DNA cross-link repair 1C

Overview
NameDNA cross-link repair 1C
Smed IDSMED30015874
Length (bp)1109
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of DNA cross-link repair 1C (SMED30015874) t-SNE clustered cells

Violin plots show distribution of expression levels for DNA cross-link repair 1C (SMED30015874) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of DNA cross-link repair 1C (SMED30015874) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for DNA cross-link repair 1C (SMED30015874) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30015874

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 1

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
head regionSMED30015874h1SMcG0021641 dd_Smed_v6_12096_0_1dd_Smed_v6PMID:28171748
Stückemann et al., 2017
whole organism asexual adult RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of DNA cross-link repair 1C vs. Ensembl Human
Match: DCLRE1C (DNA cross-link repair 1C [Source:HGNC Symbol;Acc:HGNC:17642])

HSP 1 Score: 139.043 bits (349), Expect = 1.342e-36
Identity = 105/344 (30.52%), Postives = 173/344 (50.29%), Query Frame = 3
Query:   42 MSMFSGIIYEYPQIAIDNF---NPLVSTYFISHLHLDHLCGIENFSASHLTE------IYTSDSTAKLILGRNSEFKNIVPYVKPLCLGKSYSIKIKYSDNDQYFS-KDIINVTLISSGHCLGSVMLFIEGKNGRVLYTGDFRLNLENSNQLSSDYKYGIKIMKINYLDGLYLDTTFMNKCCAHIPSREDSFVVIINLIEKILLESLDTIIFIDYKVRYTLEALYHLIYLKFNIKVHVDIKSYYQLKPLDESISFCVDPCNWNSRIHACYMDSHCRKNFEEAK------NKNK----LFTIIPTTLWWSERNLVSNKEVHYIDKFSVRVCFSHHSSFSEIIDFI 1013
            MS F G + EYP I+ID F   N     YF+SH H DH+ G+   +     E      +Y S  T +L+L  + +++    + K   +        + S  D+    K+ I VTL+ +GHC GSVM   +G NG VLYTGDFRL    + ++   +  G    ++  +  +YLDTTF +     IPSRE+    ++ L+   +  S   +++++ K  Y  E L+  +  +  ++VHV+    ++  P  E +       + N++IHAC       + F+ +K      ++N+    + +I P+T+W+ ER+  +N  V    + S R CFS HSS+SEI DF+
Sbjct:    1 MSSFEGQMAEYPTISIDRFDRENLRARAYFLSHCHKDHMKGLRAPTLKRRLECSLKVYLYCSPVTKELLLT-SPKYR----FWKKRIISIEIETPTQISLVDEASGEKEEIVVTLLPAGHCPGSVMFLFQGNNGTVLYTGDFRLAQGEAARMELLHSGG----RVKDIQSVYLDTTFCDPRFYQIPSREECLSGVLELVRSWITRSPYHVVWLNCKAAYGYEYLFTNLSEELGVQVHVNKLDMFRNMP--EILHHLTT--DRNTQIHAC-RHPKAEEYFQWSKLPCGITSRNRIPLHIISIKPSTMWFGERSRKTNVIVR-TGESSYRACFSFHSSYSEIKDFL 329          
BLAST of DNA cross-link repair 1C vs. Ensembl Human
Match: DCLRE1C (DNA cross-link repair 1C [Source:HGNC Symbol;Acc:HGNC:17642])

HSP 1 Score: 137.887 bits (346), Expect = 3.248e-35
Identity = 105/344 (30.52%), Postives = 173/344 (50.29%), Query Frame = 3
Query:   42 MSMFSGIIYEYPQIAIDNF---NPLVSTYFISHLHLDHLCGIENFSASHLTE------IYTSDSTAKLILGRNSEFKNIVPYVKPLCLGKSYSIKIKYSDNDQYFS-KDIINVTLISSGHCLGSVMLFIEGKNGRVLYTGDFRLNLENSNQLSSDYKYGIKIMKINYLDGLYLDTTFMNKCCAHIPSREDSFVVIINLIEKILLESLDTIIFIDYKVRYTLEALYHLIYLKFNIKVHVDIKSYYQLKPLDESISFCVDPCNWNSRIHACYMDSHCRKNFEEAK------NKNK----LFTIIPTTLWWSERNLVSNKEVHYIDKFSVRVCFSHHSSFSEIIDFI 1013
            MS F G + EYP I+ID F   N     YF+SH H DH+ G+   +     E      +Y S  T +L+L  + +++    + K   +        + S  D+    K+ I VTL+ +GHC GSVM   +G NG VLYTGDFRL    + ++   +  G    ++  +  +YLDTTF +     IPSRE+    ++ L+   +  S   +++++ K  Y  E L+  +  +  ++VHV+    ++  P  E +       + N++IHAC       + F+ +K      ++N+    + +I P+T+W+ ER+  +N  V    + S R CFS HSS+SEI DF+
Sbjct:    1 MSSFEGQMAEYPTISIDRFDRENLRARAYFLSHCHKDHMKGLRAPTLKRRLECSLKVYLYCSPVTKELLLT-SPKYR----FWKKRIISIEIETPTQISLVDEASGEKEEIVVTLLPAGHCPGSVMFLFQGNNGTVLYTGDFRLAQGEAARMELLHSGG----RVKDIQSVYLDTTFCDPRFYQIPSREECLSGVLELVRSWITRSPYHVVWLNCKAAYGYEYLFTNLSEELGVQVHVNKLDMFRNMP--EILHHLT--TDRNTQIHAC-RHPKAEEYFQWSKLPCGITSRNRIPLHIISIKPSTMWFGERSRKTNVIVR-TGESSYRACFSFHSSYSEIKDFL 329          
BLAST of DNA cross-link repair 1C vs. Ensembl Human
Match: DCLRE1C (DNA cross-link repair 1C [Source:HGNC Symbol;Acc:HGNC:17642])

HSP 1 Score: 93.2041 bits (230), Expect = 5.177e-20
Identity = 65/219 (29.68%), Postives = 113/219 (51.60%), Query Frame = 3
Query:  387 MLFIEGKNGRVLYTGDFRLNLENSNQLSSDYKYGIKIMKINYLDGLYLDTTFMNKCCAHIPSREDSFVVIINLIEKILLESLDTIIFIDYKVRYTLEALYHLIYLKFNIKVHVDIKSYYQLKPLDESISFCVDPCNWNSRIHACYMDSHCRKNFEEAK------NKNK----LFTIIPTTLWWSERNLVSNKEVHYIDKFSVRVCFSHHSSFSEIIDFI 1013
            M   +G NG VLYTGDFRL    + ++   +  G    ++  +  +YLDTTF +     IPSRE+    ++ L+   +  S   +++++ K  Y  E L+  +  +  ++VHV+    ++  P  E +       + N++IHAC       + F+ +K      ++N+    + +I P+T+W+ ER+  +N  V    + S R CFS HSS+SEI DF+
Sbjct:    1 MFLFQGNNGTVLYTGDFRLAQGEAARMELLHSGG----RVKDIQSVYLDTTFCDPRFYQIPSREECLSGVLELVRSWITRSPYHVVWLNCKAAYGYEYLFTNLSEELGVQVHVNKLDMFRNMP--EILHHLT--TDRNTQIHACRH-PKAEEYFQWSKLPCGITSRNRIPLHIISIKPSTMWFGERSRKTNVIVR-TGESSYRACFSFHSSYSEIKDFL 209          
BLAST of DNA cross-link repair 1C vs. Ensembl Human
Match: DCLRE1C (DNA cross-link repair 1C [Source:HGNC Symbol;Acc:HGNC:17642])

HSP 1 Score: 93.2041 bits (230), Expect = 5.177e-20
Identity = 65/219 (29.68%), Postives = 113/219 (51.60%), Query Frame = 3
Query:  387 MLFIEGKNGRVLYTGDFRLNLENSNQLSSDYKYGIKIMKINYLDGLYLDTTFMNKCCAHIPSREDSFVVIINLIEKILLESLDTIIFIDYKVRYTLEALYHLIYLKFNIKVHVDIKSYYQLKPLDESISFCVDPCNWNSRIHACYMDSHCRKNFEEAK------NKNK----LFTIIPTTLWWSERNLVSNKEVHYIDKFSVRVCFSHHSSFSEIIDFI 1013
            M   +G NG VLYTGDFRL    + ++   +  G    ++  +  +YLDTTF +     IPSRE+    ++ L+   +  S   +++++ K  Y  E L+  +  +  ++VHV+    ++  P  E +       + N++IHAC       + F+ +K      ++N+    + +I P+T+W+ ER+  +N  V    + S R CFS HSS+SEI DF+
Sbjct:    1 MFLFQGNNGTVLYTGDFRLAQGEAARMELLHSGG----RVKDIQSVYLDTTFCDPRFYQIPSREECLSGVLELVRSWITRSPYHVVWLNCKAAYGYEYLFTNLSEELGVQVHVNKLDMFRNMP--EILHHLT--TDRNTQIHACRH-PKAEEYFQWSKLPCGITSRNRIPLHIISIKPSTMWFGERSRKTNVIVR-TGESSYRACFSFHSSYSEIKDFL 209          
BLAST of DNA cross-link repair 1C vs. Ensembl Human
Match: DCLRE1C (DNA cross-link repair 1C [Source:HGNC Symbol;Acc:HGNC:17642])

HSP 1 Score: 93.2041 bits (230), Expect = 5.177e-20
Identity = 65/219 (29.68%), Postives = 113/219 (51.60%), Query Frame = 3
Query:  387 MLFIEGKNGRVLYTGDFRLNLENSNQLSSDYKYGIKIMKINYLDGLYLDTTFMNKCCAHIPSREDSFVVIINLIEKILLESLDTIIFIDYKVRYTLEALYHLIYLKFNIKVHVDIKSYYQLKPLDESISFCVDPCNWNSRIHACYMDSHCRKNFEEAK------NKNK----LFTIIPTTLWWSERNLVSNKEVHYIDKFSVRVCFSHHSSFSEIIDFI 1013
            M   +G NG VLYTGDFRL    + ++   +  G    ++  +  +YLDTTF +     IPSRE+    ++ L+   +  S   +++++ K  Y  E L+  +  +  ++VHV+    ++  P  E +       + N++IHAC       + F+ +K      ++N+    + +I P+T+W+ ER+  +N  V    + S R CFS HSS+SEI DF+
Sbjct:    1 MFLFQGNNGTVLYTGDFRLAQGEAARMELLHSGG----RVKDIQSVYLDTTFCDPRFYQIPSREECLSGVLELVRSWITRSPYHVVWLNCKAAYGYEYLFTNLSEELGVQVHVNKLDMFRNMP--EILHHLT--TDRNTQIHACRH-PKAEEYFQWSKLPCGITSRNRIPLHIISIKPSTMWFGERSRKTNVIVR-TGESSYRACFSFHSSYSEIKDFL 209          
BLAST of DNA cross-link repair 1C vs. Ensembl Celegans
Match: mrt-1 (MoRTal germline [Source:UniProtKB/TrEMBL;Acc:Q8T3E0])

HSP 1 Score: 64.6994 bits (156), Expect = 4.284e-11
Identity = 88/334 (26.35%), Postives = 137/334 (41.02%), Query Frame = 3
Query:  120 FISHLHLDHLCGIENFSASHLTEIYTSDSTAKL---ILGRNSEFKNIVPYVKPLCLGKSYSIKIKYSDNDQYFSKDIINVTLISSGHCLGSVMLFIEG------KNGRVLYTGDFRLN------LENSNQLS--SDYKYGIKIMKINYLDGLY--LDTTFMNKCCAHIPSREDSFVVIINLIEKILLESLDTIIFIDYKV---RYTLEALYHLIYLKFNIKVHVDIKSYYQLKPLDESISFCVDPCNWNSRIHACYMDSHCRKNFEEAKNKNKLFTIIPTTLWWSERNLVSNKEVHYIDKFSVRVCFSHHSSFSEIIDFILKVHSKSIYYCVSQ 1055
            F++H H DH  G++         +Y S  TAKL   I+G  ++       + PL      ++  K+         D   VTL+++ HC G+VM   EG        G VL TGDFR +      L+  NQL   ++ K+GI      YLD  Y  LD  F  +C A                EKILL++++     +  +   R   E L   I    N  + V    Y + K + + + F       N  +   Y D    K     +       I  + L+++  N V++      D+  +R+ +S HSS SEI+ F+   H K+I  C  +
Sbjct:  238 FLTHAHSDHYRGLDK---KWTRSVYCSPETAKLLPHIMGYTADSPPPAGLINPL----EENVPHKF---------DSFQVTLVNANHCPGAVMFVFEGSKIEEIAGGAVLCTGDFRADKMFLESLKPGNQLHWMTEIKFGII-----YLDNTYFSLDMPFPERCEA----------------EKILLKAIEAHPHENIVIPLHRLGREELIQAISRILNEPIMV----YDERKVISDLLDFSS-----NCGVLKQYRDIKVIKKGSYCEISQNSVIIDISMLYYTFGNGVND------DEGIIRIPYSDHSSRSEILKFLSHFHFKTITPCTKK 519          
BLAST of DNA cross-link repair 1C vs. Ensembl Celegans
Match: mrt-1 (MoRTal germline [Source:UniProtKB/TrEMBL;Acc:Q8T3E0])

HSP 1 Score: 64.6994 bits (156), Expect = 4.284e-11
Identity = 88/334 (26.35%), Postives = 137/334 (41.02%), Query Frame = 3
Query:  120 FISHLHLDHLCGIENFSASHLTEIYTSDSTAKL---ILGRNSEFKNIVPYVKPLCLGKSYSIKIKYSDNDQYFSKDIINVTLISSGHCLGSVMLFIEG------KNGRVLYTGDFRLN------LENSNQLS--SDYKYGIKIMKINYLDGLY--LDTTFMNKCCAHIPSREDSFVVIINLIEKILLESLDTIIFIDYKV---RYTLEALYHLIYLKFNIKVHVDIKSYYQLKPLDESISFCVDPCNWNSRIHACYMDSHCRKNFEEAKNKNKLFTIIPTTLWWSERNLVSNKEVHYIDKFSVRVCFSHHSSFSEIIDFILKVHSKSIYYCVSQ 1055
            F++H H DH  G++         +Y S  TAKL   I+G  ++       + PL      ++  K+         D   VTL+++ HC G+VM   EG        G VL TGDFR +      L+  NQL   ++ K+GI      YLD  Y  LD  F  +C A                EKILL++++     +  +   R   E L   I    N  + V    Y + K + + + F       N  +   Y D    K     +       I  + L+++  N V++      D+  +R+ +S HSS SEI+ F+   H K+I  C  +
Sbjct:  238 FLTHAHSDHYRGLDK---KWTRSVYCSPETAKLLPHIMGYTADSPPPAGLINPL----EENVPHKF---------DSFQVTLVNANHCPGAVMFVFEGSKIEEIAGGAVLCTGDFRADKMFLESLKPGNQLHWMTEIKFGII-----YLDNTYFSLDMPFPERCEA----------------EKILLKAIEAHPHENIVIPLHRLGREELIQAISRILNEPIMV----YDERKVISDLLDFSS-----NCGVLKQYRDIKVIKKGSYCEISQNSVIIDISMLYYTFGNGVND------DEGIIRIPYSDHSSRSEILKFLSHFHFKTITPCTKK 519          
BLAST of DNA cross-link repair 1C vs. Ensembl Fly
Match: Snm1 (gene:FBgn0037338 transcript:FBtr0078688)

HSP 1 Score: 55.4546 bits (132), Expect = 4.330e-8
Identity = 45/149 (30.20%), Postives = 74/149 (49.66%), Query Frame = 3
Query:  108 VSTYFISHLHLDHLCGIENFSASHLTEIYTSDSTAKLILGRNSEFKNIVPYVKPLCLGKSYSIKIKYSDNDQYFSKDIINVTLISSGHCLGSVMLFIEGKNGR-VLYTGDFRLNLENSNQLSSDYKYGIKIMKINYLDGLYLDTTFMNK 551
            V+ YF++H H DH  G+   +      +Y S  +A+L+            ++K   L +++  +I   D DQ    D + VT + + HC G++M F +  +G  +L+TGDFR         S+D +        + +D LYLDTT+MNK
Sbjct:  288 VTHYFLTHFHADHYIGL---TKKFCHPLYVSPISARLVRT----------FIK---LDETHIHEI---DVDQTLDVDGVQVTALEANHCPGALMFFFKLSSGECILHTGDFR--------ASADMESLPIFWNHSNIDLLYLDTTYMNK 409          
BLAST of DNA cross-link repair 1C vs. Ensembl Zebrafish
Match: dclre1c (DNA cross-link repair 1C, PSO2 homolog (S. cerevisiae) [Source:NCBI gene;Acc:566285])

