAS+IGC VVNIG  DL  G +H+VLGLLWQ+I+IGL   I L+ +  L+ALLRDGESLEDL +LSPEE+L+RW NYH+E+A    +I+NF++DI DS+ Y  L+NQ+AP    E  + ++     +R  ++++RAE +L  A  ++ + FV   D+       +   KLN+AFVA+LFN YPAL   E    ++  +E ET EE+T+RNWMNS+GV P +N+LY+D+ + + +  L + I+   VNW+ V     P     M+KL    +NC    NYA +L        LVG++ +++     TL L L +QL+R+YT  +L+ L      + V D  I+ W N     T   ++ I SFKD++I SS P+L LID+I+P S+ Y ++          L++AKYAI++ARKIGA VYALP+ +V++  KM++T++ACLM   +++
Sbjct:  112 SEEEKVAFVNWINKALEKDPDCKHVLPMDPDSDDLFTAMGDGIILCKMINLSVPDTIDERTIN--KKKLTPFTIQENLNLALNSASAIGCHVVNIGAEDLKEGRQHLVLGLLWQVIKIGLFADIELSRNEALIALLRDGESLEDLMKLSPEELLLRWANYHLEEAGCG-KINNFSSDIKDSKAYYNLLNQVAPKGDEEGIAAIIVDMSGIREKEDLKRAECMLDQADRLSCRQFVMPADVV------RGNPKLNLAFVANLFNKYPALKKPENQDIDWSSIEGETREERTFRNWMNSLGVNPRVNHLYADIDDALVIFQLYEKIKV-PVNWDRVNKPPYPKLGSNMKKL----ENC----NYAVELGKNEAKFSLVGIAGQDLNAGNRTLTLALLWQLMRRYTLNILEDLGD---GQKVTDDTIVSWVNDTL--THAEKNTISSFKDMSISSSMPVLDLIDAIQPGSIRYDLVKAEDLTEEEKLNNAKYAISMARKIGARVYALPEDLVEVKPKMVMTVFACLMARGMKR 618          
BLAST of Plastin 3 vs. Ensembl Medaka
Match: ENSORLT00000011106.2 (plastin-3-like [Source:NCBI gene;Acc:101157305])

HSP 1 Score: 400.593 bits (1028), Expect = 3.884e-131
Identity = 227/524 (43.32%), Postives = 331/524 (63.17%), Query Frame = 2
Query:  359 VSDAEERSYSDWINQALRNEEICQKYLPIDYN--KLYEACSDGVLLCKMINYSVPDTIDMRAVNVGKKLETIFCKNENLSLAVQSASSIGCCVVNIGPIDLGNGVKHIVLGLLWQIIRIGLIGKINLANHAELVALLRDGESLEDLKQLSPEEILIRWVNYHMEKANVSRRISNFNTDIMDSEIYTYLINQIAPSECRSKMMPPNEI----LRSNDNVQRAENVLSNASAMNAKAFVEANDIAMVTQKGKNREKLNMAFVAHLFNNYPALNITEKVIQEFDIVEETLEEKTYRNWMNSMGVEPYLNYLYSDLRNGIALLHLIDVIQPKTVNWETVTTKFNPMRKL----FQMQDNCLAFINYA-----KKLNLKLVGLSAENIRETETTLVLGLCFQLLRKYTFQLLQKLQPNNFNKSVEDKDIIEWANKKCQSTGKSESVIRSFKDLNIRSSKPILHLIDSIKPNSVDYSMITNNP------LDDAKYAITVARKIGANVYALPQHVVDLNQKMILTIYACLM 1867
            +S+ E  +++++IN AL  +  C  ++PI+ N   L++A +DG+LLCK+IN SVPDTID R +N  KK  T F   ENL+LA+ SAS+IGC VVNIG  DL  G  H+VLGLLWQII+IGL  KI L+ +  + ALL+DGESL+ L +LSPEE+L+RWVN+H++   +S  I+NF+ DI DS++Y +L+ QIAP   +   +P  EI    L   D  +RAE +L  A  +  + FV A D+           KLN+AFVA LFN +PAL   E   QE+ + +E+ EE+T+RNWMNS+GV P+++Y+Y DL++ + +L L + I+ K V+W        P + +     +  +NC    NYA     +K    LVG+  +++ +    L L L +QL+R+YT  LL+ L      +   D  II W NK      KS S I+SFKD +I +S P+L LID+I+P SV++ ++  +       LD+AKYA+++ARKIGA VYALP+ +V++  KM++TI+ACLM
Sbjct:  113 ISEQERFAFTNYINTALGEDPDCSHFVPINPNTGALFKAVADGILLCKLINLSVPDTIDERTIN--KKKLTPFTTQENLNLALNSASAIGCQVVNIGAQDLKEGKPHLVLGLLWQIIKIGLFAKIQLSRNKAIAALLQDGESLDVLMKLSPEELLLRWVNFHLKTVGMS--ITNFSADIKDSKVYFHLLEQIAPDGSKED-VPRVEIDMTGLYEKDLKKRAELMLQQAERLGCREFVTATDVVT------GNAKLNLAFVATLFNKHPALTKPEN--QEWIVEDESREERTFRNWMNSLGVTPHVHYIYGDLQDAMVILQLYEKIKVK-VDWNN-RVNHPPFKGVGGGHLKKIENC----NYAVELGKQKAGFSLVGIGGQDLYDGNEMLTLALMWQLMRRYTLNLLEDL---GHGEVAGDDLIISWVNKTLAEADKSSS-IKSFKDKSISTSLPVLDLIDAIQPESVNFELVKRDAESNADKLDNAKYAVSMARKIGAKVYALPEDLVEVKPKMVMTIFACLM 613          
BLAST of Plastin 3 vs. Ensembl Medaka
Match: pls1 (plastin-1 [Source:NCBI gene;Acc:101168586])

HSP 1 Score: 378.637 bits (971), Expect = 1.555e-122
Identity = 228/544 (41.91%), Postives = 327/544 (60.11%), Query Frame = 2
