SMED30015853

Overview
NameSMED30015853
Smed IDSMED30015853
Length (bp)732
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of SMED30015853 (SMED30015853) t-SNE clustered cells

Violin plots show distribution of expression levels for SMED30015853 (SMED30015853) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of SMED30015853 (SMED30015853) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for SMED30015853 (SMED30015853) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30015853

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 6

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
headSMED30015853SMESG000069882.1 SmedASXL_006390SmedAsxl_ww_GCZZ01PMID:27034770
Currie et al., 2016
whole organism asexual adult RNA-sequencing evidence
pharynxSMED30015853SMESG000069882.1 dd_Smed_v4_10099_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
neuronSMED30015853SMESG000069882.1 dd_Smed_v4_10099_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
epidermal cellSMED30015853SMESG000069882.1 dd_Smed_v4_10099_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
headSMED30015853SMESG000069882.1 dd_Smed_v6_10099_0_1dd_Smed_v6PMID:28171748
Stückemann et al., 2017
whole organism asexual adult RNA-sequencing evidence
epidermisSMED30015853SMESG000069882.1 dd_Smed_v4_10099_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Alignments
SMED30015853 aligns in the following genomic locations:
Alignment LocationAlignment Score
v31.004259:24437..25268 +3623
Homology
BLAST of SMED30015853 vs. Ensembl Human
Match: RIPK4 (receptor interacting serine/threonine kinase 4 [Source:HGNC Symbol;Acc:HGNC:496])

HSP 1 Score: 64.3142 bits (155), Expect = 3.563e-11
Identity = 42/101 (41.58%), Postives = 59/101 (58.42%), Query Frame = 3
Query:  162 AASAGDFKSVRKLLSENVKIDSRDPEGYTSLHLAAKHGHYEIVKIXXXXXXXXXXXTADLVTPLHLASFHGHVGVMKLLALSKA-DLNATTKSGCKPIDFA 461
            AA  GD  S R LL +N  ++  D EG T +H+A +HG   IV+ILL  GV+V++   D   PLH A++ GH+ ++KLLA      +NA T  G  P+  A
Sbjct:  511 AAQNGDESSTRLLLEKNASVNEVDFEGRTPMHVACQHGQENIVRILLRRGVDVSLQGKDAWLPLHYAAWQGHLPIVKLLAKQPGVSVNAQTLDGRTPLHLA 611          
BLAST of SMED30015853 vs. Ensembl Human
Match: RIPK4 (receptor interacting serine/threonine kinase 4 [Source:HGNC Symbol;Acc:HGNC:496])

HSP 1 Score: 62.7734 bits (151), Expect = 1.075e-10
Identity = 42/101 (41.58%), Postives = 59/101 (58.42%), Query Frame = 3
Query:  162 AASAGDFKSVRKLLSENVKIDSRDPEGYTSLHLAAKHGHYEIVKIXXXXXXXXXXXTADLVTPLHLASFHGHVGVMKLLALSKA-DLNATTKSGCKPIDFA 461
            AA  GD  S R LL +N  ++  D EG T +H+A +HG   IV+ILL  GV+V++   D   PLH A++ GH+ ++KLLA      +NA T  G  P+  A
Sbjct:  559 AAQNGDESSTRLLLEKNASVNEVDFEGRTPMHVACQHGQENIVRILLRRGVDVSLQGKDAWLPLHYAAWQGHLPIVKLLAKQPGVSVNAQTLDGRTPLHLA 659          
BLAST of SMED30015853 vs. Ensembl Human
Match: ANKK1 (ankyrin repeat and kinase domain containing 1 [Source:HGNC Symbol;Acc:HGNC:21027])

HSP 1 Score: 61.6178 bits (148), Expect = 2.773e-10
Identity = 35/100 (35.00%), Postives = 60/100 (60.00%), Query Frame = 3
Query:  162 AASAGDFKSVRKLLSENVKIDSRDPEGYTSLHLAAKHGHYEIVKIXXXXXXXXXXXTADLVTPLHLASFHGHVGVMKLLALSKADLNATTKSGCKPIDFA 461
            AA  GD  + R LL     +D+++ EG+T LHLAA++    + ++L+    + N+  A+  TPLH+A++ GHV ++KLL    A+L+A  ++   P+  A
Sbjct:  435 AAQNGDDGTARLLLDHGACVDAQEREGWTPLHLAAQNNFENVARLLVSRQADPNLHEAEGKTPLHVAAYFGHVSLVKLLTSQGAELDAQQRNLRTPLHLA 534          

HSP 2 Score: 57.3806 bits (137), Expect = 7.599e-9
Identity = 37/105 (35.24%), Postives = 54/105 (51.43%), Query Frame = 3
Query:  162 AASAGDFKSVRKLLSENVKIDSRDPEGYTSLHLAAKHGHYEIVKIXXXXXXXXXXXTADLVTPLHLASFHGHVGVMKLLALSKADLNATTKSGCKPIDFAPYDSE 476
            A   G  ++++ LL      D+ D  GY  LH AA  G Y I K+LL  G ++ + T    TPLHLA++ GH+ ++ LLA S A++ A       P+  A    E
Sbjct:  534 AVERGKVRAIQHLLKSGAVPDALDQSGYGPLHTAAARGKYLICKMLLRYGASLELPTHQGWTPLHLAAYKGHLEIIHLLAESHANMGALGAVNWTPLHLAARHGE 638          

HSP 3 Score: 56.9954 bits (136), Expect = 9.400e-9
Identity = 38/103 (36.89%), Postives = 54/103 (52.43%), Query Frame = 3
Query:  153 LCKAASAGDFKSVRKLLSENVKIDSRDPEGYTSLHLAAKHGHYEIVKIXXXXXXXXXXXTADLVTPLHLASFHGHVGVMKLLALSKADLNATTKSGCKPIDFA 461
            L  AA+ G +   + LL     ++    +G+T LHLAA  GH EI+ +L  +  N+  + A   TPLHLA+ HG   V+  L    AD NA  +SG  P+  A
Sbjct:  564 LHTAAARGKYLICKMLLRYGASLELPTHQGWTPLHLAAYKGHLEIIHLLAESHANMGALGAVNWTPLHLAARHGEEAVVSALLQCGADPNAAEQSGWTPLHLA 666          

HSP 4 Score: 48.9062 bits (115), Expect = 4.897e-6
Identity = 36/100 (36.00%), Postives = 54/100 (54.00%), Query Frame = 3
Query:  165 ASAGDFKSVRKLL-SENVKIDSRDPEGYTSLHLAAKHGHYEIVKIXXXXXXXXXXXTADLVTPLHLASFHGHVGVMKLLALSKADLNATTKSGCKPIDFA 461
            A+  +F++V +LL S     +  + EG T LH+AA  GH  +VK+L   G  ++    +L TPLHLA   G V  ++ L  S A  +A  +SG  P+  A
Sbjct:  468 AAQNNFENVARLLVSRQADPNLHEAEGKTPLHVAAYFGHVSLVKLLTSQGAELDAQQRNLRTPLHLAVERGKVRAIQHLLKSGAVPDALDQSGYGPLHTA 567          
BLAST of SMED30015853 vs. Ensembl Human
Match: EHMT1 (euchromatic histone lysine methyltransferase 1 [Source:HGNC Symbol;Acc:HGNC:24650])

HSP 1 Score: 56.225 bits (134), Expect = 8.966e-10
Identity = 38/98 (38.78%), Postives = 54/98 (55.10%), Query Frame = 3
Query:  153 LCKAASAGDFKSVRKLLSENVKIDSRDPEGYTSLHLAAKHGHYEIVKIXXXXXXXXXXXTAD-LVTPLHLASFHGHVGVMKLLALSKADLNATTKSGC 443
            L +AA     ++V+ L+     +D +D EG T LHLAAK GHYE+V+ LL NG        D   TP+  A+ + HV ++KLL    +D+N     GC
Sbjct:    3 LMEAAENNHLEAVKYLIKAGALVDPKDAEGSTCLHLAAKKGHYEVVQYLLSNGQMDVNCQDDGGWTPMIWATEYKHVDLVKLLLSKGSDINIRDNVGC 100          
BLAST of SMED30015853 vs. Ensembl Human
Match: ANKRD17 (ankyrin repeat domain 17 [Source:HGNC Symbol;Acc:HGNC:23575])

HSP 1 Score: 60.077 bits (144), Expect = 1.060e-9
Identity = 41/108 (37.96%), Postives = 59/108 (54.63%), Query Frame = 3
Query:  141 DEYELCKAASAGDFKSVRKLLSENVKIDSRDPEGYTSLHLAAKHGHYEIVKIXXXXXXXXXXX-TADLVTPLHLASFHGHVGVMKLLALSKADLNATTKSGCKPIDFA 461
            D   L +A S GD  +VRKLL E   ++    EG + L LA   G+YE+ ++LL    NV        +TPL  A+  GHV ++KLL   KAD+NA + +G   + +A
Sbjct:  234 DNRSLAEACSEGDVNAVRKLLIEGRSVNEHTEEGESLLCLACSAGYYELAQVLLAMHANVEDRGIKGDITPLMAAANGGHVKIVKLLLAHKADVNAQSSTGNTALTYA 341          
BLAST of SMED30015853 vs. Ensembl Celegans
Match: trp-4 (TRP (Transient receptor potential) channel family [Source:UniProtKB/TrEMBL;Acc:Q9GRV5])

HSP 1 Score: 58.151 bits (139), Expect = 1.628e-9
Identity = 44/101 (43.56%), Postives = 60/101 (59.41%), Query Frame = 3
Query:  162 AASAGDFKSVRKLLSENVKID-SRDPEGYTSLHLAAKHGHYEIVKIXXXXXXXXXXXTADLVTPLHLASFHGHVGVMKLLALSKADLNATTKSGCKPIDFA 461
            AA  G    V  LLS + +   ++D  G T LHLAA++GHYE+V +L+  G N+NV+  +  T LH A+  GH+ V+KL   S AD  A TK G  P+ FA
Sbjct: 1246 AAQQGHIAVVGMLLSRSTQQQHAKDWRGRTPLHLAAQNGHYEMVSLLIAQGSNINVMDQNGWTGLHFATRAGHLSVVKLFIDSSADPLAETKEGKVPLCFA 1346          

HSP 2 Score: 48.1358 bits (113), Expect = 2.927e-6
Identity = 25/85 (29.41%), Postives = 43/85 (50.59%), Query Frame = 3
Query:  162 AASAGDFKSVRKLLSENVKIDSRDPEGYTSLHLAAKHGHYEIVKIXXXXXXXXXXXTADLVTPLHLASFHGHVGVMKLLALSKAD 416
            AA  G ++ V  L+++   I+  D  G+T LH A + GH  +VK+ + +  +    T +   PL  A+ H H+  ++ L   K D
Sbjct: 1280 AAQNGHYEMVSLLIAQGSNINVMDQNGWTGLHFATRAGHLSVVKLFIDSSADPLAETKEGKVPLCFAAAHNHIECLRFLLKQKHD 1364          

HSP 3 Score: 46.9802 bits (110), Expect = 9.026e-6
Identity = 37/112 (33.04%), Postives = 53/112 (47.32%), Query Frame = 3
Query:  138 FDEY---ELCKAASAGDFKSVRKLLSENVKIDSRDPEGYTSLHLAAKHGHYEIVKIXXXXX-XXXXXXTADLVTPLHLASFHGHVGVMKLLALSKADLNATTKSGCKPIDFA 461
            FDE     L  AA  G    V  LL     ++S+   G   LHLAA+HGH ++V +L+ +    +  +T D  T LH A+  G + V + L    A+ NA    G  P+  A
Sbjct:  916 FDEMGRTALHLAAFNGHLSLVHLLLQHKAFVNSKSKTGEAPLHLAAQHGHVKVVNVLVQDHGAALEAITLDNQTALHFAAKFGQLAVSQTLLALGANPNARDDKGQTPLHLA 1027          
BLAST of SMED30015853 vs. Ensembl Celegans
Match: unc-44 (AO49 ankyrin [Source:UniProtKB/TrEMBL;Acc:Q7JP86])

HSP 1 Score: 58.151 bits (139), Expect = 1.637e-9
Identity = 35/101 (34.65%), Postives = 56/101 (55.45%), Query Frame = 3
Query:  159 KAASAGDFKSVRKLLSENVKIDSRDPEGYTSLHLAAKHGHYEIVKIXXXXXXXXXXXTADLVTPLHLASFHGHVGVMKLLALSKADLNATTKSGCKPIDFA 461
            +AA AGD + V +LL     I++ +  G  SLHLA+K GH E+V+ L+     V+  T    T LH+AS  G   ++ +L  + A++N  + +G  P+  A
Sbjct:   39 RAARAGDLEKVLELLRAGTDINTSNANGLNSLHLASKEGHSEVVRELIKRQAQVDAATRKGNTALHIASLAGQSLIVTILVENGANVNVQSVNGFTPLYMA 139          

HSP 2 Score: 52.7582 bits (125), Expect = 8.586e-8
Identity = 36/100 (36.00%), Postives = 54/100 (54.00%), Query Frame = 3
Query:  162 AASAGDFKSVRKLLSENVKIDSRDPEGYTSLHLAAKHGHYEIVKIXXXXXXXXXXXTADLVTPLHLASFHGHVGVMKLLALSKADLNATTKSGCKPIDFA 461
            AA +G  + V  L+ +   I ++   G   LH+AA+  H +  + LL +   V+ VT D +TPLH+A+  GHV V KLL    AD N+   +G  P+  A
Sbjct:  300 AARSGHDQVVDLLVVQGAPISAKTKNGLAPLHMAAQGDHVDAARTLLYHRAPVDDVTVDYLTPLHVAAHCGHVRVAKLLLDRSADPNSRALNGFTPLHIA 399          

HSP 3 Score: 50.447 bits (119), Expect = 5.554e-7
Identity = 36/105 (34.29%), Postives = 55/105 (52.38%), Query Frame = 3
Query:  162 AASAGDFKSVRKLLSENVKIDSRDPEGYTSLHLAAKHGHYEIVKIXXXXXXXXXXXTADLVTPLHLASFHGHVGVMKLLALSKADLNATTKSGCKPIDFAPYDSE 476
            AA  G    V  LL +    D     G T LHLAA+    ++V++L+ NG  V+    +L TPLH+AS  G+  ++ LL  + A+ NATT+    P+  A  + +
Sbjct:  432 AAFMGAINIVIYLLQQGANPDVETVRGETPLHLAARANQTDVVRVLIRNGAKVDAQARELQTPLHIASRLGNTDIVILLLQAGANSNATTRDNYSPLHIAAKEGQ 536          

HSP 4 Score: 49.6766 bits (117), Expect = 9.344e-7
Identity = 39/106 (36.79%), Postives = 54/106 (50.94%), Query Frame = 3
Query:  144 EYELCKAASAGDFKSVRKLLSENVKIDSRDPEGYTSLHLAAKHGHYEIVKIXXXXXXXXXXXTADLVTPLHLASFHGHVGVMKLLALSKADLNATTKSGCKPIDFA 461
            E  L  AA A     VR L+    K+D++  E  T LH+A++ G+ +IV +LL  G N N  T D  +PLH+A+  G   V  +L    AD    TK G  P+  A
Sbjct:  459 ETPLHLAARANQTDVVRVLIRNGAKVDAQARELQTPLHIASRLGNTDIVILLLQAGANSNATTRDNYSPLHIAAKEGQEEVAGILLDHNADKTLLTKKGFTPLHLA 564          

HSP 5 Score: 49.6766 bits (117), Expect = 1.033e-6
Identity = 33/102 (32.35%), Postives = 50/102 (49.02%), Query Frame = 3
Query:  162 AASAGDFKSVRKLLSENVKIDSRDPEGYTSLHLAAKHGHYEIVKIXXXXXXXXXXXTADLVTPLHLASFHGHVGVMKLLALSKADLNATTKSGCKPIDFAPY 467
            AA      + R LL     +D    +  T LH+AA  GH  + K+LL    + N    +  TPLH+A     + V++LL   +A + ATT+SG  P+  A +
Sbjct:  333 AAQGDHVDAARTLLYHRAPVDDVTVDYLTPLHVAAHCGHVRVAKLLLDRSADPNSRALNGFTPLHIACKKNRIKVVELLLKYRAAIEATTESGLTPLHVAAF 434          

HSP 6 Score: 48.9062 bits (115), Expect = 2.102e-6
Identity = 33/100 (33.00%), Postives = 52/100 (52.00%), Query Frame = 3
Query:  162 AASAGDFKSVRKLLSENVKIDSRDPEGYTSLHLAAKHGHYEIVKIXXXXXXXXXXXTADLVTPLHLASFHGHVGVMKLLALSKADLNATTKSGCKPIDFA 461
            AA  G     + LL +   ++ +     + LH+A K G   +  +LL  G  ++  T DL+TPLH A+  GH  V+ LL +  A ++A TK+G  P+  A
Sbjct:  234 AAHYGHENVGQLLLEKGANVNYQARHNISPLHVATKWGRTNMANLLLSRGAIIDSRTKDLLTPLHCAARSGHDQVVDLLVVQGAPISAKTKNGLAPLHMA 333          

HSP 7 Score: 48.521 bits (114), Expect = 2.813e-6
Identity = 35/100 (35.00%), Postives = 54/100 (54.00%), Query Frame = 3
Query:  162 AASAGDFKSVRKLLSENVKIDSRDPEGYTSLHLAAKHGHYEIVKIXXXXXXXXXXXTADLVTPLHLASFHGHVGVMKLLALSKADLNATTKSGCKPIDFA 461
            AA  G  +    LL  N        +G+T LHLA+K+G+ E+V++LL  G  V++   + VTPLH+A+ + +  V  LL  + A   A  K+G  P+  A
Sbjct:  531 AAKEGQEEVAGILLDHNADKTLLTKKGFTPLHLASKYGNLEVVRLLLERGTPVDIEGKNQVTPLHVAAHYNNDKVAMLLLENGASAKAAAKNGYTPLHIA 630          

HSP 8 Score: 48.1358 bits (113), Expect = 2.839e-6
Identity = 30/100 (30.00%), Postives = 50/100 (50.00%), Query Frame = 3
Query:  162 AASAGDFKSVRKLLSENVKIDSRDPEGYTSLHLAAKHGHYEIVKIXXXXXXXXXXXTADLVTPLHLASFHGHVGVMKLLALSKADLNATTKSGCKPIDFA 461
            AA  G  +  + LL  +   +SR   G+T LH+A K    ++V++LL     +   T   +TPLH+A+F G + ++  L    A+ +  T  G  P+  A
Sbjct:  366 AAHCGHVRVAKLLLDRSADPNSRALNGFTPLHIACKKNRIKVVELLLKYRAAIEATTESGLTPLHVAAFMGAINIVIYLLQQGANPDVETVRGETPLHLA 465          
BLAST of SMED30015853 vs. Ensembl Celegans
Match: unc-44 (AO49 ankyrin [Source:UniProtKB/TrEMBL;Acc:Q7JP86])

HSP 1 Score: 58.151 bits (139), Expect = 1.637e-9
Identity = 35/101 (34.65%), Postives = 56/101 (55.45%), Query Frame = 3
Query:  159 KAASAGDFKSVRKLLSENVKIDSRDPEGYTSLHLAAKHGHYEIVKIXXXXXXXXXXXTADLVTPLHLASFHGHVGVMKLLALSKADLNATTKSGCKPIDFA 461
            +AA AGD + V +LL     I++ +  G  SLHLA+K GH E+V+ L+     V+  T    T LH+AS  G   ++ +L  + A++N  + +G  P+  A
Sbjct:   39 RAARAGDLEKVLELLRAGTDINTSNANGLNSLHLASKEGHSEVVRELIKRQAQVDAATRKGNTALHIASLAGQSLIVTILVENGANVNVQSVNGFTPLYMA 139          

HSP 2 Score: 52.7582 bits (125), Expect = 8.586e-8
Identity = 36/100 (36.00%), Postives = 54/100 (54.00%), Query Frame = 3
Query:  162 AASAGDFKSVRKLLSENVKIDSRDPEGYTSLHLAAKHGHYEIVKIXXXXXXXXXXXTADLVTPLHLASFHGHVGVMKLLALSKADLNATTKSGCKPIDFA 461
            AA +G  + V  L+ +   I ++   G   LH+AA+  H +  + LL +   V+ VT D +TPLH+A+  GHV V KLL    AD N+   +G  P+  A
Sbjct:  300 AARSGHDQVVDLLVVQGAPISAKTKNGLAPLHMAAQGDHVDAARTLLYHRAPVDDVTVDYLTPLHVAAHCGHVRVAKLLLDRSADPNSRALNGFTPLHIA 399          

HSP 3 Score: 50.447 bits (119), Expect = 5.554e-7
Identity = 36/105 (34.29%), Postives = 55/105 (52.38%), Query Frame = 3
Query:  162 AASAGDFKSVRKLLSENVKIDSRDPEGYTSLHLAAKHGHYEIVKIXXXXXXXXXXXTADLVTPLHLASFHGHVGVMKLLALSKADLNATTKSGCKPIDFAPYDSE 476
            AA  G    V  LL +    D     G T LHLAA+    ++V++L+ NG  V+    +L TPLH+AS  G+  ++ LL  + A+ NATT+    P+  A  + +
Sbjct:  432 AAFMGAINIVIYLLQQGANPDVETVRGETPLHLAARANQTDVVRVLIRNGAKVDAQARELQTPLHIASRLGNTDIVILLLQAGANSNATTRDNYSPLHIAAKEGQ 536          

HSP 4 Score: 49.6766 bits (117), Expect = 9.344e-7
Identity = 39/106 (36.79%), Postives = 54/106 (50.94%), Query Frame = 3
Query:  144 EYELCKAASAGDFKSVRKLLSENVKIDSRDPEGYTSLHLAAKHGHYEIVKIXXXXXXXXXXXTADLVTPLHLASFHGHVGVMKLLALSKADLNATTKSGCKPIDFA 461
            E  L  AA A     VR L+    K+D++  E  T LH+A++ G+ +IV +LL  G N N  T D  +PLH+A+  G   V  +L    AD    TK G  P+  A
Sbjct:  459 ETPLHLAARANQTDVVRVLIRNGAKVDAQARELQTPLHIASRLGNTDIVILLLQAGANSNATTRDNYSPLHIAAKEGQEEVAGILLDHNADKTLLTKKGFTPLHLA 564          

HSP 5 Score: 49.6766 bits (117), Expect = 1.033e-6
Identity = 33/102 (32.35%), Postives = 50/102 (49.02%), Query Frame = 3
Query:  162 AASAGDFKSVRKLLSENVKIDSRDPEGYTSLHLAAKHGHYEIVKIXXXXXXXXXXXTADLVTPLHLASFHGHVGVMKLLALSKADLNATTKSGCKPIDFAPY 467
            AA      + R LL     +D    +  T LH+AA  GH  + K+LL    + N    +  TPLH+A     + V++LL   +A + ATT+SG  P+  A +
Sbjct:  333 AAQGDHVDAARTLLYHRAPVDDVTVDYLTPLHVAAHCGHVRVAKLLLDRSADPNSRALNGFTPLHIACKKNRIKVVELLLKYRAAIEATTESGLTPLHVAAF 434          

HSP 6 Score: 48.9062 bits (115), Expect = 2.102e-6
Identity = 33/100 (33.00%), Postives = 52/100 (52.00%), Query Frame = 3
Query:  162 AASAGDFKSVRKLLSENVKIDSRDPEGYTSLHLAAKHGHYEIVKIXXXXXXXXXXXTADLVTPLHLASFHGHVGVMKLLALSKADLNATTKSGCKPIDFA 461
            AA  G     + LL +   ++ +     + LH+A K G   +  +LL  G  ++  T DL+TPLH A+  GH  V+ LL +  A ++A TK+G  P+  A
Sbjct:  234 AAHYGHENVGQLLLEKGANVNYQARHNISPLHVATKWGRTNMANLLLSRGAIIDSRTKDLLTPLHCAARSGHDQVVDLLVVQGAPISAKTKNGLAPLHMA 333          

HSP 7 Score: 48.521 bits (114), Expect = 2.813e-6
Identity = 35/100 (35.00%), Postives = 54/100 (54.00%), Query Frame = 3
Query:  162 AASAGDFKSVRKLLSENVKIDSRDPEGYTSLHLAAKHGHYEIVKIXXXXXXXXXXXTADLVTPLHLASFHGHVGVMKLLALSKADLNATTKSGCKPIDFA 461
            AA  G  +    LL  N        +G+T LHLA+K+G+ E+V++LL  G  V++   + VTPLH+A+ + +  V  LL  + A   A  K+G  P+  A
Sbjct:  531 AAKEGQEEVAGILLDHNADKTLLTKKGFTPLHLASKYGNLEVVRLLLERGTPVDIEGKNQVTPLHVAAHYNNDKVAMLLLENGASAKAAAKNGYTPLHIA 630          

HSP 8 Score: 48.1358 bits (113), Expect = 2.839e-6
Identity = 30/100 (30.00%), Postives = 50/100 (50.00%), Query Frame = 3
Query:  162 AASAGDFKSVRKLLSENVKIDSRDPEGYTSLHLAAKHGHYEIVKIXXXXXXXXXXXTADLVTPLHLASFHGHVGVMKLLALSKADLNATTKSGCKPIDFA 461
            AA  G  +  + LL  +   +SR   G+T LH+A K    ++V++LL     +   T   +TPLH+A+F G + ++  L    A+ +  T  G  P+  A
Sbjct:  366 AAHCGHVRVAKLLLDRSADPNSRALNGFTPLHIACKKNRIKVVELLLKYRAAIEATTESGLTPLHVAAFMGAINIVIYLLQQGANPDVETVRGETPLHLA 465          
BLAST of SMED30015853 vs. Ensembl Celegans
Match: unc-44 (AO49 ankyrin [Source:UniProtKB/TrEMBL;Acc:Q7JP86])