HSP 1 Score: 140.198 bits (352), Expect = 2.750e-36
Identity = 110/356 (30.90%), Postives = 177/356 (49.72%), Query Frame = 3
Query:   42 MSMFSGIIYEYPQIAIDNF---NPLVSTYFISHLHLDHLCGIEN------FSASHLTEIYTSDSTAKLILGRNSEFKNIVPYVKPLCLGKSYSIKIKYSDNDQYFSKDIINVTLISSGHCLGSVMLFIEGKNGRVLYTGDFRLNLENSNQLSSDYKYGIKIMKINYLDGLYLDTTFMNKCCAHIPSREDSFVVIINLIEKILLESLDTIIFIDYKVRYTLEALYHLIYLKFNIKVHVDIKSYYQLKPLDESISFCVDPCNWNSRIHACYMDSHCRKNFEEAKNKNKL--------------FTIIPTTLWWSERNLVSNKEVHYIDKFSVRVCFSHHSSFSEIIDFILKVHSKSIY 1040
            MS F+G + EYP I++D F   N     YF+SH H DH+ G++          S   ++Y S  T +L+L  N  +     ++ PL L    SI +   D     ++D++ VTL+S+GHC GSVM   EG  G VLYTGDFRL + ++ ++    +Y     ++  +  +Y+DTTF +     IPSRE     I  L++  + +S   +++++ K  Y  E L+  +  +FN ++HV+    ++  P       C    N  ++IHAC    H +   EE    N+L               +I P+T+W+ ER   ++  V  +   S R CFS HSS+ E+ DF+  +   +IY
Sbjct:    1 MSSFAGRMKEYPSISLDRFDRENLHARAYFLSHCHKDHMKGLKGPLLKRKLKFSLTVKLYCSYVTKELLLS-NPRYAFWEDHIVPLELDSPTSISL--IDESTGETEDVV-VTLLSAGHCPGSVMFLFEGAKGTVLYTGDFRLAVGDAARM----EYLHSGDRVKDIQSVYIDTTFFDPKYYQIPSREACLAGIQQLVQDWICQSPYHVVWLNCKAAYGYEYLFTNLGQEFNSQIHVNSLDMFKKMPE----ILCHVTTNRATQIHAC---RHPKD--EEFFRANRLPCGSTAPDGIPLNIISIKPSTIWFGERTRKTSVVVK-MGSSSYRACFSFHSSYLEVKDFLSYICPVNIY 338          
BLAST of DNA cross-link repair 1C vs. Ensembl Zebrafish
Match: dclre1c (DNA cross-link repair 1C, PSO2 homolog (S. cerevisiae) [Source:NCBI gene;Acc:566285])

HSP 1 Score: 140.198 bits (352), Expect = 2.750e-36
Identity = 110/356 (30.90%), Postives = 177/356 (49.72%), Query Frame = 3
Query:   42 MSMFSGIIYEYPQIAIDNF---NPLVSTYFISHLHLDHLCGIEN------FSASHLTEIYTSDSTAKLILGRNSEFKNIVPYVKPLCLGKSYSIKIKYSDNDQYFSKDIINVTLISSGHCLGSVMLFIEGKNGRVLYTGDFRLNLENSNQLSSDYKYGIKIMKINYLDGLYLDTTFMNKCCAHIPSREDSFVVIINLIEKILLESLDTIIFIDYKVRYTLEALYHLIYLKFNIKVHVDIKSYYQLKPLDESISFCVDPCNWNSRIHACYMDSHCRKNFEEAKNKNKL--------------FTIIPTTLWWSERNLVSNKEVHYIDKFSVRVCFSHHSSFSEIIDFILKVHSKSIY 1040
            MS F+G + EYP I++D F   N     YF+SH H DH+ G++          S   ++Y S  T +L+L  N  +     ++ PL L    SI +   D     ++D++ VTL+S+GHC GSVM   EG  G VLYTGDFRL + ++ ++    +Y     ++  +  +Y+DTTF +     IPSRE     I  L++  + +S   +++++ K  Y  E L+  +  +FN ++HV+    ++  P       C    N  ++IHAC    H +   EE    N+L               +I P+T+W+ ER   ++  V  +   S R CFS HSS+ E+ DF+  +   +IY
Sbjct:    1 MSSFAGRMKEYPSISLDRFDRENLHARAYFLSHCHKDHMKGLKGPLLKRKLKFSLTVKLYCSYVTKELLLS-NPRYAFWEDHIVPLELDSPTSISL--IDESTGETEDVV-VTLLSAGHCPGSVMFLFEGAKGTVLYTGDFRLAVGDAARM----EYLHSGDRVKDIQSVYIDTTFFDPKYYQIPSREACLAGIQQLVQDWICQSPYHVVWLNCKAAYGYEYLFTNLGQEFNSQIHVNSLDMFKKMPE----ILCHVTTNRATQIHAC---RHPKD--EEFFRANRLPCGSTAPDGIPLNIISIKPSTIWFGERTRKTSVVVK-MGSSSYRACFSFHSSYLEVKDFLSYICPVNIY 338          
BLAST of DNA cross-link repair 1C vs. Ensembl Zebrafish
Match: dclre1c (DNA cross-link repair 1C, PSO2 homolog (S. cerevisiae) [Source:NCBI gene;Acc:566285])

HSP 1 Score: 117.087 bits (292), Expect = 3.104e-28
Identity = 101/356 (28.37%), Postives = 166/356 (46.63%), Query Frame = 3
Query:   42 MSMFSGIIYEYPQIAIDNF---NPLVSTYFISHLHLDHLCGIEN------FSASHLTEIYTSDSTAKLILGRNSEFKNIVPYVKPLCLGKSYSIKIKYSDNDQYFSKDIINVTLISSGHCLGSVMLFIEGKNGRVLYTGDFRLNLENSNQLSSDYKYGIKIMKINYLDGLYLDTTFMNKCCAHIPSREDSFVVIINLIEKILLESLDTIIFIDYKVRYTLEALYHLIYLKFNIKVHVDIKSYYQLKPLDESISFCVDPCNWNSRIHACYMDSHCRKNFEEAKNKNKL--------------FTIIPTTLWWSERNLVSNKEVHYIDKFSVRVCFSHHSSFSEIIDFILKVHSKSIY 1040
            MS F+G + EYP I++D F   N     YF+SH H DH+ G++          S   ++Y S  T +L+L  N  +     ++ PL L    +I +   D     ++D++ VTL+S+GHC GSVM   EG  G VLYTGDFRL + ++ +                ++ L+    F +K    +P  E     I  L++  + +S   +++++ K  Y  E L+  +  +F+ ++HV+    ++  P       C    N  ++IHAC          EE    N+L               +I P+T+W+ ER   ++  V  +   S R CFS HSS+ E+ DF+  +   +IY
Sbjct:    1 MSSFAGRMKEYPSISLDRFDRENLHARAYFLSHCHKDHMKGLKGPLLKRKLKFSLTVKLYCSYVTKELLLS-NPRYAFWEDHIVPLELDSPTNISL--IDESTGETEDVV-VTLLSAGHCPGSVMFLFEGAKGTVLYTGDFRLAVGDAAR----------------MEYLHSGDRFSDKDFFKMPHLEACLAGIQQLVQDWICQSPYHVVWLNCKAAYGYEYLFTNLGQEFSSQIHVNSLDMFKKMPE----ILCHVTTNRATQIHACR-----HPKDEEFFRANRLPCGSTAPDGIPLNIISIKPSTIWFGERTRKTSVVVK-MGSSSYRACFSFHSSYLEVKDFLSYICPVNIY 326          
BLAST of DNA cross-link repair 1C vs. Ensembl Zebrafish
Match: dclre1b (DNA cross-link repair 1B [Source:NCBI gene;Acc:768137])

HSP 1 Score: 77.0258 bits (188), Expect = 5.708e-15
Identity = 84/310 (27.10%), Postives = 135/310 (43.55%), Query Frame = 3
Query:  108 VSTYFISHLHLDHLCGIENFSASHLTEIYTSDSTAKLILGRNSEFKNIVPYVKPLCLGKSYSIKIKYSDNDQYFSKDIINVTLISSGHCLGSVMLFIEGKNGRVLYTGDFRLNLENSNQLSSDYKYGIKIMKINYL------DGLYLDTTFMNKCCAHIPSREDSFVVIINLIEKILLESLDTIIFIDYKVRYTL--EALYHLIYLKFNIKVHVDIKSYYQLKPLDESISFCVDPCNWNSRIHACYMDSHCRKNFEEAKNKNKLFTIIPTTLWWSERNLVSNKEVHYIDKFSVRVCFSHHSSFSEIIDFI 1013
            V  +F+SH+H DH CG+ + + SH   IY S  TAKL+     + +    +++PL +G+ + + +          K+ + V LI + HC G+VM   +G  G  LYTGDFR              Y   ++++  L      D LYLD T  +   A +PSR+ +       I++I+ +     + I     Y+L  E+L   + ++F   V VD +    L+ L     F  D  +   RI           N            I+PT+     R +VS     Y+      V +S HSS+ E+ DF+
Sbjct:   24 VRLFFLSHMHSDHTCGLSS-TWSH-RPIYCSPLTAKLL---RLKLQIKQKWIRPLEIGQDHMLML------DDLGKERLTVNLIDANHCPGAVMFLFQGYFGTRLYTGDFR--------------YTPSMLRVPCLQNHINIDVLYLDNTNCDPTRA-LPSRQQA----TQQIKQIIRDHPGYAVVIGL---YSLGKESLLVDLAMEFKTWVEVDRERLETLRVLQLPDVFTTD--SGAGRIRVVNQSMISASNLMAWNKLQSTIAILPTS-----RPMVSCHPNVYV------VPYSDHSSYQELEDFV 287          
BLAST of DNA cross-link repair 1C vs. Ensembl Zebrafish
Match: dclre1b (DNA cross-link repair 1B [Source:NCBI gene;Acc:768137])

HSP 1 Score: 77.0258 bits (188), Expect = 5.708e-15
Identity = 84/310 (27.10%), Postives = 135/310 (43.55%), Query Frame = 3
Query:  108 VSTYFISHLHLDHLCGIENFSASHLTEIYTSDSTAKLILGRNSEFKNIVPYVKPLCLGKSYSIKIKYSDNDQYFSKDIINVTLISSGHCLGSVMLFIEGKNGRVLYTGDFRLNLENSNQLSSDYKYGIKIMKINYL------DGLYLDTTFMNKCCAHIPSREDSFVVIINLIEKILLESLDTIIFIDYKVRYTL--EALYHLIYLKFNIKVHVDIKSYYQLKPLDESISFCVDPCNWNSRIHACYMDSHCRKNFEEAKNKNKLFTIIPTTLWWSERNLVSNKEVHYIDKFSVRVCFSHHSSFSEIIDFI 1013
            V  +F+SH+H DH CG+ + + SH   IY S  TAKL+     + +    +++PL +G+ + + +          K+ + V LI + HC G+VM   +G  G  LYTGDFR              Y   ++++  L      D LYLD T  +   A +PSR+ +       I++I+ +     + I     Y+L  E+L   + ++F   V VD +    L+ L     F  D  +   RI           N            I+PT+     R +VS     Y+      V +S HSS+ E+ DF+
Sbjct:   24 VRLFFLSHMHSDHTCGLSS-TWSH-RPIYCSPLTAKLL---RLKLQIKQKWIRPLEIGQDHMLML------DDLGKERLTVNLIDANHCPGAVMFLFQGYFGTRLYTGDFR--------------YTPSMLRVPCLQNHINIDVLYLDNTNCDPTRA-LPSRQQA----TQQIKQIIRDHPGYAVVIGL---YSLGKESLLVDLAMEFKTWVEVDRERLETLRVLQLPDVFTTD--SGAGRIRVVNQSMISASNLMAWNKLQSTIAILPTS-----RPMVSCHPNVYV------VPYSDHSSYQELEDFV 287          
BLAST of DNA cross-link repair 1C vs. Ensembl Xenopus
Match: DCLRE1C (DNA cross-link repair 1C [Source:NCBI gene;Acc:100493603])

HSP 1 Score: 133.265 bits (334), Expect = 3.294e-34
Identity = 107/354 (30.23%), Postives = 170/354 (48.02%), Query Frame = 3
Query:   42 MSMFSGIIYEYPQIAIDNF---NPLVSTYFISHLHLDHLCGIE------NFSASHLTEIYTSDSTAKLILGRNSEFKNIVPYVKPLCLGKSYSIKIKYSDNDQYFSKDIINVTLISSGHCLGSVMLFIEGKNGRVLYTGDFRLNLENSNQLSSDYKYGIKIMKINYLDGLYLDTTFMNKCCAHIPSREDSFVVIINLIEKILLESLDTIIFIDYKVRYTLEALYHLIYLKFNIKVHVDIKSYYQLKPLDESISFCVDPCNWNSRIHACYM---DSHCRKN------FEEAKNKNKLFTIIPTTLWWSERNLVSNKEVHYIDKFSVRVCFSHHSSFSEIIDFILKVHSKSIYYCV 1049
            MS F G + EYP I+ID F   N     YF+SH H DH+ G+           S    +Y S  T +L+L   +  K      + + +      +I   D    + +D++ VTL+ +GHC GSVM   +G +G VLYTGDFRL      ++   +       ++  ++ +YLDTTF +     IPSRE+    I+ L+   +  S   +++++ K  Y  E L+  +  +F  KVHV+    ++  P  E +S      +  ++IHAC     +   R N      F +      + +I P+T+W+ ER   +N  V    + S R CFS HSS+SEI DF+  +   ++Y  V
Sbjct:    1 MSSFMGRMKEYPAISIDRFDRENLSARAYFLSHCHKDHMKGLRAPFLKRRLQNSLKVHLYCSPVTKELLL---TNPKYAFWENRMISIEIDTPTQISLVDEATGYKEDVV-VTLLPAGHCPGSVMFLFQGNSGTVLYTGDFRLAKGEVARMELLHSGN----RLKDIESVYLDTTFCDPKYYQIPSREECLSGILELVRSWITLSPFHVVWLNCKAAYGYEYLFTNLSEEFGAKVHVNKLDMFKNMP--EILSHIT--TDRRTQIHACRHPVNEEFTRANRMPCGMFSDDGIPLHVISIKPSTIWFGERTRRTNVIVR-TGESSYRACFSFHSSYSEIKDFLGYIKPMNVYANV 341          
BLAST of DNA cross-link repair 1C vs. Ensembl Xenopus
Match: DCLRE1C (DNA cross-link repair 1C [Source:NCBI gene;Acc:100493603])

HSP 1 Score: 132.88 bits (333), Expect = 1.455e-33
Identity = 107/354 (30.23%), Postives = 170/354 (48.02%), Query Frame = 3
Query:   42 MSMFSGIIYEYPQIAIDNF---NPLVSTYFISHLHLDHLCGIE------NFSASHLTEIYTSDSTAKLILGRNSEFKNIVPYVKPLCLGKSYSIKIKYSDNDQYFSKDIINVTLISSGHCLGSVMLFIEGKNGRVLYTGDFRLNLENSNQLSSDYKYGIKIMKINYLDGLYLDTTFMNKCCAHIPSREDSFVVIINLIEKILLESLDTIIFIDYKVRYTLEALYHLIYLKFNIKVHVDIKSYYQLKPLDESISFCVDPCNWNSRIHACYM---DSHCRKN------FEEAKNKNKLFTIIPTTLWWSERNLVSNKEVHYIDKFSVRVCFSHHSSFSEIIDFILKVHSKSIYYCV 1049
            MS F G + EYP I+ID F   N     YF+SH H DH+ G+           S    +Y S  T +L+L   +  K      + + +      +I   D    + +D++ VTL+ +GHC GSVM   +G +G VLYTGDFRL      ++   +       ++  ++ +YLDTTF +     IPSRE+    I+ L+   +  S   +++++ K  Y  E L+  +  +F  KVHV+    ++  P  E +S      +  ++IHAC     +   R N      F +      + +I P+T+W+ ER   +N  V    + S R CFS HSS+SEI DF+  +   ++Y  V
Sbjct:    1 MSSFMGRMKEYPAISIDRFDRENLSARAYFLSHCHKDHMKGLRAPFLKRRLQNSLKVHLYCSPVTKELLL---TNPKYAFWENRMISIEIDTPTQISLVDEATGYKEDVV-VTLLPAGHCPGSVMFLFQGNSGTVLYTGDFRLAKGEVARMELLHSGN----RLKDIESVYLDTTFCDPKYYQIPSREECLSGILELVRSWITLSPFHVVWLNCKAAYGYEYLFTNLSEEFGAKVHVNKLDMFKNMP--EILSHIT--TDRRTQIHACRHPVNEEFTRANRMPCGMFSDDGIPLHVISIKPSTIWFGERTRRTNVIVR-TGESSYRACFSFHSSYSEIKDFLGYIKPMNVYANV 341          
BLAST of DNA cross-link repair 1C vs. Ensembl Xenopus
Match: DCLRE1C (DNA cross-link repair 1C [Source:NCBI gene;Acc:100493603])