Query:  320 SINGQDDVQA---VRVVSDAEERSYSDWINQALRNEEICQKYLPIDYN--KLYEACSDGVLLCKMINYSVPDTIDMRAVNVGKKLETIFCKNENLSLAVQSASSIGCCVVNIGPIDLGNGVKHIVLGLLWQIIRIGLIGKINLANHAELVALLRDGESLEDLKQLSPEEILIRWVNYHMEKANVSRRISNFNTDIMDSEIYTYLINQIAPSECRSKMMPPNEILR------SNDNVQ-RAENVLSNASAMNAKAFVEANDIAMVTQKGKNREKLNMAFVAHLFNNYPALNITEKVIQEFDIVE-ETLEEKTYRNWMNSMGVEPYLNYLYSDLRNGIALLHLIDVIQPKTVNWETVTT-KFNPMRKLFQMQDNCLAFINYAKKL-----NLKLVGLSAENIRETETTLVLGLCFQLLRKYTFQLLQKLQPNNFNKSVEDKDIIEWANKKCQSTGKSESVIRSFKDLNIRSSKPILHLIDSIKPNSVDYSMITNNP---------LDDAKYAITVARKIGANVYALPQHVVDLNQKMILTIYACLM 1867
            S  G  D+ +       +D E+ ++ +WIN+AL+N+  C   LP++ N   L+ +  DG+LLCKMIN+S PDTID R +N  KKL T F   ENL LA+ SAS+IGC VVN+   DL  G  H+VLGLLWQ+I++GL   I L+ + +L+ALL DGE LE L  LSPEE+L+RWVNYH++ A  +++I NF+ DI DS  Y +L+NQ+A  E    M+     +R      S  N++ RAE +L  A+ M+ + FV   DI           KLN+AFVA+LFN +P L   +     +D +E ET EEKT+RNWMNS+GV P +N+LY DL +G+ +L L++ ++   VNW+ V    F+ +    +  +NC    NYA +L     +  LVG+  EN+ E      L L +QL+R+YT  +L  L      + + D+ I+ W N       K+ S I +FKD  I +S P+  LID I P +V + M+  +          LD+AKYAI++ARKIGA VYALP  +V++N KM++T++ACLM
Sbjct:  103 SFGGTSDISSEGTQHSYADEEKVAFVNWINKALKNDPDCHHVLPMNPNDESLFSSLRDGILLCKMINFSQPDTIDERVINT-KKL-TTFKMTENLILALNSASAIGCRVVNVDAHDLKAGKPHLVLGLLWQVIKVGLFADIELSKNEDLIALLEDGEKLEHLMSLSPEELLLRWVNYHLQNAK-TQKIRNFSDDIKDSRAYFHLLNQLAIEE----MLENKRGIRIDMGGLSEFNLERRAELMLQQAAKMDCRQFVSPRDITA------GNSKLNLAFVANLFNMHPGLRGAKANKGNWDSIEAETREEKTFRNWMNSLGVSPSVNHLYWDLCDGLVILQLMEKVKV-PVNWKKVNNPPFSMLGGNMKKLENC----NYAVQLGKNVAHFSLVGVGGENLNEGSRVHTLALVWQLMRRYTVMVLSDLGD---GEKIGDQIILNWVNTTLGQKKKA-SQISNFKDKLISTSMPVFDLIDCIVPGAVKWDMVKKDARGKMSNEDKLDNAKYAISLARKIGARVYALPDDLVEVNPKMVMTLFACLM 624          
BLAST of Plastin 3 vs. Ensembl Medaka
Match: pls1 (plastin-1 [Source:NCBI gene;Acc:101168586])

HSP 1 Score: 377.867 bits (969), Expect = 7.431e-122
Identity = 228/544 (41.91%), Postives = 327/544 (60.11%), Query Frame = 2
Query:  320 SINGQDDVQA---VRVVSDAEERSYSDWINQALRNEEICQKYLPIDYN--KLYEACSDGVLLCKMINYSVPDTIDMRAVNVGKKLETIFCKNENLSLAVQSASSIGCCVVNIGPIDLGNGVKHIVLGLLWQIIRIGLIGKINLANHAELVALLRDGESLEDLKQLSPEEILIRWVNYHMEKANVSRRISNFNTDIMDSEIYTYLINQIAPSECRSKMMPPNEILR------SNDNVQ-RAENVLSNASAMNAKAFVEANDIAMVTQKGKNREKLNMAFVAHLFNNYPALNITEKVIQEFDIVE-ETLEEKTYRNWMNSMGVEPYLNYLYSDLRNGIALLHLIDVIQPKTVNWETVTT-KFNPMRKLFQMQDNCLAFINYAKKL-----NLKLVGLSAENIRETETTLVLGLCFQLLRKYTFQLLQKLQPNNFNKSVEDKDIIEWANKKCQSTGKSESVIRSFKDLNIRSSKPILHLIDSIKPNSVDYSMITNNP---------LDDAKYAITVARKIGANVYALPQHVVDLNQKMILTIYACLM 1867
            S  G  D+ +       +D E+ ++ +WIN+AL+N+  C   LP++ N   L+ +  DG+LLCKMIN+S PDTID R +N  KKL T F   ENL LA+ SAS+IGC VVN+   DL  G  H+VLGLLWQ+I++GL   I L+ + +L+ALL DGE LE L  LSPEE+L+RWVNYH++ A  +++I NF+ DI DS  Y +L+NQ+A  E    M+     +R      S  N++ RAE +L  A+ M+ + FV   DI           KLN+AFVA+LFN +P L   +     +D +E ET EEKT+RNWMNS+GV P +N+LY DL +G+ +L L++ ++   VNW+ V    F+ +    +  +NC    NYA +L     +  LVG+  EN+ E      L L +QL+R+YT  +L  L      + + D+ I+ W N       K+ S I +FKD  I +S P+  LID I P +V + M+  +          LD+AKYAI++ARKIGA VYALP  +V++N KM++T++ACLM
Sbjct:  140 SFGGTSDISSEGTQHSYADEEKVAFVNWINKALKNDPDCHHVLPMNPNDESLFSSLRDGILLCKMINFSQPDTIDERVINT-KKL-TTFKMTENLILALNSASAIGCRVVNVDAHDLKAGKPHLVLGLLWQVIKVGLFADIELSKNEDLIALLEDGEKLEHLMSLSPEELLLRWVNYHLQNAK-TQKIRNFSDDIKDSRAYFHLLNQLAIEE----MLENKRGIRIDMGGLSEFNLERRAELMLQQAAKMDCRQFVSPRDITA------GNSKLNLAFVANLFNMHPGLRGAKANKGNWDSIEAETREEKTFRNWMNSLGVSPSVNHLYWDLCDGLVILQLMEKVKV-PVNWKKVNNPPFSMLGGNMKKLENC----NYAVQLGKNVAHFSLVGVGGENLNEGSRVHTLALVWQLMRRYTVMVLSDLGD---GEKIGDQIILNWVNTTLGQKKKA-SQISNFKDKLISTSMPVFDLIDCIVPGAVKWDMVKKDARGKMSNEDKLDNAKYAISLARKIGARVYALPDDLVEVNPKMVMTLFACLM 661          
BLAST of Plastin 3 vs. Planmine SMEST