HSP 1 Score: 57.7658 bits (138), Expect = 1.913e-9
Identity = 35/101 (34.65%), Postives = 56/101 (55.45%), Query Frame = 3
Query:  159 KAASAGDFKSVRKLLSENVKIDSRDPEGYTSLHLAAKHGHYEIVKIXXXXXXXXXXXTADLVTPLHLASFHGHVGVMKLLALSKADLNATTKSGCKPIDFA 461
            +AA AGD + V +LL     I++ +  G  SLHLA+K GH E+V+ L+     V+  T    T LH+AS  G   ++ +L  + A++N  + +G  P+  A
Sbjct:   39 RAARAGDLEKVLELLRAGTDINTSNANGLNSLHLASKEGHSEVVRELIKRQAQVDAATRKGNTALHIASLAGQSLIVTILVENGANVNVQSVNGFTPLYMA 139          

HSP 2 Score: 52.7582 bits (125), Expect = 9.751e-8
Identity = 36/100 (36.00%), Postives = 54/100 (54.00%), Query Frame = 3
Query:  162 AASAGDFKSVRKLLSENVKIDSRDPEGYTSLHLAAKHGHYEIVKIXXXXXXXXXXXTADLVTPLHLASFHGHVGVMKLLALSKADLNATTKSGCKPIDFA 461
            AA +G  + V  L+ +   I ++   G   LH+AA+  H +  + LL +   V+ VT D +TPLH+A+  GHV V KLL    AD N+   +G  P+  A
Sbjct:  300 AARSGHDQVVDLLVVQGAPISAKTKNGLAPLHMAAQGDHVDAARTLLYHRAPVDDVTVDYLTPLHVAAHCGHVRVAKLLLDRSADPNSRALNGFTPLHIA 399          

HSP 3 Score: 50.447 bits (119), Expect = 5.914e-7
Identity = 36/105 (34.29%), Postives = 55/105 (52.38%), Query Frame = 3
Query:  162 AASAGDFKSVRKLLSENVKIDSRDPEGYTSLHLAAKHGHYEIVKIXXXXXXXXXXXTADLVTPLHLASFHGHVGVMKLLALSKADLNATTKSGCKPIDFAPYDSE 476
            AA  G    V  LL +    D     G T LHLAA+    ++V++L+ NG  V+    +L TPLH+AS  G+  ++ LL  + A+ NATT+    P+  A  + +
Sbjct:  432 AAFMGAINIVIYLLQQGANPDVETVRGETPLHLAARANQTDVVRVLIRNGAKVDAQARELQTPLHIASRLGNTDIVILLLQAGANSNATTRDNYSPLHIAAKEGQ 536          

HSP 4 Score: 49.6766 bits (117), Expect = 1.080e-6
Identity = 39/106 (36.79%), Postives = 54/106 (50.94%), Query Frame = 3
Query:  144 EYELCKAASAGDFKSVRKLLSENVKIDSRDPEGYTSLHLAAKHGHYEIVKIXXXXXXXXXXXTADLVTPLHLASFHGHVGVMKLLALSKADLNATTKSGCKPIDFA 461
            E  L  AA A     VR L+    K+D++  E  T LH+A++ G+ +IV +LL  G N N  T D  +PLH+A+  G   V  +L    AD    TK G  P+  A
Sbjct:  459 ETPLHLAARANQTDVVRVLIRNGAKVDAQARELQTPLHIASRLGNTDIVILLLQAGANSNATTRDNYSPLHIAAKEGQEEVAGILLDHNADKTLLTKKGFTPLHLA 564          

HSP 5 Score: 49.6766 bits (117), Expect = 1.162e-6
Identity = 33/102 (32.35%), Postives = 50/102 (49.02%), Query Frame = 3
Query:  162 AASAGDFKSVRKLLSENVKIDSRDPEGYTSLHLAAKHGHYEIVKIXXXXXXXXXXXTADLVTPLHLASFHGHVGVMKLLALSKADLNATTKSGCKPIDFAPY 467
            AA      + R LL     +D    +  T LH+AA  GH  + K+LL    + N    +  TPLH+A     + V++LL   +A + ATT+SG  P+  A +
Sbjct:  333 AAQGDHVDAARTLLYHRAPVDDVTVDYLTPLHVAAHCGHVRVAKLLLDRSADPNSRALNGFTPLHIACKKNRIKVVELLLKYRAAIEATTESGLTPLHVAAF 434          

HSP 6 Score: 48.521 bits (114), Expect = 2.407e-6
Identity = 30/88 (34.09%), Postives = 48/88 (54.55%), Query Frame = 3
Query:  198 LLSENVKIDSRDPEGYTSLHLAAKHGHYEIVKIXXXXXXXXXXXTADLVTPLHLASFHGHVGVMKLLALSKADLNATTKSGCKPIDFA 461
            LL +   ++ +     + LH+A K G   +  +LL  G  ++  T DL+TPLH A+  GH  V+ LL +  A ++A TK+G  P+  A
Sbjct:  246 LLEKGANVNYQARHNISPLHVATKWGRTNMANLLLSRGAIIDSRTKDLLTPLHCAARSGHDQVVDLLVVQGAPISAKTKNGLAPLHMA 333          

HSP 7 Score: 48.1358 bits (113), Expect = 3.162e-6
Identity = 35/100 (35.00%), Postives = 54/100 (54.00%), Query Frame = 3
Query:  162 AASAGDFKSVRKLLSENVKIDSRDPEGYTSLHLAAKHGHYEIVKIXXXXXXXXXXXTADLVTPLHLASFHGHVGVMKLLALSKADLNATTKSGCKPIDFA 461
            AA  G  +    LL  N        +G+T LHLA+K+G+ E+V++LL  G  V++   + VTPLH+A+ + +  V  LL  + A   A  K+G  P+  A
Sbjct:  531 AAKEGQEEVAGILLDHNADKTLLTKKGFTPLHLASKYGNLEVVRLLLERGTPVDIEGKNQVTPLHVAAHYNNDKVAMLLLENGASAKAAAKNGYTPLHIA 630          

HSP 8 Score: 48.1358 bits (113), Expect = 3.191e-6
Identity = 30/100 (30.00%), Postives = 50/100 (50.00%), Query Frame = 3
Query:  162 AASAGDFKSVRKLLSENVKIDSRDPEGYTSLHLAAKHGHYEIVKIXXXXXXXXXXXTADLVTPLHLASFHGHVGVMKLLALSKADLNATTKSGCKPIDFA 461
            AA  G  +  + LL  +   +SR   G+T LH+A K    ++V++LL     +   T   +TPLH+A+F G + ++  L    A+ +  T  G  P+  A
Sbjct:  366 AAHCGHVRVAKLLLDRSADPNSRALNGFTPLHIACKKNRIKVVELLLKYRAAIEATTESGLTPLHVAAFMGAINIVIYLLQQGANPDVETVRGETPLHLA 465          
BLAST of SMED30015853 vs. Ensembl Celegans
Match: unc-44 (AO49 ankyrin [Source:UniProtKB/TrEMBL;Acc:Q7JP86])

HSP 1 Score: 57.7658 bits (138), Expect = 1.913e-9
Identity = 35/101 (34.65%), Postives = 56/101 (55.45%), Query Frame = 3
Query:  159 KAASAGDFKSVRKLLSENVKIDSRDPEGYTSLHLAAKHGHYEIVKIXXXXXXXXXXXTADLVTPLHLASFHGHVGVMKLLALSKADLNATTKSGCKPIDFA 461
            +AA AGD + V +LL     I++ +  G  SLHLA+K GH E+V+ L+     V+  T    T LH+AS  G   ++ +L  + A++N  + +G  P+  A
Sbjct:   39 RAARAGDLEKVLELLRAGTDINTSNANGLNSLHLASKEGHSEVVRELIKRQAQVDAATRKGNTALHIASLAGQSLIVTILVENGANVNVQSVNGFTPLYMA 139          

HSP 2 Score: 52.7582 bits (125), Expect = 9.751e-8
Identity = 36/100 (36.00%), Postives = 54/100 (54.00%), Query Frame = 3
Query:  162 AASAGDFKSVRKLLSENVKIDSRDPEGYTSLHLAAKHGHYEIVKIXXXXXXXXXXXTADLVTPLHLASFHGHVGVMKLLALSKADLNATTKSGCKPIDFA 461
            AA +G  + V  L+ +   I ++   G   LH+AA+  H +  + LL +   V+ VT D +TPLH+A+  GHV V KLL    AD N+   +G  P+  A
Sbjct:  300 AARSGHDQVVDLLVVQGAPISAKTKNGLAPLHMAAQGDHVDAARTLLYHRAPVDDVTVDYLTPLHVAAHCGHVRVAKLLLDRSADPNSRALNGFTPLHIA 399          

HSP 3 Score: 50.447 bits (119), Expect = 5.914e-7
Identity = 36/105 (34.29%), Postives = 55/105 (52.38%), Query Frame = 3
Query:  162 AASAGDFKSVRKLLSENVKIDSRDPEGYTSLHLAAKHGHYEIVKIXXXXXXXXXXXTADLVTPLHLASFHGHVGVMKLLALSKADLNATTKSGCKPIDFAPYDSE 476
            AA  G    V  LL +    D     G T LHLAA+    ++V++L+ NG  V+    +L TPLH+AS  G+  ++ LL  + A+ NATT+    P+  A  + +
Sbjct:  432 AAFMGAINIVIYLLQQGANPDVETVRGETPLHLAARANQTDVVRVLIRNGAKVDAQARELQTPLHIASRLGNTDIVILLLQAGANSNATTRDNYSPLHIAAKEGQ 536          

HSP 4 Score: 49.6766 bits (117), Expect = 1.080e-6
Identity = 39/106 (36.79%), Postives = 54/106 (50.94%), Query Frame = 3
Query:  144 EYELCKAASAGDFKSVRKLLSENVKIDSRDPEGYTSLHLAAKHGHYEIVKIXXXXXXXXXXXTADLVTPLHLASFHGHVGVMKLLALSKADLNATTKSGCKPIDFA 461
            E  L  AA A     VR L+    K+D++  E  T LH+A++ G+ +IV +LL  G N N  T D  +PLH+A+  G   V  +L    AD    TK G  P+  A
Sbjct:  459 ETPLHLAARANQTDVVRVLIRNGAKVDAQARELQTPLHIASRLGNTDIVILLLQAGANSNATTRDNYSPLHIAAKEGQEEVAGILLDHNADKTLLTKKGFTPLHLA 564          

HSP 5 Score: 49.6766 bits (117), Expect = 1.162e-6
Identity = 33/102 (32.35%), Postives = 50/102 (49.02%), Query Frame = 3
Query:  162 AASAGDFKSVRKLLSENVKIDSRDPEGYTSLHLAAKHGHYEIVKIXXXXXXXXXXXTADLVTPLHLASFHGHVGVMKLLALSKADLNATTKSGCKPIDFAPY 467
            AA      + R LL     +D    +  T LH+AA  GH  + K+LL    + N    +  TPLH+A     + V++LL   +A + ATT+SG  P+  A +
Sbjct:  333 AAQGDHVDAARTLLYHRAPVDDVTVDYLTPLHVAAHCGHVRVAKLLLDRSADPNSRALNGFTPLHIACKKNRIKVVELLLKYRAAIEATTESGLTPLHVAAF 434          

HSP 6 Score: 48.521 bits (114), Expect = 2.407e-6
Identity = 30/88 (34.09%), Postives = 48/88 (54.55%), Query Frame = 3
Query:  198 LLSENVKIDSRDPEGYTSLHLAAKHGHYEIVKIXXXXXXXXXXXTADLVTPLHLASFHGHVGVMKLLALSKADLNATTKSGCKPIDFA 461
            LL +   ++ +     + LH+A K G   +  +LL  G  ++  T DL+TPLH A+  GH  V+ LL +  A ++A TK+G  P+  A
Sbjct:  246 LLEKGANVNYQARHNISPLHVATKWGRTNMANLLLSRGAIIDSRTKDLLTPLHCAARSGHDQVVDLLVVQGAPISAKTKNGLAPLHMA 333          

HSP 7 Score: 48.1358 bits (113), Expect = 3.162e-6
Identity = 35/100 (35.00%), Postives = 54/100 (54.00%), Query Frame = 3
Query:  162 AASAGDFKSVRKLLSENVKIDSRDPEGYTSLHLAAKHGHYEIVKIXXXXXXXXXXXTADLVTPLHLASFHGHVGVMKLLALSKADLNATTKSGCKPIDFA 461
            AA  G  +    LL  N        +G+T LHLA+K+G+ E+V++LL  G  V++   + VTPLH+A+ + +  V  LL  + A   A  K+G  P+  A
Sbjct:  531 AAKEGQEEVAGILLDHNADKTLLTKKGFTPLHLASKYGNLEVVRLLLERGTPVDIEGKNQVTPLHVAAHYNNDKVAMLLLENGASAKAAAKNGYTPLHIA 630          

HSP 8 Score: 48.1358 bits (113), Expect = 3.191e-6
Identity = 30/100 (30.00%), Postives = 50/100 (50.00%), Query Frame = 3
Query:  162 AASAGDFKSVRKLLSENVKIDSRDPEGYTSLHLAAKHGHYEIVKIXXXXXXXXXXXTADLVTPLHLASFHGHVGVMKLLALSKADLNATTKSGCKPIDFA 461
            AA  G  +  + LL  +   +SR   G+T LH+A K    ++V++LL     +   T   +TPLH+A+F G + ++  L    A+ +  T  G  P+  A
Sbjct:  366 AAHCGHVRVAKLLLDRSADPNSRALNGFTPLHIACKKNRIKVVELLLKYRAAIEATTESGLTPLHVAAFMGAINIVIYLLQQGANPDVETVRGETPLHLA 465          
BLAST of SMED30015853 vs. Ensembl Fly
Match: Ank2 (gene:FBgn0261788 transcript:FBtr0303119)

HSP 1 Score: 61.6178 bits (148), Expect = 1.208e-10
Identity = 36/100 (36.00%), Postives = 58/100 (58.00%), Query Frame = 3
Query:  162 AASAGDFKSVRKLLSENVKIDSRDPEGYTSLHLAAKHGHYEIVKIXXXXXXXXXXXTADLVTPLHLASFHGHVGVMKLLALSKADLNATTKSGCKPIDFA 461
            A+  G+   V  LL    ++D+   + YT+LH+AAK G  E+  +L+ NG  ++  T    TPLHL + +GH+ V +LL   +AD++A  K+G  P+  A
Sbjct:  476 ASRLGNVDIVMLLLQHGAQVDATTKDMYTALHIAAKEGQDEVAAVLIENGAALDAATKKGFTPLHLTAKYGHIKVAQLLLQKEADVDAQGKNGVTPLHVA 575          

HSP 2 Score: 56.6102 bits (135), Expect = 6.730e-9
Identity = 37/101 (36.63%), Postives = 56/101 (55.45%), Query Frame = 3
Query:  159 KAASAGDFKSVRKLLSENVKIDSRDPEGYTSLHLAAKHGHYEIVKIXXXXXXXXXXXTADLVTPLHLASFHGHVGVMKLLALSKADLNATTKSGCKPIDFA 461
            +AA AG+ + V + L  N+ I++ +  G  +LHLA+K GH  +V  LL  G  V+  T    T LH+AS  G   V+KLL    A +N  +++G  P+  A
Sbjct:   17 RAARAGNLERVLEHLKNNIDINTSNANGLNALHLASKDGHIHVVSELLRRGAIVDSATKKGNTALHIASLAGQEEVVKLLLEHNASVNVQSQNGFTPLYMA 117          

HSP 3 Score: 54.299 bits (129), Expect = 3.224e-8
Identity = 38/100 (38.00%), Postives = 53/100 (53.00%), Query Frame = 3
Query:  162 AASAGDFKSVRKLLSENVKIDSRDPEGYTSLHLAAKHGHYEIVKIXXXXXXXXXXXTADLVTPLHLASFHGHVGVMKLLALSKADLNATTKSGCKPIDFA 461
            AA +G  + V  LL     I ++   G   LH+AA+  H +  +ILL +   V+ VT D +T LH+A+  GHV V KLL    AD NA   +G  P+  A
Sbjct:  278 AARSGHEQVVDMLLERGAPISAKTKNGLAPLHMAAQGEHVDAARILLYHRAPVDEVTVDYLTALHVAAHCGHVRVAKLLLDRNADANARALNGFTPLHIA 377          

HSP 4 Score: 53.1434 bits (126), Expect = 8.859e-8
Identity = 38/103 (36.89%), Postives = 57/103 (55.34%), Query Frame = 3
Query:  144 EYELCKAASAGDFKSVRKLLSENVKIDSRDPEGYTSLHLAAKHGHYEIVKIXXXXXXXXXXXTADLVTPLHLASFHGHVGVMKLLALSKADLNATTKSGCKPI 452
            E  L  AA A     +R LL    ++D+R  E  T LH+A++ G+ +IV +LL +G  V+  T D+ T LH+A+  G   V  +L  + A L+A TK G  P+
Sbjct:  437 ETPLHLAARANQTDIIRILLRNGAQVDARAREQQTPLHIASRLGNVDIVMLLLQHGAQVDATTKDMYTALHIAAKEGQDEVAAVLIENGAALDAATKKGFTPL 539          

HSP 5 Score: 50.447 bits (119), Expect = 6.235e-7
Identity = 37/123 (30.08%), Postives = 61/123 (49.59%), Query Frame = 3
Query:  162 AASAGDFKSVRKLLSENVKIDSRDPEGYTSLHLAAKHGHYEIVKIXXXXXXXXXXXTADLVTPLHLASFHGHVGVMKLLALSKADLNATTKSGCKPIDFAPYDSERWRILRDASLNILPYSEL 530
            AA  G  +    L+     +D+   +G+T LHL AK+GH ++ ++LL    +V+    + VTPLH+A  + +  V  LL    A  +AT K+G  P+  A   ++      D +  +L Y  L
Sbjct:  509 AAKEGQDEVAAVLIENGAALDAATKKGFTPLHLTAKYGHIKVAQLLLQKEADVDAQGKNGVTPLHVACHYNNQQVALLLLEKGASPHATAKNGHTPLHIAARKNQ-----MDIATTLLEYGAL 626          

HSP 6 Score: 48.9062 bits (115), Expect = 2.496e-6
Identity = 34/100 (34.00%), Postives = 57/100 (57.00%), Query Frame = 3
Query:  162 AASAGDFKSVRKLLSENVKIDSRDPEGYTSLHLAAKHGHYEIVKIXXXXXXXXXXXTADLVTPLHLASFHGHVGVMKLLALSKADLNATTKSGCKPIDFA 461
            A+  G    V +LL     +DS   +G T+LH+A+  G  E+VK+LL +  +VNV + +  TPL++A+   H  V++LL  + A+ +  T+ G  P+  A
Sbjct:   51 ASKDGHIHVVSELLRRGAIVDSATKKGNTALHIASLAGQEEVVKLLLEHNASVNVQSQNGFTPLYMAAQENHDAVVRLLLSNGANQSLATEDGFTPLAVA 150          

HSP 7 Score: 48.521 bits (114), Expect = 2.968e-6
Identity = 33/102 (32.35%), Postives = 51/102 (50.00%), Query Frame = 3
Query:  162 AASAGDFKSVRKLLSENVKIDSRDPEGYTSLHLAAKHGHYEIVKIXXXXXXXXXXXTADLVTPLHLASFHGHVGVMKLLALSKADLNATTKSGCKPIDFAPY 467
            AA      + R LL     +D    +  T+LH+AA  GH  + K+LL    + N    +  TPLH+A     + V++LL    A ++ATT+SG  P+  A +
Sbjct:  311 AAQGEHVDAARILLYHRAPVDEVTVDYLTALHVAAHCGHVRVAKLLLDRNADANARALNGFTPLHIACKKNRLKVVELLLRHGASISATTESGLTPLHVAAF 412          

HSP 8 Score: 47.7506 bits (112), Expect = 4.594e-6
Identity = 37/96 (38.54%), Postives = 53/96 (55.21%), Query Frame = 3
Query:  177 DFKSVRKLLSEN-VKIDSRDPEGYTSLHLAAKHGHYEIVKIXXXXXXXXXXXTADLVTPLHLASFHGHVGVMKLLALSKADLNATTKSGCKPIDFA 461
            D  +V ++L +N   ID     GYT LH+A+  G   +V+ LL NG NV+  T+   TPLH  +  GH  ++ LL   KA+ NA T +G  P+  A
Sbjct:  678 DNVNVAEILEKNGANIDMATKAGYTPLHVASHFGQANMVRFLLQNGANVDAATSIGYTPLHQTAQQGHCHIVNLLLEHKANANAQTVNGQTPLHIA 773          

HSP 9 Score: 47.3654 bits (111), Expect = 6.259e-6
Identity = 31/100 (31.00%), Postives = 53/100 (53.00%), Query Frame = 3
Query:  162 AASAGDFKSVRKLLSENVKIDSRDPEGYTSLHLAAKHGHYEIVKIXXXXXXXXXXXTADLVTPLHLASFHGHVGVMKLLALSKADLNATTKSGCKPIDFA 461
            AA  G  +  + LL  N   ++R   G+T LH+A K    ++V++LL +G +++  T   +TPLH+A+F G + ++  L    A  +  T  G  P+  A
Sbjct:  344 AAHCGHVRVAKLLLDRNADANARALNGFTPLHIACKKNRLKVVELLLRHGASISATTESGLTPLHVAAFMGCMNIVIYLLQHDASPDVPTVRGETPLHLA 443          
BLAST of SMED30015853 vs. Ensembl Fly
Match: Ank2 (gene:FBgn0261788 transcript:FBtr0334061)

HSP 1 Score: 61.6178 bits (148), Expect = 1.337e-10
Identity = 36/100 (36.00%), Postives = 58/100 (58.00%), Query Frame = 3
Query:  162 AASAGDFKSVRKLLSENVKIDSRDPEGYTSLHLAAKHGHYEIVKIXXXXXXXXXXXTADLVTPLHLASFHGHVGVMKLLALSKADLNATTKSGCKPIDFA 461
            A+  G+   V  LL    ++D+   + YT+LH+AAK G  E+  +L+ NG  ++  T    TPLHL + +GH+ V +LL   +AD++A  K+G  P+  A
Sbjct:  626 ASRLGNVDIVMLLLQHGAQVDATTKDMYTALHIAAKEGQDEVAAVLIENGAALDAATKKGFTPLHLTAKYGHIKVAQLLLQKEADVDAQGKNGVTPLHVA 725          

HSP 2 Score: 56.6102 bits (135), Expect = 7.299e-9
Identity = 37/101 (36.63%), Postives = 56/101 (55.45%), Query Frame = 3
Query:  159 KAASAGDFKSVRKLLSENVKIDSRDPEGYTSLHLAAKHGHYEIVKIXXXXXXXXXXXTADLVTPLHLASFHGHVGVMKLLALSKADLNATTKSGCKPIDFA 461
            +AA AG+ + V + L  N+ I++ +  G  +LHLA+K GH  +V  LL  G  V+  T    T LH+AS  G   V+KLL    A +N  +++G  P+  A
Sbjct:  167 RAARAGNLERVLEHLKNNIDINTSNANGLNALHLASKDGHIHVVSELLRRGAIVDSATKKGNTALHIASLAGQEEVVKLLLEHNASVNVQSQNGFTPLYMA 267          

HSP 3 Score: 54.299 bits (129), Expect = 3.592e-8
Identity = 38/100 (38.00%), Postives = 53/100 (53.00%), Query Frame = 3
Query:  162 AASAGDFKSVRKLLSENVKIDSRDPEGYTSLHLAAKHGHYEIVKIXXXXXXXXXXXTADLVTPLHLASFHGHVGVMKLLALSKADLNATTKSGCKPIDFA 461
            AA +G  + V  LL     I ++   G   LH+AA+  H +  +ILL +   V+ VT D +T LH+A+  GHV V KLL    AD NA   +G  P+  A
Sbjct:  428 AARSGHEQVVDMLLERGAPISAKTKNGLAPLHMAAQGEHVDAARILLYHRAPVDEVTVDYLTALHVAAHCGHVRVAKLLLDRNADANARALNGFTPLHIA 527          

HSP 4 Score: 53.1434 bits (126), Expect = 1.024e-7
Identity = 38/103 (36.89%), Postives = 57/103 (55.34%), Query Frame = 3
Query:  144 EYELCKAASAGDFKSVRKLLSENVKIDSRDPEGYTSLHLAAKHGHYEIVKIXXXXXXXXXXXTADLVTPLHLASFHGHVGVMKLLALSKADLNATTKSGCKPI 452
            E  L  AA A     +R LL    ++D+R  E  T LH+A++ G+ +IV +LL +G  V+  T D+ T LH+A+  G   V  +L  + A L+A TK G  P+
Sbjct:  587 ETPLHLAARANQTDIIRILLRNGAQVDARAREQQTPLHIASRLGNVDIVMLLLQHGAQVDATTKDMYTALHIAAKEGQDEVAAVLIENGAALDAATKKGFTPL 689          

HSP 5 Score: 50.447 bits (119), Expect = 6.813e-7
Identity = 37/123 (30.08%), Postives = 61/123 (49.59%), Query Frame = 3
Query:  162 AASAGDFKSVRKLLSENVKIDSRDPEGYTSLHLAAKHGHYEIVKIXXXXXXXXXXXTADLVTPLHLASFHGHVGVMKLLALSKADLNATTKSGCKPIDFAPYDSERWRILRDASLNILPYSEL 530
            AA  G  +    L+     +D+   +G+T LHL AK+GH ++ ++LL    +V+    + VTPLH+A  + +  V  LL    A  +AT K+G  P+  A   ++      D +  +L Y  L
Sbjct:  659 AAKEGQDEVAAVLIENGAALDAATKKGFTPLHLTAKYGHIKVAQLLLQKEADVDAQGKNGVTPLHVACHYNNQQVALLLLEKGASPHATAKNGHTPLHIAARKNQ-----MDIATTLLEYGAL 776          