HSP 1 Score: 132.88 bits (333), Expect = 1.752e-33
Identity = 107/356 (30.06%), Postives = 173/356 (48.60%), Query Frame = 3
Query:   42 MSMFSGIIYEYPQIAIDNF---NPLVSTYFISHLHLDHLCGIE------NFSASHLTEIYTSDSTAKLIL--GRNSEFKNIVPYVKPLCLGKSYSIKIKYSDNDQYFSKDIINVTLISSGHCLGSVMLFIEGKNGRVLYTGDFRLNLENSNQLSSDYKYGIKIMKINYLDGLYLDTTFMNKCCAHIPSREDSFVVIINLIEKILLESLDTIIFIDYKVRYTLEALYHLIYLKFNIKVHVDIKSYYQLKPLDESISFCVDPCNWNSRIHACYM---DSHCRKN------FEEAKNKNKLFTIIPTTLWWSERNLVSNKEVHYIDKFSVRVCFSHHSSFSEIIDFILKVHSKSIYYCV 1049
            MS F G + EYP I+ID F   N     YF+SH H DH+ G+           S    +Y S  T +L+L   + + ++N +     + +      +I   D    + +D++ VTL+ +GHC GSVM   +G +G VLYTGDFRL      ++   +       ++  ++ +YLDTTF +     IPSRE+    I+ L+   +  S   +++++ K  Y  E L+  +  +F  KVHV+    ++  P  E +S      +  ++IHAC     +   R N      F +      + +I P+T+W+ ER   +N  V    + S R CFS HSS+SEI DF+  +   ++Y  V
Sbjct:    1 MSSFMGRMKEYPAISIDRFDRENLSARAYFLSHCHKDHMKGLRAPFLKRRLQNSLKVHLYCSPVTKELLLTNPKYAFWENRM-----ISIEIDTPTQISLVDEATGYKEDVV-VTLLPAGHCPGSVMFLFQGNSGTVLYTGDFRLAKGEVARMELLHSGN----RLKDIESVYLDTTFCDPKYYQIPSREECLSGILELVRSWITLSPFHVVWLNCKAAYGYEYLFTNLSEEFGAKVHVNKLDMFKNMP--EILSHIT--TDRRTQIHACRHPVNEEFTRANRMPCGMFSDDGIPLHVISIKPSTIWFGERTRRTNVIVR-TGESSYRACFSFHSSYSEIKDFLGYIKPMNVYANV 341          
BLAST of DNA cross-link repair 1C vs. Ensembl Xenopus
Match: DCLRE1C (DNA cross-link repair 1C [Source:NCBI gene;Acc:100493603])

HSP 1 Score: 132.88 bits (333), Expect = 1.840e-33
Identity = 107/354 (30.23%), Postives = 170/354 (48.02%), Query Frame = 3
Query:   42 MSMFSGIIYEYPQIAIDNF---NPLVSTYFISHLHLDHLCGIE------NFSASHLTEIYTSDSTAKLILGRNSEFKNIVPYVKPLCLGKSYSIKIKYSDNDQYFSKDIINVTLISSGHCLGSVMLFIEGKNGRVLYTGDFRLNLENSNQLSSDYKYGIKIMKINYLDGLYLDTTFMNKCCAHIPSREDSFVVIINLIEKILLESLDTIIFIDYKVRYTLEALYHLIYLKFNIKVHVDIKSYYQLKPLDESISFCVDPCNWNSRIHACYM---DSHCRKN------FEEAKNKNKLFTIIPTTLWWSERNLVSNKEVHYIDKFSVRVCFSHHSSFSEIIDFILKVHSKSIYYCV 1049
            MS F G + EYP I+ID F   N     YF+SH H DH+ G+           S    +Y S  T +L+L   +  K      + + +      +I   D    + +D++ VTL+ +GHC GSVM   +G +G VLYTGDFRL      ++   +       ++  ++ +YLDTTF +     IPSRE+    I+ L+   +  S   +++++ K  Y  E L+  +  +F  KVHV+    ++  P  E +S      +  ++IHAC     +   R N      F +      + +I P+T+W+ ER   +N  V    + S R CFS HSS+SEI DF+  +   ++Y  V
Sbjct:    1 MSSFMGRMKEYPAISIDRFDRENLSARAYFLSHCHKDHMKGLRAPFLKRRLQNSLKVHLYCSPVTKELLL---TNPKYAFWENRMISIEIDTPTQISLVDEATGYKEDVV-VTLLPAGHCPGSVMFLFQGNSGTVLYTGDFRLAKGEVARMELLHSGN----RVKDIESVYLDTTFCDPKYYQIPSREECLSGILELVRSWITLSPFHVVWLNCKAAYGYEYLFTNLSEEFGAKVHVNKLDMFKNMP--EILSHIT--TDRRTQIHACRHPVNEEFTRANRMPCGMFSDDGIPLHVISIKPSTIWFGERTRRTNVIVR-TGESSYRACFSFHSSYSEIKDFLGYIKPMNVYANV 341          
BLAST of DNA cross-link repair 1C vs. Ensembl Xenopus
Match: DCLRE1C (DNA cross-link repair 1C [Source:NCBI gene;Acc:100493603])

HSP 1 Score: 129.028 bits (323), Expect = 3.349e-32
Identity = 109/364 (29.95%), Postives = 176/364 (48.35%), Query Frame = 3
Query:   42 MSMFSGIIYEYPQIAIDNF---NPLVSTYFISHLHLDHLCGIE------NFSASHLTEIYTSDSTAKLIL--GRNSEFKNIVPYVKPLCLGKSYSIKIKYSDNDQYFSKDIINVTLISSGHCLGSVMLFIEGKNGRVLYTGDFRLNLENSNQLSSDYKYGIKIMKINYLDGLYLDTTFMNKCCAHIPSREDSFVVIINLIEKILLESLDTIIFIDYKVRYTLEALYHLIYLKFNIKVHVDIKSYYQLKPLDESISFCVDPCNWNSRIHACYM---DSHCRKN------FEEAKNKNKLFTIIPTTLWWSERNLVSNKEVHYIDKFSVRVCFSHHSSFSE-IIDFILKVHSKSIYYCVSQTCNTL 1070
            MS F G + EYP I+ID F   N     YF+SH H DH+ G+           S    +Y S  T +L+L   + + ++N     + + +      +I   D    + +D++ VTL+ +GHC GSVM   +G +G VLYTGDFRL      ++   +       ++  ++ +YLDTTF +     IPSRE+    I+ L+   +  S   +++++ K  Y  E L+  +  +F  KVHV+    ++  P  E +S      +  ++IHAC     +   R N      F +      + +I P+T+W+ ER   +N  V    + S R CFS HSS+SE I++  L  +++     V QTC T 
Sbjct:    1 MSSFMGRMKEYPAISIDRFDRENLSARAYFLSHCHKDHMKGLRAPFLKRRLQNSLKVHLYCSPVTKELLLTNPKYAFWEN-----RMISIEIDTPTQISLVDEATGYKEDVV-VTLLPAGHCPGSVMFLFQGNSGTVLYTGDFRLAKGEVARMELLHSGN----RVKDIESVYLDTTFCDPKYYQIPSREECLSGILELVRSWITLSPFHVVWLNCKAAYGYEYLFTNLSEEFGAKVHVNKLDMFKNMP--EILSHIT--TDRRTQIHACRHPVNEEFTRANRMPCGMFSDDGIPLHVISIKPSTIWFGERTRRTNVIVR-TGESSYRACFSFHSSYSELIVNDRLLCYAEVYINPVFQTCKTF 349          
BLAST of DNA cross-link repair 1C vs. Ensembl Mouse
Match: Dclre1c (DNA cross-link repair 1C [Source:MGI Symbol;Acc:MGI:2441769])

HSP 1 Score: 144.05 bits (362), Expect = 3.071e-38
Identity = 110/345 (31.88%), Postives = 169/345 (48.99%), Query Frame = 3
Query:   42 MSMFSGIIYEYPQIAIDNF---NPLVSTYFISHLHLDHLCGIENFSASHLTE------IYTSDSTAKLIL--GRNSEFKNIVPYVKPLCLGKSYSIKIKYSDNDQYFSKDIINVTLISSGHCLGSVMLFIEGKNGRVLYTGDFRLNLENSNQLSSDYKYGIKIMKINYLDGLYLDTTFMNKCCAHIPSREDSFVVIINLIEKILLESLDTIIFIDYKVRYTLEALYHLIYLKFNIKVHVDIKSYYQLKPLDESISFCVDPCNWNSRIHACYMDSHCRKNFE--------EAKNKNKLFTII--PTTLWWSERNLVSNKEVHYIDKFSVRVCFSHHSSFSEIIDFI 1013
            MS F G + EYP I+ID F   N     YF+SH H DH+ G+   S     E      +Y S  T +L+L   +   ++N +     + +      +I   D      ++++ VTL+ +GHC GSVM   +G NG VLYTGDFRL    ++++   +  G    ++  +  +YLDTTF +     IPSRE     I+ L+   +  S   +++++ K  Y  E L+  +  +  ++VHVD    ++  P D       D    N++IHAC       + F+         ++NK  L TI   P+T+W+ ER   +N  V    + S R CFS HSSFSEI DF+
Sbjct:    1 MSSFQGQMAEYPTISIDRFDRENLKARAYFLSHCHKDHMKGLRAPSLKRRLECSLKVFLYCSPVTKELLLTSPKYRFWENRI-----ITIEIETPTQISLVDEASGEKEEVV-VTLLPAGHCPGSVMFLFQGSNGTVLYTGDFRLAKGEASRMELLHSGG----RVKDIQSVYLDTTFCDPRFYQIPSREQCLRGILELVRSWVTRSPHHVVWLNCKAAYGYEYLFTNLSEELGVQVHVDKLDMFKNMP-DILHHLTTDR---NTQIHAC-RHPKAEECFQWNKLPCGITSQNKTALHTISIKPSTMWFGERTRKTNVIVR-TGESSYRACFSFHSSFSEIKDFL 329          
BLAST of DNA cross-link repair 1C vs. Ensembl Mouse
Match: Dclre1c (DNA cross-link repair 1C [Source:MGI Symbol;Acc:MGI:2441769])

HSP 1 Score: 143.665 bits (361), Expect = 1.180e-37
Identity = 110/345 (31.88%), Postives = 169/345 (48.99%), Query Frame = 3
Query:   42 MSMFSGIIYEYPQIAIDNF---NPLVSTYFISHLHLDHLCGIENFSASHLTE------IYTSDSTAKLIL--GRNSEFKNIVPYVKPLCLGKSYSIKIKYSDNDQYFSKDIINVTLISSGHCLGSVMLFIEGKNGRVLYTGDFRLNLENSNQLSSDYKYGIKIMKINYLDGLYLDTTFMNKCCAHIPSREDSFVVIINLIEKILLESLDTIIFIDYKVRYTLEALYHLIYLKFNIKVHVDIKSYYQLKPLDESISFCVDPCNWNSRIHACYMDSHCRKNFE--------EAKNKNKLFTII--PTTLWWSERNLVSNKEVHYIDKFSVRVCFSHHSSFSEIIDFI 1013
            MS F G + EYP I+ID F   N     YF+SH H DH+ G+   S     E      +Y S  T +L+L   +   ++N +     + +      +I   D      ++++ VTL+ +GHC GSVM   +G NG VLYTGDFRL    ++++   +  G    ++  +  +YLDTTF +     IPSRE     I+ L+   +  S   +++++ K  Y  E L+  +  +  ++VHVD    ++  P D       D    N++IHAC       + F+         ++NK  L TI   P+T+W+ ER   +N  V    + S R CFS HSSFSEI DF+
Sbjct:    1 MSSFQGQMAEYPTISIDRFDRENLKARAYFLSHCHKDHMKGLRAPSLKRRLECSLKVFLYCSPVTKELLLTSPKYRFWENRI-----ITIEIETPTQISLVDEASGEKEEVV-VTLLPAGHCPGSVMFLFQGSNGTVLYTGDFRLAKGEASRMELLHSGG----RVKDIQSVYLDTTFCDPRFYQIPSREQCLRGILELVRSWVTRSPHHVVWLNCKAAYGYEYLFTNLSEELGVQVHVDKLDMFKNMP-DILHHLTTD---RNTQIHAC-RHPKAEECFQWNKLPCGITSQNKTALHTISIKPSTMWFGERTRKTNVIVR-TGESSYRACFSFHSSFSEIKDFL 329          
BLAST of DNA cross-link repair 1C vs. Ensembl Mouse
Match: Dclre1c (DNA cross-link repair 1C [Source:MGI Symbol;Acc:MGI:2441769])

HSP 1 Score: 142.895 bits (359), Expect = 4.854e-37
Identity = 110/345 (31.88%), Postives = 168/345 (48.70%), Query Frame = 3
Query:   42 MSMFSGIIYEYPQIAIDNF---NPLVSTYFISHLHLDHLCGIENFSASHLTE------IYTSDSTAKLILGRNSE--FKNIVPYVKPLCLGKSYSIKIKYSDNDQYFSKDIINVTLISSGHCLGSVMLFIEGKNGRVLYTGDFRLNLENSNQLSSDYKYGIKIMKINYLDGLYLDTTFMNKCCAHIPSREDSFVVIINLIEKILLESLDTIIFIDYKVRYTLEALYHLIYLKFNIKVHVDIKSYYQLKPLDESISFCVDPCNWNSRIHACYMDSHCRKNFE--------EAKNKNKLFTII--PTTLWWSERNLVSNKEVHYIDKFSVRVCFSHHSSFSEIIDFI 1013
            MS F G + EYP I+ID F   N     YF+SH H DH+ G+   S     E      +Y S  T +L+L       ++N +     + +      +I   D      ++++ VTL+ +GHC GSVM   +G NG VLYTGDFRL    ++++   +  G    ++  +  +YLDTTF +     IPSRE     I+ L+   +  S   +++++ K  Y  E L+  +  +  ++VHVD    ++  P D       D    N++IHAC       + F+         ++NK  L TI   P+T+W+ ER   +N  V    + S R CFS HSSFSEI DF+
Sbjct:    1 MSSFQGQMAEYPTISIDRFDRENLKARAYFLSHCHKDHMKGLRAPSLKRRLECSLKVFLYCSPVTKELLLTSPKYRFWENRI-----ITIEIETPTQISLVDEASGEKEEVV-VTLLPAGHCPGSVMFLFQGSNGTVLYTGDFRLAKGEASRMELLHSGG----RVKDIQSVYLDTTFCDPRFYQIPSREQCLRGILELVRSWVTRSPHHVVWLNCKAAYGYEYLFTNLSEELGVQVHVDKLDMFKNMP-DILHHLTTD---RNTQIHACRH-PKAEECFQWNKLPCGITSQNKTALHTISIKPSTMWFGERTRKTNVIVR-TGESSYRACFSFHSSFSEIKDFL 329          
BLAST of DNA cross-link repair 1C vs. Ensembl Mouse
Match: Dclre1b (DNA cross-link repair 1B [Source:MGI Symbol;Acc:MGI:2156057])