Match: SMESG000070679.1 (SMESG000070679.1)

HSP 1 Score: 1084.32 bits (2803), Expect = 0.000e+0
Identity = 526/526 (100.00%), Postives = 526/526 (100.00%), Query Frame = 2
Query:  314 QSSINGQDDVQAVRVVSDAEERSYSDWINQALRNEEICQKYLPIDYNKLYEACSDGVLLCKMINYSVPDTIDMRAVNVGKKLETIFCKNENLSLAVQSASSIGCCVVNIGPIDLGNGVKHIVLGLLWQIIRIGLIGKINLANHAELVALLRDGESLEDLKQLSPEEILIRWVNYHMEKANVSRRISNFNTDIMDSEIYTYLINQIAPSECRSKMMPPNEILRSNDNVQRAENVLSNASAMNAKAFVEANDIAMVTQKGKNREKLNMAFVAHLFNNYPALNITEKVIQEFDIVEETLEEKTYRNWMNSMGVEPYLNYLYSDLRNGIALLHLIDVIQPKTVNWETVTTKFNPMRKLFQMQDNCLAFINYAKKLNLKLVGLSAENIRETETTLVLGLCFQLLRKYTFQLLQKLQPNNFNKSVEDKDIIEWANKKCQSTGKSESVIRSFKDLNIRSSKPILHLIDSIKPNSVDYSMITNNPLDDAKYAITVARKIGANVYALPQHVVDLNQKMILTIYACLMLVDLQKHS 1891
            QSSINGQDDVQAVRVVSDAEERSYSDWINQALRNEEICQKYLPIDYNKLYEACSDGVLLCKMINYSVPDTIDMRAVNVGKKLETIFCKNENLSLAVQSASSIGCCVVNIGPIDLGNGVKHIVLGLLWQIIRIGLIGKINLANHAELVALLRDGESLEDLKQLSPEEILIRWVNYHMEKANVSRRISNFNTDIMDSEIYTYLINQIAPSECRSKMMPPNEILRSNDNVQRAENVLSNASAMNAKAFVEANDIAMVTQKGKNREKLNMAFVAHLFNNYPALNITEKVIQEFDIVEETLEEKTYRNWMNSMGVEPYLNYLYSDLRNGIALLHLIDVIQPKTVNWETVTTKFNPMRKLFQMQDNCLAFINYAKKLNLKLVGLSAENIRETETTLVLGLCFQLLRKYTFQLLQKLQPNNFNKSVEDKDIIEWANKKCQSTGKSESVIRSFKDLNIRSSKPILHLIDSIKPNSVDYSMITNNPLDDAKYAITVARKIGANVYALPQHVVDLNQKMILTIYACLMLVDLQKHS
Sbjct:   16 QSSINGQDDVQAVRVVSDAEERSYSDWINQALRNEEICQKYLPIDYNKLYEACSDGVLLCKMINYSVPDTIDMRAVNVGKKLETIFCKNENLSLAVQSASSIGCCVVNIGPIDLGNGVKHIVLGLLWQIIRIGLIGKINLANHAELVALLRDGESLEDLKQLSPEEILIRWVNYHMEKANVSRRISNFNTDIMDSEIYTYLINQIAPSECRSKMMPPNEILRSNDNVQRAENVLSNASAMNAKAFVEANDIAMVTQKGKNREKLNMAFVAHLFNNYPALNITEKVIQEFDIVEETLEEKTYRNWMNSMGVEPYLNYLYSDLRNGIALLHLIDVIQPKTVNWETVTTKFNPMRKLFQMQDNCLAFINYAKKLNLKLVGLSAENIRETETTLVLGLCFQLLRKYTFQLLQKLQPNNFNKSVEDKDIIEWANKKCQSTGKSESVIRSFKDLNIRSSKPILHLIDSIKPNSVDYSMITNNPLDDAKYAITVARKIGANVYALPQHVVDLNQKMILTIYACLMLVDLQKHS 541          
BLAST of Plastin 3 vs. Planmine SMEST
Match: SMESG000081113.1 (SMESG000081113.1)

HSP 1 Score: 625.55 bits (1612), Expect = 0.000e+0
Identity = 296/519 (57.03%), Postives = 400/519 (77.07%), Query Frame = 2
Query:  326 NGQDDVQAVRVVSDAEERSYSDWINQALRNEEICQKYLPIDYNKLYEACSDGVLLCKMINYSVPDTIDMRAVNVGKKLETIFCKNENLSLAVQSASSIGCCVVNIGPIDLGNGVKHIVLGLLWQIIRIGLIGKINLANHAELVALLRDGESLEDLKQLSPEEILIRWVNYHMEKANVSRRISNFNTDIMDSEIYTYLINQIAPSECRSKMMPPNEILRSNDNVQRAENVLSNASAMNAKAFVEANDIAMVTQKGKNREKLNMAFVAHLFNNYPALNITEKVIQEFDIVEETLEEKTYRNWMNSMGVEPYLNYLYSDLRNGIALLHLIDVIQPKTVNWETVTTKFNPMRKLFQMQDNCLAFINYAKKLNLKLVGLSAENIRETETTLVLGLCFQLLRKYTFQLLQKLQPNNFNKSVEDKDIIEWANKKCQSTGKSESVIRSFKDLNIRSSKPILHLIDSIKPNSVDYSMITNNPLDDAKYAITVARKIGANVYALPQHVVDLNQKMILTIYACLMLVDLQ 1882
            + +    A   V D+EER +S+WI++ L  + +C  YLPI +++LY    DGVLLCK+IN +VPDT+D R +N G  L+++F KNENL LAV SA +IGCC+VNIGP D+  G KH++LGL+WQ+IRIGL+G +NL +HAELVALLR+ E+L+DLKQL+PEE+L+RWVNYH+EKA +++RI+NF  DI DSEIY++L+ QIAP++ R +M+PP  IL++ DN++RAE +L NAS ++A+ F+E  D+AMVTQ+G+NREKLN+AFVA+LFN YPAL +      + +I EETLEEKTYRNWMNSMGV PY+  +YSDL+NG+ LL LID++QP  V W+ +   F+P +K+FQ+  NC   I YAKKLN  +V LSA+NI++    +VLGLCFQ+LR YT +LL K+ P       +DKDII WANKK ++  K+ S I SFKD +I +SKPIL LID+I PNSVD+ ++TN PL DAK+ I+ AR+IGA +YALPQH+VD+NQKM++T+YACLML+D Q
Sbjct:  107 DDEKSTHAKHTVCDSEERGFSNWISRVLSKDPLCAPYLPIKHDELYNKLQDGVLLCKLINSAVPDTVDERVMNTGASLKSVFKKNENLCLAVNSAEAIGCCMVNIGPEDIDKGTKHLILGLVWQVIRIGLLGLVNLLHHAELVALLREDETLDDLKQLTPEELLLRWVNYHLEKAGITKRITNFKEDIQDSEIYSHLLYQIAPADKRDEMLPPISILKNTDNMKRAELMLGNASILDARVFIEPEDVAMVTQRGQNREKLNLAFVANLFNTYPALIVD----SDIEIREETLEEKTYRNWMNSMGVTPYVKDIYSDLKNGLVLLQLIDLLQPGIVEWKKIVRVFDPKKKVFQILGNCSYVIEYAKKLNFNIVNLSADNIKDATPNMVLGLCFQMLRSYTMKLLSKVLPG----KKDDKDIIGWANKKTEAANKT-SKISSFKDPSIATSKPILDLIDAIVPNSVDFKLLTNEPLQDAKFTISQARRIGARIYALPQHLVDVNQKMVMTVYACLMLLDHQ 616          