HSP 6 Score: 48.521 bits (114), Expect = 2.653e-6
Identity = 34/100 (34.00%), Postives = 57/100 (57.00%), Query Frame = 3
Query:  162 AASAGDFKSVRKLLSENVKIDSRDPEGYTSLHLAAKHGHYEIVKIXXXXXXXXXXXTADLVTPLHLASFHGHVGVMKLLALSKADLNATTKSGCKPIDFA 461
            A+  G    V +LL     +DS   +G T+LH+A+  G  E+VK+LL +  +VNV + +  TPL++A+   H  V++LL  + A+ +  T+ G  P+  A
Sbjct:  201 ASKDGHIHVVSELLRRGAIVDSATKKGNTALHIASLAGQEEVVKLLLEHNASVNVQSQNGFTPLYMAAQENHDAVVRLLLSNGANQSLATEDGFTPLAVA 300          

HSP 7 Score: 48.521 bits (114), Expect = 3.270e-6
Identity = 33/102 (32.35%), Postives = 51/102 (50.00%), Query Frame = 3
Query:  162 AASAGDFKSVRKLLSENVKIDSRDPEGYTSLHLAAKHGHYEIVKIXXXXXXXXXXXTADLVTPLHLASFHGHVGVMKLLALSKADLNATTKSGCKPIDFAPY 467
            AA      + R LL     +D    +  T+LH+AA  GH  + K+LL    + N    +  TPLH+A     + V++LL    A ++ATT+SG  P+  A +
Sbjct:  461 AAQGEHVDAARILLYHRAPVDEVTVDYLTALHVAAHCGHVRVAKLLLDRNADANARALNGFTPLHIACKKNRLKVVELLLRHGASISATTESGLTPLHVAAF 562          

HSP 8 Score: 47.7506 bits (112), Expect = 4.836e-6
Identity = 37/96 (38.54%), Postives = 53/96 (55.21%), Query Frame = 3
Query:  177 DFKSVRKLLSEN-VKIDSRDPEGYTSLHLAAKHGHYEIVKIXXXXXXXXXXXTADLVTPLHLASFHGHVGVMKLLALSKADLNATTKSGCKPIDFA 461
            D  +V ++L +N   ID     GYT LH+A+  G   +V+ LL NG NV+  T+   TPLH  +  GH  ++ LL   KA+ NA T +G  P+  A
Sbjct:  828 DNVNVAEILEKNGANIDMATKAGYTPLHVASHFGQANMVRFLLQNGANVDAATSIGYTPLHQTAQQGHCHIVNLLLEHKANANAQTVNGQTPLHIA 923          

HSP 9 Score: 47.3654 bits (111), Expect = 6.894e-6
Identity = 31/100 (31.00%), Postives = 53/100 (53.00%), Query Frame = 3
Query:  162 AASAGDFKSVRKLLSENVKIDSRDPEGYTSLHLAAKHGHYEIVKIXXXXXXXXXXXTADLVTPLHLASFHGHVGVMKLLALSKADLNATTKSGCKPIDFA 461
            AA  G  +  + LL  N   ++R   G+T LH+A K    ++V++LL +G +++  T   +TPLH+A+F G + ++  L    A  +  T  G  P+  A
Sbjct:  494 AAHCGHVRVAKLLLDRNADANARALNGFTPLHIACKKNRLKVVELLLRHGASISATTESGLTPLHVAAFMGCMNIVIYLLQHDASPDVPTVRGETPLHLA 593          
BLAST of SMED30015853 vs. Ensembl Fly
Match: Ank2 (gene:FBgn0261788 transcript:FBtr0303113)

HSP 1 Score: 61.6178 bits (148), Expect = 1.633e-10
Identity = 36/100 (36.00%), Postives = 58/100 (58.00%), Query Frame = 3
Query:  162 AASAGDFKSVRKLLSENVKIDSRDPEGYTSLHLAAKHGHYEIVKIXXXXXXXXXXXTADLVTPLHLASFHGHVGVMKLLALSKADLNATTKSGCKPIDFA 461
            A+  G+   V  LL    ++D+   + YT+LH+AAK G  E+  +L+ NG  ++  T    TPLHL + +GH+ V +LL   +AD++A  K+G  P+  A
Sbjct:  476 ASRLGNVDIVMLLLQHGAQVDATTKDMYTALHIAAKEGQDEVAAVLIENGAALDAATKKGFTPLHLTAKYGHIKVAQLLLQKEADVDAQGKNGVTPLHVA 575          

HSP 2 Score: 56.225 bits (134), Expect = 1.001e-8
Identity = 37/103 (35.92%), Postives = 56/103 (54.37%), Query Frame = 3
Query:  153 LCKAASAGDFKSVRKLLSENVKIDSRDPEGYTSLHLAAKHGHYEIVKIXXXXXXXXXXXTADLVTPLHLASFHGHVGVMKLLALSKADLNATTKSGCKPIDFA 461
              +AA AG+ + V + L  N+ I++ +  G  +LHLA+K GH  +V  LL  G  V+  T    T LH+AS  G   V+KLL    A +N  +++G  P+  A
Sbjct:   15 FLRAARAGNLERVLEHLKNNIDINTSNANGLNALHLASKDGHIHVVSELLRRGAIVDSATKKGNTALHIASLAGQEEVVKLLLEHNASVNVQSQNGFTPLYMA 117          

HSP 3 Score: 53.1434 bits (126), Expect = 9.956e-8
Identity = 36/97 (37.11%), Postives = 55/97 (56.70%), Query Frame = 3
Query:  162 AASAGDFKSVRKLLSENVKIDSRDPEGYTSLHLAAKHGHYEIVKIXXXXXXXXXXXTADLVTPLHLASFHGHVGVMKLLALSKADLNATTKSGCKPI 452
            AA A     +R LL    ++D+R  E  T LH+A++ G+ +IV +LL +G  V+  T D+ T LH+A+  G   V  +L  + A L+A TK G  P+
Sbjct:  443 AARANQTDIIRILLRNGAQVDARAREQQTPLHIASRLGNVDIVMLLLQHGAQVDATTKDMYTALHIAAKEGQDEVAAVLIENGAALDAATKKGFTPL 539          

HSP 4 Score: 52.373 bits (124), Expect = 1.633e-7
Identity = 38/100 (38.00%), Postives = 53/100 (53.00%), Query Frame = 3
Query:  162 AASAGDFKSVRKLLSENVKIDSRDPEGYTSLHLAAKHGHYEIVKIXXXXXXXXXXXTADLVTPLHLASFHGHVGVMKLLALSKADLNATTKSGCKPIDFA 461
            AA +G  + V  LL     I ++   G   LH+AA+  H +  +ILL +   V+ VT D +T LH+A+  GHV V KLL    AD NA   +G  P+  A
Sbjct:  278 AARSGHEQVVDMLLERGAPISAKTKNGLAPLHMAAQGEHVDAARILLYHRAPVDEVTVDYLTALHVAAHCGHVRVAKLLLDRNADANARALNGFTPLHIA 377          

HSP 5 Score: 49.6766 bits (117), Expect = 1.410e-6
Identity = 33/100 (33.00%), Postives = 53/100 (53.00%), Query Frame = 3
Query:  162 AASAGDFKSVRKLLSENVKIDSRDPEGYTSLHLAAKHGHYEIVKIXXXXXXXXXXXTADLVTPLHLASFHGHVGVMKLLALSKADLNATTKSGCKPIDFA 461
            AA  G  +    L+     +D+   +G+T LHL AK+GH ++ ++LL    +V+    + VTPLH+A  + +  V  LL    A  +AT K+G  P+  A
Sbjct:  509 AAKEGQDEVAAVLIENGAALDAATKKGFTPLHLTAKYGHIKVAQLLLQKEADVDAQGKNGVTPLHVACHYNNQQVALLLLEKGASPHATAKNGHTPLHIA 608          

HSP 6 Score: 48.9062 bits (115), Expect = 2.326e-6
Identity = 37/96 (38.54%), Postives = 53/96 (55.21%), Query Frame = 3
Query:  177 DFKSVRKLLSEN-VKIDSRDPEGYTSLHLAAKHGHYEIVKIXXXXXXXXXXXTADLVTPLHLASFHGHVGVMKLLALSKADLNATTKSGCKPIDFA 461
            D  +V ++L +N   ID     GYT LH+A+  G   +V+ LL NG NV+  T+   TPLH  +  GH  ++ LL   KA+ NA T +G  P+  A
Sbjct:  678 DNVNVAEILEKNGANIDMATKAGYTPLHVASHFGQANMVRFLLQNGANVDAATSIGYTPLHQTAQQGHCHIVNLLLEHKANANAQTVNGQTPLHIA 773          

HSP 7 Score: 48.1358 bits (113), Expect = 3.836e-6
Identity = 34/100 (34.00%), Postives = 57/100 (57.00%), Query Frame = 3
Query:  162 AASAGDFKSVRKLLSENVKIDSRDPEGYTSLHLAAKHGHYEIVKIXXXXXXXXXXXTADLVTPLHLASFHGHVGVMKLLALSKADLNATTKSGCKPIDFA 461
            A+  G    V +LL     +DS   +G T+LH+A+  G  E+VK+LL +  +VNV + +  TPL++A+   H  V++LL  + A+ +  T+ G  P+  A
Sbjct:   51 ASKDGHIHVVSELLRRGAIVDSATKKGNTALHIASLAGQEEVVKLLLEHNASVNVQSQNGFTPLYMAAQENHDAVVRLLLSNGANQSLATEDGFTPLAVA 150          

HSP 8 Score: 47.3654 bits (111), Expect = 7.788e-6
Identity = 36/111 (32.43%), Postives = 54/111 (48.65%), Query Frame = 3
Query:  162 AASAGDFKSVRKLLSENVKIDSRDPEGYTSLHLAAKHGHYEIVKIXXXXXXXXXXXTADLVTPLHLASFHGHVGVM-KLLALSKADLNATTKSGCKPIDFAPYDSERWRIL 491
            A+  G    VR LL     +D+    GYT LH  A+ GH  IV +LL +  N N  T +  TPLH+A   G++ V+  L  ++K D  A   S  +         E++R++
Sbjct:  707 ASHFGQANMVRFLLQNGANVDAATSIGYTPLHQTAQQGHCHIVNLLLEHKANANAQTVNGQTPLHIARKLGYISVLDSLKTITKEDETAAAPSQAE---------EKYRVV 808          
BLAST of SMED30015853 vs. Ensembl Fly
Match: Ank2 (gene:FBgn0261788 transcript:FBtr0303117)

HSP 1 Score: 61.2326 bits (147), Expect = 1.722e-10
Identity = 36/100 (36.00%), Postives = 58/100 (58.00%), Query Frame = 3
Query:  162 AASAGDFKSVRKLLSENVKIDSRDPEGYTSLHLAAKHGHYEIVKIXXXXXXXXXXXTADLVTPLHLASFHGHVGVMKLLALSKADLNATTKSGCKPIDFA 461
            A+  G+   V  LL    ++D+   + YT+LH+AAK G  E+  +L+ NG  ++  T    TPLHL + +GH+ V +LL   +AD++A  K+G  P+  A
Sbjct:  476 ASRLGNVDIVMLLLQHGAQVDATTKDMYTALHIAAKEGQDEVAAVLIENGAALDAATKKGFTPLHLTAKYGHIKVAQLLLQKEADVDAQGKNGVTPLHVA 575          

HSP 2 Score: 56.225 bits (134), Expect = 1.065e-8
Identity = 37/103 (35.92%), Postives = 56/103 (54.37%), Query Frame = 3
Query:  153 LCKAASAGDFKSVRKLLSENVKIDSRDPEGYTSLHLAAKHGHYEIVKIXXXXXXXXXXXTADLVTPLHLASFHGHVGVMKLLALSKADLNATTKSGCKPIDFA 461
              +AA AG+ + V + L  N+ I++ +  G  +LHLA+K GH  +V  LL  G  V+  T    T LH+AS  G   V+KLL    A +N  +++G  P+  A
Sbjct:   15 FLRAARAGNLERVLEHLKNNIDINTSNANGLNALHLASKDGHIHVVSELLRRGAIVDSATKKGNTALHIASLAGQEEVVKLLLEHNASVNVQSQNGFTPLYMA 117          

HSP 3 Score: 53.1434 bits (126), Expect = 1.050e-7
Identity = 36/97 (37.11%), Postives = 55/97 (56.70%), Query Frame = 3
Query:  162 AASAGDFKSVRKLLSENVKIDSRDPEGYTSLHLAAKHGHYEIVKIXXXXXXXXXXXTADLVTPLHLASFHGHVGVMKLLALSKADLNATTKSGCKPI 452
            AA A     +R LL    ++D+R  E  T LH+A++ G+ +IV +LL +G  V+  T D+ T LH+A+  G   V  +L  + A L+A TK G  P+
Sbjct:  443 AARANQTDIIRILLRNGAQVDARAREQQTPLHIASRLGNVDIVMLLLQHGAQVDATTKDMYTALHIAAKEGQDEVAAVLIENGAALDAATKKGFTPL 539          

HSP 4 Score: 52.373 bits (124), Expect = 1.630e-7
Identity = 38/100 (38.00%), Postives = 53/100 (53.00%), Query Frame = 3
Query:  162 AASAGDFKSVRKLLSENVKIDSRDPEGYTSLHLAAKHGHYEIVKIXXXXXXXXXXXTADLVTPLHLASFHGHVGVMKLLALSKADLNATTKSGCKPIDFA 461
            AA +G  + V  LL     I ++   G   LH+AA+  H +  +ILL +   V+ VT D +T LH+A+  GHV V KLL    AD NA   +G  P+  A
Sbjct:  278 AARSGHEQVVDMLLERGAPISAKTKNGLAPLHMAAQGEHVDAARILLYHRAPVDEVTVDYLTALHVAAHCGHVRVAKLLLDRNADANARALNGFTPLHIA 377          

HSP 5 Score: 49.6766 bits (117), Expect = 1.486e-6
Identity = 33/100 (33.00%), Postives = 53/100 (53.00%), Query Frame = 3
Query:  162 AASAGDFKSVRKLLSENVKIDSRDPEGYTSLHLAAKHGHYEIVKIXXXXXXXXXXXTADLVTPLHLASFHGHVGVMKLLALSKADLNATTKSGCKPIDFA 461
            AA  G  +    L+     +D+   +G+T LHL AK+GH ++ ++LL    +V+    + VTPLH+A  + +  V  LL    A  +AT K+G  P+  A
Sbjct:  509 AAKEGQDEVAAVLIENGAALDAATKKGFTPLHLTAKYGHIKVAQLLLQKEADVDAQGKNGVTPLHVACHYNNQQVALLLLEKGASPHATAKNGHTPLHIA 608          

HSP 6 Score: 48.9062 bits (115), Expect = 2.386e-6
Identity = 37/96 (38.54%), Postives = 53/96 (55.21%), Query Frame = 3
Query:  177 DFKSVRKLLSEN-VKIDSRDPEGYTSLHLAAKHGHYEIVKIXXXXXXXXXXXTADLVTPLHLASFHGHVGVMKLLALSKADLNATTKSGCKPIDFA 461
            D  +V ++L +N   ID     GYT LH+A+  G   +V+ LL NG NV+  T+   TPLH  +  GH  ++ LL   KA+ NA T +G  P+  A
Sbjct:  678 DNVNVAEILEKNGANIDMATKAGYTPLHVASHFGQANMVRFLLQNGANVDAATSIGYTPLHQTAQQGHCHIVNLLLEHKANANAQTVNGQTPLHIA 773          

HSP 7 Score: 48.1358 bits (113), Expect = 4.006e-6
Identity = 34/100 (34.00%), Postives = 57/100 (57.00%), Query Frame = 3
Query:  162 AASAGDFKSVRKLLSENVKIDSRDPEGYTSLHLAAKHGHYEIVKIXXXXXXXXXXXTADLVTPLHLASFHGHVGVMKLLALSKADLNATTKSGCKPIDFA 461
            A+  G    V +LL     +DS   +G T+LH+A+  G  E+VK+LL +  +VNV + +  TPL++A+   H  V++LL  + A+ +  T+ G  P+  A
Sbjct:   51 ASKDGHIHVVSELLRRGAIVDSATKKGNTALHIASLAGQEEVVKLLLEHNASVNVQSQNGFTPLYMAAQENHDAVVRLLLSNGANQSLATEDGFTPLAVA 150          

HSP 8 Score: 47.3654 bits (111), Expect = 8.208e-6
Identity = 36/111 (32.43%), Postives = 54/111 (48.65%), Query Frame = 3
Query:  162 AASAGDFKSVRKLLSENVKIDSRDPEGYTSLHLAAKHGHYEIVKIXXXXXXXXXXXTADLVTPLHLASFHGHVGVM-KLLALSKADLNATTKSGCKPIDFAPYDSERWRIL 491
            A+  G    VR LL     +D+    GYT LH  A+ GH  IV +LL +  N N  T +  TPLH+A   G++ V+  L  ++K D  A   S  +         E++R++
Sbjct:  707 ASHFGQANMVRFLLQNGANVDAATSIGYTPLHQTAQQGHCHIVNLLLEHKANANAQTVNGQTPLHIARKLGYISVLDSLKTITKEDETAAAPSQAE---------EKYRVV 808          
BLAST of SMED30015853 vs. Ensembl Fly
Match: Ank2 (gene:FBgn0261788 transcript:FBtr0303111)

HSP 1 Score: 61.2326 bits (147), Expect = 1.725e-10
Identity = 36/100 (36.00%), Postives = 58/100 (58.00%), Query Frame = 3
Query:  162 AASAGDFKSVRKLLSENVKIDSRDPEGYTSLHLAAKHGHYEIVKIXXXXXXXXXXXTADLVTPLHLASFHGHVGVMKLLALSKADLNATTKSGCKPIDFA 461
            A+  G+   V  LL    ++D+   + YT+LH+AAK G  E+  +L+ NG  ++  T    TPLHL + +GH+ V +LL   +AD++A  K+G  P+  A
Sbjct:  483 ASRLGNVDIVMLLLQHGAQVDATTKDMYTALHIAAKEGQDEVAAVLIENGAALDAATKKGFTPLHLTAKYGHIKVAQLLLQKEADVDAQGKNGVTPLHVA 582          

HSP 2 Score: 56.225 bits (134), Expect = 1.047e-8
Identity = 37/103 (35.92%), Postives = 56/103 (54.37%), Query Frame = 3
Query:  153 LCKAASAGDFKSVRKLLSENVKIDSRDPEGYTSLHLAAKHGHYEIVKIXXXXXXXXXXXTADLVTPLHLASFHGHVGVMKLLALSKADLNATTKSGCKPIDFA 461
              +AA AG+ + V + L  N+ I++ +  G  +LHLA+K GH  +V  LL  G  V+  T    T LH+AS  G   V+KLL    A +N  +++G  P+  A
Sbjct:   22 FLRAARAGNLERVLEHLKNNIDINTSNANGLNALHLASKDGHIHVVSELLRRGAIVDSATKKGNTALHIASLAGQEEVVKLLLEHNASVNVQSQNGFTPLYMA 124          

HSP 3 Score: 53.1434 bits (126), Expect = 1.013e-7
Identity = 36/97 (37.11%), Postives = 55/97 (56.70%), Query Frame = 3
Query:  162 AASAGDFKSVRKLLSENVKIDSRDPEGYTSLHLAAKHGHYEIVKIXXXXXXXXXXXTADLVTPLHLASFHGHVGVMKLLALSKADLNATTKSGCKPI 452
            AA A     +R LL    ++D+R  E  T LH+A++ G+ +IV +LL +G  V+  T D+ T LH+A+  G   V  +L  + A L+A TK G  P+
Sbjct:  450 AARANQTDIIRILLRNGAQVDARAREQQTPLHIASRLGNVDIVMLLLQHGAQVDATTKDMYTALHIAAKEGQDEVAAVLIENGAALDAATKKGFTPL 546          

HSP 4 Score: 52.373 bits (124), Expect = 1.693e-7
Identity = 38/100 (38.00%), Postives = 53/100 (53.00%), Query Frame = 3
Query:  162 AASAGDFKSVRKLLSENVKIDSRDPEGYTSLHLAAKHGHYEIVKIXXXXXXXXXXXTADLVTPLHLASFHGHVGVMKLLALSKADLNATTKSGCKPIDFA 461
            AA +G  + V  LL     I ++   G   LH+AA+  H +  +ILL +   V+ VT D +T LH+A+  GHV V KLL    AD NA   +G  P+  A
Sbjct:  285 AARSGHEQVVDMLLERGAPISAKTKNGLAPLHMAAQGEHVDAARILLYHRAPVDEVTVDYLTALHVAAHCGHVRVAKLLLDRNADANARALNGFTPLHIA 384          

HSP 5 Score: 49.6766 bits (117), Expect = 1.515e-6
Identity = 33/100 (33.00%), Postives = 53/100 (53.00%), Query Frame = 3
Query:  162 AASAGDFKSVRKLLSENVKIDSRDPEGYTSLHLAAKHGHYEIVKIXXXXXXXXXXXTADLVTPLHLASFHGHVGVMKLLALSKADLNATTKSGCKPIDFA 461
            AA  G  +    L+     +D+   +G+T LHL AK+GH ++ ++LL    +V+    + VTPLH+A  + +  V  LL    A  +AT K+G  P+  A
Sbjct:  516 AAKEGQDEVAAVLIENGAALDAATKKGFTPLHLTAKYGHIKVAQLLLQKEADVDAQGKNGVTPLHVACHYNNQQVALLLLEKGASPHATAKNGHTPLHIA 615          

HSP 6 Score: 48.9062 bits (115), Expect = 2.367e-6
Identity = 37/96 (38.54%), Postives = 53/96 (55.21%), Query Frame = 3
Query:  177 DFKSVRKLLSEN-VKIDSRDPEGYTSLHLAAKHGHYEIVKIXXXXXXXXXXXTADLVTPLHLASFHGHVGVMKLLALSKADLNATTKSGCKPIDFA 461
            D  +V ++L +N   ID     GYT LH+A+  G   +V+ LL NG NV+  T+   TPLH  +  GH  ++ LL   KA+ NA T +G  P+  A
Sbjct:  685 DNVNVAEILEKNGANIDMATKAGYTPLHVASHFGQANMVRFLLQNGANVDAATSIGYTPLHQTAQQGHCHIVNLLLEHKANANAQTVNGQTPLHIA 780          

HSP 7 Score: 48.1358 bits (113), Expect = 3.975e-6
Identity = 34/100 (34.00%), Postives = 57/100 (57.00%), Query Frame = 3
Query:  162 AASAGDFKSVRKLLSENVKIDSRDPEGYTSLHLAAKHGHYEIVKIXXXXXXXXXXXTADLVTPLHLASFHGHVGVMKLLALSKADLNATTKSGCKPIDFA 461
            A+  G    V +LL     +DS   +G T+LH+A+  G  E+VK+LL +  +VNV + +  TPL++A+   H  V++LL  + A+ +  T+ G  P+  A
Sbjct:   58 ASKDGHIHVVSELLRRGAIVDSATKKGNTALHIASLAGQEEVVKLLLEHNASVNVQSQNGFTPLYMAAQENHDAVVRLLLSNGANQSLATEDGFTPLAVA 157          

HSP 8 Score: 47.3654 bits (111), Expect = 8.217e-6
Identity = 36/111 (32.43%), Postives = 54/111 (48.65%), Query Frame = 3
Query:  162 AASAGDFKSVRKLLSENVKIDSRDPEGYTSLHLAAKHGHYEIVKIXXXXXXXXXXXTADLVTPLHLASFHGHVGVM-KLLALSKADLNATTKSGCKPIDFAPYDSERWRIL 491
            A+  G    VR LL     +D+    GYT LH  A+ GH  IV +LL +  N N  T +  TPLH+A   G++ V+  L  ++K D  A   S  +         E++R++
Sbjct:  714 ASHFGQANMVRFLLQNGANVDAATSIGYTPLHQTAQQGHCHIVNLLLEHKANANAQTVNGQTPLHIARKLGYISVLDSLKTITKEDETAAAPSQAE---------EKYRVV 815          
BLAST of SMED30015853 vs. Ensembl Zebrafish
Match: BX469921.1 (ankyrin 3a [Source:NCBI gene;Acc:103909035])

HSP 1 Score: 63.5438 bits (153), Expect = 3.851e-11
Identity = 43/118 (36.44%), Postives = 66/118 (55.93%), Query Frame = 3
Query:  141 DEYELCKAASAGDFKSVRKLLSENVKIDSRDPEGYTSLHLAAKHGHYEIVKIXXXXXXXXXXXTADLVTPLHLASFHGHVGVMKLLALSKADLNATTKSGCKPIDFAP-YDSERWRIL 491
            D+  L  A+  G  + V++LL +    ++    GYT LHL+A+ GH EI  +LL  G +++  T    TPLH+A+ +G + V  LL   KA  +A  KSG  P+  A  YD++R  +L
Sbjct:  500 DQTALHIASRLGKLEIVQQLLQKGALPNAATTSGYTPLHLSAREGHQEIAALLLEQGSSLSAATKKGFTPLHVAAKYGQLEVANLLLQKKAAPDAAGKSGLTPLHVAAHYDNQRVALL 617          

HSP 2 Score: 59.6918 bits (143), Expect = 9.313e-10
Identity = 41/106 (38.68%), Postives = 55/106 (51.89%), Query Frame = 3
Query:  144 EYELCKAASAGDFKSVRKLLSENVKIDSRDPEGYTSLHLAAKHGHYEIVKIXXXXXXXXXXXTADLVTPLHLASFHGHVGVMKLLALSKADLNATTKSGCKPIDFA 461
            E  L  AA AG    VR LL    K+D +  +  T+LH+A++ G  EIV+ LL  G   N  T    TPLHL++  GH  +  LL    + L+A TK G  P+  A
Sbjct:  468 ETALHMAARAGQIDVVRYLLQNGAKVDIKAKDDQTALHIASRLGKLEIVQQLLQKGALPNAATTSGYTPLHLSAREGHQEIAALLLEQGSSLSAATKKGFTPLHVA 573          