HSP 1 Score: 79.7221 bits (195), Expect = 7.911e-16
Identity = 86/339 (25.37%), Postives = 146/339 (43.07%), Query Frame = 3
Query:   51 FSGIIYEYPQIAIDNFN----PLVSTYFISHLHLDHLCGIENFSASHLTEIYTSDSTAKLILGRNSEFKNIVPYVKPLCLGKSYSIKIKYSDNDQYFSKDIINVTLISSGHCLGSVMLFIEGKNGRVLYTGDFRLNLENSNQLSSDYKYGIKIMKINYLDGLYLDTTFMNKCCAHIPSREDSFVVIINLIEKILLESLDTIIFIDYKVRYTLEALYHLIYLKFNIKVHVDIKSYYQLKPLDESISFCVDPCNWNSRIHACYMDSHCRKNFEEAKNKNKLFTIIPTTLWWSERNLVSNKEVHYIDKFSVRVCFSHHSSFSEIIDFILKVHSKSIYYCVSQ 1055
             +G++     IA+D ++         +F++H+H DH  G+   S++    +Y S  TA L+  R    K+   +++ L +G+S+ + +          ++ + VTLI + HC GSVM   EG  G +LYTGDFR          S  K    I+    +  LYLD T  N     +PSR+++   I+ LI +    ++   ++   K     E+L   + L+F   V +  +    ++ L  +  F V+      RIHA      C     +    +    I PT+     R + S     Y       V +S HSS+SE+  F+  +    +   V Q
Sbjct:    1 MNGVVIPQTPIAVDFWSLRRAGSARLFFLTHMHCDHTVGL---SSTWARPLYCSPITACLLHRRLQVSKH---WIRALEVGESHVLPLDE------IGQETMTVTLIDANHCPGSVMFLFEGYFGTILYTGDFRYT-------PSMLKEPALILG-KQIHTLYLDNTNCNPALV-LPSRQEATQQIVQLIRQFPQHNIKIGLYSLGK-----ESLLEQLALEFRTWVVLSPQRLELVQLLGLADVFTVE--EEAGRIHAVDHTEICHSAMLQWNQSHPTIAIFPTS-----RKVRSPHPSIYT------VPYSDHSSYSELRAFVAALRPCQVVPIVHQ 300          
BLAST of DNA cross-link repair 1C vs. Ensembl Mouse
Match: Dclre1b (DNA cross-link repair 1B [Source:MGI Symbol;Acc:MGI:2156057])

HSP 1 Score: 79.7221 bits (195), Expect = 7.911e-16
Identity = 86/339 (25.37%), Postives = 146/339 (43.07%), Query Frame = 3
Query:   51 FSGIIYEYPQIAIDNFN----PLVSTYFISHLHLDHLCGIENFSASHLTEIYTSDSTAKLILGRNSEFKNIVPYVKPLCLGKSYSIKIKYSDNDQYFSKDIINVTLISSGHCLGSVMLFIEGKNGRVLYTGDFRLNLENSNQLSSDYKYGIKIMKINYLDGLYLDTTFMNKCCAHIPSREDSFVVIINLIEKILLESLDTIIFIDYKVRYTLEALYHLIYLKFNIKVHVDIKSYYQLKPLDESISFCVDPCNWNSRIHACYMDSHCRKNFEEAKNKNKLFTIIPTTLWWSERNLVSNKEVHYIDKFSVRVCFSHHSSFSEIIDFILKVHSKSIYYCVSQ 1055
             +G++     IA+D ++         +F++H+H DH  G+   S++    +Y S  TA L+  R    K+   +++ L +G+S+ + +          ++ + VTLI + HC GSVM   EG  G +LYTGDFR          S  K    I+    +  LYLD T  N     +PSR+++   I+ LI +    ++   ++   K     E+L   + L+F   V +  +    ++ L  +  F V+      RIHA      C     +    +    I PT+     R + S     Y       V +S HSS+SE+  F+  +    +   V Q
Sbjct:    1 MNGVVIPQTPIAVDFWSLRRAGSARLFFLTHMHCDHTVGL---SSTWARPLYCSPITACLLHRRLQVSKH---WIRALEVGESHVLPLDE------IGQETMTVTLIDANHCPGSVMFLFEGYFGTILYTGDFRYT-------PSMLKEPALILG-KQIHTLYLDNTNCNPALV-LPSRQEATQQIVQLIRQFPQHNIKIGLYSLGK-----ESLLEQLALEFRTWVVLSPQRLELVQLLGLADVFTVE--EEAGRIHAVDHTEICHSAMLQWNQSHPTIAIFPTS-----RKVRSPHPSIYT------VPYSDHSSYSELRAFVAALRPCQVVPIVHQ 300          
BLAST of DNA cross-link repair 1C vs. UniProt/SwissProt
Match: sp|Q8K4J0|DCR1C_MOUSE (Protein artemis OS=Mus musculus OX=10090 GN=Dclre1c PE=1 SV=2)

HSP 1 Score: 142.895 bits (359), Expect = 3.395e-36
Identity = 110/345 (31.88%), Postives = 168/345 (48.70%), Query Frame = 3
Query:   42 MSMFSGIIYEYPQIAIDNF---NPLVSTYFISHLHLDHLCGIENFSASHLTE------IYTSDSTAKLILGRNSE--FKNIVPYVKPLCLGKSYSIKIKYSDNDQYFSKDIINVTLISSGHCLGSVMLFIEGKNGRVLYTGDFRLNLENSNQLSSDYKYGIKIMKINYLDGLYLDTTFMNKCCAHIPSREDSFVVIINLIEKILLESLDTIIFIDYKVRYTLEALYHLIYLKFNIKVHVDIKSYYQLKPLDESISFCVDPCNWNSRIHACYMDSHCRKNFE--------EAKNKNKLFTII--PTTLWWSERNLVSNKEVHYIDKFSVRVCFSHHSSFSEIIDFI 1013
            MS F G + EYP I+ID F   N     YF+SH H DH+ G+   S     E      +Y S  T +L+L       ++N +     + +      +I   D      ++++ VTL+ +GHC GSVM   +G NG VLYTGDFRL    ++++   +  G    ++  +  +YLDTTF +     IPSRE     I+ L+   +  S   +++++ K  Y  E L+  +  +  ++VHVD    ++  P D       D    N++IHAC       + F+         ++NK  L TI   P+T+W+ ER   +N  V    + S R CFS HSSFSEI DF+
Sbjct:    1 MSSFQGQMAEYPTISIDRFDRENLKARAYFLSHCHKDHMKGLRAPSLKRRLECSLKVFLYCSPVTKELLLTSPKYRFWENRI-----ITIEIETPTQISLVDEASGEKEEVV-VTLLPAGHCPGSVMFLFQGSNGTVLYTGDFRLAKGEASRMELLHSGG----RVKDIQSVYLDTTFCDPRFYQIPSREQCLRGILELVRSWVTRSPHHVVWLNCKAAYGYEYLFTNLSEELGVQVHVDKLDMFKNMP-DILHHLTTD---RNTQIHACRH-PKAEECFQWNKLPCGITSQNKTALHTISIKPSTMWFGERTRKTNVIVR-TGESSYRACFSFHSSFSEIKDFL 329          
BLAST of DNA cross-link repair 1C vs. UniProt/SwissProt
Match: sp|Q5QJC2|DCR1C_CHICK (Protein artemis OS=Gallus gallus OX=9031 GN=DCLRE1C PE=2 SV=1)

HSP 1 Score: 141.354 bits (355), Expect = 1.269e-35
Identity = 112/351 (31.91%), Postives = 177/351 (50.43%), Query Frame = 3
Query:   42 MSMFSGIIYEYPQIAIDNF---NPLVSTYFISHLHLDHLCGIE------NFSASHLTEIYTSDSTAKLILGRNSEFKNIVPYVKPLCLGKSYSIKIKYSDNDQYFSKDIINVTLISSGHCLGSVMLFIEGKNGRVLYTGDFRLNLENSNQLSSDYKYGIKIMKINYLDGLYLDTTFMNKCCAHIPSREDSFVVIINLIEKILLESLDTIIFIDYKVRYTLEALYHLIYLKFNIKVHVDIKSYYQLKPLDESISFCVDPCNWNSRIHACYM---DSHCRKNFEE----AKNKNKL--FTIIPTTLWWSERNLVSNKEVHYIDKFSVRVCFSHHSSFSEIIDFILKVHSKSIY 1040
            MS F G + EYPQ++ID F   N     YF+SH H DH+ G+          +S   ++Y S  T +L+L  NS++     ++  L +     I +    ++    K+ I VTL+ +GHC GSVM   +G+NG VLYTGDFRL    + ++   +  G  +  I     +YLDTTF +    HIPSRE+    I+ L+      S   +++++ K  Y  E L+  +  +  IKVHV+    ++  P    I + +    + ++IHAC     D + R N        +N   L   +I P+T+W+ ER   +N  V    + + R CFS HSS+SEI+DF+  +   ++Y
Sbjct:    1 MSRFGGRLREYPQLSIDRFDYDNLRARAYFLSHCHKDHMKGLRAPALRRRLQSSLKVKLYCSPVTKELLL-TNSKYAFWENHIVALEVETPTQISLV---DETTGEKEDIEVTLLPAGHCPGSVMFLFQGENGTVLYTGDFRLAKGEAARMELLHS-GTSVKDIQ---SVYLDTTFCDPRFYHIPSREECLSGILELVRSWTTLSRYHVVWLNCKAAYGYEYLFINLSEELGIKVHVNKLDMFKNMP---EILYHITTDRY-TQIHACRHPKDDDYVRGNRLPCGITCQNGTPLHVISIKPSTMWFGERIKKTNVIVR-TGESTYRACFSFHSSYSEIMDFLSYIRPVNVY 338          
BLAST of DNA cross-link repair 1C vs. UniProt/SwissProt
Match: sp|Q5RGE5|DCR1C_DANRE (Protein artemis OS=Danio rerio OX=7955 GN=dclre1c PE=2 SV=1)

HSP 1 Score: 140.198 bits (352), Expect = 2.076e-35
Identity = 110/356 (30.90%), Postives = 177/356 (49.72%), Query Frame = 3
Query:   42 MSMFSGIIYEYPQIAIDNF---NPLVSTYFISHLHLDHLCGIEN------FSASHLTEIYTSDSTAKLILGRNSEFKNIVPYVKPLCLGKSYSIKIKYSDNDQYFSKDIINVTLISSGHCLGSVMLFIEGKNGRVLYTGDFRLNLENSNQLSSDYKYGIKIMKINYLDGLYLDTTFMNKCCAHIPSREDSFVVIINLIEKILLESLDTIIFIDYKVRYTLEALYHLIYLKFNIKVHVDIKSYYQLKPLDESISFCVDPCNWNSRIHACYMDSHCRKNFEEAKNKNKL--------------FTIIPTTLWWSERNLVSNKEVHYIDKFSVRVCFSHHSSFSEIIDFILKVHSKSIY 1040
            MS F+G + EYP I++D F   N     YF+SH H DH+ G++          S   ++Y S  T +L+L  N  +     ++ PL L    SI +   D     ++D++ VTL+S+GHC GSVM   EG  G VLYTGDFRL + ++ ++    +Y     ++  +  +Y+DTTF +     IPSRE     I  L++  + +S   +++++ K  Y  E L+  +  +FN ++HV+    ++  P       C    N  ++IHAC    H +   EE    N+L               +I P+T+W+ ER   ++  V  +   S R CFS HSS+ E+ DF+  +   +IY
Sbjct:    1 MSSFAGRMKEYPSISLDRFDRENLHARAYFLSHCHKDHMKGLKGPLLKRKLKFSLTVKLYCSYVTKELLLS-NPRYAFWEDHIVPLELDSPTSISL--IDESTGETEDVV-VTLLSAGHCPGSVMFLFEGAKGTVLYTGDFRLAVGDAARM----EYLHSGDRVKDIQSVYIDTTFFDPKYYQIPSREACLAGIQQLVQDWICQSPYHVVWLNCKAAYGYEYLFTNLGQEFNSQIHVNSLDMFKKMPE----ILCHVTTNRATQIHAC---RHPKD--EEFFRANRLPCGSTAPDGIPLNIISIKPSTIWFGERTRKTSVVVK-MGSSSYRACFSFHSSYLEVKDFLSYICPVNIY 338          
BLAST of DNA cross-link repair 1C vs. UniProt/SwissProt
Match: sp|Q5XIX3|DCR1C_RAT (Protein artemis OS=Rattus norvegicus OX=10116 GN=Dclre1c PE=1 SV=1)

HSP 1 Score: 139.428 bits (350), Expect = 5.531e-35
Identity = 110/348 (31.61%), Postives = 167/348 (47.99%), Query Frame = 3
Query:   42 MSMFSGIIYEYPQIAIDNF---NPLVSTYFISHLHLDHLCGIENFSASHLTE------IYTSDSTAKLILGRNSEFKNIVPYVKPLCLGKSYSIKIKYSD-----NDQYFSKDIINVTLISSGHCLGSVMLFIEGKNGRVLYTGDFRLNLENSNQLSSDYKYGIKIMKINYLDGLYLDTTFMNKCCAHIPSREDSFVVIINLIEKILLESLDTIIFIDYKVRYTLEALYHLIYLKFNIKVHVDIKSYYQLKPLDESISFCVDPCNWNSRIHACYMDSHCRKNFE--------EAKNKNKLFTII--PTTLWWSERNLVSNKEVHYIDKFSVRVCFSHHSSFSEIIDFI 1013
            MS F G + EYP I+ID F   N     YF+SH H DH+ G+   S     E      +Y S  T +L+L          P  K     +  +I+I+        ++    K+ + VTL+ +GHC GSVM   +G NG VLYTGDFRL     +++   +  G    ++  +  +YLDTTF +     IPSRE+    ++ L+   +  S   +++++ K  Y  E L+  +  +  ++VHVD    ++  P D       D    N++IHAC       + F+         +K K  L TI   P+T+W+ ER   +N  V    + S R CFS HSS+SEI DF+
Sbjct:    1 MSSFQGQMEEYPTISIDRFDRENLKARAYFLSHCHKDHMKGLRAPSMKRRLECSLKVFLYCSPVTKELLL--------TSPKYK-FWENRIIAIEIETPTQVSLVDEASGEKEEVVVTLLPAGHCPGSVMFLFQGSNGTVLYTGDFRLAKGEVSRMELLHSGG----RVKDIQSVYLDTTFCDPRFYQIPSREECLRGVLELVRSWITRSPKHVVWLNCKAAYGYEYLFTNLSEELGVQVHVDKLDMFKNMP-DILHHLTTD---RNTQIHACRH-PKAEEYFQWNKLPCGMASKTKTVLHTISIKPSTMWFGERTRKTNVIVR-TGESSYRACFSFHSSYSEIKDFL 329          
BLAST of DNA cross-link repair 1C vs. UniProt/SwissProt
Match: sp|Q5R6Z9|DCR1C_PONAB (Protein artemis OS=Pongo abelii OX=9601 GN=DCLRE1C PE=2 SV=1)

HSP 1 Score: 139.043 bits (349), Expect = 7.569e-35
Identity = 107/344 (31.10%), Postives = 173/344 (50.29%), Query Frame = 3
Query:   42 MSMFSGIIYEYPQIAIDNF---NPLVSTYFISHLHLDHLCGIENFSASHLTE------IYTSDSTAKLILGRNSEFKNIVPYVKPLCLGKSYSIKIKYSDNDQYFS-KDIINVTLISSGHCLGSVMLFIEGKNGRVLYTGDFRLNLENSNQLSSDYKYGIKIMKINYLDGLYLDTTFMNKCCAHIPSREDSFVVIINLIEKILLESLDTIIFIDYKVRYTLEALYHLIYLKFNIKVHVDIKSYYQLKPLDESISFCVDPCNWNSRIHACYMDSHCRKNFEEAK------NKNK----LFTIIPTTLWWSERNLVSNKEVHYIDKFSVRVCFSHHSSFSEIIDFI 1013
            MS F G + EYP I+ID F   N     YF+SH H DH+ G+   +     E      +Y S  T +L+L  + +++    + K   +        + S  D+    K+ I VTL+ +GHC GSVM   +G NG VLYTGDFRL    + ++   +  G    +I  +  +YLDTTF +     IPSRE+    I+ L+   +  S   +++++ K  Y  E L+  +  +  ++VHV+    ++  P  E +       + N++IHAC       + F+ +K      ++N+    + +I P+T+W+ ER+  +N  V    + S R CFS HSS+SEI DF+
Sbjct:    1 MSSFEGQMAEYPTISIDRFDRENLRARAYFLSHCHKDHMKGLRAPTLKRRLECSLKVYLYCSPVTKELLLT-SPKYR----FWKKRIISIEIETPTQISLVDEASGEKEEIVVTLLPAGHCPGSVMFLFQGNNGTVLYTGDFRLAQGEAARMELLHSGG----RIKDIQSVYLDTTFCDPRFYQIPSREECLSGILELVRSWITRSPYHVVWLNCKAAYGYEYLFTNLSEELGVQVHVNKLDMFRNMP--EILHHLT--TDRNTQIHAC-RHPKAEEYFQWSKLPCGITSRNRIPLHIISIKPSTMWFGERSRKTNVIVR-TGESSYRACFSFHSSYSEIKDFL 329          
BLAST of DNA cross-link repair 1C vs. TrEMBL
Match: C3YPJ3 (DRMBL domain-containing protein OS=Branchiostoma floridae OX=7739 GN=BRAFLDRAFT_215154 PE=4 SV=1)