BLAST of Plastin 3 vs. Planmine SMEST
Match: SMESG000081126.1 (SMESG000081126.1)

HSP 1 Score: 601.668 bits (1550), Expect = 0.000e+0
Identity = 292/519 (56.26%), Postives = 395/519 (76.11%), Query Frame = 2
Query:  335 DDVQAVRVVSDAEERSYSDWINQALRNEEICQKYLPIDYNKLYEACSDGVLLCKMINYSVPDTIDMRAVNVGKKLETIFCKNENLSLAVQSASSIGCCVVNIGPIDLGNGVKHIVLGLLWQIIRIGLIGKINLANHAELVALLRDGESLEDLKQLSPEEILIRWVNYHMEKANVSRRISNFNTDIMDSEIYTYLINQIAPSECRSKMMPPNEILRSNDNVQRAENVLSNASAMNAKAFVEANDIAMVTQKGKNREKLNMAFVAHLFNNYPALNITEKVIQEFDIVEETLEEKTYRNWMNSMGVEPYLNYLYSDLRNGIALLHLIDVIQPKTVNWETVTTKFNPMRKLFQMQDNCLAFINYAKKLNLKLVGLSAENIRETETTLVLGLCFQLLRKYTFQLLQKLQPNNFNKSVEDKDIIEWANKKCQSTGKSESVIRSFKDLNIRSSKPILHLIDSIKPNSVDYSMITNNPLDDAKYAITVARKIGANVYALPQHVVDLNQKMILTIYACLMLVDLQKHS 1891
            +  QA+  + D+EER +S+WI++ L  + +C  YLPI +++LY    DGVLLCK+IN +VPDT+D R +N G  L+++F KNENL LAV SA +IGCC+VNIGP D+  G KH++LGL+WQ+IRIGL+G +NL +HAELVALLR+ E+L+DLKQL+PEE+L+RWVNYH+EKA +++RI+NF  DI DSEIY++L+ QIAP++ R +M+PP  IL++ DN++RAE +L NAS ++A+ F+E  D+AMVTQ+G+NREKLN+AFVA+LFN YPAL +   +    +I EETLEEKTYRNWMNSMGV PY+  +YSDL+NG+ LL LID++QP  V W  +   F+P +K+FQ+  NC   I YAKKLN  +V LSA+NI++    +VLGLCFQ+LR YT  LL  +         +DKDII WAN K +   K  S I SFKD +I +SKPIL LID+I PNSVD+ ++TN PL DAK+ I+ AR+IGA +YALPQH+VD+NQKM++T+YACLM++D   +S
Sbjct:  107 EGTQAIHTICDSEERGFSNWISRVLSKDPLCASYLPIKHDELYNKLQDGVLLCKLINSAVPDTVDERVMNTGASLKSVFKKNENLCLAVNSAEAIGCCMVNIGPEDIDKGTKHLILGLVWQVIRIGLLGLVNLLHHAELVALLREDETLDDLKQLTPEELLLRWVNYHLEKAGITKRITNFKEDIQDSEIYSHLLYQIAPADKRDEMLPPISILKNTDNMKRAELMLGNASILDARVFIEPEDVAMVTQRGQNREKLNLAFVANLFNTYPALIVDSDI----EIREETLEEKTYRNWMNSMGVTPYVKDIYSDLKNGLVLLQLIDLLQPGIVEWSKIIKVFDPKKKVFQILGNCSYVIEYAKKLNFNIVNLSADNIKDATPNMVLGLCFQMLRFYTMTLLSSV----LRDKKDDKDIIIWANLKTEQANKY-SQISSFKDPSIATSKPILDLIDAIVPNSVDFKLLTNEPLQDAKFTISQARRIGARIYALPQHLVDVNQKMVMTVYACLMMLDFDINS 616          
BLAST of Plastin 3 vs. Planmine SMEST
Match: SMESG000007726.1 (SMESG000007726.1)

HSP 1 Score: 514.227 bits (1323), Expect = 1.287e-175
Identity = 261/519 (50.29%), Postives = 363/519 (69.94%), Query Frame = 2
Query:  335 DDVQAVRVVSDAEERSYSDWINQALRNEE-ICQKYLPIDY--NKLYEACSDGVLLCKMINYSVPDTIDMRAVNVGKKLETIFCKNENLSLAVQSASSIGCCVVNIGPIDLGNGVKHIVLGLLWQIIRIGLIGKINLANHAELVALLRDGESLEDLKQLSPEEILIRWVNYHMEKANVSRRISNFNTDIMDSEIYTYLINQIAPSECRSKMMPPNEILRSNDNVQRAENVLSNASAMNAKAFVEANDIAMVTQKGKNREKLNMAFVAHLFNNYPALNITEKVIQEFDIVEETLEEKTYRNWMNSMGVEPYLNYLYSDLRNGIALLHLIDVIQPKTVNWETVTTKFNPMRKLFQMQDNCLAFINYAKKLNLKLVGLSAENIRETETTLVLGLCFQLLRKYTFQLLQKLQPNNFNKSVEDKDIIEWANKKCQSTGKSESVIRSFKDLNIRSSKPILHLIDSIKPNSVDYSMITNNPLDDAKYAITVARKIGANVYALPQHVVDLNQKMILTIYACLMLVDLQ 1882
            ++ ++   VS AEER YS+WIN  L N+E + +KYLP       +Y+   DG+LLCK+IN +VP+TID R +N G+ L+  F K ENL LA+ SA+SIGCCVVN+GP D+ +G KHI+LGL+WQ+IR GL+G+INL  +  L ALL  GES++DLK+LSPE++LIRWVN+ ++KA+   RI NF  D+M+ E Y YL++QIAP + +S ++ P EI++ ND +QRAE VL NA+ +N+K FV   DI     +GKNREKLN+AF+A+LFN+YP+L   +  I   +I+EETLEEKTYRNW+NS G+   +N  Y D  +G+  L++ D + P  VNW  V   F+  R+LFQ Q NC   I   KK NLK+  +S ENIR  +   +LGLCFQ++R  T ++L+KL      K ++DKDII W N   +  GK+ S I SFKD NI +S P++ L+D+IKP SV YS+I+++ L DA YA+++ARKIGAN + LP H+  LNQKMI+T++A LM+V L+