HSP 3 Score: 58.151 bits (139), Expect = 2.328e-9
Identity = 38/102 (37.25%), Postives = 54/102 (52.94%), Query Frame = 3
Query:  165 ASAGD-FKSVRKLLSENVKIDSRDPEGYTSLHLAAKHGHYEIVKIXXXXXXXXXXXTADLVTPLHLASFHGHVGVMKLLALSKADLNATTKSGCKPIDFAPY 467
            A+ GD    V+ LL  N  +D    +  T+LH+AA  GHY++ K+++    N N    +  TPLH+A     V VM+LL    A L A T+SG  PI  A +
Sbjct:  342 ATQGDHLNCVQLLLQHNAPVDDVTNDYLTALHVAAHCGHYKVAKVIVDKKANPNAKALNGFTPLHIACKKNRVKVMELLLKHGASLQAVTESGLTPIHVAAF 443          

HSP 4 Score: 56.225 bits (134), Expect = 1.309e-8
Identity = 41/118 (34.75%), Postives = 63/118 (53.39%), Query Frame = 3
Query:  108 KIIREIKSVNFDEYELCKAASAGDFKSVRKLLSENVKIDSRDPEGYTSLHLAAKHGHYEIVKIXXXXXXXXXXXTADLVTPLHLASFHGHVGVMKLLALSKADLNATTKSGCKPIDFA 461
            K+ R+ K  +       +AA AG+ + V   L   V I+  +  G  +LHLA+K GH E+V  LL  G NV+  T    T LH+AS  G   V++ L  + A++NA +++G  P+  A
Sbjct:   31 KLSRDQKKKSDSNASYLRAARAGNLEKVLDYLKTGVDINICNQNGLNALHLASKEGHVEVVAELLKLGANVDAATKKGNTALHIASLAGQTEVVRELVTNGANVNAQSQNGFTPLYMA 148          

HSP 5 Score: 50.447 bits (119), Expect = 9.947e-7
Identity = 34/97 (35.05%), Postives = 52/97 (53.61%), Query Frame = 3
Query:  162 AASAGDFKSVRKLLSENVKIDSRDPEGYTSLHLAAKHGHYEIVKIXXXXXXXXXXXTADLVTPLHLASFHGHVGVMKLLALSKADLNATTKSGCKPI 452
            AA   D KS   LL  +   D     G+T LH+AA +G+  +  +LL  G  V+ +  + +TPLH+AS  G+  ++KLL    + + A TK G  P+
Sbjct:  210 AARKDDTKSAALLLQNDHNADVESKSGFTPLHIAAHYGNINVATLLLNRGAAVDFMARNDITPLHVASKRGNGNMVKLLLDRGSKIEAKTKDGLTPL 306          

HSP 6 Score: 50.0618 bits (118), Expect = 1.261e-6
Identity = 35/93 (37.63%), Postives = 48/93 (51.61%), Query Frame = 3
Query:  198 LLSENVKIDSRDPEGYTSLHLAAKHGHYEIVKIXXXXXXXXXXXTADLVTPLHLASFHGHVGVMKLLALSKADLNATTKSGCKPIDFAPYDSE 476
            LL +     S    GYT LH+AAK    EI   LL  G   N VT   ++PLHLA+  G V ++ LL   +A++N   K+G  P+  A  D +
Sbjct:  618 LLDQGASPHSPAKNGYTPLHIAAKKNQLEIGTTLLEYGAECNTVTRQGISPLHLAAQEGSVDLVSLLLTKQANVNMGNKNGLTPLHLAAQDDK 710          

HSP 7 Score: 48.1358 bits (113), Expect = 5.129e-6
Identity = 34/100 (34.00%), Postives = 52/100 (52.00%), Query Frame = 3
Query:  162 AASAGDFKSVRKLLSENVKIDSRDPEGYTSLHLAAKHGHYEIVKIXXXXXXXXXXXTADLVTPLHLASFHGHVGVMKLLALSKADLNATTKSGCKPIDFA 461
             A +G  + V  LL     I S+   G + LH+A +  H   V++LL +   V+ VT D +T LH+A+  GH  V K++   KA+ NA   +G  P+  A
Sbjct:  309 GARSGHEQVVEMLLDRGAPILSKTKNGLSPLHMATQGDHLNCVQLLLQHNAPVDDVTNDYLTALHVAAHCGHYKVAKVIVDKKANPNAKALNGFTPLHIA 408          

HSP 8 Score: 47.3654 bits (111), Expect = 8.929e-6
Identity = 33/100 (33.00%), Postives = 51/100 (51.00%), Query Frame = 3
Query:  162 AASAGDFKSVRKLLSENVKIDSRDPEGYTSLHLAAKHGHYEIVKIXXXXXXXXXXXTADLVTPLHLASFHGHVGVMKLLALSKADLNATTKSGCKPIDFA 461
            AA  G+      LL+    +D       T LH+A+K G+  +VK+LL  G  +   T D +TPLH  +  GH  V+++L    A + + TK+G  P+  A
Sbjct:  243 AAHYGNINVATLLLNRGAAVDFMARNDITPLHVASKRGNGNMVKLLLDRGSKIEAKTKDGLTPLHCGARSGHEQVVEMLLDRGAPILSKTKNGLSPLHMA 342          
BLAST of SMED30015853 vs. Ensembl Zebrafish
Match: ank3a (ankyrin 3a [Source:ZFIN;Acc:ZDB-GENE-060621-1])

HSP 1 Score: 63.5438 bits (153), Expect = 3.922e-11
Identity = 43/118 (36.44%), Postives = 66/118 (55.93%), Query Frame = 3
Query:  141 DEYELCKAASAGDFKSVRKLLSENVKIDSRDPEGYTSLHLAAKHGHYEIVKIXXXXXXXXXXXTADLVTPLHLASFHGHVGVMKLLALSKADLNATTKSGCKPIDFAP-YDSERWRIL 491
            D+  L  A+  G  + V++LL +    ++    GYT LHL+A+ GH EI  +LL  G +++  T    TPLH+A+ +G + V  LL   KA  +A  KSG  P+  A  YD++R  +L
Sbjct:  500 DQTALHIASRLGKLEIVQQLLQKGALPNAATTSGYTPLHLSAREGHQEIAALLLEQGSSLSAATKKGFTPLHVAAKYGQLEVANLLLQKKAAPDAAGKSGLTPLHVAAHYDNQRVALL 617          

HSP 2 Score: 59.3066 bits (142), Expect = 9.484e-10
Identity = 41/106 (38.68%), Postives = 55/106 (51.89%), Query Frame = 3
Query:  144 EYELCKAASAGDFKSVRKLLSENVKIDSRDPEGYTSLHLAAKHGHYEIVKIXXXXXXXXXXXTADLVTPLHLASFHGHVGVMKLLALSKADLNATTKSGCKPIDFA 461
            E  L  AA AG    VR LL    K+D +  +  T+LH+A++ G  EIV+ LL  G   N  T    TPLHL++  GH  +  LL    + L+A TK G  P+  A
Sbjct:  468 ETALHMAARAGQIDVVRYLLQNGAKVDIKAKDDQTALHIASRLGKLEIVQQLLQKGALPNAATTSGYTPLHLSAREGHQEIAALLLEQGSSLSAATKKGFTPLHVA 573          

HSP 3 Score: 58.151 bits (139), Expect = 2.393e-9
Identity = 38/102 (37.25%), Postives = 54/102 (52.94%), Query Frame = 3
Query:  165 ASAGD-FKSVRKLLSENVKIDSRDPEGYTSLHLAAKHGHYEIVKIXXXXXXXXXXXTADLVTPLHLASFHGHVGVMKLLALSKADLNATTKSGCKPIDFAPY 467
            A+ GD    V+ LL  N  +D    +  T+LH+AA  GHY++ K+++    N N    +  TPLH+A     V VM+LL    A L A T+SG  PI  A +
Sbjct:  342 ATQGDHLNCVQLLLQHNAPVDDVTNDYLTALHVAAHCGHYKVAKVIVDKKANPNAKALNGFTPLHIACKKNRVKVMELLLKHGASLQAVTESGLTPIHVAAF 443          

HSP 4 Score: 55.0694 bits (131), Expect = 2.684e-8
Identity = 38/101 (37.62%), Postives = 57/101 (56.44%), Query Frame = 3
Query:  159 KAASAGDFKSVRKLLSENVKIDSRDPEGYTSLHLAAKHGHYEIVKIXXXXXXXXXXXTADLVTPLHLASFHGHVGVMKLLALSKADLNATTKSGCKPIDFA 461
            +AA AG+ + V   L   V I+  +  G  +LHLA+K GH E+V  LL  G NV+  T    T LH+AS  G   V++ L  + A++NA +++G  P+  A
Sbjct:   48 RAARAGNLEKVLDYLKTGVDINICNQNGLNALHLASKEGHVEVVAELLKLGANVDAATKKGNTALHIASLAGQTEVVRELVTNGANVNAQSQNGFTPLYMA 148          

HSP 5 Score: 50.447 bits (119), Expect = 9.853e-7
Identity = 34/97 (35.05%), Postives = 52/97 (53.61%), Query Frame = 3
Query:  162 AASAGDFKSVRKLLSENVKIDSRDPEGYTSLHLAAKHGHYEIVKIXXXXXXXXXXXTADLVTPLHLASFHGHVGVMKLLALSKADLNATTKSGCKPI 452
            AA   D KS   LL  +   D     G+T LH+AA +G+  +  +LL  G  V+ +  + +TPLH+AS  G+  ++KLL    + + A TK G  P+
Sbjct:  210 AARKDDTKSAALLLQNDHNADVESKSGFTPLHIAAHYGNINVATLLLNRGAAVDFMARNDITPLHVASKRGNGNMVKLLLDRGSKIEAKTKDGLTPL 306          

HSP 6 Score: 50.0618 bits (118), Expect = 1.272e-6
Identity = 35/93 (37.63%), Postives = 48/93 (51.61%), Query Frame = 3
Query:  198 LLSENVKIDSRDPEGYTSLHLAAKHGHYEIVKIXXXXXXXXXXXTADLVTPLHLASFHGHVGVMKLLALSKADLNATTKSGCKPIDFAPYDSE 476
            LL +     S    GYT LH+AAK    EI   LL  G   N VT   ++PLHLA+  G V ++ LL   +A++N   K+G  P+  A  D +
Sbjct:  618 LLDQGASPHSPAKNGYTPLHIAAKKNQLEIGTTLLEYGAECNTVTRQGISPLHLAAQEGSVDLVSLLLTKQANVNMGNKNGLTPLHLAAQDDK 710          

HSP 7 Score: 48.1358 bits (113), Expect = 5.270e-6
Identity = 34/100 (34.00%), Postives = 52/100 (52.00%), Query Frame = 3
Query:  162 AASAGDFKSVRKLLSENVKIDSRDPEGYTSLHLAAKHGHYEIVKIXXXXXXXXXXXTADLVTPLHLASFHGHVGVMKLLALSKADLNATTKSGCKPIDFA 461
             A +G  + V  LL     I S+   G + LH+A +  H   V++LL +   V+ VT D +T LH+A+  GH  V K++   KA+ NA   +G  P+  A
Sbjct:  309 GARSGHEQVVEMLLDRGAPILSKTKNGLSPLHMATQGDHLNCVQLLLQHNAPVDDVTNDYLTALHVAAHCGHYKVAKVIVDKKANPNAKALNGFTPLHIA 408          

HSP 8 Score: 47.3654 bits (111), Expect = 9.090e-6
Identity = 33/100 (33.00%), Postives = 51/100 (51.00%), Query Frame = 3
Query:  162 AASAGDFKSVRKLLSENVKIDSRDPEGYTSLHLAAKHGHYEIVKIXXXXXXXXXXXTADLVTPLHLASFHGHVGVMKLLALSKADLNATTKSGCKPIDFA 461
            AA  G+      LL+    +D       T LH+A+K G+  +VK+LL  G  +   T D +TPLH  +  GH  V+++L    A + + TK+G  P+  A
Sbjct:  243 AAHYGNINVATLLLNRGAAVDFMARNDITPLHVASKRGNGNMVKLLLDRGSKIEAKTKDGLTPLHCGARSGHEQVVEMLLDRGAPILSKTKNGLSPLHMA 342          
BLAST of SMED30015853 vs. Ensembl Zebrafish
Match: ank3a (ankyrin 3a [Source:ZFIN;Acc:ZDB-GENE-060621-1])

HSP 1 Score: 63.5438 bits (153), Expect = 3.922e-11
Identity = 43/118 (36.44%), Postives = 66/118 (55.93%), Query Frame = 3
Query:  141 DEYELCKAASAGDFKSVRKLLSENVKIDSRDPEGYTSLHLAAKHGHYEIVKIXXXXXXXXXXXTADLVTPLHLASFHGHVGVMKLLALSKADLNATTKSGCKPIDFAP-YDSERWRIL 491
            D+  L  A+  G  + V++LL +    ++    GYT LHL+A+ GH EI  +LL  G +++  T    TPLH+A+ +G + V  LL   KA  +A  KSG  P+  A  YD++R  +L
Sbjct:  500 DQTALHIASRLGKLEIVQQLLQKGALPNAATTSGYTPLHLSAREGHQEIAALLLEQGSSLSAATKKGFTPLHVAAKYGQLEVANLLLQKKAAPDAAGKSGLTPLHVAAHYDNQRVALL 617          

HSP 2 Score: 59.3066 bits (142), Expect = 9.484e-10
Identity = 41/106 (38.68%), Postives = 55/106 (51.89%), Query Frame = 3
Query:  144 EYELCKAASAGDFKSVRKLLSENVKIDSRDPEGYTSLHLAAKHGHYEIVKIXXXXXXXXXXXTADLVTPLHLASFHGHVGVMKLLALSKADLNATTKSGCKPIDFA 461
            E  L  AA AG    VR LL    K+D +  +  T+LH+A++ G  EIV+ LL  G   N  T    TPLHL++  GH  +  LL    + L+A TK G  P+  A
Sbjct:  468 ETALHMAARAGQIDVVRYLLQNGAKVDIKAKDDQTALHIASRLGKLEIVQQLLQKGALPNAATTSGYTPLHLSAREGHQEIAALLLEQGSSLSAATKKGFTPLHVA 573          

HSP 3 Score: 58.151 bits (139), Expect = 2.393e-9
Identity = 38/102 (37.25%), Postives = 54/102 (52.94%), Query Frame = 3
Query:  165 ASAGD-FKSVRKLLSENVKIDSRDPEGYTSLHLAAKHGHYEIVKIXXXXXXXXXXXTADLVTPLHLASFHGHVGVMKLLALSKADLNATTKSGCKPIDFAPY 467
            A+ GD    V+ LL  N  +D    +  T+LH+AA  GHY++ K+++    N N    +  TPLH+A     V VM+LL    A L A T+SG  PI  A +
Sbjct:  342 ATQGDHLNCVQLLLQHNAPVDDVTNDYLTALHVAAHCGHYKVAKVIVDKKANPNAKALNGFTPLHIACKKNRVKVMELLLKHGASLQAVTESGLTPIHVAAF 443          

HSP 4 Score: 55.0694 bits (131), Expect = 2.684e-8
Identity = 38/101 (37.62%), Postives = 57/101 (56.44%), Query Frame = 3
Query:  159 KAASAGDFKSVRKLLSENVKIDSRDPEGYTSLHLAAKHGHYEIVKIXXXXXXXXXXXTADLVTPLHLASFHGHVGVMKLLALSKADLNATTKSGCKPIDFA 461
            +AA AG+ + V   L   V I+  +  G  +LHLA+K GH E+V  LL  G NV+  T    T LH+AS  G   V++ L  + A++NA +++G  P+  A
Sbjct:   48 RAARAGNLEKVLDYLKTGVDINICNQNGLNALHLASKEGHVEVVAELLKLGANVDAATKKGNTALHIASLAGQTEVVRELVTNGANVNAQSQNGFTPLYMA 148          

HSP 5 Score: 50.447 bits (119), Expect = 9.853e-7
Identity = 34/97 (35.05%), Postives = 52/97 (53.61%), Query Frame = 3
Query:  162 AASAGDFKSVRKLLSENVKIDSRDPEGYTSLHLAAKHGHYEIVKIXXXXXXXXXXXTADLVTPLHLASFHGHVGVMKLLALSKADLNATTKSGCKPI 452
            AA   D KS   LL  +   D     G+T LH+AA +G+  +  +LL  G  V+ +  + +TPLH+AS  G+  ++KLL    + + A TK G  P+
Sbjct:  210 AARKDDTKSAALLLQNDHNADVESKSGFTPLHIAAHYGNINVATLLLNRGAAVDFMARNDITPLHVASKRGNGNMVKLLLDRGSKIEAKTKDGLTPL 306          

HSP 6 Score: 50.0618 bits (118), Expect = 1.272e-6
Identity = 35/93 (37.63%), Postives = 48/93 (51.61%), Query Frame = 3
Query:  198 LLSENVKIDSRDPEGYTSLHLAAKHGHYEIVKIXXXXXXXXXXXTADLVTPLHLASFHGHVGVMKLLALSKADLNATTKSGCKPIDFAPYDSE 476
            LL +     S    GYT LH+AAK    EI   LL  G   N VT   ++PLHLA+  G V ++ LL   +A++N   K+G  P+  A  D +
Sbjct:  618 LLDQGASPHSPAKNGYTPLHIAAKKNQLEIGTTLLEYGAECNTVTRQGISPLHLAAQEGSVDLVSLLLTKQANVNMGNKNGLTPLHLAAQDDK 710          

HSP 7 Score: 48.1358 bits (113), Expect = 5.270e-6
Identity = 34/100 (34.00%), Postives = 52/100 (52.00%), Query Frame = 3
Query:  162 AASAGDFKSVRKLLSENVKIDSRDPEGYTSLHLAAKHGHYEIVKIXXXXXXXXXXXTADLVTPLHLASFHGHVGVMKLLALSKADLNATTKSGCKPIDFA 461
             A +G  + V  LL     I S+   G + LH+A +  H   V++LL +   V+ VT D +T LH+A+  GH  V K++   KA+ NA   +G  P+  A
Sbjct:  309 GARSGHEQVVEMLLDRGAPILSKTKNGLSPLHMATQGDHLNCVQLLLQHNAPVDDVTNDYLTALHVAAHCGHYKVAKVIVDKKANPNAKALNGFTPLHIA 408          

HSP 8 Score: 47.3654 bits (111), Expect = 9.090e-6
Identity = 33/100 (33.00%), Postives = 51/100 (51.00%), Query Frame = 3
Query:  162 AASAGDFKSVRKLLSENVKIDSRDPEGYTSLHLAAKHGHYEIVKIXXXXXXXXXXXTADLVTPLHLASFHGHVGVMKLLALSKADLNATTKSGCKPIDFA 461
            AA  G+      LL+    +D       T LH+A+K G+  +VK+LL  G  +   T D +TPLH  +  GH  V+++L    A + + TK+G  P+  A
Sbjct:  243 AAHYGNINVATLLLNRGAAVDFMARNDITPLHVASKRGNGNMVKLLLDRGSKIEAKTKDGLTPLHCGARSGHEQVVEMLLDRGAPILSKTKNGLSPLHMA 342          
BLAST of SMED30015853 vs. Ensembl Zebrafish
Match: BX469921.1 (ankyrin 3a [Source:NCBI gene;Acc:103909035])

HSP 1 Score: 63.1586 bits (152), Expect = 6.712e-11
Identity = 43/118 (36.44%), Postives = 66/118 (55.93%), Query Frame = 3
Query:  141 DEYELCKAASAGDFKSVRKLLSENVKIDSRDPEGYTSLHLAAKHGHYEIVKIXXXXXXXXXXXTADLVTPLHLASFHGHVGVMKLLALSKADLNATTKSGCKPIDFAP-YDSERWRIL 491
            D+  L  A+  G  + V++LL +    ++    GYT LHL+A+ GH EI  +LL  G +++  T    TPLH+A+ +G + V  LL   KA  +A  KSG  P+  A  YD++R  +L
Sbjct:  486 DQTALHIASRLGKLEIVQQLLQKGALPNAATTSGYTPLHLSAREGHQEIAALLLEQGSSLSAATKKGFTPLHVAAKYGQLEVANLLLQKKAAPDAAGKSGLTPLHVAAHYDNQRVALL 603          

HSP 2 Score: 58.9214 bits (141), Expect = 1.558e-9
Identity = 41/106 (38.68%), Postives = 55/106 (51.89%), Query Frame = 3
Query:  144 EYELCKAASAGDFKSVRKLLSENVKIDSRDPEGYTSLHLAAKHGHYEIVKIXXXXXXXXXXXTADLVTPLHLASFHGHVGVMKLLALSKADLNATTKSGCKPIDFA 461
            E  L  AA AG    VR LL    K+D +  +  T+LH+A++ G  EIV+ LL  G   N  T    TPLHL++  GH  +  LL    + L+A TK G  P+  A
Sbjct:  454 ETALHMAARAGQIDVVRYLLQNGAKVDIKAKDDQTALHIASRLGKLEIVQQLLQKGALPNAATTSGYTPLHLSAREGHQEIAALLLEQGSSLSAATKKGFTPLHVA 559          

HSP 3 Score: 57.7658 bits (138), Expect = 3.818e-9
Identity = 38/102 (37.25%), Postives = 54/102 (52.94%), Query Frame = 3
Query:  165 ASAGD-FKSVRKLLSENVKIDSRDPEGYTSLHLAAKHGHYEIVKIXXXXXXXXXXXTADLVTPLHLASFHGHVGVMKLLALSKADLNATTKSGCKPIDFAPY 467
            A+ GD    V+ LL  N  +D    +  T+LH+AA  GHY++ K+++    N N    +  TPLH+A     V VM+LL    A L A T+SG  PI  A +
Sbjct:  328 ATQGDHLNCVQLLLQHNAPVDDVTNDYLTALHVAAHCGHYKVAKVIVDKKANPNAKALNGFTPLHIACKKNRVKVMELLLKHGASLQAVTESGLTPIHVAAF 429          

HSP 4 Score: 54.6842 bits (130), Expect = 4.114e-8
Identity = 38/101 (37.62%), Postives = 57/101 (56.44%), Query Frame = 3
Query:  159 KAASAGDFKSVRKLLSENVKIDSRDPEGYTSLHLAAKHGHYEIVKIXXXXXXXXXXXTADLVTPLHLASFHGHVGVMKLLALSKADLNATTKSGCKPIDFA 461
            +AA AG+ + V   L   V I+  +  G  +LHLA+K GH E+V  LL  G NV+  T    T LH+AS  G   V++ L  + A++NA +++G  P+  A
Sbjct:   26 RAARAGNLEKVLDYLKTGVDINICNQNGLNALHLASKEGHVEVVAELLKLGANVDAATKKGNTALHIASLAGQTEVVRELVTNGANVNAQSQNGFTPLYMA 126          

HSP 5 Score: 49.6766 bits (117), Expect = 1.869e-6
Identity = 35/93 (37.63%), Postives = 48/93 (51.61%), Query Frame = 3
Query:  198 LLSENVKIDSRDPEGYTSLHLAAKHGHYEIVKIXXXXXXXXXXXTADLVTPLHLASFHGHVGVMKLLALSKADLNATTKSGCKPIDFAPYDSE 476
            LL +     S    GYT LH+AAK    EI   LL  G   N VT   ++PLHLA+  G V ++ LL   +A++N   K+G  P+  A  D +
Sbjct:  604 LLDQGASPHSPAKNGYTPLHIAAKKNQLEIGTTLLEYGAECNTVTRQGISPLHLAAQEGSVDLVSLLLTKQANVNMGNKNGLTPLHLAAQDDK 696          

HSP 6 Score: 47.7506 bits (112), Expect = 6.863e-6
Identity = 40/128 (31.25%), Postives = 61/128 (47.66%), Query Frame = 3
Query:   81 NDENLIDESKI-IREIKSVNFDEYELCKAASAGDFKSVRKLLSENVKIDSRDPEGYTSLHLAAKHGHYEIVKIXXXXXXXXXXXTADLVTPLHLASFHGHVGVMKLLALSKADLNATTKSGCKPIDFA 461
            ND N   ESK+ +       F    +  AA  G+      LL+    +D       T LH+A+K G+  +VK+LL  G  +   T D +TPLH  +  GH  V+++L    A + + TK+G  P+  A
Sbjct:  203 NDHNADVESKMMVNRTTESGFTPLHI--AAHYGNINVATLLLNRGAAVDFMARNDITPLHVASKRGNGNMVKLLLDRGSKIEAKTKDGLTPLHCGARSGHEQVVEMLLDRGAPILSKTKNGLSPLHMA 328          

HSP 7 Score: 47.7506 bits (112), Expect = 7.380e-6
Identity = 34/100 (34.00%), Postives = 52/100 (52.00%), Query Frame = 3
Query:  162 AASAGDFKSVRKLLSENVKIDSRDPEGYTSLHLAAKHGHYEIVKIXXXXXXXXXXXTADLVTPLHLASFHGHVGVMKLLALSKADLNATTKSGCKPIDFA 461
             A +G  + V  LL     I S+   G + LH+A +  H   V++LL +   V+ VT D +T LH+A+  GH  V K++   KA+ NA   +G  P+  A
Sbjct:  295 GARSGHEQVVEMLLDRGAPILSKTKNGLSPLHMATQGDHLNCVQLLLQHNAPVDDVTNDYLTALHVAAHCGHYKVAKVIVDKKANPNAKALNGFTPLHIA 394          
BLAST of SMED30015853 vs. Ensembl Zebrafish
Match: ank3a (ankyrin 3a [Source:ZFIN;Acc:ZDB-GENE-060621-1])