HSP 1 Score: 164.851 bits (416), Expect = 1.573e-43
Identity = 115/364 (31.59%), Postives = 189/364 (51.92%), Query Frame = 3
Query:   42 MSMFSGIIYEYPQIAIDNF---NPLVSTYFISHLHLDHLCGIEN------FSASHLTEIYTSDSTAKLILGRNSEFKNIVPYVKPLCLGKSYSIKIKYSDNDQYFSKD-IINVTLISSGHCLGSVMLFIEGKNGRVLYTGDFRLNLENSNQLSSDYKYGIKIMKINYLDGLYLDTTFMNKCCAHIPSREDSFVVIINLIEKILLESLDTIIFIDYKVRYTLEALYHLIYLKFNIKVHVDIKSYYQLKPLDESISFCVDPCNWNSRIHACYMDSH-----CRKNFEEAKNKNKLFTIIPTTLWWS----ERNLVSNKEVHYIDKFSVRVCFSHHSSFSEIIDFILKVHSKSIYYCVSQTCNTLKK 1076
            MS F G + EY  ++ID F   N     +F+SH H DH+ G++N        AS  T +Y SD T  L+L    +FK + PY+  + +    S+ +     D+   K+  + VTL+ +GHC GSVM   EG  G VLYTGDFRL +  + Q    ++ G ++  I     LY+DTTF+     +IPSRED    +IN+++  + +    ++ ++ K +Y  E L+  +  +FN+KVHV+  S YQ  P    I  C+      ++IHAC          C K      ++ ++ ++ P+T+W++      +++     H+      RVCFS HSS++EI DF+  +  K+++  V+    TL++
Sbjct:    1 MSCFGGRMSEYRYLSIDRFDGENLESWAFFLSHAHRDHMVGLDNPGFLSRLKASLKTRLYCSDITKALLL-TEKQFKPLEPYIVSVQIDTPTSLTV----TDEVTGKEHSLLVTLLQAGHCPGSVMFLFEGLEGTVLYTGDFRLPVGGAAQFQHLHQ-GDRLKDIQ---SLYVDTTFLVPEAKYIPSREDCCTALINVVQSWISKGAHYVVRMNCKAKYGYEYLFIELCRRFNMKVHVNDPSVYQAIP---EIFQCLTSDPSETQIHACRYQKGRHPLPC-KYRPPPPHELEVMSVTPSTMWFTAYAGPGDVIRKGSRHHH-----RVCFSFHSSYTEIRDFVGYIRPKTVHANVAPVGTTLEE 346          
BLAST of DNA cross-link repair 1C vs. TrEMBL
Match: S4RFM2 (DNA cross-link repair 1C, PSO2 homolog (S. cerevisiae) OS=Petromyzon marinus OX=7757 PE=4 SV=1)

HSP 1 Score: 164.851 bits (416), Expect = 4.608e-43
Identity = 115/355 (32.39%), Postives = 183/355 (51.55%), Query Frame = 3
Query:   42 MSMFSGIIYEYPQIAIDNF---NPLVSTYFISHLHLDHLCGI------ENFSASHLTEIYTSDSTAKLILGRNSEFKNIVPYVKPLCLGKSYSIKIKYSDNDQYFSKDIINVTLISSGHCLGSVMLFIEGKNGRVLYTGDFRLNLENSNQLSSDYKYGIKIMKINYLDGLYLDTTFMNKCCAHIPSREDSFVVIINLIEKILLESLDTIIFIDYKVRYTLEALYHLIYLKFNIKVHVDIKSYYQLKP--LDESISFCVDPCNWNSRIHACYMDSH----------CRKNFEEAKNKN-KLFTIIPTTLWWSERNLVSNKEVHYIDKFSVRVCFSHHSSFSEIIDFILKVHSKSIY 1040
            MS F G   EYP ++ID F   N     +F+SH H DH+ G+      +    S    +Y S  T +L+L  N  ++ +  +   + +    + +I  +D+      D++ VTL+ +GHC GSVM   EG +G VLYTGDFRL     +++ + +  G    +I  +  +YLDTTF +  C +IPSRED    I+NL+   + +S   +I+++ K  Y  E L+  +  +F  KVH+     +Q  P  LD          + N++IHAC +             CR+  ++AK K+  + +I P+T+W+++RN    K +    + S R CFS HSSFSEI DFI  +   +I+
Sbjct:    1 MSSFLGKTAEYPSVSIDRFDRDNVDARAFFLSHCHQDHMVGLYSEALRKKLERSPGVHLYCSPVTRELLLS-NWRYRFLERFT--VAIEVDTATQISLTDDKTKQKTDLV-VTLLPAGHCPGSVMFLFEGDHGAVLYTGDFRLPRGGVSRMGALHSAG----RIKRIKSIYLDTTFCDPMCYYIPSREDCLKGILNLVRGWITQSPQHVIWLNCKAAYGYEYLFTHLSREFGQKVHLGYLEMFQNMPDILDHVTH------DSNTQIHACRIPKDAGICEGRRLPCRE--KDAKGKSLHMMSIKPSTMWFTQRN-KKTKIIVRTGESSYRACFSFHSSFSEIEDFISYIKPANIF 338          
BLAST of DNA cross-link repair 1C vs. TrEMBL
Match: V4A3J4 (DRMBL domain-containing protein OS=Lottia gigantea OX=225164 GN=LOTGIDRAFT_209646 PE=4 SV=1)

HSP 1 Score: 155.221 bits (391), Expect = 2.753e-40
Identity = 115/347 (33.14%), Postives = 176/347 (50.72%), Query Frame = 3
Query:   42 MSMFSGIIYEYPQIAIDNF---NPLVSTYFISHLHLDHLCGI------ENFSASHLTEIYTSDSTAKLILGRNS-EFKNIVPYVKPLCLGKSYSIKIKYSDNDQYFSKDIINVTLISSGHCLGSVMLFIEGKNGRVLYTGDFRLNLENSNQLSSDY-KYGIKIMKINYLDGLYLDTTFMNKCCAHIPSREDSFVVIINLIEKILLESLDTIIFIDYKVRYTLEALYHLIYLKFNIKVHV-DIKSYYQLKPLDESISFCVDPCNWNSRIHACYMDSHCRKNFEEAKNKNKLFTIIPTTLWWSERNLVSNKEVHYIDKFSV--RVCFSHHSSFSEIIDFILKVHSKSIY 1040
            MS F G + EY +I+ID F   N L S +F+SH H DH+ G+      +   A +   +Y SD +  L+LG N+  F ++ PY+K L + +  +I I    N       +++VTL+ +GHC GSVM   EG  G VLYTGDFR   + +  LS  + + GIK +K      LY+DTTF      H PSR     V + L+++ L  S    ++I   + Y  E L   I+   N  +H  D K     +  D +I++  DP   ++RIHAC                +KL  + P+T+W++   + S K      K S   RVC+S HSS+SEI +F+  ++ + ++
Sbjct:    1 MSTFCGRMREYSEISIDRFDGGNLLSSVFFLSHCHRDHMTGLNYRSFAKRLQAGNNIYLYMSDVSKVLLLGDNTYSFHHLEPYIKTLQIKRPSTITIPC--NTVSGKPKLVSVTLLPAGHCPGSVMFLFEGNEGTVLYTGDFRWEKDKAASLSHLHNELGIKPIK-----SLYIDTTFCVPNALHFPSRYQCVEVTVQLVKEWLSHSKSHFVYIASPMNYGHEHLQVEIFKHTNEPIHTSDWKYSIYTQIQDLAIAYTTDP---SARIHACV---------------SKLLVLRPSTMWFTMSTICSEKLKEEPTKSSDPHRVCYSLHSSYSEIKNFVSYLNPEEVF 322          
BLAST of DNA cross-link repair 1C vs. TrEMBL
Match: A0A2G8JWK7 (Lactamase_B domain-containing protein OS=Stichopus japonicus OX=307972 GN=BSL78_23048 PE=4 SV=1)

HSP 1 Score: 160.229 bits (404), Expect = 2.140e-39
Identity = 115/347 (33.14%), Postives = 184/347 (53.03%), Query Frame = 3
Query:   42 MSMFSGIIYEYPQIAIDNFNPL----VSTYFISHLHLDHLCGIENFS-ASHLT-----EIYTSDSTAKLILGRNSEFKNIVPYVKPLCLGKSYSIKIKYSDNDQYFSKDIINVTLISSGHCLGSVMLFIEGKNGRVLYTGDFRLNLENSNQLSSDY-KYGIKIMKINYLDGLYLDTTFMNKCCAHIPSREDSFVVIINLIEKILLESLDTIIFIDYKVRYTLEALYHLIYLKFNIKVHVD---IKSYYQLKPLDESISFCVDPCNWNSRIHACYMDSHCRKNFEEAKNKNKLFTIIPTTLWWSERNLVSNKEVHYIDKFSVRVCFSHHSSFSEIIDFILKVHSKSIY 1040
            MS FSGI  EYP++AID F+         YF+SH+H DH  G+ + + A+HL      ++Y S+ T + +L  +S+ +++   +  L + +   + I    ND    K+ + VTL+ +GHC GSVM  +EG  G+VLYTGDFR  + ++  + + +   G+K +K      LY+DTTF +     IP+RE S   ++ +IE+ L      ++ I  + +Y  E L+  I   F +KVHV    +K Y ++  L E ++         +R+HA      CRK     K+   + TI P+T+W++  N   +  +  I     R+CFS HSS+SEI DFI  +   +IY
Sbjct:    1 MSTFSGITREYPEVAIDYFSGKQILKARAYFLSHVHTDHTVGLHSSTFANHLENHPTYKLYCSEVTREFLL-TSSKHRHLKKSLLALPVEQRCDVFIP---NDVTGEKEKLQVTLLPAGHCPGSVMFLLEGNAGKVLYTGDFRFKIGDAANMDALHDGEGVKALK-----SLYIDTTFFDPKIMFIPNREQSCEAMLRVIEEQLQRGPRHMVHIKCRAKYGYEYLFIEISRAFGMKVHVSGEIMKQYERVPSLAEHMTT----EGSATRVHA------CRKYACTLKDAVDVITITPSTMWFNS-NAQPDDVLKKISSHYYRLCFSFHSSYSEICDFIQYLKPTNIY 327          
BLAST of DNA cross-link repair 1C vs. TrEMBL
Match: A0A158NB18 (DRMBL domain-containing protein OS=Atta cephalotes OX=12957 GN=105617782 PE=4 SV=1)

HSP 1 Score: 151.369 bits (381), Expect = 1.076e-38
Identity = 118/358 (32.96%), Postives = 175/358 (48.88%), Query Frame = 3
Query:   42 MSMFSGIIYEYPQIAIDNF---NPLVSTYFISHLHLDHLCGIENFSASHLTE----IYTSDSTAKLILGRNSE-FKNIVPYVKPLCLGKSYSIKIKYSDNDQYFSKDIINVTLISSGHCLGSVMLFIEGKNGRVLYTGDFRLNLENSNQLSSDYKYGIKIMKINY-------LDGLYLDTTFMNKCCAHIPSREDSFVVIINLIEKILLESLDTIIFIDYKVRYTLEALYHLIYLKFNIKVHVD---IKSYYQLKPLDESISFCVDPCNWNSRIHACYMDSHC--RKNFEEAKN--KNKLFTIIPTTLWWSERNLVSNKEVHYIDKFSVRVCFSHHSSFSEIIDFILKVHSKSIYYCV 1049
            MS F G+I E P I++D F   N   S YF+SH H+DH+CG+ N    HL +    +Y S  T   +  +  E  +N+  YVK + + K   I I+Y  N      DI+ VT  S+GHC GSVM   E  N  +LYTGDFR+N         DY    KI  +NY        D +YLDTTF+     ++P+R +S  V+  +++K L ES   ++ ++    Y  E LY  +       +HV      SY ++  L   ++   +P   ++RIHAC   S C  R       N  +  + TI+P+   W  R+     E     + +  VC+S H+SF E+ +FI     K+I+ CV
Sbjct:    1 MSTFVGLIKEIPGISVDRFDRENMNSSVYFLSHCHIDHMCGLNNMFFDHLKQYNKYLYCSRITKVFLENKYYENLRNVETYVKDIEVDKK--ICIEYRSNYNSEETDILFVTFTSAGHCPGSVMFVFEKMNKLILYTGDFRIN-------PKDY---YKIKSLNYCNNFPKKFDNVYLDTTFLGHDFTYLPTRIESINVMCKVVKKWLDESPRKVVILECSALYGSEFLYMELSKSLKTLIHVKEYVYNSYIRIPELACHVT--NNP--LDARIHACMSKSTCMNRSGLRCRTNVLQQDILTIVPSVKKWKGRDTSVIGEWDKFSEKTFNVCYSTHASFDELKEFIQYFKPKNIHPCV 342          
BLAST of DNA cross-link repair 1C vs. Ensembl Cavefish
Match: dclre1c (protein artemis [Source:NCBI gene;Acc:103039825])

HSP 1 Score: 129.028 bits (323), Expect = 2.419e-32
Identity = 112/356 (31.46%), Postives = 171/356 (48.03%), Query Frame = 3
Query:   42 MSMFSGIIYEYPQIAIDNF---NPLVSTYFISHLHLDHLCGIENFSASH------LTEIYTSDSTAKLILGRNSEFKNIVPYVKPLCLGKSYSIKIKYSDNDQYFSKDIINVTLISSGHCLGSVMLFIEGKNGRVLYTGDFRLNLENSNQLSSDYKYGIKIMKINYLDGLYLDTTFMNKCCAHIPSREDSFVVIINLIEKILLESLDTIIFIDYKVRYTLEALYHLIYLKFNIKVHVDIKSYYQLKPLDESISFCVDPCNWNSRIHACYMDSHCRKNFEEAKNKNKL--------------FTIIPTTLWWSERNLVSNKEVHYIDKFSVRVCFSHHSSFSEIIDFILKVHSKSIY 1040
            MS F G + EY  I+ID F   N     YF+SH H DH+ G++              ++Y S  T +L+L  N ++     ++  L L     I +   D     S+D++ VTL+ +GHC GSVM   EG  G VLYTGDFRL + ++ ++   +  G ++  I     +YLD+TF +     IPSRE   + I  LI+  +  S   +++++ K  Y  E L+  +  +F+ +VHV+    Y+  P       C    N  ++IHAC    H +   EE    N+L               +I P+T+W+ ER     K +  +   S R CFS HSS+SEI DF+      +IY
Sbjct:    1 MSSFPGRMKEYSTISIDRFDKENLHARAYFLSHCHKDHMKGLKGPLLKRKLKFCLTVKLYCSFVTKELLLS-NRKYSFWEDHIVALELDSPTHISL--IDEVTGESEDVV-VTLLPAGHCPGSVMFLFEGAQGTVLYTGDFRLGIGDAARMEHLHS-GDRVKDIQ---SVYLDSTFYDPKFYQIPSREACLIGIRELIQDWISLSPYHVVWLNCKAAYGYEYLFTNLGEEFSSQVHVNSLDTYKKMPE----ILCHVTTNRATQIHACR---HPKD--EELFRTNRLPCGCTAPDGTPLRIVSIKPSTMWFGERTR-KTKVIVRMGGSSYRACFSFHSSYSEIKDFLSYTRPVNIY 338          
BLAST of DNA cross-link repair 1C vs. Ensembl Cavefish
Match: dclre1b (DNA cross-link repair 1B [Source:NCBI gene;Acc:768137])