Sbjct:   98 ENFESKHTVSSAEERGYSEWINTLLENDEDLKEKYLPFTNMNEDVYDKSKDGLLLCKLINKAVPNTIDERVLNKGESLKGFFKKQENLVLAINSAASIGCCVVNVGPGDISDGTKHIMLGLIWQVIRAGLLGQINLVYNPNLTALLFPGESVDDLKKLSPEDLLIRWVNFQLKKADCPTRIRNFKEDVMNCEAYIYLLHQIAPEDKKSLLISPEEIMKVNDPIQRAELVLKNATTLNSKVFVTIEDIVNANVRGKNREKLNLAFIANLFNSYPSLEEIKNEIVI-EIIEETLEEKTYRNWINSQGILTQVNTFYYDTTDGLVFLYIFDKLNPGCVNWSKVVRNFDSKRRLFQEQGNCNEVIEAGKKCNLKIQNMSGENIRNRDKVYILGLCFQMMRYNTIKVLEKLCGG--GKKIDDKDIISWVNDTLEKAGKT-SRITSFKDRNIATSLPVIDLVDAIKPGSVQYSLISSDRLKDASYAVSMARKIGANAFVLPDHIASLNQKMIMTLFASLMIVGLE 612          
BLAST of Plastin 3 vs. Planmine SMEST
Match: SMESG000048251.1 (SMESG000048251.1)

HSP 1 Score: 300.056 bits (767), Expect = 6.540e-94
Identity = 168/506 (33.20%), Postives = 287/506 (56.72%), Query Frame = 2
Query:  368 AEERSYSDWINQALRNEEICQKYLPID--YNKLYEACSDGVLLCKMINYSVPDTIDMRAVNVGKKLETIFCKNENLSLAVQSASSIGCCVVNIGPIDLGNGVKHIVLGLLWQIIRIGLIGKINLANHAELVALLRDGESLEDLKQLSPEEILIRWVNYHMEKANVSRRISNFNTDIMDSEIYTYLINQIAPSECRSKMMPPNEILRSNDNVQRAENVLSNASAMNAKAFVEANDIAMVTQKGKNREKLNMAFVAHLFNNYPA-LNITEKVIQEFDIV--EETLEEKTYRNWMNSMGVEPYLNYLYSDLRNGIALLHLIDVIQPKTVNWETVTTKFNPMRKLFQMQDNCLAFINYAKKLNLKLVGLSAENIRETETTLVLGLCFQLLRKYTFQLLQKLQPNNFNKSVEDKDIIEWANKKCQSTGKSESVIRSFKDLNIRSSKPILHLIDSIKPNSVDYSMITNNPLDDAKYAITVARKIGANVYALPQHVVDLNQKMILTIYACLML 1870
            +E+R+YS WIN+ L N+  C++YLP+D   + +Y+   DGV+LCK++N S+P  ID R +N G++L     K ENL+L + +A   GC + N    D+  GVK+  +  +WQIIRIG +  +   NH E+V L + G+SL+DL++ S  +I+IR+ NYH+ K+ +   +++++ D  D  +Y +L  ++AP+  R KM+ P  I R      RA N++ N   + A++F+  +DI    ++  +  KL++  + +LF ++   L++   V +  +     E LEE T RN++NS  V P+ N++ +D RNG  L  L +V++P   +       F+  R   Q   NC   +  A+   L    L AE I +++ + +LGL  +++R Y  +       +N+     +K+I++WAN + + +GK +S++RSF D  I        +++S+ P  VD S + NN L +A Y +++A K G  VY LP+H V+ N K +   +A LM+
Sbjct:   16 SEKRAYSRWINKVLANDPDCRQYLPLDPYGDDIYDKVQDGVILCKLLNISLPGAIDERTMNRGQRLLNYAQKMENLALVLNAARCRGCSMGNADINDIYAGVKYATIDFIWQIIRIGFLHDVTFHNHPEIVELKKVGDSLDDLREQSSHDIIIRYANYHLSKSGMRNFVNDYDDDFKDCLVYAHLTYRVAPATIRGKMISPTNITRERCVEARARNIIRNLEELGAESFLTEDDIINGFERRDSCSKLHLCTIGYLFKHFNGDLSVHRPVYRTKNNSGNGECLEELTCRNFLNSFDVYPFCNHVLNDCRNGWILGELFEVLRPGYTSGVKFILDFDSNRIHAQRVHNCTKIVKLAQNYVLNTPNLDAEKIADSDKSSILGLIVEMMRAYVCR-------DNY----IEKEILDWANCQLRKSGK-QSMMRSFGDRIIAEDNLFAVVLESVAPGLVDRSCLGNNKLLNAYYYVSIAHKAGIPVYTLPEHFVEGNAKFVALAFATLMV 509          
The following BLAST results are available for this feature:
BLAST of Plastin 3 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
PLS31.814e-13043.43plastin 3 [Source:HGNC Symbol;Acc:HGNC:9091][more]
PLS31.814e-13043.43plastin 3 [Source:HGNC Symbol;Acc:HGNC:9091][more]
LCP15.955e-13043.62lymphocyte cytosolic protein 1 [Source:HGNC Symbol... [more]
LCP15.955e-13043.62lymphocyte cytosolic protein 1 [Source:HGNC Symbol... [more]
PLS31.519e-12742.70plastin 3 [Source:HGNC Symbol;Acc:HGNC:9091][more]
back to top
BLAST of Plastin 3 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
plst-19.126e-10043.89PLaSTin (Actin bundling protein) homolog [Source:... [more]
plst-11.094e-9943.77PLaSTin (Actin bundling protein) homolog [Source:... [more]
Y73B3B.19.702e-3143.54pep chromosome:WBcel235:X:209108:211241:-1 gene:WB... [more]
M116.59.909e-726.61pep chromosome:WBcel235:IV:8414293:8421061:-1 gene... [more]
anc-14.960e-629.46Nuclear anchorage protein 1 [Source:UniProtKB/Swi... [more]
back to top
BLAST of Plastin 3 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Fim1.290e-15044.21gene:FBgn0024238 transcript:FBtr0074442[more]