HSP 1 Score: 63.1586 bits (152), Expect = 6.713e-11
Identity = 43/118 (36.44%), Postives = 66/118 (55.93%), Query Frame = 3
Query:  141 DEYELCKAASAGDFKSVRKLLSENVKIDSRDPEGYTSLHLAAKHGHYEIVKIXXXXXXXXXXXTADLVTPLHLASFHGHVGVMKLLALSKADLNATTKSGCKPIDFAP-YDSERWRIL 491
            D+  L  A+  G  + V++LL +    ++    GYT LHL+A+ GH EI  +LL  G +++  T    TPLH+A+ +G + V  LL   KA  +A  KSG  P+  A  YD++R  +L
Sbjct:  491 DQTALHIASRLGKLEIVQQLLQKGALPNAATTSGYTPLHLSAREGHQEIAALLLEQGSSLSAATKKGFTPLHVAAKYGQLEVANLLLQKKAAPDAAGKSGLTPLHVAAHYDNQRVALL 608          

HSP 2 Score: 58.9214 bits (141), Expect = 1.558e-9
Identity = 41/106 (38.68%), Postives = 55/106 (51.89%), Query Frame = 3
Query:  144 EYELCKAASAGDFKSVRKLLSENVKIDSRDPEGYTSLHLAAKHGHYEIVKIXXXXXXXXXXXTADLVTPLHLASFHGHVGVMKLLALSKADLNATTKSGCKPIDFA 461
            E  L  AA AG    VR LL    K+D +  +  T+LH+A++ G  EIV+ LL  G   N  T    TPLHL++  GH  +  LL    + L+A TK G  P+  A
Sbjct:  459 ETALHMAARAGQIDVVRYLLQNGAKVDIKAKDDQTALHIASRLGKLEIVQQLLQKGALPNAATTSGYTPLHLSAREGHQEIAALLLEQGSSLSAATKKGFTPLHVA 564          

HSP 3 Score: 57.7658 bits (138), Expect = 3.819e-9
Identity = 38/102 (37.25%), Postives = 54/102 (52.94%), Query Frame = 3
Query:  165 ASAGD-FKSVRKLLSENVKIDSRDPEGYTSLHLAAKHGHYEIVKIXXXXXXXXXXXTADLVTPLHLASFHGHVGVMKLLALSKADLNATTKSGCKPIDFAPY 467
            A+ GD    V+ LL  N  +D    +  T+LH+AA  GHY++ K+++    N N    +  TPLH+A     V VM+LL    A L A T+SG  PI  A +
Sbjct:  333 ATQGDHLNCVQLLLQHNAPVDDVTNDYLTALHVAAHCGHYKVAKVIVDKKANPNAKALNGFTPLHIACKKNRVKVMELLLKHGASLQAVTESGLTPIHVAAF 434          

HSP 4 Score: 54.6842 bits (130), Expect = 4.114e-8
Identity = 38/101 (37.62%), Postives = 57/101 (56.44%), Query Frame = 3
Query:  159 KAASAGDFKSVRKLLSENVKIDSRDPEGYTSLHLAAKHGHYEIVKIXXXXXXXXXXXTADLVTPLHLASFHGHVGVMKLLALSKADLNATTKSGCKPIDFA 461
            +AA AG+ + V   L   V I+  +  G  +LHLA+K GH E+V  LL  G NV+  T    T LH+AS  G   V++ L  + A++NA +++G  P+  A
Sbjct:   31 RAARAGNLEKVLDYLKTGVDINICNQNGLNALHLASKEGHVEVVAELLKLGANVDAATKKGNTALHIASLAGQTEVVRELVTNGANVNAQSQNGFTPLYMA 131          

HSP 5 Score: 49.6766 bits (117), Expect = 1.869e-6
Identity = 35/93 (37.63%), Postives = 48/93 (51.61%), Query Frame = 3
Query:  198 LLSENVKIDSRDPEGYTSLHLAAKHGHYEIVKIXXXXXXXXXXXTADLVTPLHLASFHGHVGVMKLLALSKADLNATTKSGCKPIDFAPYDSE 476
            LL +     S    GYT LH+AAK    EI   LL  G   N VT   ++PLHLA+  G V ++ LL   +A++N   K+G  P+  A  D +
Sbjct:  609 LLDQGASPHSPAKNGYTPLHIAAKKNQLEIGTTLLEYGAECNTVTRQGISPLHLAAQEGSVDLVSLLLTKQANVNMGNKNGLTPLHLAAQDDK 701          

HSP 6 Score: 47.7506 bits (112), Expect = 6.864e-6
Identity = 40/128 (31.25%), Postives = 61/128 (47.66%), Query Frame = 3
Query:   81 NDENLIDESKI-IREIKSVNFDEYELCKAASAGDFKSVRKLLSENVKIDSRDPEGYTSLHLAAKHGHYEIVKIXXXXXXXXXXXTADLVTPLHLASFHGHVGVMKLLALSKADLNATTKSGCKPIDFA 461
            ND N   ESK+ +       F    +  AA  G+      LL+    +D       T LH+A+K G+  +VK+LL  G  +   T D +TPLH  +  GH  V+++L    A + + TK+G  P+  A
Sbjct:  208 NDHNADVESKMMVNRTTESGFTPLHI--AAHYGNINVATLLLNRGAAVDFMARNDITPLHVASKRGNGNMVKLLLDRGSKIEAKTKDGLTPLHCGARSGHEQVVEMLLDRGAPILSKTKNGLSPLHMA 333          

HSP 7 Score: 47.7506 bits (112), Expect = 7.382e-6
Identity = 34/100 (34.00%), Postives = 52/100 (52.00%), Query Frame = 3
Query:  162 AASAGDFKSVRKLLSENVKIDSRDPEGYTSLHLAAKHGHYEIVKIXXXXXXXXXXXTADLVTPLHLASFHGHVGVMKLLALSKADLNATTKSGCKPIDFA 461
             A +G  + V  LL     I S+   G + LH+A +  H   V++LL +   V+ VT D +T LH+A+  GH  V K++   KA+ NA   +G  P+  A
Sbjct:  300 GARSGHEQVVEMLLDRGAPILSKTKNGLSPLHMATQGDHLNCVQLLLQHNAPVDDVTNDYLTALHVAAHCGHYKVAKVIVDKKANPNAKALNGFTPLHIA 399          
BLAST of SMED30015853 vs. Ensembl Xenopus
Match: cpsf1 (cleavage and polyadenylation specific factor 1 [Source:Xenbase;Acc:XB-GENE-5881751])

HSP 1 Score: 70.4774 bits (171), Expect = 1.196e-13
Identity = 46/130 (35.38%), Postives = 72/130 (55.38%), Query Frame = 3
Query:   87 ENLIDES-KIIREIKSVNFDEYELCKAASAGDFKSVRKLLSENVKIDSRDPEGYTSLHLAAKHGHYEIVKIXXXXXXXXXXXTADLVTPLHLASFHGHVGVMKLLALSKADLNATTKSGCKPIDFAPYDS 473
            ENL ++S   ++E K+++        AA  G+ + V++LL +   +DSRD  G+TSLH AA +GH   VK+L+  G  ++       TPLH A+ +GH  + +LL    A+  ATTK G  P+  A  + 
Sbjct:   23 ENLPEKSCPGVKEWKTLHL-------AAWNGNTRLVKQLLQQGEAVDSRDGLGWTSLHCAAANGHLSTVKLLIQRGALLSCQDGSGCTPLHHAAHNGHTHLCELLLQRGANPGATTKGGLTPLHLAASNG 145          

HSP 2 Score: 48.9062 bits (115), Expect = 2.660e-6
Identity = 31/79 (39.24%), Postives = 46/79 (58.23%), Query Frame = 3
Query:  162 AASAGDFKSVRKLLSENVKIDSRDPEGYTSLHLAAKHGHYEIVKIXXXXXXXXXXXTADLVTPLHLASFHGHVGVMKLL 398
            AA  G+ + VR LL +N +ID +D  G T+LH AA  GH  +VK+L+ NG   N   +  ++P+  ++  GH GV   L
Sbjct:  240 AAGNGNLEVVRLLLEKNAEIDEQDKHGRTALHRAAGAGHLHVVKLLVQNGACPNQRDSLGLSPVQRSAVCGHGGVSAFL 318          

HSP 3 Score: 47.3654 bits (111), Expect = 7.952e-6
Identity = 32/100 (32.00%), Postives = 50/100 (50.00%), Query Frame = 3
Query:  162 AASAGDFKSVRKLLSENVKIDSRDPEGYTSLHLAAKHGHYEIVKIXXXXXXXXXXXTADLVTPLHLASFHGHVGVMKLLALSKADLNATTKSGCKPIDFA 461
            AA+ G   +V+ L+     +  +D  G T LH AA +GH  + ++LL  G N    T   +TPLHLA+ +GH  + +LL     D      +   P+ +A
Sbjct:   75 AAANGHLSTVKLLIQRGALLSCQDGSGCTPLHHAAHNGHTHLCELLLQRGANPGATTKGGLTPLHLAASNGHTLITQLLLKQNLDPCVGDNNQWSPLHWA 174          
BLAST of SMED30015853 vs. Ensembl Xenopus
Match: fbxo9 (F-box protein 9 [Source:Xenbase;Acc:XB-GENE-1002447])

HSP 1 Score: 62.3882 bits (150), Expect = 1.079e-10
Identity = 39/105 (37.14%), Postives = 61/105 (58.10%), Query Frame = 3
Query:  162 AASAGDFKSVRKLLSENVKIDSRDPEGYTSLHLAAKHGHYEIVKIXXXXXXXXXXXTADLVTPLHLASFHGHVGVMKLLALSKADLNATTKSGCKPIDFAPYDSE 476
            +A AG+ + +  LL+ NV I+ +D  G T+LHLAA++GH +I+K LL  G  VN+   + +TPLH A+  G+  ++ LL   KA +N        P+  A Y  +
Sbjct:  232 SALAGNLQVINYLLNTNVDINVKDINGLTALHLAAENGHSKIIKCLLKKGAIVNITDINHLTPLHRAAGRGYTEIVTLLLKQKAAVNNMDIQNLTPLHHAAYKGQ 336          

HSP 2 Score: 53.5286 bits (127), Expect = 9.339e-8
Identity = 39/120 (32.50%), Postives = 61/120 (50.83%), Query Frame = 3
Query:  129 SVNFDEYE----LCKAASAGDFKSVRKLLSENVKIDSRDPEGYTSLHLAAKHGHYEIVKIXXXXXXXXXXXTADLVTPLHLASFHGHVGVMKLLALSKADLNATTKSGCKPIDFAPYDSE 476
            +VN  +Y     L  AA  GD   V+ LL +   ++ RD   YT LH AA  GH E+   LL  G   ++V     TPLHLA+ +GH+  +K+L  +KA ++    +   P+ +   + +
Sbjct:   85 AVNCQDYRGWSLLHSAAFCGDLALVKYLLQKGASVNLRDVRSYTPLHRAAWTGHAELTDYLLQCGALPDIVNYCGETPLHLAAANGHLLCVKILIQNKASIDIKDNNKWTPLQWCSINDQ 204          
BLAST of SMED30015853 vs. Ensembl Xenopus
Match: gorasp1 (golgi reassembly stacking protein 1 [Source:Xenbase;Acc:XB-GENE-976361])

HSP 1 Score: 60.077 bits (144), Expect = 7.457e-10
Identity = 33/88 (37.50%), Postives = 55/88 (62.50%), Query Frame = 3
Query:  162 AASAGDFKSVRKLLSENVKIDSRDPEGYTSLHLAAKHGHYEIVKIXXXXXXXXXXXTADLVTPLHLASFHGHVGVMKLLALSKADLNA 425
            AA  GD + VR LL  +  +DS++ + +T+LHLAA++G+  +V++L     N N    +  T LHLA++ GH  ++KLL    A++N+
Sbjct:  432 AAQGGDDRIVRLLLDHSANVDSKERDDWTALHLAAQNGYENVVRVLFTRHTNPNSQEVNGKTALHLATYFGHYKLVKLLISQGANVNS 519          

HSP 2 Score: 49.6766 bits (117), Expect = 1.952e-6
Identity = 32/105 (30.48%), Postives = 56/105 (53.33%), Query Frame = 3
Query:  162 AASAGDFKSVRKLLSENVKIDSRDPEGYTSLHLAAKHGHYEIVKIXXXXXXXXXXXTADLVTPLHLASFHGHVGVMKLLALSKADLNATTKSGCKPIDFAPYDSE 476
            AA  G F+  + L+ +   ++  D   YT+LH+AA  G+  I K+L+ +G N +  +    TPLHLA++ GH  ++ LL    +++++       P+  A   SE
Sbjct:  531 AADKGYFRVAQHLIQKGANLNFPDQSNYTALHMAAVKGNSMICKLLIKHGANADAKSFQDWTPLHLATYKGHTEIINLLKDGGSNIDSEGDLKWTPLHLAVRYSE 635          

HSP 3 Score: 48.1358 bits (113), Expect = 6.573e-6
Identity = 36/100 (36.00%), Postives = 54/100 (54.00%), Query Frame = 3
Query:  162 AASAGDFKSVRKLLSENVKIDSRDPEGYTSLHLAAKHGHYEIVKIXXXXXXXXXXXTADLVTPLHLASFHGHVGVMKLLALSKADLNATTKSGCKPIDFA 461
            AA  G    VR L + +   +S++  G T+LHLA   GHY++VK+L+  G NVN +  D  T LH+A+  G+  V + L    A+LN   +S    +  A
Sbjct:  465 AAQNGYENVVRVLFTRHTNPNSQEVNGKTALHLATYFGHYKLVKLLISQGANVNSIQNDQRTALHIAADKGYFRVAQHLIQKGANLNFPDQSNYTALHMA 564          
BLAST of SMED30015853 vs. Ensembl Xenopus
Match: tpm4 (tropomyosin 4 [Source:Xenbase;Acc:XB-GENE-6077097])

HSP 1 Score: 60.077 bits (144), Expect = 9.328e-10
Identity = 41/118 (34.75%), Postives = 67/118 (56.78%), Query Frame = 3
Query:  141 DEYELCKAASAGDFKSVRKLLSENVKIDSRDPEGYTSLHLAAKHGHYEIVKIXXXXXXXXXXXTADLVTPLHLASFHGHVGVMKLLALSKADLNATTKSGCKPIDFAP-YDSERWRIL 491
            D+  L  +A  G    V++LL +    D+    GYT LHL+++ GH ++  +LL +G +  +VT    TPLH+A+ +G + V+KLL    A  +A  KSG  P+  A  YD+++  +L
Sbjct:  473 DQTPLHISARLGKADIVQQLLKQGAYPDAATTSGYTPLHLSSREGHDDVASVLLEHGASFGIVTKKGFTPLHVAAKYGKIEVVKLLLQKNASPDAAGKSGLTPLHVAAHYDNQKVALL 590          

HSP 2 Score: 57.7658 bits (138), Expect = 4.934e-9
Identity = 39/102 (38.24%), Postives = 55/102 (53.92%), Query Frame = 3
Query:  165 ASAGD-FKSVRKLLSENVKIDSRDPEGYTSLHLAAKHGHYEIVKIXXXXXXXXXXXTADLVTPLHLASFHGHVGVMKLLALSKADLNATTKSGCKPIDFAPY 467
            A+ GD    V+ LL  NV +D    +  T+LH+AA  GHY++ K+LL    N N    +  TPLH+A     + VM+LL    A + A T+SG  PI  A +
Sbjct:  315 ATQGDHLNCVQLLLQHNVPVDDVTNDYLTALHVAAHCGHYKVAKVLLDKKANPNAKALNGFTPLHIACKKNRLKVMELLLKHGASIQAVTESGLTPIHVAAF 416          

HSP 3 Score: 54.6842 bits (130), Expect = 4.856e-8
Identity = 35/101 (34.65%), Postives = 57/101 (56.44%), Query Frame = 3
Query:  159 KAASAGDFKSVRKLLSENVKIDSRDPEGYTSLHLAAKHGHYEIVKIXXXXXXXXXXXTADLVTPLHLASFHGHVGVMKLLALSKADLNATTKSGCKPIDFA 461
            +AA +G+ +     L   V I+  +  G  +LHLA+K GH EIV  L+  G +V+  T    T LH+AS  G   V+++L  + A++NA +++G  P+  A
Sbjct:   21 RAARSGNLEKALDYLKNGVDINICNQNGLNALHLASKEGHVEIVSELIQRGADVDASTKKGNTALHIASLAGQTEVVRVLVTNGANVNAQSQNGFTPLYMA 121          

HSP 4 Score: 51.9878 bits (123), Expect = 4.599e-7
Identity = 37/106 (34.91%), Postives = 53/106 (50.00%), Query Frame = 3
Query:  144 EYELCKAASAGDFKSVRKLLSENVKIDSRDPEGYTSLHLAAKHGHYEIVKIXXXXXXXXXXXTADLVTPLHLASFHGHVGVMKLLALSKADLNATTKSGCKPIDFA 461
            E  L  AA AG  + VR LL    +++++  +  T LH++A+ G  +IV+ LL  G   +  T    TPLHL+S  GH  V  +L    A     TK G  P+  A
Sbjct:  441 ETALHMAARAGQSEVVRFLLQNGAQVEAKAKDDQTPLHISARLGKADIVQQLLKQGAYPDAATTSGYTPLHLSSREGHDDVASVLLEHGASFGIVTKKGFTPLHVA 546          

HSP 5 Score: 51.2174 bits (121), Expect = 8.109e-7
Identity = 30/74 (40.54%), Postives = 43/74 (58.11%), Query Frame = 3
Query:  240 GYTSLHLAAKHGHYEIVKIXXXXXXXXXXXTADLVTPLHLASFHGHVGVMKLLALSKADLNATTKSGCKPIDFA 461
            GYT LH+AAK    +I   LL  G + N +T   + P+HLA+  GHV ++ LL    A++N + KSG  P+  A
Sbjct:  605 GYTPLHIAAKKNQMDIATTLLEYGADANAITKQGIAPVHLAAQEGHVDMVSLLLTRSANVNVSNKSGLTPLHLA 678          

HSP 6 Score: 50.8322 bits (120), Expect = 1.047e-6
Identity = 30/97 (30.93%), Postives = 51/97 (52.58%), Query Frame = 3
Query:  162 AASAGDFKSVRKLLSENVKIDSRDPEGYTSLHLAAKHGHYEIVKIXXXXXXXXXXXTADLVTPLHLASFHGHVGVMKLLALSKADLNATTKSGCKPI 452
            AA  G    V  LL+ +  ++  +  G T LHLAA+     + ++L   G  ++  T    TPLH+AS +G++ ++  L    + +NA TK+G  P+
Sbjct:  645 AAQEGHVDMVSLLLTRSANVNVSNKSGLTPLHLAAQEDRVSVAEVLANQGAVIDGTTKMFYTPLHVASHYGNIKMVTFLLQHGSKVNAKTKNGYTPL 741          

HSP 7 Score: 50.447 bits (119), Expect = 1.580e-6
Identity = 32/97 (32.99%), Postives = 52/97 (53.61%), Query Frame = 3
Query:  162 AASAGDFKSVRKLLSENVKIDSRDPEGYTSLHLAAKHGHYEIVKIXXXXXXXXXXXTADLVTPLHLASFHGHVGVMKLLALSKADLNATTKSGCKPI 452
            AA   D K+   LL  +   D     G+T LH+AA +G+  +  +LL  G  V+    + +TPLH+AS  G+  ++KLL    + ++A T+ G  P+
Sbjct:  183 AARKDDTKAAALLLQNDHNADVESKSGFTPLHIAAHYGNINVATLLLNRGAAVDFTARNDITPLHVASKRGNANMVKLLLDRGSKIDAKTRDGLTPL 279          

HSP 8 Score: 48.521 bits (114), Expect = 5.762e-6
Identity = 30/93 (32.26%), Postives = 52/93 (55.91%), Query Frame = 3
Query:  162 AASAGDFKSVRKLLSENVKIDSRDPEGYTSLHLAAKHGHYEIVKIXXXXXXXXXXXTADLVTPLHLASFHGHVGVMKLLALSKADLNATTKSG 440
            AA  G +K  + LL +    +++   G+T LH+A K    +++++LL +G ++  VT   +TP+H+A+F GHV ++  L    A  N T   G
Sbjct:  348 AAHCGHYKVAKVLLDKKANPNAKALNGFTPLHIACKKNRLKVMELLLKHGASIQAVTESGLTPIHVAAFMGHVNIVSQLNHHGASPNTTNVRG 440          
BLAST of SMED30015853 vs. Ensembl Xenopus
Match: tpm4 (tropomyosin 4 [Source:Xenbase;Acc:XB-GENE-6077097])

HSP 1 Score: 60.077 bits (144), Expect = 9.377e-10
Identity = 41/118 (34.75%), Postives = 67/118 (56.78%), Query Frame = 3
Query:  141 DEYELCKAASAGDFKSVRKLLSENVKIDSRDPEGYTSLHLAAKHGHYEIVKIXXXXXXXXXXXTADLVTPLHLASFHGHVGVMKLLALSKADLNATTKSGCKPIDFAP-YDSERWRIL 491
            D+  L  +A  G    V++LL +    D+    GYT LHL+++ GH ++  +LL +G +  +VT    TPLH+A+ +G + V+KLL    A  +A  KSG  P+  A  YD+++  +L
Sbjct:  482 DQTPLHISARLGKADIVQQLLKQGAYPDAATTSGYTPLHLSSREGHDDVASVLLEHGASFGIVTKKGFTPLHVAAKYGKIEVVKLLLQKNASPDAAGKSGLTPLHVAAHYDNQKVALL 599          

HSP 2 Score: 57.7658 bits (138), Expect = 4.960e-9
Identity = 39/102 (38.24%), Postives = 55/102 (53.92%), Query Frame = 3
Query:  165 ASAGD-FKSVRKLLSENVKIDSRDPEGYTSLHLAAKHGHYEIVKIXXXXXXXXXXXTADLVTPLHLASFHGHVGVMKLLALSKADLNATTKSGCKPIDFAPY 467
            A+ GD    V+ LL  NV +D    +  T+LH+AA  GHY++ K+LL    N N    +  TPLH+A     + VM+LL    A + A T+SG  PI  A +
Sbjct:  324 ATQGDHLNCVQLLLQHNVPVDDVTNDYLTALHVAAHCGHYKVAKVLLDKKANPNAKALNGFTPLHIACKKNRLKVMELLLKHGASIQAVTESGLTPIHVAAF 425          

HSP 3 Score: 54.6842 bits (130), Expect = 4.837e-8
Identity = 35/101 (34.65%), Postives = 57/101 (56.44%), Query Frame = 3
Query:  159 KAASAGDFKSVRKLLSENVKIDSRDPEGYTSLHLAAKHGHYEIVKIXXXXXXXXXXXTADLVTPLHLASFHGHVGVMKLLALSKADLNATTKSGCKPIDFA 461
            +AA +G+ +     L   V I+  +  G  +LHLA+K GH EIV  L+  G +V+  T    T LH+AS  G   V+++L  + A++NA +++G  P+  A
Sbjct:   30 RAARSGNLEKALDYLKNGVDINICNQNGLNALHLASKEGHVEIVSELIQRGADVDASTKKGNTALHIASLAGQTEVVRVLVTNGANVNAQSQNGFTPLYMA 130          

HSP 4 Score: 51.9878 bits (123), Expect = 4.709e-7
Identity = 37/106 (34.91%), Postives = 53/106 (50.00%), Query Frame = 3
Query:  144 EYELCKAASAGDFKSVRKLLSENVKIDSRDPEGYTSLHLAAKHGHYEIVKIXXXXXXXXXXXTADLVTPLHLASFHGHVGVMKLLALSKADLNATTKSGCKPIDFA 461
            E  L  AA AG  + VR LL    +++++  +  T LH++A+ G  +IV+ LL  G   +  T    TPLHL+S  GH  V  +L    A     TK G  P+  A
Sbjct:  450 ETALHMAARAGQSEVVRFLLQNGAQVEAKAKDDQTPLHISARLGKADIVQQLLKQGAYPDAATTSGYTPLHLSSREGHDDVASVLLEHGASFGIVTKKGFTPLHVA 555          

HSP 5 Score: 51.2174 bits (121), Expect = 8.154e-7
Identity = 30/74 (40.54%), Postives = 43/74 (58.11%), Query Frame = 3
Query:  240 GYTSLHLAAKHGHYEIVKIXXXXXXXXXXXTADLVTPLHLASFHGHVGVMKLLALSKADLNATTKSGCKPIDFA 461
            GYT LH+AAK    +I   LL  G + N +T   + P+HLA+  GHV ++ LL    A++N + KSG  P+  A
Sbjct:  614 GYTPLHIAAKKNQMDIATTLLEYGADANAITKQGIAPVHLAAQEGHVDMVSLLLTRSANVNVSNKSGLTPLHLA 687          

HSP 6 Score: 50.8322 bits (120), Expect = 1.082e-6
Identity = 30/97 (30.93%), Postives = 51/97 (52.58%), Query Frame = 3
Query:  162 AASAGDFKSVRKLLSENVKIDSRDPEGYTSLHLAAKHGHYEIVKIXXXXXXXXXXXTADLVTPLHLASFHGHVGVMKLLALSKADLNATTKSGCKPI 452
            AA  G    V  LL+ +  ++  +  G T LHLAA+     + ++L   G  ++  T    TPLH+AS +G++ ++  L    + +NA TK+G  P+
Sbjct:  654 AAQEGHVDMVSLLLTRSANVNVSNKSGLTPLHLAAQEDRVSVAEVLANQGAVIDGTTKMFYTPLHVASHYGNIKMVTFLLQHGSKVNAKTKNGYTPL 750          