HSP 1 Score: 83.1889 bits (204), Expect = 4.793e-17
Identity = 86/317 (27.13%), Postives = 141/317 (44.48%), Query Frame = 3
Query:  108 VSTYFISHLHLDHLCGIENFSASHLTEIYTSDSTAKLILGRNSEFKNIVPYVKPLCLGKSYSIKIKYSDNDQYFSKDIINVTLISSGHCLGSVMLFIEGKNGRVLYTGDFRLNLENSNQLSSDYKYGIKIMKINYLDGLYLDTTFMNKCCAHIPSREDSFVVIINLIEKILLESLDTIIFIDYKVRYTL--EALYHLIYLKFNIKVHVDIKSYYQLKPLDESISFCVDPCNWNSRIHACYMDSHCRKNFEEAKNKNKLFTIIPTTLWWSERNLVSNKEVHYIDKFSVRVCFSHHSSFSEIIDFILKVHSKSIYYCVS 1052
            V  +F+SH+H DH CG+ +  ++    IY S  TAKL+     + +    ++  L +G+++ + +    +D    K+ + VTLI + HC G+VM F EG  G +LYTGDFR       +          +     +D LYLD T  +   + +PSR+ +       I++I+    +  + I     Y L  E+L   + L+F   V VD +    L+ L+    F  +P     RI A         N      +     I+PT+     R +VS     Y+      V +S HSS+ E+ DF+  +   S+   V 
Sbjct:   24 VRLFFLSHMHTDHTCGLTSTWSNR--PIYCSPVTAKLL---QLKLQVKEKWIHALEVGEAHMLPL----DD--IGKEKLTVTLIDANHCPGAVMFFFEGYFGTILYTGDFRYTPSMLREPC--------LRNNTTIDVLYLDNTNCDPTRS-LPSRQRA----CQQIKEIIRSHPNYTVVIGL---YALGKESLLVQLALEFKTWVEVDTERLETLRVLELPDVFTTEP--GAGRIRAVSQSEITASNLLAWNKEQPTMAILPTS-----RPVVSCHPNVYV------VPYSDHSSYQELEDFVSALRPISLVPIVG 300          
BLAST of DNA cross-link repair 1C vs. Ensembl Cavefish
Match: dclre1a (DNA cross-link repair 1A [Source:NCBI gene;Acc:103042754])

HSP 1 Score: 54.299 bits (129), Expect = 1.586e-7
Identity = 78/313 (24.92%), Postives = 133/313 (42.49%), Query Frame = 3
Query:  108 VSTYFISHLHLDHLCGIENFSASHLTEIYTSDSTAKLILGRNSEFKNIVPYVKPLCLGKSYSIKIKYSDNDQYFSKDIINVTLISSGHCLGSVMLFIEGKNGR-VLYTGDFRLN--LENSNQLSSDYKYGIKIMKINYLDGLYLDTTFMNKCCAHIPSREDSFVVIINLI-EKILLESLDTIIFIDYKVRYTLEALYHLIYLKFNIKVHVDIKSYYQLKPLD-ESISFCVDPCNWNSRIHACYMDSHCRKNFEE-----AKNKNKLFTIIPTTLWWSERNLVSNKEVHYIDKFSV-RVCFSHHSSFSEIIDFI 1013
            ++ YF++H H DH  G+   S      IY +  T  L+    S+ K    YV  L +     +             D + VTL+ + HC G+ ML     +G+ VL+TGDFR +  +E   +L      G ++        LYLDTT+ +   A  P++++      N   E + L     ++   Y V    E ++  I      KV++    Y  +  L+ + I  C+      +R+H   M     KN E      +++ ++L    PT   ++    V+N +    +  S+  V +S HSSF E+  F+
Sbjct:  620 ITAYFLTHFHSDHYGGLTKRST---LPIYCNKITGNLV---KSKLKVDEQYVHILPMNTECVV-------------DGVKVTLLDANHCPGAAMLLFLLPDGQTVLHTGDFRADPSMERYPEL-----QGFRVQT------LYLDTTYCSPEYA-FPTQQEVITFAANTAFELVTLNPRTLVVCGTYAVGK--EKVFLAISDVLASKVYMSRDRYNTMCCLESKQICQCITTDPKAARVHVLPMMQLNFKNLEAHLHKHSQSYDQLVAFKPTGWTFTHSGDVTNIQPEVKNNISIYGVPYSEHSSFLELKRFV 899          
BLAST of DNA cross-link repair 1C vs. Ensembl Sea Lamprey
Match: dclre1c (DNA cross-link repair 1C, PSO2 homolog (S. cerevisiae) [Source:NCBI gene;Acc:566285])

HSP 1 Score: 164.851 bits (416), Expect = 3.540e-47
Identity = 115/355 (32.39%), Postives = 183/355 (51.55%), Query Frame = 3
Query:   42 MSMFSGIIYEYPQIAIDNF---NPLVSTYFISHLHLDHLCGI------ENFSASHLTEIYTSDSTAKLILGRNSEFKNIVPYVKPLCLGKSYSIKIKYSDNDQYFSKDIINVTLISSGHCLGSVMLFIEGKNGRVLYTGDFRLNLENSNQLSSDYKYGIKIMKINYLDGLYLDTTFMNKCCAHIPSREDSFVVIINLIEKILLESLDTIIFIDYKVRYTLEALYHLIYLKFNIKVHVDIKSYYQLKP--LDESISFCVDPCNWNSRIHACYMDSH----------CRKNFEEAKNKN-KLFTIIPTTLWWSERNLVSNKEVHYIDKFSVRVCFSHHSSFSEIIDFILKVHSKSIY 1040
            MS F G   EYP ++ID F   N     +F+SH H DH+ G+      +    S    +Y S  T +L+L  N  ++ +  +   + +    + +I  +D+      D++ VTL+ +GHC GSVM   EG +G VLYTGDFRL     +++ + +  G    +I  +  +YLDTTF +  C +IPSRED    I+NL+   + +S   +I+++ K  Y  E L+  +  +F  KVH+     +Q  P  LD          + N++IHAC +             CR+  ++AK K+  + +I P+T+W+++RN    K +    + S R CFS HSSFSEI DFI  +   +I+
Sbjct:    1 MSSFLGKTAEYPSVSIDRFDRDNVDARAFFLSHCHQDHMVGLYSEALRKKLERSPGVHLYCSPVTRELLLS-NWRYRFLERFT--VAIEVDTATQISLTDDKTKQKTDLV-VTLLPAGHCPGSVMFLFEGDHGAVLYTGDFRLPRGGVSRMGALHSAG----RIKRIKSIYLDTTFCDPMCYYIPSREDCLKGILNLVRGWITQSPQHVIWLNCKAAYGYEYLFTHLSREFGQKVHLGYLEMFQNMPDILDHVTH------DSNTQIHACRIPKDAGICEGRRLPCRE--KDAKGKSLHMMSIKPSTMWFTQRN-KKTKIIVRTGESSYRACFSFHSSFSEIEDFISYIKPANIF 338          
BLAST of DNA cross-link repair 1C vs. Ensembl Sea Lamprey
Match: ENSPMAT00000006050.1 (pep scaffold:Pmarinus_7.0:GL476493:567169:571241:-1 gene:ENSPMAG00000005467.1 transcript:ENSPMAT00000006050.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 79.337 bits (194), Expect = 9.521e-17
Identity = 58/185 (31.35%), Postives = 92/185 (49.73%), Query Frame = 3
Query:   51 FSGIIYEYPQIAIDNFN----PLVSTYFISHLHLDHLCGIENFSASHLTEIYTSDSTAKLILGRNSEFKNIVPYVKPLCLGKSYSIKIKYSDNDQYFSKDIINVTLISSGHCLGSVMLFIEGKNGRVLYTGDFRLNLENSNQLSSDYKYGIKIMKIN-YLDGLYLDTTFMNKCCA--HIPSREDS 584
             +G +  Y  +A+D +     P    +F+SH+H DH  G+   + +    IY S  TA L+     +F     +++PL LG+S+ + +          K+ + VTLI + HC G+VM   +G  G +LYTGDFR   E            + +++ N  +D LYLD T+   C +  H PSRED+
Sbjct:    1 MNGKLIPYTPLAVDFWRVAKFPEARIFFLSHMHADHTSGL---TPTWSRPIYCSPITAVLL---KRKFSIADKFIRPLELGESHCVPL------DGVGKETMTVTLIDANHCPGAVMFLFQGYFGNILYTGDFRFIPE---------MLKLPLLQTNIIIDVLYLDNTY---CPSKWHFPSREDA 161          
BLAST of DNA cross-link repair 1C vs. Ensembl Yeast
Match: PSO2 (Nuclease required for DNA single- and double-strand break repair; acts at a post-incision step in repair of breaks that result from interstrand cross-links produced by a variety of mono- and bi-functional psoralen derivatives; induced by UV-irradiation; forms nuclear foci upon DNA replication stress [Source:SGD;Acc:S000004745])

HSP 1 Score: 51.6026 bits (122), Expect = 1.248e-7
Identity = 50/173 (28.90%), Postives = 83/173 (47.98%), Query Frame = 3
Query:   78 QIAIDNFN----PLVSTYFISHLHLDHLCGIE----NFSASHLTE-IYTSDSTAKLILGRNSEFKNIVPYVKPLCLGKSYSIKIKYSDNDQYFSKDIINVTLISSGHCLGS-VMLFIE-------GKNGRVLYTGDFRLNLENSNQLSSDYKYGIKIMKINYLDGLYLDTTFM 545
            +I +D FN      +S YF+SH H DH  G++    N   + + + +Y S  TA L+   N +FK  +  ++ L + K + I             D I+V  + + HC G+ +MLF E           ++L+TGDFR    N+  + +  K+  +      +D +YLDTT+M
Sbjct:  227 EIVVDGFNYKASETISQYFLSHFHSDHYIGLKKSWNNPDENPIKKTLYCSKITAILV---NLKFKIPMDEIQILPMNKRFWI------------TDTISVVTLDANHCPGAIIMLFQEFLANSYDKPIRQILHTGDFR---SNAKMIETIQKWLAETAN-ETIDQVYLDTTYM 380          
BLAST of DNA cross-link repair 1C vs. Ensembl Nematostella
Match: EDO48182 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RK35])

HSP 1 Score: 128.257 bits (321), Expect = 1.906e-34
Identity = 91/305 (29.84%), Postives = 159/305 (52.13%), Query Frame = 3
Query:   42 MSMFSGIIYEYPQIAIDNF---NPLVSTYFISHLHLDHLCGIENFS-----ASHLTEIYTSDSTAKLILGRNSEFKNIVPYVKPLCLGKSYSIKIKYSDNDQYFSKDIINVTLISSGHCLGSVMLFIEGKNGRVLYTGDFRLNLENSNQLSSDYKYGIKIMKINYLDGLYLDTTFMNKCCAHIPSREDSFVVIINLIEKILLESLDTIIFIDYKVRYTLEALYHLIYLKFNIKVHVDIKSYYQLKPLDESIS-FCVDPCNWNSRIHACYM---DSHCRKNFEEAKN--KNKLFTIIPTTLWWSER 914
            MS F G + EYPQ++ID F   N     YF+SH H DH+ G+++ +      S    I+ S++T  L+L  ++ F ++  Y+  + L + + +     + ++   +++I VTL S+GHC+GSVM   EG  G VLYTGDFRL   ++ +++  +  G    ++  +  +Y+DTTF       IPSR+++   I  +I++   +  + ++ +  K +Y  E +   I + + IK+HV  +     + L + I  F  D     +RIHAC+    DS          N  + K+  I P+T W+++R
Sbjct:    1 MSCFRGKLLEYPQVSIDCFDNENLDSYAYFLSHCHRDHMQGLDSATFSDAIKSKKQRIFCSETTRNLLLC-DASFSHLEEYLTGIPLDQPFVVTPYDKETNK---EEVITVTLFSAGHCVGSVMFLFEGLKGNVLYTGDFRLATGDTKRITVLHCNG----RVKDIRSVYIDTTFCLPKMMSIPSRKETNDAIFKVIDRWFSQGAEHVVSLQCKSKYGYEYMLKSIAIYYKIKIHVSDERLEMYRYLSDMIQHFTTDAS--KTRIHACHWKNSDSSTLPCGLVLPNGLEPKVLRIRPSTFWFAQR 295          
BLAST of DNA cross-link repair 1C vs. Ensembl Nematostella
Match: EDO46457 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RPX0])

HSP 1 Score: 83.5741 bits (205), Expect = 3.665e-18
Identity = 82/310 (26.45%), Postives = 139/310 (44.84%), Query Frame = 3
Query:  117 YFISHLHLDHLCGIENFSASHLTEIYTSDSTAKLILGR---NSEFKNIVPYVKPLCLGKSYSIKIKYSDNDQYFSKDIINVTLISSGHCLGSVMLFIEGKNGRVLYTGDFRLNLENSNQLSSDYKYGIKIMKINYLDGLYLDTTFMNKCCAHIPSREDSFVVIINLIEKILLESLDTIIFIDYKVRYTLEALYHLIYLKFNIKVHVDIKSYYQLKPLDESISFCVDPCNWNSRIHACYMDSHCRKNFEEAKNKNKLFTIIPTTLWWSERNLVSNKEVHYIDKFSVRVCFSHHSSFSEIIDFILKVHSKSI 1037
            +F+SH H DH  G+ +    +  +IY S+ T ++++ +   N +    +P  +P+ L                  ++++ VTL+ + HC G+VM   EG  G +LYTGDFR         S         +K   +D LYLD T+ +  C + P++  +  +I ++I + L +  D II +    +   E L   I L+FN  + V  K    LK LD    F  +       +    ++S+    F +       F I+PT L+  E+   SN   H  +   V V +S HSSF E++ F+  +    +
Sbjct:   27 FFLSHAHADHTQGLTSSWTKY--KIYCSEITKRILMHKLNVNEDLLVALPLGEPVVLPLDEE------------GREMLTVTLLDANHCPGAVMFLFEGYFGTILYTGDFRFKPAMLLHES---------LKGKQIDKLYLDNTYCHPSC-NFPTKTKTMKLIFDIIRRRLGD--DIIIPLRTLGK---EDLLVKIALEFNCWIGVTPKKMELLKWLDLPDVFTSEWHKTQIIVAQHPVNSYTLSQFRDP------FVILPTALYEGEK---SNPYRHLPN--YVTVPYSDHSSFKELLRFVSGIAPAEV 296          
BLAST of DNA cross-link repair 1C vs. Ensembl Nematostella
Match: EDO43089 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RZG8])

HSP 1 Score: 71.633 bits (174), Expect = 4.956e-14
Identity = 82/313 (26.20%), Postives = 128/313 (40.89%), Query Frame = 3
Query:  102 PLVSTYFISHLHLDHLCGIENFSASHLTEIYTSDSTAKLILGRNSEFKNIVPYVKPLCLGKSYSIKIKYSDNDQYFSKDIINVTLISSGHCLGSVMLFIEGKNGR-VLYTGDFRLNLENSNQLSSDYKYGIKIMKINYLDGLYLDTTFMNKCCAHIPSREDSFVVIINLIEKILLESLDTIIFIDYKVRYTL--EALYHLIYLKFNIKVHVDIKSYYQLKPLDES-ISFCVDPCNWNSRIHACYMD----SHCRKNFEEAKNKNKLFTIIPTTLWWSERNLVSNKEVHYIDKFSV-RVCFSHHSSFSEIIDFI 1013
            P +  YF+SH H DH  G++    SH   IY S  TA L+    S+ K    Y+K L +             D     D + VTL+ + HC G+V+L  E  NG+ +L+TGDFR + E  +  +         +    +D LYLDTT+ +      P +E++    +    + + E+  T+I       YT+  E ++  I  +   KV V       L  L+   I   +       RIH   M      H     ++ K K         T W  +   +S          S+  V +S HSS+ E+  F+
Sbjct:   24 PGIKVYFLSHFHYDHYGGLKK-GFSH--PIYCSKVTANLV---ESKIKVSQRYIKALPM-------------DTPVIVDKVQVTLLDANHCPGAVLLLFELPNGKTILHTGDFRASREMESYPA---------LANKTIDTLYLDTTYCDPQYT-FPKQEETINFAVTKAAQAVSENPKTLIVCG---TYTIGKEKVFLAIAKELGCKVTVQSDKKRILDSLESDFIQSVITTDKSEGRIHVLPMGKLNHQHLSSYMDQFKGKFTRVVAFKPTGWEHKSGPLSATRPVTKGPISIYGVPYSEHSSYEEMKRFV 304          
BLAST of DNA cross-link repair 1C vs. Ensembl Medaka
Match: dclre1c (DNA cross-link repair 1C [Source:NCBI gene;Acc:101169653])