Fim2.139e-15044.21gene:FBgn0024238 transcript:FBtr0074441[more]
Fim3.432e-15044.21gene:FBgn0024238 transcript:FBtr0074443[more]
kst3.398e-624.41gene:FBgn0004167 transcript:FBtr0300017[more]
kst3.545e-624.41gene:FBgn0004167 transcript:FBtr0332056[more]
back to top
BLAST of Plastin 3 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
lcp12.067e-13443.50lymphocyte cytosolic protein 1 (L-plastin) [Source... [more]
pls38.561e-13444.21plastin 3 (T isoform) [Source:ZFIN;Acc:ZDB-GENE-04... [more]
pls38.561e-13444.21plastin 3 (T isoform) [Source:ZFIN;Acc:ZDB-GENE-04... [more]
pls11.568e-12642.91plastin 1 (I isoform) [Source:ZFIN;Acc:ZDB-GENE-03... [more]
pls13.813e-12642.91plastin 1 (I isoform) [Source:ZFIN;Acc:ZDB-GENE-03... [more]
back to top
BLAST of Plastin 3 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
snx51.798e-13242.77sorting nexin 5 [Source:Xenbase;Acc:XB-GENE-947018... [more]
snx51.564e-13142.77sorting nexin 5 [Source:Xenbase;Acc:XB-GENE-947018... [more]
snx51.871e-13142.77sorting nexin 5 [Source:Xenbase;Acc:XB-GENE-947018... [more]
snx51.985e-13142.77sorting nexin 5 [Source:Xenbase;Acc:XB-GENE-947018... [more]
snx52.506e-13142.77sorting nexin 5 [Source:Xenbase;Acc:XB-GENE-947018... [more]
back to top
BLAST of Plastin 3 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Lcp11.702e-13643.87lymphocyte cytosolic protein 1 [Source:MGI Symbol;... [more]
Lcp11.702e-13643.87lymphocyte cytosolic protein 1 [Source:MGI Symbol;... [more]
Lcp11.702e-13643.87lymphocyte cytosolic protein 1 [Source:MGI Symbol;... [more]
Pls11.187e-13144.38plastin 1 (I-isoform) [Source:MGI Symbol;Acc:MGI:1... [more]
Pls34.660e-13043.24plastin 3 (T-isoform) [Source:MGI Symbol;Acc:MGI:1... [more]
back to top
BLAST of Plastin 3 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q61233|PLSL_MOUSE1.191e-13543.87Plastin-2 OS=Mus musculus OX=10090 GN=Lcp1 PE=1 SV... [more]
sp|Q6P698|PLSL_DANRE1.106e-13343.40Plastin-2 OS=Danio rerio OX=7955 GN=lcp1 PE=2 SV=1[more]
sp|Q3V0K9|PLSI_MOUSE8.306e-13144.38Plastin-1 OS=Mus musculus OX=10090 GN=Pls1 PE=1 SV... [more]
sp|A7E3Q8|PLST_BOVIN3.575e-13043.43Plastin-3 OS=Bos taurus OX=9913 GN=PLS3 PE=2 SV=1[more]
sp|P13797|PLST_HUMAN8.711e-13043.43Plastin-3 OS=Homo sapiens OX=9606 GN=PLS3 PE=1 SV=... [more]
back to top
BLAST of Plastin 3 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A1I8JCX63.310e-17648.79Uncharacterized protein OS=Macrostomum lignano OX=... [more]
A0A1I8JAL89.458e-17649.15Uncharacterized protein OS=Macrostomum lignano OX=... [more]
A0A1I8GSA32.416e-17448.96Uncharacterized protein OS=Macrostomum lignano OX=... [more]
A0A068WCX73.016e-17149.05Plastin 3 OS=Echinococcus granulosus OX=6210 GN=Eg... [more]
A0A068YAJ73.828e-17149.05Plastin 3 OS=Echinococcus multilocularis OX=6211 G... [more]
back to top
BLAST of Plastin 3 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
lcp16.009e-13544.02lymphocyte cytosolic protein 1 (L-plastin) [Source... [more]
pls31.727e-11541.18plastin 3 (T isoform) [Source:ZFIN;Acc:ZDB-GENE-04... [more]
pls12.123e-9336.69plastin 1 (I isoform) [Source:ZFIN;Acc:ZDB-GENE-03... [more]
flna1.050e-624.36filamin A, alpha (actin binding protein 280) [Sour... [more]
si:ch211-165e15.13.315e-624.60si:ch211-165e15.1 [Source:ZFIN;Acc:ZDB-GENE-081028... [more]
back to top
BLAST of Plastin 3 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 1