HSP 7 Score: 50.0618 bits (118), Expect = 1.618e-6
Identity = 32/97 (32.99%), Postives = 52/97 (53.61%), Query Frame = 3
Query:  162 AASAGDFKSVRKLLSENVKIDSRDPEGYTSLHLAAKHGHYEIVKIXXXXXXXXXXXTADLVTPLHLASFHGHVGVMKLLALSKADLNATTKSGCKPI 452
            AA   D K+   LL  +   D     G+T LH+AA +G+  +  +LL  G  V+    + +TPLH+AS  G+  ++KLL    + ++A T+ G  P+
Sbjct:  192 AARKDDTKAAALLLQNDHNADVESKSGFTPLHIAAHYGNINVATLLLNRGAAVDFTARNDITPLHVASKRGNANMVKLLLDRGSKIDAKTRDGLTPL 288          

HSP 8 Score: 48.521 bits (114), Expect = 5.901e-6
Identity = 30/93 (32.26%), Postives = 52/93 (55.91%), Query Frame = 3
Query:  162 AASAGDFKSVRKLLSENVKIDSRDPEGYTSLHLAAKHGHYEIVKIXXXXXXXXXXXTADLVTPLHLASFHGHVGVMKLLALSKADLNATTKSG 440
            AA  G +K  + LL +    +++   G+T LH+A K    +++++LL +G ++  VT   +TP+H+A+F GHV ++  L    A  N T   G
Sbjct:  357 AAHCGHYKVAKVLLDKKANPNAKALNGFTPLHIACKKNRLKVMELLLKHGASIQAVTESGLTPIHVAAFMGHVNIVSQLNHHGASPNTTNVRG 449          
BLAST of SMED30015853 vs. Ensembl Mouse
Match: Ankk1 (ankyrin repeat and kinase domain containing 1 [Source:MGI Symbol;Acc:MGI:3045301])

HSP 1 Score: 64.3142 bits (155), Expect = 2.304e-11
Identity = 34/100 (34.00%), Postives = 62/100 (62.00%), Query Frame = 3
Query:  162 AASAGDFKSVRKLLSENVKIDSRDPEGYTSLHLAAKHGHYEIVKIXXXXXXXXXXXTADLVTPLHLASFHGHVGVMKLLALSKADLNATTKSGCKPIDFA 461
            AA  GD  + R LL     +++R+ EG+T LHLAA++    + ++L+    +++   A+  TPLH+A++ GH+G++KLL+   A+L+A  ++   P+  A
Sbjct:  443 AAQNGDDHTARLLLDHGALVNAREHEGWTPLHLAAQNNFENVARLLVSRQADLSPHEAEGKTPLHVAAYFGHIGLVKLLSGQGAELDAQQRNLRTPLHLA 542          

HSP 2 Score: 55.8398 bits (133), Expect = 1.600e-8
Identity = 37/100 (37.00%), Postives = 54/100 (54.00%), Query Frame = 3
Query:  162 AASAGDFKSVRKLLSENVKIDSRDPEGYTSLHLAAKHGHYEIVKIXXXXXXXXXXXTADLVTPLHLASFHGHVGVMKLLALSKADLNATTKSGCKPIDFA 461
            AA+ G     + LL     ++ R  +G+T LHLA   GH EI+  L  + V+++ + +   TPLHLA+F G  GVM  L    A+ NA  +SG  P+  A
Sbjct:  575 AAARGKDLIFKMLLRYGASLELRTQQGWTPLHLATYKGHLEIIHQLAKSHVDLDALGSMQWTPLHLAAFQGEEGVMLALLQCGANPNAAEQSGWTPLHLA 674          

HSP 3 Score: 55.4546 bits (132), Expect = 1.755e-8
Identity = 36/105 (34.29%), Postives = 55/105 (52.38%), Query Frame = 3
Query:  162 AASAGDFKSVRKLLSENVKIDSRDPEGYTSLHLAAKHGHYEIVKIXXXXXXXXXXXTADLVTPLHLASFHGHVGVMKLLALSKADLNATTKSGCKPIDFAPYDSE 476
            A   G  ++++ LL      D+ D  GY+ LH+AA  G   I K+LL  G ++ + T    TPLHLA++ GH+ ++  LA S  DL+A       P+  A +  E
Sbjct:  542 AVERGKVRAIQHLLKCGALPDALDHSGYSPLHIAAARGKDLIFKMLLRYGASLELRTQQGWTPLHLATYKGHLEIIHQLAKSHVDLDALGSMQWTPLHLAAFQGE 646          

HSP 4 Score: 47.7506 bits (112), Expect = 7.946e-6
Identity = 35/100 (35.00%), Postives = 52/100 (52.00%), Query Frame = 3
Query:  165 ASAGDFKSVRKLL-SENVKIDSRDPEGYTSLHLAAKHGHYEIVKIXXXXXXXXXXXTADLVTPLHLASFHGHVGVMKLLALSKADLNATTKSGCKPIDFA 461
            A+  +F++V +LL S    +   + EG T LH+AA  GH  +VK+L   G  ++    +L TPLHLA   G V  ++ L    A  +A   SG  P+  A
Sbjct:  476 AAQNNFENVARLLVSRQADLSPHEAEGKTPLHVAAYFGHIGLVKLLSGQGAELDAQQRNLRTPLHLAVERGKVRAIQHLLKCGALPDALDHSGYSPLHIA 575          
BLAST of SMED30015853 vs. Ensembl Mouse
Match: Ripk4 (receptor-interacting serine-threonine kinase 4 [Source:MGI Symbol;Acc:MGI:1919638])

HSP 1 Score: 62.003 bits (149), Expect = 1.384e-10
Identity = 41/101 (40.59%), Postives = 57/101 (56.44%), Query Frame = 3
Query:  162 AASAGDFKSVRKLLSENVKIDSRDPEGYTSLHLAAKHGHYEIVKIXXXXXXXXXXXTADLVTPLHLASFHGHVGVMKLLALSKA-DLNATTKSGCKPIDFA 461
            AA  GD  S R LL +N  ++  D EG T +H+A +HG   IV+ LL  GV+V +   D   PLH A++ GH+ ++KLLA      +NA T  G  P+  A
Sbjct:  513 AAQNGDEASTRLLLEKNASVNEVDFEGRTPMHVACQHGQENIVRTLLRRGVDVGLQGKDAWLPLHYAAWQGHLPIVKLLAKQPGVSVNAQTLDGRTPLHLA 613          

HSP 2 Score: 47.7506 bits (112), Expect = 6.639e-6
Identity = 34/105 (32.38%), Postives = 53/105 (50.48%), Query Frame = 3
Query:  162 AASAGDFKSVRKLLSE-NVKIDSRDPEGYTSLHLAAKHGHYEIVKIXXXXXXXXXXXTADLVTPLHLASFHGHVGVMKLLALSKADLNATTKSGCKPIDFAPYDS 473
            AA  G    V+ L  +  V ++++  +G T LHLAA+ GHY + +IL+    +VN+ +    TPLH+A+  GH    +LL    A   A T  G   +  A  + 
Sbjct:  579 AAWQGHLPIVKLLAKQPGVSVNAQTLDGRTPLHLAAQRGHYRVARILIDLCSDVNICSLQAQTPLHVAAETGHTSTARLLLHRGAGKEALTSEGYTALHLAAQNG 683          
BLAST of SMED30015853 vs. Ensembl Mouse
Match: Ankrd17 (ankyrin repeat domain 17 [Source:MGI Symbol;Acc:MGI:1932101])

HSP 1 Score: 60.077 bits (144), Expect = 6.757e-10
Identity = 41/108 (37.96%), Postives = 59/108 (54.63%), Query Frame = 3
Query:  141 DEYELCKAASAGDFKSVRKLLSENVKIDSRDPEGYTSLHLAAKHGHYEIVKIXXXXXXXXXXX-TADLVTPLHLASFHGHVGVMKLLALSKADLNATTKSGCKPIDFA 461
            D   L +A S GD  +VRKLL E   ++    EG + L LA   G+YE+ ++LL    NV        +TPL  A+  GHV ++KLL   KAD+NA + +G   + +A
Sbjct:  230 DNRSLAEACSEGDVNAVRKLLIEGRSVNEHTEEGESLLCLACSAGYYELAQVLLAMHANVEDRGIKGDITPLMAAANGGHVKIVKLLLAHKADVNAQSSTGNTALTYA 337          
BLAST of SMED30015853 vs. Ensembl Mouse
Match: Ankrd17 (ankyrin repeat domain 17 [Source:MGI Symbol;Acc:MGI:1932101])

HSP 1 Score: 60.077 bits (144), Expect = 6.757e-10
Identity = 41/108 (37.96%), Postives = 59/108 (54.63%), Query Frame = 3
Query:  141 DEYELCKAASAGDFKSVRKLLSENVKIDSRDPEGYTSLHLAAKHGHYEIVKIXXXXXXXXXXX-TADLVTPLHLASFHGHVGVMKLLALSKADLNATTKSGCKPIDFA 461
            D   L +A S GD  +VRKLL E   ++    EG + L LA   G+YE+ ++LL    NV        +TPL  A+  GHV ++KLL   KAD+NA + +G   + +A
Sbjct:  230 DNRSLAEACSEGDVNAVRKLLIEGRSVNEHTEEGESLLCLACSAGYYELAQVLLAMHANVEDRGIKGDITPLMAAANGGHVKIVKLLLAHKADVNAQSSTGNTALTYA 337          
BLAST of SMED30015853 vs. Ensembl Mouse
Match: Ankrd17 (ankyrin repeat domain 17 [Source:MGI Symbol;Acc:MGI:1932101])

HSP 1 Score: 60.077 bits (144), Expect = 7.097e-10
Identity = 41/108 (37.96%), Postives = 59/108 (54.63%), Query Frame = 3
Query:  141 DEYELCKAASAGDFKSVRKLLSENVKIDSRDPEGYTSLHLAAKHGHYEIVKIXXXXXXXXXXX-TADLVTPLHLASFHGHVGVMKLLALSKADLNATTKSGCKPIDFA 461
            D   L +A S GD  +VRKLL E   ++    EG + L LA   G+YE+ ++LL    NV        +TPL  A+  GHV ++KLL   KAD+NA + +G   + +A
Sbjct:  230 DNRSLAEACSEGDVNAVRKLLIEGRSVNEHTEEGESLLCLACSAGYYELAQVLLAMHANVEDRGIKGDITPLMAAANGGHVKIVKLLLAHKADVNAQSSTGNTALTYA 337          
BLAST of SMED30015853 vs. UniProt/SwissProt
Match: sp|Q8BZ25|ANKK1_MOUSE (Ankyrin repeat and protein kinase domain-containing protein 1 OS=Mus musculus OX=10090 GN=Ankk1 PE=2 SV=1)

HSP 1 Score: 64.3142 bits (155), Expect = 1.612e-10
Identity = 34/100 (34.00%), Postives = 62/100 (62.00%), Query Frame = 3
Query:  162 AASAGDFKSVRKLLSENVKIDSRDPEGYTSLHLAAKHGHYEIVKIXXXXXXXXXXXTADLVTPLHLASFHGHVGVMKLLALSKADLNATTKSGCKPIDFA 461
            AA  GD  + R LL     +++R+ EG+T LHLAA++    + ++L+    +++   A+  TPLH+A++ GH+G++KLL+   A+L+A  ++   P+  A
Sbjct:  443 AAQNGDDHTARLLLDHGALVNAREHEGWTPLHLAAQNNFENVARLLVSRQADLSPHEAEGKTPLHVAAYFGHIGLVKLLSGQGAELDAQQRNLRTPLHLA 542          

HSP 2 Score: 55.8398 bits (133), Expect = 1.119e-7
Identity = 37/100 (37.00%), Postives = 54/100 (54.00%), Query Frame = 3
Query:  162 AASAGDFKSVRKLLSENVKIDSRDPEGYTSLHLAAKHGHYEIVKIXXXXXXXXXXXTADLVTPLHLASFHGHVGVMKLLALSKADLNATTKSGCKPIDFA 461
            AA+ G     + LL     ++ R  +G+T LHLA   GH EI+  L  + V+++ + +   TPLHLA+F G  GVM  L    A+ NA  +SG  P+  A
Sbjct:  575 AAARGKDLIFKMLLRYGASLELRTQQGWTPLHLATYKGHLEIIHQLAKSHVDLDALGSMQWTPLHLAAFQGEEGVMLALLQCGANPNAAEQSGWTPLHLA 674          

HSP 3 Score: 55.4546 bits (132), Expect = 1.227e-7
Identity = 36/105 (34.29%), Postives = 55/105 (52.38%), Query Frame = 3
Query:  162 AASAGDFKSVRKLLSENVKIDSRDPEGYTSLHLAAKHGHYEIVKIXXXXXXXXXXXTADLVTPLHLASFHGHVGVMKLLALSKADLNATTKSGCKPIDFAPYDSE 476
            A   G  ++++ LL      D+ D  GY+ LH+AA  G   I K+LL  G ++ + T    TPLHLA++ GH+ ++  LA S  DL+A       P+  A +  E
Sbjct:  542 AVERGKVRAIQHLLKCGALPDALDHSGYSPLHIAAARGKDLIFKMLLRYGASLELRTQQGWTPLHLATYKGHLEIIHQLAKSHVDLDALGSMQWTPLHLAAFQGE 646          
BLAST of SMED30015853 vs. UniProt/SwissProt
Match: sp|P57078|RIPK4_HUMAN (Receptor-interacting serine/threonine-protein kinase 4 OS=Homo sapiens OX=9606 GN=RIPK4 PE=1 SV=1)

HSP 1 Score: 62.7734 bits (151), Expect = 5.163e-10
Identity = 42/101 (41.58%), Postives = 59/101 (58.42%), Query Frame = 3
Query:  162 AASAGDFKSVRKLLSENVKIDSRDPEGYTSLHLAAKHGHYEIVKIXXXXXXXXXXXTADLVTPLHLASFHGHVGVMKLLALSKA-DLNATTKSGCKPIDFA 461
            AA  GD  S R LL +N  ++  D EG T +H+A +HG   IV+ILL  GV+V++   D   PLH A++ GH+ ++KLLA      +NA T  G  P+  A
Sbjct:  559 AAQNGDESSTRLLLEKNASVNEVDFEGRTPMHVACQHGQENIVRILLRRGVDVSLQGKDAWLPLHYAAWQGHLPIVKLLAKQPGVSVNAQTLDGRTPLHLA 659          
BLAST of SMED30015853 vs. UniProt/SwissProt
Match: sp|Q9ERK0|RIPK4_MOUSE (Receptor-interacting serine/threonine-protein kinase 4 OS=Mus musculus OX=10090 GN=Ripk4 PE=1 SV=2)

HSP 1 Score: 62.003 bits (149), Expect = 9.682e-10
Identity = 41/101 (40.59%), Postives = 57/101 (56.44%), Query Frame = 3
Query:  162 AASAGDFKSVRKLLSENVKIDSRDPEGYTSLHLAAKHGHYEIVKIXXXXXXXXXXXTADLVTPLHLASFHGHVGVMKLLALSKA-DLNATTKSGCKPIDFA 461
            AA  GD  S R LL +N  ++  D EG T +H+A +HG   IV+ LL  GV+V +   D   PLH A++ GH+ ++KLLA      +NA T  G  P+  A
Sbjct:  513 AAQNGDEASTRLLLEKNASVNEVDFEGRTPMHVACQHGQENIVRTLLRRGVDVGLQGKDAWLPLHYAAWQGHLPIVKLLAKQPGVSVNAQTLDGRTPLHLA 613          
BLAST of SMED30015853 vs. UniProt/SwissProt
Match: sp|Q8NFD2|ANKK1_HUMAN (Ankyrin repeat and protein kinase domain-containing protein 1 OS=Homo sapiens OX=9606 GN=ANKK1 PE=1 SV=1)

HSP 1 Score: 61.6178 bits (148), Expect = 1.332e-9
Identity = 35/100 (35.00%), Postives = 60/100 (60.00%), Query Frame = 3
Query:  162 AASAGDFKSVRKLLSENVKIDSRDPEGYTSLHLAAKHGHYEIVKIXXXXXXXXXXXTADLVTPLHLASFHGHVGVMKLLALSKADLNATTKSGCKPIDFA 461
            AA  GD  + R LL     +D+++ EG+T LHLAA++    + ++L+    + N+  A+  TPLH+A++ GHV ++KLL    A+L+A  ++   P+  A
Sbjct:  435 AAQNGDDGTARLLLDHGACVDAQEREGWTPLHLAAQNNFENVARLLVSRQADPNLHEAEGKTPLHVAAYFGHVSLVKLLTSQGAELDAQQRNLRTPLHLA 534          

HSP 2 Score: 57.3806 bits (137), Expect = 3.649e-8
Identity = 37/105 (35.24%), Postives = 54/105 (51.43%), Query Frame = 3
Query:  162 AASAGDFKSVRKLLSENVKIDSRDPEGYTSLHLAAKHGHYEIVKIXXXXXXXXXXXTADLVTPLHLASFHGHVGVMKLLALSKADLNATTKSGCKPIDFAPYDSE 476
            A   G  ++++ LL      D+ D  GY  LH AA  G Y I K+LL  G ++ + T    TPLHLA++ GH+ ++ LLA S A++ A       P+  A    E
Sbjct:  534 AVERGKVRAIQHLLKSGAVPDALDQSGYGPLHTAAARGKYLICKMLLRYGASLELPTHQGWTPLHLAAYKGHLEIIHLLAESHANMGALGAVNWTPLHLAARHGE 638          

HSP 3 Score: 56.9954 bits (136), Expect = 4.514e-8
Identity = 38/103 (36.89%), Postives = 54/103 (52.43%), Query Frame = 3
Query:  153 LCKAASAGDFKSVRKLLSENVKIDSRDPEGYTSLHLAAKHGHYEIVKIXXXXXXXXXXXTADLVTPLHLASFHGHVGVMKLLALSKADLNATTKSGCKPIDFA 461
            L  AA+ G +   + LL     ++    +G+T LHLAA  GH EI+ +L  +  N+  + A   TPLHLA+ HG   V+  L    AD NA  +SG  P+  A
Sbjct:  564 LHTAAARGKYLICKMLLRYGASLELPTHQGWTPLHLAAYKGHLEIIHLLAESHANMGALGAVNWTPLHLAARHGEEAVVSALLQCGADPNAAEQSGWTPLHLA 666          
BLAST of SMED30015853 vs. UniProt/SwissProt
Match: sp|Q99NH0|ANR17_MOUSE (Ankyrin repeat domain-containing protein 17 OS=Mus musculus OX=10090 GN=Ankrd17 PE=1 SV=2)

HSP 1 Score: 60.077 bits (144), Expect = 4.727e-9
Identity = 41/108 (37.96%), Postives = 59/108 (54.63%), Query Frame = 3
Query:  141 DEYELCKAASAGDFKSVRKLLSENVKIDSRDPEGYTSLHLAAKHGHYEIVKIXXXXXXXXXXX-TADLVTPLHLASFHGHVGVMKLLALSKADLNATTKSGCKPIDFA 461
            D   L +A S GD  +VRKLL E   ++    EG + L LA   G+YE+ ++LL    NV        +TPL  A+  GHV ++KLL   KAD+NA + +G   + +A
Sbjct:  230 DNRSLAEACSEGDVNAVRKLLIEGRSVNEHTEEGESLLCLACSAGYYELAQVLLAMHANVEDRGIKGDITPLMAAANGGHVKIVKLLLAHKADVNAQSSTGNTALTYA 337          
BLAST of SMED30015853 vs. TrEMBL
Match: A0A183ARE2 (ANK_REP_REGION domain-containing protein OS=Echinostoma caproni OX=27848 GN=ECPE_LOCUS9527 PE=4 SV=1)

HSP 1 Score: 115.546 bits (288), Expect = 5.049e-28
Identity = 59/145 (40.69%), Postives = 87/145 (60.00%), Query Frame = 3
Query:  141 DEYELCKAASAGDFKSVRKLLSENVKIDSRDPEGYTSLHLAAKHGHYEIVKIXXXXXXXXXXXTADLVTPLHLASFHGHVGVMKLLALSKADLNATTKSGCKPIDFAPYDSERWRILRDASLNILPYSELLKETLDLPVLPAFAM 575
            DE ELC A   G+ K + K + +   ++  D  G   LH AA+ G++E  K+L+ N     V+  + VTPLHLA+   H  ++K L +S AD+N    SGCKP+DFAP+ SE W+IL +A+   LP  E L +T  +P++P FA+
Sbjct:   25 DELELCSATKCGNLKQMSKCIGDGANVNFLDGFGRAPLHYAAQSGNFEAAKLLVANKALTGVMDGNHVTPLHLAAKGNHKLLVKFLVMSGADVNVECASGCKPVDFAPFGSETWQILINAAQGQLPLVEHLVQTRTVPMVPQFAI 169          
BLAST of SMED30015853 vs. TrEMBL
Match: A0A4S2MD91 (ANK_REP_REGION domain-containing protein OS=Opisthorchis felineus OX=147828 GN=CRM22_002167 PE=4 SV=1)

HSP 1 Score: 112.849 bits (281), Expect = 4.809e-27
Identity = 62/145 (42.76%), Postives = 89/145 (61.38%), Query Frame = 3
Query:  141 DEYELCKAASAGDFKSVRKLLSENVKIDSRDPEGYTSLHLAAKHGHYEIVKIXXXXXXXXXXXTADLVTPLHLASFHGHVGVMKLLALSKADLNATTKSGCKPIDFAPYDSERWRILRDASLNILPYSELLKETLDLPVLPAFAM 575
            +E++LC A    D K++ + + +  KID  D  G T LH A ++G YE  KILL N   VN++ A+ +TPLHLA+   H  + KLL L+ ADL     SGC+P+DFAPY SE W++L DA    LP  + L +   +P++P FA+
Sbjct:   25 EEFKLCDAVCVTDLKTISQCIKDGAKIDFFDGFGRTPLHYACQYGSYEATKILLGNKAKVNIMDANQITPLHLAARGNHPAITKLLLLNGADLKVECLSGCRPVDFAPYGSETWQVLVDAENGRLPDVDDLTKAKLVPLVPKFAI 169          
BLAST of SMED30015853 vs. TrEMBL
Match: A0A183K144 (ANK_REP_REGION domain-containing protein OS=Schistosoma curassoni OX=6186 GN=SCUD_LOCUS8707 PE=4 SV=1)

HSP 1 Score: 110.923 bits (276), Expect = 2.677e-26
Identity = 64/145 (44.14%), Postives = 90/145 (62.07%), Query Frame = 3
Query:  141 DEYELCKAASAGDFKSVRKLLSENVKIDSRDPEGYTSLHLAAKHGHYEIVKIXXXXXXXXXXXTADLVTPLHLASFHGHVGVMKLLALSKADLNATTKSGCKPIDFAPYDSERWRILRDASLNILPYSELLKETLDLPVLPAFAM 575
            +E  LCKAA   D K+V K ++  V I+  D  G T+LH AA +G YE VK+L+ N  NVN+  ++  TPLH+A+   H  V+K L +S AD+N    SG KPID A Y+SE W++L DA+   LP  E L +T  +P++P F +
Sbjct:   24 NELNLCKAARHADIKAVSKCIANGVNINFIDGFGKTALHYAAANGSYESVKLLVANKANVNIWDSNGTTPLHMAAKGNHTRVVKFLLMSGADINHQCISGVKPIDLAIYNSETWKVLLDAANGDLPKIEHLIQTCTVPLIPQFTI 168          
BLAST of SMED30015853 vs. TrEMBL
Match: A0A094ZEP9 (Ankyrin-3 OS=Schistosoma haematobium OX=6185 GN=MS3_01007 PE=4 SV=1)

HSP 1 Score: 110.538 bits (275), Expect = 3.645e-26
Identity = 64/145 (44.14%), Postives = 90/145 (62.07%), Query Frame = 3
Query:  141 DEYELCKAASAGDFKSVRKLLSENVKIDSRDPEGYTSLHLAAKHGHYEIVKIXXXXXXXXXXXTADLVTPLHLASFHGHVGVMKLLALSKADLNATTKSGCKPIDFAPYDSERWRILRDASLNILPYSELLKETLDLPVLPAFAM 575
            +E  LCKAA   D K+V K ++  V I+  D  G T+LH AA +G YE VK+L+ N  NVN+  ++  TPLH+A+   H  V+K L +S AD+N    SG KPID A Y+SE W++L DA+   LP  E L +T  +P++P F +
Sbjct:   24 NELNLCKAARHADIKAVSKCIANGVNINFIDGFGKTALHYAAANGSYESVKLLVANKANVNIWDSNGTTPLHMAAKGNHTRVVKFLLMSGADINHQCISGVKPIDLAIYNSETWKVLLDAANGDLPKIEHLIQTRTVPLIPQFTI 168          
BLAST of SMED30015853 vs. TrEMBL
Match: A0A430PZS9 (ANK_REP_REGION domain-containing protein OS=Schistosoma bovis OX=6184 GN=DC041_0005139 PE=4 SV=1)

HSP 1 Score: 110.538 bits (275), Expect = 3.969e-26
Identity = 64/145 (44.14%), Postives = 90/145 (62.07%), Query Frame = 3
Query:  141 DEYELCKAASAGDFKSVRKLLSENVKIDSRDPEGYTSLHLAAKHGHYEIVKIXXXXXXXXXXXTADLVTPLHLASFHGHVGVMKLLALSKADLNATTKSGCKPIDFAPYDSERWRILRDASLNILPYSELLKETLDLPVLPAFAM 575
            +E  LCKAA   D K+V K ++  V I+  D  G T+LH AA +G YE VK+L+ N  NVN+  ++  TPLH+A+   H  V+K L +S AD+N    SG KPID A Y+SE W++L DA+   LP  E L +T  +P++P F +
Sbjct:   24 NELNLCKAARHADIKAVSKCIANGVNINFIDGFGKTALHYAAANGSYESVKLLVANKANVNIWDSNGTTPLHMAAKGNHTRVVKFLLMSGADINHQCISGVKPIDLAIYNSETWKVLLDAANGDLPKIEHLIQTRTVPLIPQFTI 168          
BLAST of SMED30015853 vs. Ensembl Cavefish
Match: ENSAMXT00000037173.1 (pep primary_assembly:Astyanax_mexicanus-2.0:16:21074007:21119253:-1 gene:ENSAMXG00000017269.2 transcript:ENSAMXT00000037173.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 65.0846 bits (157), Expect = 7.024e-12
Identity = 43/123 (34.96%), Postives = 68/123 (55.28%), Query Frame = 3
Query:  111 IIREIKSVNFDE--YELCKAASAGDFKSVRKLLSENVKIDSRDPEGYTSLHLAAKHGHYEIVKIXXXXXXXXXXXTADLVTPLHLASFHGHVGVMKLLALSKADLNATTKSGCKPIDFAPYDS 473
            I+R+I+   F +      +AA AG+   V + L   V I + +  G  +LHLAAK GH ++V+ LL  G +V+  T    T LH+AS  G   V+K+L    AD+NA +++G  P+  A  ++
Sbjct:    3 IVRKIQCNKFSDSNTSFLRAARAGNIDKVLEYLKGGVDIGTSNQNGLNALHLAAKEGHMDLVQELLERGSSVDSATKKGNTALHIASLAGQAEVVKILVKQGADINAQSQNGFTPLYMASQEN 125          