HSP 1 Score: 137.117 bits (344), Expect = 2.345e-35
Identity = 109/356 (30.62%), Postives = 175/356 (49.16%), Query Frame = 3
Query:   42 MSMFSGIIYEYPQIAIDNF---NPLVSTYFISHLHLDHLCGIEN------FSASHLTEIYTSDSTAKLILGRNSEFKNIVPYVKPLCLGKSYSIKIKYSDNDQYFSKDIINVTLISSGHCLGSVMLFIEGKNGRVLYTGDFRLNLENSNQLSSDYKYGIKIMKINYLDGLYLDTTFMNKCCAHIPSREDSFVVIINLIEKILLESLDTIIFIDYKVRYTLEALYHLIYLKFNIKVHVDIKSYYQLKPLDESISFCVDPCNWNSRIHACYMDSHCRKNFEEAKNKNKL--------------FTIIPTTLWWSERNLVSNKEVHYIDKFSVRVCFSHHSSFSEIIDFILKVHSKSIY 1040
            MS F+G + EYP +++D F   N     YF+SH H DH+ G++          S    +Y S  T +L+L  N ++     Y+ PL L     I +    ++    K+ + VTL+ +GHC GSVM   EG  G VLYTGDFRL + +  ++   +  G ++  I     +Y+D+TF +     IPSRE     I  L+   + +S   +++++ K  Y  E L+  +  +F  ++HV+  S    K + E +S+     + ++RIHAC    H +   EE    N+L               +I P+T+W+ ER   +N  +      S R CFS HSS+SE+ DF+  +   +IY
Sbjct:    1 MSSFAGRMKEYPTVSLDRFDRENLHARAYFLSHCHKDHMKGLKGPLLKRKLQFSRTVRLYCSFVTKELLL-NNQKYSFWEEYIVPLELESPTQISLV---DEASGEKEEVVVTLLPAGHCPGSVMFLFEGCRGNVLYTGDFRLAVGDVARMELLHS-GSRVKDIQ---SVYVDSTFYDPRFYQIPSREVCLKGISELVGNWISQSPYHVVWLNCKAAYGYEYLFTNLGEEFGTQIHVN--SLAMFKKMPEILSYVT--TDRSARIHACR---HPKD--EEFFQGNRLPCGCSAADGTPLRIISIKPSTMWFGERTKRTNVIIR-TGSSSYRACFSFHSSYSELKDFLAYLKPVNIY 338          
BLAST of DNA cross-link repair 1C vs. Ensembl Medaka
Match: dclre1c (DNA cross-link repair 1C [Source:NCBI gene;Acc:101169653])

HSP 1 Score: 124.02 bits (310), Expect = 8.268e-31
Identity = 104/356 (29.21%), Postives = 166/356 (46.63%), Query Frame = 3
Query:   42 MSMFSGIIYEYPQIAIDNF---NPLVSTYFISHLHLDHLCGIEN------FSASHLTEIYTSDSTAKLILGRNSEFKNIVPYVKPLCLGKSYSIKIKYSDNDQYFSKDIINVTLISSGHCLGSVMLFIEGKNGRVLYTGDFRLNLENSNQLSSDYKYGIKIMKINYLDGLYLDTTFMNKCCAHIPSREDSFVVIINLIEKILLESLDTIIFIDYKVRYTLEALYHLIYLKFNIKVHVDIKSYYQLKPLDESISFCVDPCNWNSRIHACYMDSHCRKNFEEAKNKNKL--------------FTIIPTTLWWSERNLVSNKEVHYIDKFSVRVCFSHHSSFSEIIDFILKVHSKSIY 1040
            MS F+G + EYP +++D F   N     YF+SH H DH+ G++          S    +Y S  T +L+L  N ++     Y+ PL L     I +    ++    K+ + VTL+ +GHC GSVM   EG  G VLYTGDFRL + +           +  M++ +     +D    N      P RE     I  L+   + +S   +++++ K  Y  E L+  +  +F  ++HV+  S    K + E +S+     + ++RIHAC    H +   EE    N+L               +I P+T+W+ ER   +N  +      S R CFS HSS+SE+ DF+  +   +IY
Sbjct:    1 MSSFAGRMKEYPTVSLDRFDRENLHARAYFLSHCHKDHMKGLKGPLLKRKLQFSRTVRLYCSFVTKELLL-NNQKYSFWEEYIVPLELESPTQISLV---DEASGEKEEVVVTLLPAGHCPGSVMFLFEGCRGNVLYTGDFRLAVGD-----------VARMELLHSGSRSVDALQQN------PDREVCLKGISELVGNWISQSPYHVVWLNCKAAYGYEYLFTNLGEEFGTQIHVN--SLAMFKKMPEILSYVT--TDRSARIHACR---HPKD--EEFFQGNRLPCGCSAADGTPLRIISIKPSTMWFGERTKRTNVIIR-TGSSSYRACFSFHSSYSELKDFLAYLKPVNIY 325          
BLAST of DNA cross-link repair 1C vs. Ensembl Medaka
Match: dclre1b (DNA cross-link repair 1B [Source:NCBI gene;Acc:101166551])

HSP 1 Score: 73.559 bits (179), Expect = 8.278e-14
Identity = 88/335 (26.27%), Postives = 144/335 (42.99%), Query Frame = 3
Query:   57 GIIYEYPQIAIDNFN----PLVSTYFISHLHLDHLCGIENFSASHLTEIYTSDSTAKLILGRNSEFKNIVPYVKPLCLGKSYSIKIKYSDNDQYFSKDIINVTLISSGHCLGSVMLFIEGKNGRVLYTGDFRLNLENSNQLSSDYKYGIKIMKIN-YLDGLYLDTTFMNKCCAHIPSREDSFVVIINLIEKILLESLDTIIFIDYKVRYTL--EALYHLIYLKFNIKVHVDIKSYYQLKPLDESISFCVDPCNWNSRIHACYMDSHCRKNFEEAKNKNKLFTIIPTTLWWSERNLVS-NKEVHYIDKFSVRVCFSHHSSFSEIIDFILKVHSKSI 1037
            G I  +  +A+D ++    P    +F+SH+H DH  G+ +  +     IY S  TAKL+  +    +    ++ PL +G+   + +          K+ + VTLI + HC G+VM   +G  G +LYTGDFR          S        +K N  +D LYLD T  +     +PSR+ +       I++I+    D  + I     YTL  E+L   +  +F   V V       LK L+    F  +      R            + ++  N+     I+PT+     R L+S +  VH        V +S HSS+ E++DF+  +   S+
Sbjct:    5 GKIIPHTPLAVDFWHVRKCPSARLFFLSHMHADHTVGLTSTWSGR--PIYCSPVTAKLLHLKLKVKEQ---WIHPLEIGEQNLLPL------DDIGKETLTVTLIDANHCPGAVMFLFQGYFGSILYTGDFRY---------SPSMLREPCLKNNITIDVLYLDDTNCDPNRT-LPSRQKA----TQQIKEIIRSHPDHNVVIGL---YTLGKESLLLELAKEFQTWVEVSYDRMETLKVLELPDVFTTE--QGTGRFRVVDHSEITSASLQDWNNEQPTLAILPTS-----RPLISYHPSVHV-------VPYSDHSSYQEVVDFVSTLKPMSL 297          
BLAST of DNA cross-link repair 1C vs. Planmine SMEST
Match: SMESG000028344.1 (SMESG000028344.1)

HSP 1 Score: 660.603 bits (1703), Expect = 0.000e+0
Identity = 329/345 (95.36%), Postives = 329/345 (95.36%), Query Frame = 3
Query:   42 MSMFSGIIYEYPQIAIDNFNPLVSTYFISHLHLDHLCGIENFSASHLTEIYTSDSTAKLILGRNSEFKNIVPYVKPLCLGKSYSIKIKYSDNDQYFSKDIINVTLISSGHCLGSVMLFIEGKNGRVLYTGDFRLNLENSNQLSSDYKYGIKIMKINYLDGLYLDTTFMNKCCAHIPSREDSFVVIINLIEKILLESLDTIIFIDYKVRYTLEALYHLIYLKFNIKVHVDIKSYYQLKPLDESISFCVDPCNWNSRIHACYMDSHCRKNFEEAKNKNKLFTIIPTTLWWSERNLVSNKEVHYIDKFSVRVCFSHHSSFSEIIDFILKVHSKSIYYCVSQTCNTLKK 1076
            MSMFSGIIYEYPQIAIDNFNPLVSTYFISHLHLDHLCGIENFSASH TEIYTSDSTAKLILGRNSEFKNIVPYVKPLCLGKSYSIKIKYSDNDQYFSKDIINVTLISSGHCLGSVMLFIEGKNGRVLYT               DYKYGIKIMKINYLDGLYLDTTFMNKCCAHIPSREDSFVVIINLIEKILLESLDTIIFIDYKVRYTLEALYHLIYLKFNIKVHVDIKSYYQLKPLDESISFCVDPCNWNSRIHACYMDSHCRKNFEEAKNKNKLFTIIPTTLWWSERNLVSNKEVHYIDKFSVRVCFSHHSSFSEIIDFILKVHSKSIYYCVSQTCNTLKK
Sbjct:    1 MSMFSGIIYEYPQIAIDNFNPLVSTYFISHLHLDHLCGIENFSASHQTEIYTSDSTAKLILGRNSEFKNIVPYVKPLCLGKSYSIKIKYSDNDQYFSKDIINVTLISSGHCLGSVMLFIEGKNGRVLYT---------------DYKYGIKIMKINYLDGLYLDTTFMNKCCAHIPSREDSFVVIINLIEKILLESLDTIIFIDYKVRYTLEALYHLIYLKFNIKVHVDIKSYYQLKPLDESISFCVDPCNWNSRIHACYMDSHCRKNFEEAKNKNKLFTIIPTTLWWSERNLVSNKEVHYIDKFSVRVCFSHHSSFSEIIDFILKVHSKSIYYCVSQTCNTLKK 330          
BLAST of DNA cross-link repair 1C vs. Planmine SMEST
Match: SMESG000028344.1 (SMESG000028344.1)

HSP 1 Score: 655.981 bits (1691), Expect = 0.000e+0
Identity = 327/343 (95.34%), Postives = 327/343 (95.34%), Query Frame = 3
Query:   48 MFSGIIYEYPQIAIDNFNPLVSTYFISHLHLDHLCGIENFSASHLTEIYTSDSTAKLILGRNSEFKNIVPYVKPLCLGKSYSIKIKYSDNDQYFSKDIINVTLISSGHCLGSVMLFIEGKNGRVLYTGDFRLNLENSNQLSSDYKYGIKIMKINYLDGLYLDTTFMNKCCAHIPSREDSFVVIINLIEKILLESLDTIIFIDYKVRYTLEALYHLIYLKFNIKVHVDIKSYYQLKPLDESISFCVDPCNWNSRIHACYMDSHCRKNFEEAKNKNKLFTIIPTTLWWSERNLVSNKEVHYIDKFSVRVCFSHHSSFSEIIDFILKVHSKSIYYCVSQTCNTLKK 1076
            MFSGIIYEYPQIAIDNFNPLVSTYFISHLHLDHLCGIENFSASH TEIYTSDSTAKLILGRNSEFKNIVPYVKPLCLGKSYSIKIKYSDNDQYFSKDIINVTLISSGHCLGSVMLFIEGKNGRVLYT               DYKYGIKIMKINYLDGLYLDTTFMNKCCAHIPSREDSFVVIINLIEKILLESLDTIIFIDYKVRYTLEALYHLIYLKFNIKVHVDIKSYYQLKPLDESISFCVDPCNWNSRIHACYMDSHCRKNFEEAKNKNKLFTIIPTTLWWSERNLVSNKEVHYIDKFSVRVCFSHHSSFSEIIDFILKVHSKSIYYCVSQTCNTLKK
Sbjct:    1 MFSGIIYEYPQIAIDNFNPLVSTYFISHLHLDHLCGIENFSASHQTEIYTSDSTAKLILGRNSEFKNIVPYVKPLCLGKSYSIKIKYSDNDQYFSKDIINVTLISSGHCLGSVMLFIEGKNGRVLYT---------------DYKYGIKIMKINYLDGLYLDTTFMNKCCAHIPSREDSFVVIINLIEKILLESLDTIIFIDYKVRYTLEALYHLIYLKFNIKVHVDIKSYYQLKPLDESISFCVDPCNWNSRIHACYMDSHCRKNFEEAKNKNKLFTIIPTTLWWSERNLVSNKEVHYIDKFSVRVCFSHHSSFSEIIDFILKVHSKSIYYCVSQTCNTLKK 328          
BLAST of DNA cross-link repair 1C vs. Planmine SMEST
Match: SMESG000028344.1 (SMESG000028344.1)

HSP 1 Score: 639.417 bits (1648), Expect = 0.000e+0
Identity = 322/345 (93.33%), Postives = 322/345 (93.33%), Query Frame = 3
Query:   42 MSMFSGIIYEYPQIAIDNFNPLVSTYFISHLHLDHLCGIENFSASHLTEIYTSDSTAKLILGRNSEFKNIVPYVKPLCLGKSYSIKIKYSDNDQYFSKDIINVTLISSGHCLGSVMLFIEGKNGRVLYTGDFRLNLENSNQLSSDYKYGIKIMKINYLDGLYLDTTFMNKCCAHIPSREDSFVVIINLIEKILLESLDTIIFIDYKVRYTLEALYHLIYLKFNIKVHVDIKSYYQLKPLDESISFCVDPCNWNSRIHACYMDSHCRKNFEEAKNKNKLFTIIPTTLWWSERNLVSNKEVHYIDKFSVRVCFSHHSSFSEIIDFILKVHSKSIYYCVSQTCNTLKK 1076
            MSMFSGIIYEYPQIAIDNFNPLVSTYFISHLHLDHLCGIENFSASH TEIYTSDSTAKLILGRNSEFKNIVPYVKPLCLGKSYSIKIKYSDNDQYFSKDIINVTLISSGHCLGSVMLFIEGKNGRVLYT               DYK       INYLDGLYLDTTFMNKCCAHIPSREDSFVVIINLIEKILLESLDTIIFIDYKVRYTLEALYHLIYLKFNIKVHVDIKSYYQLKPLDESISFCVDPCNWNSRIHACYMDSHCRKNFEEAKNKNKLFTIIPTTLWWSERNLVSNKEVHYIDKFSVRVCFSHHSSFSEIIDFILKVHSKSIYYCVSQTCNTLKK
Sbjct:    1 MSMFSGIIYEYPQIAIDNFNPLVSTYFISHLHLDHLCGIENFSASHQTEIYTSDSTAKLILGRNSEFKNIVPYVKPLCLGKSYSIKIKYSDNDQYFSKDIINVTLISSGHCLGSVMLFIEGKNGRVLYT---------------DYK-------INYLDGLYLDTTFMNKCCAHIPSREDSFVVIINLIEKILLESLDTIIFIDYKVRYTLEALYHLIYLKFNIKVHVDIKSYYQLKPLDESISFCVDPCNWNSRIHACYMDSHCRKNFEEAKNKNKLFTIIPTTLWWSERNLVSNKEVHYIDKFSVRVCFSHHSSFSEIIDFILKVHSKSIYYCVSQTCNTLKK 323          
BLAST of DNA cross-link repair 1C vs. Planmine SMEST
Match: SMESG000028344.1 (SMESG000028344.1)