Match NameE-valueIdentityDescription
lcp19.954e-6537.71lymphocyte cytosolic protein 1 (L-plastin) [Source... [more]
back to top
BLAST of Plastin 3 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 1
Match NameE-valueIdentityDescription
SAC65.944e-9934.17Fimbrin, actin-bundling protein; cooperates with S... [more]
back to top
BLAST of Plastin 3 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 4
Match NameE-valueIdentityDescription
EDO324841.592e-13042.41Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO403822.848e-12842.62Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO324861.379e-2444.76Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO277177.883e-1847.06Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Plastin 3 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
pls31.688e-13342.80plastin-3 [Source:NCBI gene;Acc:101161915][more]
lcp15.785e-13343.02plastin-2 [Source:NCBI gene;Acc:101162720][more]
ENSORLT00000011106.23.884e-13143.32plastin-3-like [Source:NCBI gene;Acc:101157305][more]
pls11.555e-12241.91plastin-1 [Source:NCBI gene;Acc:101168586][more]
pls17.431e-12241.91plastin-1 [Source:NCBI gene;Acc:101168586][more]
back to top
BLAST of Plastin 3 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000070679.10.000e+0100.00SMESG000070679.1[more]
SMESG000081113.10.000e+057.03SMESG000081113.1[more]
SMESG000081126.10.000e+056.26SMESG000081126.1[more]
SMESG000007726.11.287e-17550.29SMESG000007726.1[more]
SMESG000048251.16.540e-9433.20SMESG000048251.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30015879 ID=SMED30015879|Name=Plastin 3|organism=Schmidtea mediterranea sexual|type=transcript|length=1991bp
TGTTTTCTTAGCAAATCCAGGTAAAAAAATAAGCAGTTCACAAACTTGTG
AGATAGATGTTTGTTCTCTAGTAGTTATTTCACGAATATACATATAACAA
ATATACAAGCAATTTATCAAAGATAGCAAATAGTACATTGGACACTTTAT
CTTTATGTTATGCCAAGGTCTGAAGAACCCAAATGTCTATAGATATTATT
GCACATTTTCTTAAAAATTGTGTAGTTTATTTATTCAACAATACATGATC
AATAAATTTGTTTTAAAAAAGAAAAAGTACTTTGTATTTATTTTTAATGT
GATTTATTTTCAGCAAAGTAGCATCAATGGACAAGATGATGTTCAAGCTG
TGAGAGTAGTAAGTGATGCTGAGGAAAGGAGCTATTCAGATTGGATAAAT
CAAGCTCTCAGAAACGAAGAGATCTGTCAAAAATATCTACCAATAGATTA
TAATAAACTTTATGAAGCATGTTCTGATGGCGTTTTGTTGTGTAAAATGA
TAAATTACTCAGTTCCTGATACAATTGACATGAGAGCTGTTAATGTTGGG
AAAAAATTGGAAACAATATTTTGTAAAAATGAAAATTTATCATTAGCTGT
TCAATCAGCTTCATCAATTGGATGTTGTGTAGTAAACATCGGCCCAATAG
ATTTGGGAAACGGTGTAAAACACATCGTACTTGGACTGTTGTGGCAAATA
ATTCGAATAGGTCTAATTGGTAAAATAAATTTAGCAAATCACGCAGAATT
AGTGGCTTTGTTACGTGACGGAGAGAGTCTTGAAGATTTAAAGCAACTAA
GTCCCGAAGAAATTCTAATAAGATGGGTGAATTATCATATGGAAAAAGCC
AATGTTTCCCGAAGAATTTCAAATTTCAATACAGACATTATGGACTCGGA
AATTTATACATATCTTATAAATCAAATTGCACCGAGTGAATGCCGGTCAA
AAATGATGCCGCCCAATGAAATTTTAAGATCAAATGATAACGTTCAGAGA
GCTGAAAATGTCCTTAGCAATGCAAGCGCCATGAACGCTAAAGCGTTTGT
TGAAGCCAATGATATTGCTATGGTTACACAGAAAGGTAAAAATCGCGAAA
AGCTAAATATGGCGTTTGTGGCGCATTTGTTCAACAATTATCCGGCCTTG
AATATCACAGAAAAGGTGATTCAAGAATTCGACATAGTGGAAGAGACTTT
GGAAGAAAAGACTTACAGGAATTGGATGAACTCAATGGGAGTTGAACCTT
ATCTAAATTATCTTTACTCTGATTTACGAAATGGAATAGCATTGCTACAT
TTAATAGACGTAATTCAACCAAAGACGGTCAATTGGGAAACAGTCACTAC
CAAATTCAATCCAATGAGGAAACTTTTCCAAATGCAAGACAACTGTCTAG
CGTTTATTAATTATGCAAAAAAGTTGAATTTAAAATTGGTGGGATTATCA
GCGGAAAACATTCGAGAAACCGAAACGACTTTAGTTTTAGGATTGTGTTT
TCAATTGCTGAGGAAATACACATTCCAATTGCTACAGAAACTGCAGCCGA
ATAACTTCAACAAATCCGTTGAAGACAAGGACATTATTGAATGGGCAAAT
AAAAAATGCCAATCGACTGGAAAGTCAGAGTCTGTTATCAGGTCTTTCAA
AGATCTGAATATAAGATCTTCCAAACCGATACTTCATTTAATAGATTCAA