HSP 2 Score: 52.7582 bits (125), Expect = 1.179e-7
Identity = 37/102 (36.27%), Postives = 51/102 (50.00%), Query Frame = 3
Query:  162 AASAGDFKSVRKLLSENVKIDSRDPEGYTSLHLAAKHGHYEIVKIXXXXXXXXXXXTADLVTPLHLASFHGHVGVMKLLALSKADLNATTKSGCKPIDFAPY 467
            AA     + V+ LL     +D    +  T+LH+AA  GHY + K+LL    N N    +  TPLH+A     V VM+LL    A + A T+SG  PI  A +
Sbjct:  315 AAQGDHVECVKHLLQHKAPVDDVTLDYLTALHVAAHCGHYRVTKLLLDKRANPNARALNGFTPLHIACKKNRVKVMELLVKYGASIQAITESGLTPIHVAAF 416          

HSP 3 Score: 50.447 bits (119), Expect = 5.431e-7
Identity = 33/100 (33.00%), Postives = 56/100 (56.00%), Query Frame = 3
Query:  162 AASAGDFKSVRKLLSENVKIDSRDPEGYTSLHLAAKHGHYEIVKIXXXXXXXXXXXTADLVTPLHLASFHGHVGVMKLLALSKADLNATTKSGCKPIDFA 461
            AA  G    V++LL     +DS   +G T+LH+A+  G  E+VKIL+  G ++N  + +  TPL++AS   H+ V++ L  +  + +  T+ G  P+  A
Sbjct:   55 AAKEGHMDLVQELLERGSSVDSATKKGNTALHIASLAGQAEVVKILVKQGADINAQSQNGFTPLYMASQENHLDVVRYLLENGGNQSTATEDGFTPLAIA 154          

HSP 4 Score: 50.0618 bits (118), Expect = 7.770e-7
Identity = 39/100 (39.00%), Postives = 54/100 (54.00%), Query Frame = 3
Query:  162 AASAGDFKSVRKLLSENVKIDSRDPEGYTSLHLAAKHGHYEIVKIXXXXXXXXXXXTADLVTPLHLASFHGHVGVMKLLALSKADLNATTKSGCKPIDFA 461
            AA +G   +V  LL     I +R   G + LH+AA+  H E VK LL +   V+ VT D +T LH+A+  GH  V KLL   +A+ NA   +G  P+  A
Sbjct:  282 AARSGHDTAVELLLERGAPILARTKNGLSPLHMAAQGDHVECVKHLLQHKAPVDDVTLDYLTALHVAAHCGHYRVTKLLLDKRANPNARALNGFTPLHIA 381          

HSP 5 Score: 50.0618 bits (118), Expect = 9.251e-7
Identity = 35/100 (35.00%), Postives = 53/100 (53.00%), Query Frame = 3
Query:  162 AASAGDFKSVRKLLSENVKIDSRDPEGYTSLHLAAKHGHYEIVKIXXXXXXXXXXXTADLVTPLHLASFHGHVGVMKLLALSKADLNATTKSGCKPIDFA 461
            AA  G+      LL+    +D     G T LH+A+K G+  +V++LL  G  ++  T D +TPLH A+  GH   ++LL    A + A TK+G  P+  A
Sbjct:  216 AAHYGNVNVATLLLNRGAAVDFTARNGITPLHVASKRGNTNMVRLLLDRGSQIDAKTRDGLTPLHCAARSGHDTAVELLLERGAPILARTKNGLSPLHMA 315          

HSP 6 Score: 49.6766 bits (117), Expect = 1.101e-6
Identity = 33/100 (33.00%), Postives = 54/100 (54.00%), Query Frame = 3
Query:  162 AASAGDFKSVRKLLSENVKIDSRDPEGYTSLHLAAKHGHYEIVKIXXXXXXXXXXXTADLVTPLHLASFHGHVGVMKLLALSKADLNATTKSGCKPIDFA 461
            AA   D KS   LL  +   D +   G+T LH+AA +G+  +  +LL  G  V+    + +TPLH+AS  G+  +++LL    + ++A T+ G  P+  A
Sbjct:  183 AARKDDTKSAALLLQNDHNADVQSKSGFTPLHIAAHYGNVNVATLLLNRGAAVDFTARNGITPLHVASKRGNTNMVRLLLDRGSQIDAKTRDGLTPLHCA 282          
BLAST of SMED30015853 vs. Ensembl Cavefish
Match: ENSAMXT00000046579.1 (pep primary_assembly:Astyanax_mexicanus-2.0:16:21094996:21225385:-1 gene:ENSAMXG00000017269.2 transcript:ENSAMXT00000046579.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 62.3882 bits (150), Expect = 4.014e-11
Identity = 39/105 (37.14%), Postives = 60/105 (57.14%), Query Frame = 3
Query:  159 KAASAGDFKSVRKLLSENVKIDSRDPEGYTSLHLAAKHGHYEIVKIXXXXXXXXXXXTADLVTPLHLASFHGHVGVMKLLALSKADLNATTKSGCKPIDFAPYDS 473
            +AA AG+   V + L   V I + +  G  +LHLAAK GH ++V+ LL  G +V+  T    T LH+AS  G   V+K+L    AD+NA +++G  P+  A  ++
Sbjct:   38 RAARAGNIDKVLEYLKGGVDIGTSNQNGLNALHLAAKEGHMDLVQELLERGSSVDSATKKGNTALHIASLAGQAEVVKILVKQGADINAQSQNGFTPLYMASQEN 142          

HSP 2 Score: 51.6026 bits (122), Expect = 1.806e-7
Identity = 33/100 (33.00%), Postives = 56/100 (56.00%), Query Frame = 3
Query:  162 AASAGDFKSVRKLLSENVKIDSRDPEGYTSLHLAAKHGHYEIVKIXXXXXXXXXXXTADLVTPLHLASFHGHVGVMKLLALSKADLNATTKSGCKPIDFA 461
            AA  G    V++LL     +DS   +G T+LH+A+  G  E+VKIL+  G ++N  + +  TPL++AS   H+ V++ L  +  + +  T+ G  P+  A
Sbjct:   72 AAKEGHMDLVQELLERGSSVDSATKKGNTALHIASLAGQAEVVKILVKQGADINAQSQNGFTPLYMASQENHLDVVRYLLENGGNQSTATEDGFTPLAIA 171          
BLAST of SMED30015853 vs. Ensembl Cavefish
Match: ank3b (ankyrin 3b [Source:ZFIN;Acc:ZDB-GENE-060621-2])

HSP 1 Score: 60.8474 bits (146), Expect = 2.662e-10
Identity = 41/118 (34.75%), Postives = 66/118 (55.93%), Query Frame = 3
Query:  141 DEYELCKAASAGDFKSVRKLLSENVKIDSRDPEGYTSLHLAAKHGHYEIVKIXXXXXXXXXXXTADLVTPLHLASFHGHVGVMKLLALSKADLNATTKSGCKPIDFAP-YDSERWRIL 491
            D+  L  ++  G  + +++LL      DS    GYT LHLAA+ GH ++  ILL  G ++ + T    TPLH+A+ +G + V  LL   +A  +A+ KSG  P+  A  YD+++  +L
Sbjct:  446 DQTPLHISSRLGKPEIIQQLLQHGACPDSTTTSGYTPLHLAAREGHKDVASILLDQGASLGITTKKGFTPLHVAAKYGKIEVANLLLQKRAPPDASGKSGLTPLHVAAHYDNQKVALL 563          

HSP 2 Score: 56.225 bits (134), Expect = 1.138e-8
Identity = 36/102 (35.29%), Postives = 54/102 (52.94%), Query Frame = 3
Query:  165 ASAGD-FKSVRKLLSENVKIDSRDPEGYTSLHLAAKHGHYEIVKIXXXXXXXXXXXTADLVTPLHLASFHGHVGVMKLLALSKADLNATTKSGCKPIDFAPY 467
            A+ GD    V+ LL   V +D    +  T+LH+AA  GHY++ K+++    N N    +  TPLH+A     + VM+LL    A + A T+SG  PI  A +
Sbjct:  288 ATQGDHLNCVQLLLHHEVPVDDVTNDYLTALHVAAHCGHYKVAKVIVDKKANPNAKALNGFTPLHIACKKNRIKVMELLLKHGASIQAVTESGLTPIHVAAF 389          

HSP 3 Score: 53.9138 bits (128), Expect = 5.440e-8
Identity = 37/106 (34.91%), Postives = 55/106 (51.89%), Query Frame = 3
Query:  144 EYELCKAASAGDFKSVRKLLSENVKIDSRDPEGYTSLHLAAKHGHYEIVKIXXXXXXXXXXXTADLVTPLHLASFHGHVGVMKLLALSKADLNATTKSGCKPIDFA 461
            E  L  AA AG  + V+ L+     +D++  +  T LH++++ G  EI++ LL +G   +  T    TPLHLA+  GH  V  +L    A L  TTK G  P+  A
Sbjct:  414 ETALHMAARAGQTEVVKYLVQNGAYVDAKSKDDQTPLHISSRLGKPEIIQQLLQHGACPDSTTTSGYTPLHLAAREGHKDVASILLDQGASLGITTKKGFTPLHVA 519          

HSP 4 Score: 51.9878 bits (123), Expect = 2.683e-7
Identity = 34/97 (35.05%), Postives = 52/97 (53.61%), Query Frame = 3
Query:  162 AASAGDFKSVRKLLSENVKIDSRDPEGYTSLHLAAKHGHYEIVKIXXXXXXXXXXXTADLVTPLHLASFHGHVGVMKLLALSKADLNATTKSGCKPI 452
            AA   D K+   LL  +   D     G+T LH+AA +G+  +  +LL  G  V+    + +TPLH+AS  G+  ++KLL    A ++A TK G  P+
Sbjct:  156 AARKDDTKAAALLLQNDHNADVESKSGFTPLHIAAHYGNINVATLLLNRGAAVDFKARNDITPLHVASKRGNSNMVKLLLERGARIDAKTKDGLTPL 252          

HSP 5 Score: 51.2174 bits (121), Expect = 4.819e-7
Identity = 37/105 (35.24%), Postives = 52/105 (49.52%), Query Frame = 3
Query:  162 AASAGDFKSVRKLLSENVKIDSRDPEGYTSLHLAAKHGHYEIVKIXXXXXXXXXXXTADLVTPLHLASFHGHVGVMKLLALSKADLNATTKSGCKPIDFAPYDSE 476
            AA   + K    LL +     +    GYT LH+AAK    EI   LL  G + N +T   ++PLHLAS  G+V ++ LL    A +N   KSG  P+  A  + +
Sbjct:  552 AAHYDNQKVALLLLDQGASPHAAAKNGYTPLHIAAKKNQMEIATTLLEYGADTNAITRQGISPLHLASQEGNVDMVTLLMARDATINLCNKSGLTPLHLAAQEDQ 656          

HSP 6 Score: 49.6766 bits (117), Expect = 1.638e-6
Identity = 33/100 (33.00%), Postives = 53/100 (53.00%), Query Frame = 3
Query:  162 AASAGDFKSVRKLLSENVKIDSRDPEGYTSLHLAAKHGHYEIVKIXXXXXXXXXXXTADLVTPLHLASFHGHVGVMKLLALSKADLNATTKSGCKPIDFA 461
            AA  G+      LL+    +D +     T LH+A+K G+  +VK+LL  G  ++  T D +TPLH  +  GH  V+++L    A + + TK+G  P+  A
Sbjct:  189 AAHYGNINVATLLLNRGAAVDFKARNDITPLHVASKRGNSNMVKLLLERGARIDAKTKDGLTPLHCGARSGHEQVVEMLLDRGAPILSKTKNGLSPLHMA 288          

HSP 7 Score: 48.1358 bits (113), Expect = 4.072e-6
Identity = 32/87 (36.78%), Postives = 48/87 (55.17%), Query Frame = 3
Query:  201 LSENVKIDSRDPEGYTSLHLAAKHGHYEIVKIXXXXXXXXXXXTADLVTPLHLASFHGHVGVMKLLALSKADLNATTKSGCKPIDFA 461
            L   V I+  +  G  +LHLA+K GH E+V  L+  G  V+  T    T LH+AS  G   V+K L  + A++NA +++G  P+  A
Sbjct:    8 LKSGVDINICNQNGLNALHLASKEGHVEVVTQLIKMGATVDAATKKGNTALHIASLAGQSDVVKELVTNGANVNAQSQNGFTPLYMA 94          

HSP 8 Score: 48.1358 bits (113), Expect = 4.222e-6
Identity = 35/100 (35.00%), Postives = 53/100 (53.00%), Query Frame = 3
Query:  162 AASAGDFKSVRKLLSENVKIDSRDPEGYTSLHLAAKHGHYEIVKIXXXXXXXXXXXTADLVTPLHLASFHGHVGVMKLLALSKADLNATTKSGCKPIDFA 461
             A +G  + V  LL     I S+   G + LH+A +  H   V++LL + V V+ VT D +T LH+A+  GH  V K++   KA+ NA   +G  P+  A
Sbjct:  255 GARSGHEQVVEMLLDRGAPILSKTKNGLSPLHMATQGDHLNCVQLLLHHEVPVDDVTNDYLTALHVAAHCGHYKVAKVIVDKKANPNAKALNGFTPLHIA 354          

HSP 9 Score: 47.3654 bits (111), Expect = 7.692e-6
Identity = 26/79 (32.91%), Postives = 47/79 (59.49%), Query Frame = 3
Query:  162 AASAGDFKSVRKLLSENVKIDSRDPEGYTSLHLAAKHGHYEIVKIXXXXXXXXXXXTADLVTPLHLASFHGHVGVMKLL 398
            A+  G+   V+ LL    +ID++  +G T LH  A+ GH ++V++LL  G  +   T + ++PLH+A+   H+  ++LL
Sbjct:  222 ASKRGNSNMVKLLLERGARIDAKTKDGLTPLHCGARSGHEQVVEMLLDRGAPILSKTKNGLSPLHMATQGDHLNCVQLL 300          
BLAST of SMED30015853 vs. Ensembl Cavefish
Match: ank3a (ankyrin 3a [Source:ZFIN;Acc:ZDB-GENE-060621-1])

HSP 1 Score: 60.077 bits (144), Expect = 4.557e-10
Identity = 42/106 (39.62%), Postives = 54/106 (50.94%), Query Frame = 3
Query:  144 EYELCKAASAGDFKSVRKLLSENVKIDSRDPEGYTSLHLAAKHGHYEIVKIXXXXXXXXXXXTADLVTPLHLASFHGHVGVMKLLALSKADLNATTKSGCKPIDFA 461
            E  L  AA AG    VR LL    K+D +  +  T+LH+A++ G  EIV++LL  G   +  T    TPLHLA   GH     LL    A L+A TK G  P+  A
Sbjct:  469 ETALHMAARAGQADVVRYLLQNGAKVDIKAKDDQTALHIASRLGKAEIVQLLLQKGAWASAATTSGYTPLHLAVREGHQETASLLLEHGASLSAATKKGFTPLHVA 574          

HSP 2 Score: 58.151 bits (139), Expect = 2.240e-9
Identity = 38/102 (37.25%), Postives = 55/102 (53.92%), Query Frame = 3
Query:  165 ASAGD-FKSVRKLLSENVKIDSRDPEGYTSLHLAAKHGHYEIVKIXXXXXXXXXXXTADLVTPLHLASFHGHVGVMKLLALSKADLNATTKSGCKPIDFAPY 467
            A+ GD    V+ LL  +V +D    +  T+LH+AA  GHY++ K+++    N N    +  TPLH+A     V VM+LL    A L A T+SG  PI  A +
Sbjct:  343 ATQGDHLNCVQLLLQHDVPVDDVTNDYLTALHVAAHCGHYKVAKVIVDKKANPNAKALNGFTPLHIACKKNRVKVMELLLKHGASLQAVTESGLTPIHVAAF 444          

HSP 3 Score: 55.8398 bits (133), Expect = 1.380e-8
Identity = 39/118 (33.05%), Postives = 62/118 (52.54%), Query Frame = 3
Query:  141 DEYELCKAASAGDFKSVRKLLSENVKIDSRDPEGYTSLHLAAKHGHYEIVKIXXXXXXXXXXXTADLVTPLHLASFHGHVGVMKLLALSKADLNATTKSGCKPIDFAP-YDSERWRIL 491
            D+  L  A+  G  + V+ LL +     +    GYT LHLA + GH E   +LL +G +++  T    TPLH+A+ +G +   KLL   +A  +   K+G  P+  A  YD++R  +L
Sbjct:  501 DQTALHIASRLGKAEIVQLLLQKGAWASAATTSGYTPLHLAVREGHQETASLLLEHGASLSAATKKGFTPLHVAAKYGQIEAAKLLLQKRAAPDTAGKTGLTPLHVAAHYDNQRVALL 618          

HSP 4 Score: 55.0694 bits (131), Expect = 2.654e-8
Identity = 39/115 (33.91%), Postives = 60/115 (52.17%), Query Frame = 3
Query:  117 REIKSVNFDEYELCKAASAGDFKSVRKLLSENVKIDSRDPEGYTSLHLAAKHGHYEIVKIXXXXXXXXXXXTADLVTPLHLASFHGHVGVMKLLALSKADLNATTKSGCKPIDFA 461
            RE K  +       +AA AG+ +     L   V I+  +  G  +LHLA+K GH E+V  LL  G +V+  T    T LH+AS  G   V++ L  + A++NA +++G  P+  A
Sbjct:   35 REQKKKSDSNASYLRAARAGNLEKALDYLKTGVDINICNQNGLNALHLASKEGHVEVVAELLKLGASVDAATKKGNTALHIASLAGQTDVVRELVTNGANVNAQSQNGFTPLYMA 149          

HSP 5 Score: 51.6026 bits (122), Expect = 3.562e-7
Identity = 33/97 (34.02%), Postives = 55/97 (56.70%), Query Frame = 3
Query:  162 AASAGDFKSVRKLLSENVKIDSRDPEGYTSLHLAAKHGHYEIVKIXXXXXXXXXXXTADLVTPLHLASFHGHVGVMKLLALSKADLNATTKSGCKPI 452
            AA  G    V  LL++N  ++  +  G T LHLAA+     + ++LL +G  V+  T    TPLH+A  +G++ ++  L  ++A +N+ TKSG  P+
Sbjct:  673 AAQEGSVDLVSLLLTKNANVNMGNKNGLTPLHLAAQEDRVGVAEVLLNHGAEVDAHTKTGYTPLHVACHYGNMKMVSFLLENQAKINSKTKSGYTPL 769          

HSP 6 Score: 51.2174 bits (121), Expect = 5.088e-7
Identity = 34/97 (35.05%), Postives = 53/97 (54.64%), Query Frame = 3
Query:  162 AASAGDFKSVRKLLSENVKIDSRDPEGYTSLHLAAKHGHYEIVKIXXXXXXXXXXXTADLVTPLHLASFHGHVGVMKLLALSKADLNATTKSGCKPI 452
            AA   D KS   LL  +   D     G+T LH+AA +G+  +  +LL  G  V+ +  + +TPLH+A+  G+  ++KLL    A ++A TK G  P+
Sbjct:  211 AARKDDTKSAALLLQNDHNADVESKSGFTPLHIAAHYGNINVATLLLNRGAAVDFMARNDITPLHVAAKRGNGNMVKLLLDRGAKIDAKTKDGLTPL 307          

HSP 7 Score: 48.9062 bits (115), Expect = 2.400e-6
Identity = 28/79 (35.44%), Postives = 47/79 (59.49%), Query Frame = 3
Query:  162 AASAGDFKSVRKLLSENVKIDSRDPEGYTSLHLAAKHGHYEIVKIXXXXXXXXXXXTADLVTPLHLASFHGHVGVMKLL 398
            AA  G+   V+ LL    KID++  +G T LH  A+ GH ++V++LL  G  +   T + ++PLH+A+   H+  ++LL
Sbjct:  277 AAKRGNGNMVKLLLDRGAKIDAKTKDGLTPLHCGARSGHEQVVEMLLDRGAPILSKTKNGLSPLHMATQGDHLNCVQLL 355          

HSP 8 Score: 48.521 bits (114), Expect = 3.616e-6
Identity = 34/100 (34.00%), Postives = 52/100 (52.00%), Query Frame = 3
Query:  162 AASAGDFKSVRKLLSENVKIDSRDPEGYTSLHLAAKHGHYEIVKIXXXXXXXXXXXTADLVTPLHLASFHGHVGVMKLLALSKADLNATTKSGCKPIDFA 461
            AA  G+      LL+    +D       T LH+AAK G+  +VK+LL  G  ++  T D +TPLH  +  GH  V+++L    A + + TK+G  P+  A
Sbjct:  244 AAHYGNINVATLLLNRGAAVDFMARNDITPLHVAAKRGNGNMVKLLLDRGAKIDAKTKDGLTPLHCGARSGHEQVVEMLLDRGAPILSKTKNGLSPLHMA 343          

HSP 9 Score: 48.1358 bits (113), Expect = 5.108e-6
Identity = 35/100 (35.00%), Postives = 53/100 (53.00%), Query Frame = 3
Query:  162 AASAGDFKSVRKLLSENVKIDSRDPEGYTSLHLAAKHGHYEIVKIXXXXXXXXXXXTADLVTPLHLASFHGHVGVMKLLALSKADLNATTKSGCKPIDFA 461
             A +G  + V  LL     I S+   G + LH+A +  H   V++LL + V V+ VT D +T LH+A+  GH  V K++   KA+ NA   +G  P+  A
Sbjct:  310 GARSGHEQVVEMLLDRGAPILSKTKNGLSPLHMATQGDHLNCVQLLLQHDVPVDDVTNDYLTALHVAAHCGHYKVAKVIVDKKANPNAKALNGFTPLHIA 409          
BLAST of SMED30015853 vs. Ensembl Cavefish
Match: ank3a (ankyrin 3a [Source:ZFIN;Acc:ZDB-GENE-060621-1])

HSP 1 Score: 60.077 bits (144), Expect = 5.272e-10
Identity = 42/106 (39.62%), Postives = 54/106 (50.94%), Query Frame = 3
Query:  144 EYELCKAASAGDFKSVRKLLSENVKIDSRDPEGYTSLHLAAKHGHYEIVKIXXXXXXXXXXXTADLVTPLHLASFHGHVGVMKLLALSKADLNATTKSGCKPIDFA 461
            E  L  AA AG    VR LL    K+D +  +  T+LH+A++ G  EIV++LL  G   +  T    TPLHLA   GH     LL    A L+A TK G  P+  A
Sbjct:  441 ETALHMAARAGQADVVRYLLQNGAKVDIKAKDDQTALHIASRLGKAEIVQLLLQKGAWASAATTSGYTPLHLAVREGHQETASLLLEHGASLSAATKKGFTPLHVA 546          

HSP 2 Score: 58.151 bits (139), Expect = 2.362e-9
Identity = 38/102 (37.25%), Postives = 55/102 (53.92%), Query Frame = 3
Query:  165 ASAGD-FKSVRKLLSENVKIDSRDPEGYTSLHLAAKHGHYEIVKIXXXXXXXXXXXTADLVTPLHLASFHGHVGVMKLLALSKADLNATTKSGCKPIDFAPY 467
            A+ GD    V+ LL  +V +D    +  T+LH+AA  GHY++ K+++    N N    +  TPLH+A     V VM+LL    A L A T+SG  PI  A +
Sbjct:  315 ATQGDHLNCVQLLLQHDVPVDDVTNDYLTALHVAAHCGHYKVAKVIVDKKANPNAKALNGFTPLHIACKKNRVKVMELLLKHGASLQAVTESGLTPIHVAAF 416          

HSP 3 Score: 55.8398 bits (133), Expect = 1.509e-8
Identity = 39/118 (33.05%), Postives = 62/118 (52.54%), Query Frame = 3
Query:  141 DEYELCKAASAGDFKSVRKLLSENVKIDSRDPEGYTSLHLAAKHGHYEIVKIXXXXXXXXXXXTADLVTPLHLASFHGHVGVMKLLALSKADLNATTKSGCKPIDFAP-YDSERWRIL 491
            D+  L  A+  G  + V+ LL +     +    GYT LHLA + GH E   +LL +G +++  T    TPLH+A+ +G +   KLL   +A  +   K+G  P+  A  YD++R  +L
Sbjct:  473 DQTALHIASRLGKAEIVQLLLQKGAWASAATTSGYTPLHLAVREGHQETASLLLEHGASLSAATKKGFTPLHVAAKYGQIEAAKLLLQKRAAPDTAGKTGLTPLHVAAHYDNQRVALL 590          