HSP 1 Score: 635.565 bits (1638), Expect = 0.000e+0
Identity = 320/343 (93.29%), Postives = 320/343 (93.29%), Query Frame = 3
Query:   48 MFSGIIYEYPQIAIDNFNPLVSTYFISHLHLDHLCGIENFSASHLTEIYTSDSTAKLILGRNSEFKNIVPYVKPLCLGKSYSIKIKYSDNDQYFSKDIINVTLISSGHCLGSVMLFIEGKNGRVLYTGDFRLNLENSNQLSSDYKYGIKIMKINYLDGLYLDTTFMNKCCAHIPSREDSFVVIINLIEKILLESLDTIIFIDYKVRYTLEALYHLIYLKFNIKVHVDIKSYYQLKPLDESISFCVDPCNWNSRIHACYMDSHCRKNFEEAKNKNKLFTIIPTTLWWSERNLVSNKEVHYIDKFSVRVCFSHHSSFSEIIDFILKVHSKSIYYCVSQTCNTLKK 1076
            MFSGIIYEYPQIAIDNFNPLVSTYFISHLHLDHLCGIENFSASH TEIYTSDSTAKLILGRNSEFKNIVPYVKPLCLGKSYSIKIKYSDNDQYFSKDIINVTLISSGHCLGSVMLFIEGKNGRVLYT               DYK       INYLDGLYLDTTFMNKCCAHIPSREDSFVVIINLIEKILLESLDTIIFIDYKVRYTLEALYHLIYLKFNIKVHVDIKSYYQLKPLDESISFCVDPCNWNSRIHACYMDSHCRKNFEEAKNKNKLFTIIPTTLWWSERNLVSNKEVHYIDKFSVRVCFSHHSSFSEIIDFILKVHSKSIYYCVSQTCNTLKK
Sbjct:    1 MFSGIIYEYPQIAIDNFNPLVSTYFISHLHLDHLCGIENFSASHQTEIYTSDSTAKLILGRNSEFKNIVPYVKPLCLGKSYSIKIKYSDNDQYFSKDIINVTLISSGHCLGSVMLFIEGKNGRVLYT---------------DYK-------INYLDGLYLDTTFMNKCCAHIPSREDSFVVIINLIEKILLESLDTIIFIDYKVRYTLEALYHLIYLKFNIKVHVDIKSYYQLKPLDESISFCVDPCNWNSRIHACYMDSHCRKNFEEAKNKNKLFTIIPTTLWWSERNLVSNKEVHYIDKFSVRVCFSHHSSFSEIIDFILKVHSKSIYYCVSQTCNTLKK 321          
BLAST of DNA cross-link repair 1C vs. Planmine SMEST
Match: SMESG000028344.1 (SMESG000028344.1)

HSP 1 Score: 468.389 bits (1204), Expect = 7.998e-168
Identity = 238/261 (91.19%), Postives = 238/261 (91.19%), Query Frame = 3
Query:   42 MSMFSGIIYEYPQIAIDNFNPLVSTYFISHLHLDHLCGIENFSASHLTEIYTSDSTAKLILGRNSEFKNIVPYVKPLCLGKSYSIKIKYSDNDQYFSKDIINVTLISSGHCLGSVMLFIEGKNGRVLYTGDFRLNLENSNQLSSDYKYGIKIMKINYLDGLYLDTTFMNKCCAHIPSREDSFVVIINLIEKILLESLDTIIFIDYKVRYTLEALYHLIYLKFNIKVHVDIKSYYQLKPLDESISFCVDPCNWNSRIHACYM 824
            MSMFSGIIYEYPQIAIDNFNPLVSTYFISHLHLDHLCGIENFSASH TEIYTSDSTAKLILGRNSEFKNIVPYVKPLCLGKSYSIKIKYSDNDQYFSKDIINVTLISSGHCLGSVMLFIEGKNGRVLYT               DY       KINYLDGLYLDTTFMNKCCAHIPSREDSFVVIINLIEKILLESLDTIIFIDYKVRYTLEALYHLIYLKFNIKVHVDIKSYYQLKPLDESISFCVDPCNWNSRIHACYM
Sbjct:    1 MSMFSGIIYEYPQIAIDNFNPLVSTYFISHLHLDHLCGIENFSASHQTEIYTSDSTAKLILGRNSEFKNIVPYVKPLCLGKSYSIKIKYSDNDQYFSKDIINVTLISSGHCLGSVMLFIEGKNGRVLYT---------------DY-------KINYLDGLYLDTTFMNKCCAHIPSREDSFVVIINLIEKILLESLDTIIFIDYKVRYTLEALYHLIYLKFNIKVHVDIKSYYQLKPLDESISFCVDPCNWNSRIHACYM 239          
The following BLAST results are available for this feature:
BLAST of DNA cross-link repair 1C vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
DCLRE1C1.342e-3630.52DNA cross-link repair 1C [Source:HGNC Symbol;Acc:H... [more]
DCLRE1C3.248e-3530.52DNA cross-link repair 1C [Source:HGNC Symbol;Acc:H... [more]
DCLRE1C5.177e-2029.68DNA cross-link repair 1C [Source:HGNC Symbol;Acc:H... [more]
DCLRE1C5.177e-2029.68DNA cross-link repair 1C [Source:HGNC Symbol;Acc:H... [more]
DCLRE1C5.177e-2029.68DNA cross-link repair 1C [Source:HGNC Symbol;Acc:H... [more]
back to top
BLAST of DNA cross-link repair 1C vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 2
Match NameE-valueIdentityDescription
mrt-14.284e-1126.35MoRTal germline [Source:UniProtKB/TrEMBL;Acc:Q8T3... [more]
mrt-14.284e-1126.35MoRTal germline [Source:UniProtKB/TrEMBL;Acc:Q8T3... [more]
back to top
BLAST of DNA cross-link repair 1C vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 1
Match NameE-valueIdentityDescription
Snm14.330e-830.20gene:FBgn0037338 transcript:FBtr0078688[more]
back to top
BLAST of DNA cross-link repair 1C vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
dclre1c2.750e-3630.90DNA cross-link repair 1C, PSO2 homolog (S. cerevis... [more]
dclre1c2.750e-3630.90DNA cross-link repair 1C, PSO2 homolog (S. cerevis... [more]
dclre1c3.104e-2828.37DNA cross-link repair 1C, PSO2 homolog (S. cerevis... [more]
dclre1b5.708e-1527.10DNA cross-link repair 1B [Source:NCBI gene;Acc:768... [more]
dclre1b5.708e-1527.10DNA cross-link repair 1B [Source:NCBI gene;Acc:768... [more]
back to top
BLAST of DNA cross-link repair 1C vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
DCLRE1C3.294e-3430.23DNA cross-link repair 1C [Source:NCBI gene;Acc:100... [more]
DCLRE1C1.455e-3330.23DNA cross-link repair 1C [Source:NCBI gene;Acc:100... [more]
DCLRE1C1.752e-3330.06DNA cross-link repair 1C [Source:NCBI gene;Acc:100... [more]
DCLRE1C1.840e-3330.23DNA cross-link repair 1C [Source:NCBI gene;Acc:100... [more]
DCLRE1C3.349e-3229.95DNA cross-link repair 1C [Source:NCBI gene;Acc:100... [more]
back to top
BLAST of DNA cross-link repair 1C vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Dclre1c3.071e-3831.88DNA cross-link repair 1C [Source:MGI Symbol;Acc:MG... [more]
Dclre1c1.180e-3731.88DNA cross-link repair 1C [Source:MGI Symbol;Acc:MG... [more]
Dclre1c4.854e-3731.88DNA cross-link repair 1C [Source:MGI Symbol;Acc:MG... [more]
Dclre1b7.911e-1625.37DNA cross-link repair 1B [Source:MGI Symbol;Acc:MG... [more]
Dclre1b7.911e-1625.37DNA cross-link repair 1B [Source:MGI Symbol;Acc:MG... [more]
back to top
BLAST of DNA cross-link repair 1C vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q8K4J0|DCR1C_MOUSE3.395e-3631.88Protein artemis OS=Mus musculus OX=10090 GN=Dclre1... [more]
sp|Q5QJC2|DCR1C_CHICK1.269e-3531.91Protein artemis OS=Gallus gallus OX=9031 GN=DCLRE1... [more]
sp|Q5RGE5|DCR1C_DANRE2.076e-3530.90Protein artemis OS=Danio rerio OX=7955 GN=dclre1c ... [more]
sp|Q5XIX3|DCR1C_RAT5.531e-3531.61Protein artemis OS=Rattus norvegicus OX=10116 GN=D... [more]
sp|Q5R6Z9|DCR1C_PONAB7.569e-3531.10Protein artemis OS=Pongo abelii OX=9601 GN=DCLRE1C... [more]
back to top
BLAST of DNA cross-link repair 1C vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
C3YPJ31.573e-4331.59DRMBL domain-containing protein OS=Branchiostoma f... [more]
S4RFM24.608e-4332.39DNA cross-link repair 1C, PSO2 homolog (S. cerevis... [more]
V4A3J42.753e-4033.14DRMBL domain-containing protein OS=Lottia gigantea... [more]
A0A2G8JWK72.140e-3933.14Lactamase_B domain-containing protein OS=Stichopus... [more]
A0A158NB181.076e-3832.96DRMBL domain-containing protein OS=Atta cephalotes... [more]
back to top
BLAST of DNA cross-link repair 1C vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 3
Match NameE-valueIdentityDescription
dclre1c2.419e-3231.46protein artemis [Source:NCBI gene;Acc:103039825][more]
dclre1b4.793e-1727.13DNA cross-link repair 1B [Source:NCBI gene;Acc:768... [more]
dclre1a1.586e-724.92DNA cross-link repair 1A [Source:NCBI gene;Acc:103... [more]
back to top
BLAST of DNA cross-link repair 1C vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 2
Match NameE-valueIdentityDescription
dclre1c3.540e-4732.39DNA cross-link repair 1C, PSO2 homolog (S. cerevis... [more]
ENSPMAT00000006050.19.521e-1731.35pep scaffold:Pmarinus_7.0:GL476493:567169:571241:-... [more]
back to top
BLAST of DNA cross-link repair 1C vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 1
Match NameE-valueIdentityDescription
PSO21.248e-728.90Nuclease required for DNA single- and double-stran... [more]
back to top
BLAST of DNA cross-link repair 1C vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 3
Match NameE-valueIdentityDescription
EDO481821.906e-3429.84Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO464573.665e-1826.45Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO430894.956e-1426.20Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of DNA cross-link repair 1C vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 3
Match NameE-valueIdentityDescription
dclre1c2.345e-3530.62DNA cross-link repair 1C [Source:NCBI gene;Acc:101... [more]
dclre1c8.268e-3129.21DNA cross-link repair 1C [Source:NCBI gene;Acc:101... [more]
dclre1b8.278e-1426.27DNA cross-link repair 1B [Source:NCBI gene;Acc:101... [more]
back to top
BLAST of DNA cross-link repair 1C vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000028344.10.000e+095.36SMESG000028344.1[more]
SMESG000028344.10.000e+095.34SMESG000028344.1[more]
SMESG000028344.10.000e+093.33SMESG000028344.1[more]
SMESG000028344.10.000e+093.29SMESG000028344.1[more]
SMESG000028344.17.998e-16891.19SMESG000028344.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30015874 ID=SMED30015874|Name=DNA cross-link repair 1C|organism=Schmidtea mediterranea sexual|type=transcript|length=1109bp
GGATTCACTTGTTTTTTTAATATTTTTTTAAACATGGAATAATGTCAATG
TTTTCTGGAATTATTTATGAATATCCACAAATTGCCATAGATAATTTTAA
TCCTTTAGTTTCGACTTATTTTATTTCACACTTGCATTTAGATCATTTAT
GTGGAATTGAAAATTTTTCGGCTTCTCATCTAACTGAAATTTATACTTCT
GATTCCACAGCCAAATTAATATTAGGACGTAATTCTGAATTTAAAAACAT
TGTTCCATATGTTAAACCTTTATGTTTGGGAAAATCATATTCTATTAAAA
TAAAATATTCGGATAATGATCAATACTTTTCTAAAGATATTATTAATGTC
ACGCTAATCTCTTCAGGACATTGTTTAGGTTCAGTGATGCTCTTCATTGA
AGGGAAAAATGGTCGAGTACTATATACCGGTGACTTTCGTTTAAATTTAG
AAAATTCGAATCAATTATCTTCAGATTACAAGTATGGTATAAAAATAATG
AAAATTAATTACTTGGATGGTTTATATTTGGATACAACTTTTATGAACAA
ATGTTGTGCACATATTCCTTCTCGAGAAGATAGTTTTGTGGTAATTATTA
ATCTAATTGAGAAAATTTTGCTGGAAAGTTTGGACACTATAATCTTTATT
GATTATAAAGTCAGATACACTTTAGAAGCTTTATATCACCTTATTTACTT
GAAGTTTAACATAAAGGTTCATGTTGATATCAAATCGTATTATCAACTCA
AGCCTTTGGATGAAAGTATTTCATTTTGTGTTGACCCATGTAATTGGAAT
TCTCGCATACATGCTTGCTATATGGATAGTCACTGCAGAAAAAATTTTGA
AGAAGCTAAAAATAAAAATAAGTTATTTACAATAATTCCTACTACATTAT
GGTGGTCAGAAAGAAATTTAGTTAGTAACAAGGAAGTCCATTATATTGAT
AAATTTTCTGTTCGAGTGTGTTTTTCACACCATAGTTCATTTTCGGAAAT
CATAGATTTTATTTTAAAAGTTCATTCGAAAAGTATTTACTACTGTGTTT
CACAAACTTGTAATACGCTAAAAAAGTAATTCTTAAAAAGTCTTAATTTT
TGTTTTAAT
back to top

protein sequence of SMED30015874-orf-1

>SMED30015874-orf-1 ID=SMED30015874-orf-1|Name=SMED30015874-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=346bp
MSMFSGIIYEYPQIAIDNFNPLVSTYFISHLHLDHLCGIENFSASHLTEI
YTSDSTAKLILGRNSEFKNIVPYVKPLCLGKSYSIKIKYSDNDQYFSKDI
INVTLISSGHCLGSVMLFIEGKNGRVLYTGDFRLNLENSNQLSSDYKYGI
KIMKINYLDGLYLDTTFMNKCCAHIPSREDSFVVIINLIEKILLESLDTI
IFIDYKVRYTLEALYHLIYLKFNIKVHVDIKSYYQLKPLDESISFCVDPC
NWNSRIHACYMDSHCRKNFEEAKNKNKLFTIIPTTLWWSERNLVSNKEVH
YIDKFSVRVCFSHHSSFSEIIDFILKVHSKSIYYCVSQTCNTLKK*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: molecular function
TermDefinition
GO:0000014single-stranded DNA endodeoxyribonuclease activity
GO:00084095'-3' exonuclease activity
GO:0003684damaged DNA binding
GO:0004518nuclease activity
GO:0004519endonuclease activity
GO:0004527exonuclease activity
GO:0016787hydrolase activity
GO:00353125'-3' exodeoxyribonuclease activity
Vocabulary: biological process
TermDefinition
GO:0000723telomere maintenance
GO:0006302double-strand break repair
GO:0010212response to ionizing radiation
GO:0030183B cell differentiation
GO:0033151V(D)J recombination
GO:0051276chromosome organization
GO:0002250adaptive immune response
GO:0002376immune system process
GO:0006281DNA repair
GO:0006303double-strand break repair via nonhomologous end joining
GO:0006310DNA recombination
GO:0006974cellular response to DNA damage stimulus
GO:0031848protection from non-homologous end joining at telomere
GO:0036297interstrand cross-link repair
GO:0090305nucleic acid phosphodiester bond hydrolysis
Vocabulary: cellular component
TermDefinition
GO:0005654nucleoplasm
GO:0005794Golgi apparatus
GO:0000784nuclear chromosome, telomeric region
GO:0005634nucleus
GO:0070419nonhomologous end joining complex
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000017photoreceptor neuron
PLANA:0000418head
PLANA:0002075pigment cell
Vocabulary: INTERPRO
TermDefinition
IPR036866RibonucZ/Hydroxyglut_hydro
IPR011084DRMBL
IPR001279Metallo-B-lactamas
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR011084DNA repair metallo-beta-lactamasePFAMPF07522DRMBLcoord: 254..336
e-value: 3.9E-8
score: 33.5
IPR001279Metallo-beta-lactamasePFAMPF00753Lactamase_Bcoord: 27..137
e-value: 1.0E-4
score: 22.4
IPR036866Ribonuclease Z/Hydroxyacylglutathione hydrolase-likeGENE3DG3DSA:3.60.15.10coord: 11..336
e-value: 1.5E-53
score: 184.1
IPR036866Ribonuclease Z/Hydroxyacylglutathione hydrolase-likeSUPERFAMILYSSF56281Metallo-hydrolase/oxidoreductasecoord: 23..325
NoneNo IPR availableGENE3DG3DSA:3.40.50.12650coord: 174..314
e-value: 1.5E-53
score: 184.1
NoneNo IPR availablePANTHERPTHR23240:SF8PROTEIN ARTEMIScoord: 2..336
NoneNo IPR availablePANTHERPTHR23240DNA CROSS-LINK REPAIR PROTEIN PSO2/SNM1-RELATEDcoord: 2..336