TCAAACCGAATTCGGTTGATTATTCAATGATAACAAATAATCCCCTAGAT
GATGCAAAATACGCCATAACTGTGGCAAGGAAAATCGGGGCTAACGTTTA
CGCGTTGCCCCAACACGTTGTTGATTTGAACCAGAAAATGATTCTAACTA
TTTACGCGTGTTTGATGTTGGTTGATTTGCAAAAGCATTCATAAATAATT
ATAAAATTCAATATTCAAAATTAATCACTTAACTTGAAATTTAATTTACA
TTTCAATAAATAATTTTTTATTTAAAAAAAACTTTTTTTAG
back to top

protein sequence of SMED30015879-orf-1

>SMED30015879-orf-1 ID=SMED30015879-orf-1|Name=SMED30015879-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=550bp
MINKFVLKKKKYFVFIFNVIYFQQSSINGQDDVQAVRVVSDAEERSYSDW
INQALRNEEICQKYLPIDYNKLYEACSDGVLLCKMINYSVPDTIDMRAVN
VGKKLETIFCKNENLSLAVQSASSIGCCVVNIGPIDLGNGVKHIVLGLLW
QIIRIGLIGKINLANHAELVALLRDGESLEDLKQLSPEEILIRWVNYHME
KANVSRRISNFNTDIMDSEIYTYLINQIAPSECRSKMMPPNEILRSNDNV
QRAENVLSNASAMNAKAFVEANDIAMVTQKGKNREKLNMAFVAHLFNNYP
ALNITEKVIQEFDIVEETLEEKTYRNWMNSMGVEPYLNYLYSDLRNGIAL
LHLIDVIQPKTVNWETVTTKFNPMRKLFQMQDNCLAFINYAKKLNLKLVG
LSAENIRETETTLVLGLCFQLLRKYTFQLLQKLQPNNFNKSVEDKDIIEW
ANKKCQSTGKSESVIRSFKDLNIRSSKPILHLIDSIKPNSVDYSMITNNP
LDDAKYAITVARKIGANVYALPQHVVDLNQKMILTIYACLMLVDLQKHS*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: molecular function
TermDefinition
GO:0051015actin filament binding
GO:0005515protein binding
GO:0003779actin binding
Vocabulary: biological process
TermDefinition
GO:0051017actin filament bundle assembly
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000016pharynx
PLANA:0000026gut
PLANA:0000034epidermis
PLANA:0000070intestinal phagocyte
PLANA:0000103central nervous system
PLANA:0000204ovary
PLANA:0000208testis
PLANA:0000240body wall musculature
PLANA:0002032epidermal cell
PLANA:0003116parenchymal cell
Vocabulary: INTERPRO
TermDefinition
IPR036872CH_dom_sf
IPR039959Fimbrin/Plastin
IPR001715CH-domain
IPR001589Actinin_actin-bd_CS
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR001715Calponin homology domainSMARTSM00033ch_5coord: 43..155
e-value: 3.0E-18
score: 76.6
coord: 443..543
e-value: 6.7E-13
score: 58.9
coord: 320..424
e-value: 2.1E-18
score: 77.1
coord: 187..298
e-value: 2.6E-6
score: 37.0
IPR001715Calponin homology domainPFAMPF00307CHcoord: 443..542
e-value: 4.2E-12
score: 46.2
coord: 186..300
e-value: 1.1E-16
score: 60.9
coord: 43..155
e-value: 6.9E-17
score: 61.6
coord: 320..425
e-value: 2.7E-15
score: 56.5
IPR001715Calponin homology domainPROSITEPS50021CHcoord: 41..157
score: 19.853
IPR001715Calponin homology domainPROSITEPS50021CHcoord: 318..426
score: 20.263
IPR001715Calponin homology domainPROSITEPS50021CHcoord: 185..300
score: 15.396
IPR001715Calponin homology domainPROSITEPS50021CHcoord: 441..545
score: 14.91
IPR001715Calponin homology domainCDDcd00014CHcoord: 43..157
e-value: 1.49707E-17
score: 76.1955
IPR036872CH domain superfamilyGENE3DG3DSA:1.10.418.10coord: 160..296
e-value: 4.8E-36
score: 125.6
IPR036872CH domain superfamilyGENE3DG3DSA:1.10.418.10coord: 37..159
e-value: 5.3E-32
score: 112.3
IPR036872CH domain superfamilyGENE3DG3DSA:1.10.418.10coord: 314..433
e-value: 1.3E-27
score: 98.1
IPR036872CH domain superfamilyGENE3DG3DSA:1.10.418.10coord: 435..542
e-value: 9.2E-27
score: 95.3
IPR036872CH domain superfamilySUPERFAMILYSSF47576Calponin-homology domain, CH-domaincoord: 40..541
NoneNo IPR availablePANTHERPTHR19961:SF18FI19014P1coord: 37..548
IPR039959Fimbrin/PlastinPANTHERPTHR19961FIMBRIN/PLASTINcoord: 37..548
IPR001589Actinin-type actin-binding domain, conserved sitePROSITEPS00019ACTININ_1coord: 320..329