HSP 4 Score: 53.9138 bits (128), Expect = 5.422e-8
Identity = 36/101 (35.64%), Postives = 56/101 (55.45%), Query Frame = 3
Query:  159 KAASAGDFKSVRKLLSENVKIDSRDPEGYTSLHLAAKHGHYEIVKIXXXXXXXXXXXTADLVTPLHLASFHGHVGVMKLLALSKADLNATTKSGCKPIDFA 461
            +AA AG+ +     L   V I+  +  G  +LHLA+K GH E+V  LL  G +V+  T    T LH+AS  G   V++ L  + A++NA +++G  P+  A
Sbjct:   13 RAARAGNLEKALDYLKTGVDINICNQNGLNALHLASKEGHVEVVAELLKLGASVDAATKKGNTALHIASLAGQTDVVRELVTNGANVNAQSQNGFTPLYMA 113          

HSP 5 Score: 51.6026 bits (122), Expect = 3.786e-7
Identity = 33/97 (34.02%), Postives = 55/97 (56.70%), Query Frame = 3
Query:  162 AASAGDFKSVRKLLSENVKIDSRDPEGYTSLHLAAKHGHYEIVKIXXXXXXXXXXXTADLVTPLHLASFHGHVGVMKLLALSKADLNATTKSGCKPI 452
            AA  G    V  LL++N  ++  +  G T LHLAA+     + ++LL +G  V+  T    TPLH+A  +G++ ++  L  ++A +N+ TKSG  P+
Sbjct:  645 AAQEGSVDLVSLLLTKNANVNMGNKNGLTPLHLAAQEDRVGVAEVLLNHGAEVDAHTKTGYTPLHVACHYGNMKMVSFLLENQAKINSKTKSGYTPL 741          

HSP 6 Score: 48.9062 bits (115), Expect = 2.645e-6
Identity = 28/79 (35.44%), Postives = 47/79 (59.49%), Query Frame = 3
Query:  162 AASAGDFKSVRKLLSENVKIDSRDPEGYTSLHLAAKHGHYEIVKIXXXXXXXXXXXTADLVTPLHLASFHGHVGVMKLL 398
            AA  G+   V+ LL    KID++  +G T LH  A+ GH ++V++LL  G  +   T + ++PLH+A+   H+  ++LL
Sbjct:  249 AAKRGNGNMVKLLLDRGAKIDAKTKDGLTPLHCGARSGHEQVVEMLLDRGAPILSKTKNGLSPLHMATQGDHLNCVQLL 327          

HSP 7 Score: 48.521 bits (114), Expect = 4.020e-6
Identity = 34/100 (34.00%), Postives = 52/100 (52.00%), Query Frame = 3
Query:  162 AASAGDFKSVRKLLSENVKIDSRDPEGYTSLHLAAKHGHYEIVKIXXXXXXXXXXXTADLVTPLHLASFHGHVGVMKLLALSKADLNATTKSGCKPIDFA 461
            AA  G+      LL+    +D       T LH+AAK G+  +VK+LL  G  ++  T D +TPLH  +  GH  V+++L    A + + TK+G  P+  A
Sbjct:  216 AAHYGNINVATLLLNRGAAVDFMARNDITPLHVAAKRGNGNMVKLLLDRGAKIDAKTKDGLTPLHCGARSGHEQVVEMLLDRGAPILSKTKNGLSPLHMA 315          

HSP 8 Score: 47.7506 bits (112), Expect = 5.427e-6
Identity = 35/100 (35.00%), Postives = 53/100 (53.00%), Query Frame = 3
Query:  162 AASAGDFKSVRKLLSENVKIDSRDPEGYTSLHLAAKHGHYEIVKIXXXXXXXXXXXTADLVTPLHLASFHGHVGVMKLLALSKADLNATTKSGCKPIDFA 461
             A +G  + V  LL     I S+   G + LH+A +  H   V++LL + V V+ VT D +T LH+A+  GH  V K++   KA+ NA   +G  P+  A
Sbjct:  282 GARSGHEQVVEMLLDRGAPILSKTKNGLSPLHMATQGDHLNCVQLLLQHDVPVDDVTNDYLTALHVAAHCGHYKVAKVIVDKKANPNAKALNGFTPLHIA 381          
BLAST of SMED30015853 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000007449.1 (pep scaffold:Pmarinus_7.0:GL478728:201453:233342:1 gene:ENSPMAG00000006704.1 transcript:ENSPMAT00000007449.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 65.4698 bits (158), Expect = 1.594e-12
Identity = 41/106 (38.68%), Postives = 59/106 (55.66%), Query Frame = 3
Query:  144 EYELCKAASAGDFKSVRKLLSENVKIDSRDPEGYTSLHLAAKHGHYEIVKIXXXXXXXXXXXTADLVTPLHLASFHGHVGVMKLLALSKADLNATTKSGCKPIDFA 461
            E  L  AA AG  + VR LL    ++D++  E  T LH+AA+ G  EIV++LL +  + +  T++  TPLH+A+  GH  V  +L    A L  TTK G  P+  A
Sbjct:   82 ETALHMAARAGQTEVVRSLLRNGAQVDAKAREEQTPLHIAARLGKLEIVQLLLQHMASPDAATSNGYTPLHVAAREGHEDVTAILLEHGASLAVTTKKGFTPLHVA 187          

HSP 2 Score: 58.5362 bits (140), Expect = 3.020e-10
Identity = 41/111 (36.94%), Postives = 61/111 (54.95%), Query Frame = 3
Query:  162 AASAGDFKSVRKLLSENVKIDSRDPEGYTSLHLAAKHGHYEIVKIXXXXXXXXXXXTADLVTPLHLASFHGHVGVMKLLALSKADLNATTKSGCKPIDFAP-YDSERWRIL 491
            AA  G  + V+ LL      D+    GYT LH+AA+ GH ++  ILL +G ++ V T    TPLH+AS +G + V  LL    A  +A  K+G  P+  A  YD+++  +L
Sbjct:  121 AARLGKLEIVQLLLQHMASPDAATSNGYTPLHVAAREGHEDVTAILLEHGASLAVTTKKGFTPLHVASKYGKMEVASLLLQRFASPDAAGKNGLTPLHVASHYDNQKVALL 231          

HSP 3 Score: 55.0694 bits (131), Expect = 5.142e-9
Identity = 36/88 (40.91%), Postives = 43/88 (48.86%), Query Frame = 3
Query:  198 LLSENVKIDSRDPEGYTSLHLAAKHGHYEIVKIXXXXXXXXXXXTADLVTPLHLASFHGHVGVMKLLALSKADLNATTKSGCKPIDFA 461
            LL +     +    GYT LH+AAK    EI   LL  G   N +T   V PLHL +  GH  V  LL    AD+N  TKSG  P+  A
Sbjct:  232 LLDQGASPHATAKNGYTPLHIAAKKDQLEIATTLLEYGAETNAITRQGVAPLHLGAQEGHADVASLLLARYADVNHATKSGLSPLHLA 319          

HSP 4 Score: 47.7506 bits (112), Expect = 1.343e-6
Identity = 32/97 (32.99%), Postives = 49/97 (50.52%), Query Frame = 3
Query:  162 AASAGDFKSVRKLLSENVKIDSRDPEGYTSLHLAAKHGHYEIVKIXXXXXXXXXXXTADLVTPLHLASFHGHVGVMKLLALSKADLNATTKSGCKPI 452
            AA     +    LL    + ++   +G   LHL A+ GH ++  +LL    +VN  T   ++PLHLA+    V V ++L    A +NATTK G  P+
Sbjct:  253 AAKKDQLEIATTLLEYGAETNAITRQGVAPLHLGAQEGHADVASLLLARYADVNHATKSGLSPLHLAAQEDKVNVAEILVKHGAHVNATTKLGYTPL 349          

HSP 5 Score: 45.0542 bits (105), Expect = 9.532e-6
Identity = 33/100 (33.00%), Postives = 54/100 (54.00%), Query Frame = 3
Query:  162 AASAGDFKSVRKLLSENVKIDSRDPEGYTSLHLAAKHGHYEIVKIXXXXXXXXXXXTADLVTPLHLASFHGHVGVMKLLALSKADLNATTKSGCKPIDFA 461
            +A  G+   V  LL      ++ +  G T+LH+AA+ G  E+V+ LL NG  V+    +  TPLH+A+  G + +++LL    A  +A T +G  P+  A
Sbjct:   55 SAFMGNLNIVLILLQGGASPNATNVRGETALHMAARAGQTEVVRSLLRNGAQVDAKAREEQTPLHIAARLGKLEIVQLLLQHMASPDAATSNGYTPLHVA 154          
BLAST of SMED30015853 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000007446.1 (pep scaffold:Pmarinus_7.0:GL478728:200023:240674:1 gene:ENSPMAG00000006704.1 transcript:ENSPMAT00000007446.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 64.6994 bits (156), Expect = 2.474e-12
Identity = 41/106 (38.68%), Postives = 59/106 (55.66%), Query Frame = 3
Query:  144 EYELCKAASAGDFKSVRKLLSENVKIDSRDPEGYTSLHLAAKHGHYEIVKIXXXXXXXXXXXTADLVTPLHLASFHGHVGVMKLLALSKADLNATTKSGCKPIDFA 461
            E  L  AA AG  + VR LL    ++D++  E  T LH+AA+ G  EIV++LL +  + +  T++  TPLH+A+  GH  V  +L    A L  TTK G  P+  A
Sbjct:  172 ETALHMAARAGQTEVVRSLLRNGAQVDAKAREEQTPLHIAARLGKLEIVQLLLQHMASPDAATSNGYTPLHVAAREGHEDVTAILLEHGASLAVTTKKGFTPLHVA 277          

HSP 2 Score: 58.151 bits (139), Expect = 4.705e-10
Identity = 41/111 (36.94%), Postives = 61/111 (54.95%), Query Frame = 3
Query:  162 AASAGDFKSVRKLLSENVKIDSRDPEGYTSLHLAAKHGHYEIVKIXXXXXXXXXXXTADLVTPLHLASFHGHVGVMKLLALSKADLNATTKSGCKPIDFAP-YDSERWRIL 491
            AA  G  + V+ LL      D+    GYT LH+AA+ GH ++  ILL +G ++ V T    TPLH+AS +G + V  LL    A  +A  K+G  P+  A  YD+++  +L
Sbjct:  211 AARLGKLEIVQLLLQHMASPDAATSNGYTPLHVAAREGHEDVTAILLEHGASLAVTTKKGFTPLHVASKYGKMEVASLLLQRFASPDAAGKNGLTPLHVASHYDNQKVALL 321          

HSP 3 Score: 54.299 bits (129), Expect = 7.418e-9
Identity = 36/88 (40.91%), Postives = 43/88 (48.86%), Query Frame = 3
Query:  198 LLSENVKIDSRDPEGYTSLHLAAKHGHYEIVKIXXXXXXXXXXXTADLVTPLHLASFHGHVGVMKLLALSKADLNATTKSGCKPIDFA 461
            LL +     +    GYT LH+AAK    EI   LL  G   N +T   V PLHL +  GH  V  LL    AD+N  TKSG  P+  A
Sbjct:  322 LLDQGASPHATAKNGYTPLHIAAKKDQLEIATTLLEYGAETNAITRQGVAPLHLGAQEGHADVASLLLARYADVNHATKSGLSPLHLA 409          

HSP 4 Score: 47.3654 bits (111), Expect = 1.505e-6
Identity = 36/102 (35.29%), Postives = 54/102 (52.94%), Query Frame = 3
Query:  165 ASAGD-FKSVRKLLSENVKIDSRDPEGYTSLHLAAKHGHYEIVKIXXXXXXXXXXXTADLVTPLHLASFHGHVGVMKLLALSKADLNATTKSGCKPIDFAPY 467
            A+ GD  + V+ L+     +D    +  T+LH+AA  GHY   K+LL  G N NV   +  TPLH+A     + VM+LL    A + A T+SG  P+  + +
Sbjct:   46 ATQGDHVECVQVLMQYRAPVDDITLDYLTALHVAAHCGHYRTAKVLLDKGANPNVRALNGFTPLHIACKKNRIRVMELLLKYGASIEAVTESGLTPMHVSAF 147          

HSP 5 Score: 47.3654 bits (111), Expect = 1.789e-6
Identity = 32/97 (32.99%), Postives = 49/97 (50.52%), Query Frame = 3
Query:  162 AASAGDFKSVRKLLSENVKIDSRDPEGYTSLHLAAKHGHYEIVKIXXXXXXXXXXXTADLVTPLHLASFHGHVGVMKLLALSKADLNATTKSGCKPI 452
            AA     +    LL    + ++   +G   LHL A+ GH ++  +LL    +VN  T   ++PLHLA+    V V ++L    A +NATTK G  P+
Sbjct:  343 AAKKDQLEIATTLLEYGAETNAITRQGVAPLHLGAQEGHADVASLLLARYADVNHATKSGLSPLHLAAQEDKVNVAEILVKHGAHVNATTKLGYTPL 439          

HSP 6 Score: 46.9802 bits (110), Expect = 2.436e-6
Identity = 28/93 (30.11%), Postives = 52/93 (55.91%), Query Frame = 3
Query:  162 AASAGDFKSVRKLLSENVKIDSRDPEGYTSLHLAAKHGHYEIVKIXXXXXXXXXXXTADLVTPLHLASFHGHVGVMKLLALSKADLNATTKSG 440
            AA  G +++ + LL +    + R   G+T LH+A K     ++++LL  G ++  VT   +TP+H+++F G++ ++ +L    A  NAT   G
Sbjct:   79 AAHCGHYRTAKVLLDKGANPNVRALNGFTPLHIACKKNRIRVMELLLKYGASIEAVTESGLTPMHVSAFMGNLNIVLILLQGGASPNATNVRG 171          

HSP 7 Score: 46.2098 bits (108), Expect = 3.630e-6
Identity = 31/100 (31.00%), Postives = 51/100 (51.00%), Query Frame = 3
Query:  162 AASAGDFKSVRKLLSENVKIDSRDPEGYTSLHLAAKHGHYEIVKIXXXXXXXXXXXTADLVTPLHLASFHGHVGVMKLLALSKADLNATTKSGCKPIDFA 461
            AA +G  + V  LL +   I ++   G + LH+A +  H E V++L+     V+ +T D +T LH+A+  GH    K+L    A+ N    +G  P+  A
Sbjct:   13 AARSGHEQVVEILLEQGAPILAKTKNGLSPLHMATQGDHVECVQVLMQYRAPVDDITLDYLTALHVAAHCGHYRTAKVLLDKGANPNVRALNGFTPLHIA 112          
BLAST of SMED30015853 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000000376.1 (pep scaffold:Pmarinus_7.0:GL476650:183420:196917:-1 gene:ENSPMAG00000000338.1 transcript:ENSPMAT00000000376.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 57.7658 bits (138), Expect = 4.478e-10
Identity = 41/106 (38.68%), Postives = 60/106 (56.60%), Query Frame = 3
Query:  144 EYELCKAASAGDFKSVRKLLSENVKIDSRDPEGYTSLHLAAKHGHYEIVKIXXXXXXXXXXXTADLVTPLHLASFHGHVGVMKLLALSKADLNATTKSGCKPIDFA 461
            E  L  AA  G+ + +R+L+S    ++ +D  G+T LH A  HG+Y + K LLL G +VN    D  TPLH A+ +G++GV++LL    AD       G  P+D A
Sbjct:  181 ETSLHMAAIRGEVRQLRELISRGADVNVKDFAGWTPLHEACNHGYYAVAKQLLLAGADVNTRGLDDDTPLHDAASNGYLGVVRLLMRYNADPYQKNAKGECPVDVA 286          
BLAST of SMED30015853 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000000095.1 (pep scaffold:Pmarinus_7.0:GL477582:20897:60453:1 gene:ENSPMAG00000000080.1 transcript:ENSPMAT00000000095.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 57.3806 bits (137), Expect = 7.298e-10
Identity = 40/106 (37.74%), Postives = 57/106 (53.77%), Query Frame = 3
Query:  144 EYELCKAASAGDFKSVRKLLSENVKIDSRDPEGYTSLHLAAKHGHYEIVKIXXXXXXXXXXXTADLVTPLHLASFHGHVGVMKLLALSKADLNATTKSGCKPIDFA 461
            E  L  A+ AG  + V+ LL    ++  +  E  T LH+A++ G  EIV++LL  G + N  TA   TPL+ AS  GH  V  LL  + AD++  TK G  P+  A
Sbjct:  437 ETPLHMASRAGQLEVVKTLLQSGARVGVKAREDQTPLHIASRLGKAEIVQLLLQRGSDPNAPTASGSTPLYFASREGHGDVASLLLENGADISPVTKKGFTPLHIA 542          

HSP 2 Score: 56.6102 bits (135), Expect = 1.501e-9
Identity = 34/100 (34.00%), Postives = 59/100 (59.00%), Query Frame = 3
Query:  162 AASAGDFKSVRKLLSENVKIDSRDPEGYTSLHLAAKHGHYEIVKIXXXXXXXXXXXTADLVTPLHLASFHGHVGVMKLLALSKADLNATTKSGCKPIDFA 461
            AA  G ++  + LL    + ++R   G+T LH+A K    +++++LL +G +++  T   +TP+H+ASF GH+ V++LL  + A  NAT   G  P+  A
Sbjct:  344 AAHCGHYRVAKLLLDRGGEPNARALNGFTPLHIACKKNRIKVMELLLKHGASIHTTTESGLTPIHVASFMGHLNVVQLLLQNGASSNATNVRGETPLHMA 443          

HSP 3 Score: 53.9138 bits (128), Expect = 1.161e-8
Identity = 37/100 (37.00%), Postives = 54/100 (54.00%), Query Frame = 3
Query:  162 AASAGDFKSVRKLLSENVKIDSRDPEGYTSLHLAAKHGHYEIVKIXXXXXXXXXXXTADLVTPLHLASFHGHVGVMKLLALSKADLNATTKSGCKPIDFA 461
            AA  G+      LL+    +D     G T LH+AAK G+  +VK+LL  G  ++  T D +TPLH A+  GH  V+++L    A + A TK+G  P+  A
Sbjct:  212 AAHYGNMNVATLLLNLGAAVDFTARNGITPLHVAAKRGNNNMVKLLLDRGAKIDTKTRDGLTPLHCAARSGHEKVIEMLLERDAPILAKTKNGLSPLHMA 311          

HSP 4 Score: 51.9878 bits (123), Expect = 4.240e-8
Identity = 31/102 (30.39%), Postives = 56/102 (54.90%), Query Frame = 3
Query:  162 AASAGDFKSVRKLLSENVKIDSRDPEGYTSLHLAAKHGHYEIVKIXXXXXXXXXXXTADLVTPLHLASFHGHVGVMKLLALSKADLNATTKSGCKPIDFAPY 467
            AA  G+   V+ LL    KID++  +G T LH AA+ GH +++++LL     +   T + ++PLH+A+   H+  ++LL   +A ++  T     P+  A +
Sbjct:  245 AAKRGNNNMVKLLLDRGAKIDTKTRDGLTPLHCAARSGHEKVIEMLLERDAPILAKTKNGLSPLHMATQGEHLACVQLLLGRQAPVDDVTLDYLTPLHVAAH 346          

HSP 5 Score: 51.9878 bits (123), Expect = 4.319e-8
Identity = 37/100 (37.00%), Postives = 54/100 (54.00%), Query Frame = 3
Query:  162 AASAGDFKSVRKLLSENVKIDSRDPEGYTSLHLAAKHGHYEIVKIXXXXXXXXXXXTADLVTPLHLASFHGHVGVMKLLALSKADLNATTKSGCKPIDFA 461
            A+  G    V+ LL      ++ +  G T LH+A++ G  E+VK LL +G  V V   +  TPLH+AS  G   +++LL    +D NA T SG  P+ FA
Sbjct:  410 ASFMGHLNVVQLLLQNGASSNATNVRGETPLHMASRAGQLEVVKTLLQSGARVGVKAREDQTPLHIASRLGKAEIVQLLLQRGSDPNAPTASGSTPLYFA 509          

HSP 6 Score: 50.447 bits (119), Expect = 1.645e-7
Identity = 34/93 (36.56%), Postives = 48/93 (51.61%), Query Frame = 3
Query:  189 VRKLLSENVKIDSRDPEGYTSLHLAAKHGHYEIVKIXXXXXXXXXXXTADLVTPLHLASFHGHVGVMKLLALSKADLNATTKSGCKPIDFAPY 467
            V+ LL     +D    +  T LH+AA  GHY + K+LL  G   N    +  TPLH+A     + VM+LL    A ++ TT+SG  PI  A +
Sbjct:  320 VQLLLGRQAPVDDVTLDYLTPLHVAAHCGHYRVAKLLLDRGGEPNARALNGFTPLHIACKKNRIKVMELLLKHGASIHTTTESGLTPIHVASF 412          

HSP 7 Score: 49.6766 bits (117), Expect = 2.646e-7
Identity = 35/100 (35.00%), Postives = 52/100 (52.00%), Query Frame = 3
Query:  162 AASAGDFKSVRKLLSENVKIDSRDPEGYTSLHLAAKHGHYEIVKIXXXXXXXXXXXTADLVTPLHLASFHGHVGVMKLLALSKADLNATTKSGCKPIDFA 461
            AA +G  K +  LL  +  I ++   G + LH+A +  H   V++LL     V+ VT D +TPLH+A+  GH  V KLL     + NA   +G  P+  A
Sbjct:  278 AARSGHEKVIEMLLERDAPILAKTKNGLSPLHMATQGEHLACVQLLLGRQAPVDDVTLDYLTPLHVAAHCGHYRVAKLLLDRGGEPNARALNGFTPLHIA 377          

HSP 8 Score: 49.2914 bits (116), Expect = 3.643e-7
Identity = 40/128 (31.25%), Postives = 68/128 (53.12%), Query Frame = 3
Query:   81 NDENLIDESKIIREIKSVNFDEYE-LCKAASAGDFKSVRKLLSENVKIDSRDPEGYTSLHLAAKHGHYEIVKIXXXXXXXXXXXTADLVTPLHLASFHGHVGVMKLLALSKADLNATTKSGCKPIDFA 461
            N E L+D  K   +I + N +    L  A+  G    V +LL    +ID+    G T+LH+AA  G  +IV++L+  G N+N  + +  TPL++A+   H+ ++K L  + A+ +  T+ G  P+  A
Sbjct:   23 NLERLMDHLKGGMDINTCNQNGLNALHLASKEGHVDVVTELLKREAEIDTATKVGNTALHIAALAGQTDIVRVLVEFGANINAQSQNGFTPLYMAAQENHLEIVKFLLDNGANQSVATEDGFTPLAVA 150          

HSP 9 Score: 48.521 bits (114), Expect = 6.836e-7
Identity = 32/97 (32.99%), Postives = 52/97 (53.61%), Query Frame = 3
Query:  162 AASAGDFKSVRKLLSENVKIDSRDPEGYTSLHLAAKHGHYEIVKIXXXXXXXXXXXTADLVTPLHLASFHGHVGVMKLLALSKADLNATTKSGCKPI 452
            AA  G    V  LL  +  I      G T++HLAA+     + +IL  +  +VN  T    TPLH+AS +G++ ++  L  ++A +NA T++G  P+
Sbjct:  643 AAQEGHADMVALLLGRHASISLATKGGLTAMHLAAQEDKVNVAEILTKHKADVNTTTKLCYTPLHVASHYGNIKMVNFLLRNRALVNAKTRNGYTPL 739          

HSP 10 Score: 47.3654 bits (111), Expect = 1.538e-6
Identity = 29/101 (28.71%), Postives = 55/101 (54.46%), Query Frame = 3
Query:  159 KAASAGDFKSVRKLLSENVKIDSRDPEGYTSLHLAAKHGHYEIVKIXXXXXXXXXXXTADLVTPLHLASFHGHVGVMKLLALSKADLNATTKSGCKPIDFA 461
            +AA  G+ + +   L   + I++ +  G  +LHLA+K GH ++V  LL     ++  T    T LH+A+  G   ++++L    A++NA +++G  P+  A
Sbjct:   17 RAARNGNLERLMDHLKGGMDINTCNQNGLNALHLASKEGHVDVVTELLKREAEIDTATKVGNTALHIAALAGQTDIVRVLVEFGANINAQSQNGFTPLYMA 117          

HSP 11 Score: 47.3654 bits (111), Expect = 1.566e-6
Identity = 33/88 (37.50%), Postives = 45/88 (51.14%), Query Frame = 3
Query:  198 LLSENVKIDSRDPEGYTSLHLAAKHGHYEIVKIXXXXXXXXXXXTADLVTPLHLASFHGHVGVMKLLALSKADLNATTKSGCKPIDFA 461
            LL +     S    GYT LH+AAK    E+ K+LL  G   N++T   V PLHLA+  GH  ++ LL    A ++  TK G   +  A
Sbjct:  589 LLDKGASPHSTAKNGYTPLHIAAKKNQLEVGKVLLELGAETNMLTQQGVAPLHLAAQEGHADMVALLLGRHASISLATKGGLTAMHLA 676          

HSP 12 Score: 46.595 bits (109), Expect = 2.827e-6
Identity = 32/102 (31.37%), Postives = 53/102 (51.96%), Query Frame = 3
Query:  162 AASAGDFKSVRKLLSENVKIDSRDPEGYTSLHLAAKHGHYEIVKIXXXXXXXXXXXTADLVTPLHLASFHGHVGVMKLLALSKADLNATTKSGCKPIDFAPY 467
            AA     +  + LL    + +    +G   LHLAA+ GH ++V +LL    ++++ T   +T +HLA+    V V ++L   KAD+N TTK    P+  A +
Sbjct:  610 AAKKNQLEVGKVLLELGAETNMLTQQGVAPLHLAAQEGHADMVALLLGRHASISLATKGGLTAMHLAAQEDKVNVAEILTKHKADVNTTTKLCYTPLHVASH 711          

HSP 13 Score: 46.2098 bits (108), Expect = 3.679e-6
Identity = 35/79 (44.30%), Postives = 46/79 (58.23%), Query Frame = 3
Query:  162 AASAGDFKSVRKLLSENVKIDSRDPEGYTSLHLAAKHGHYEIVKIXXXXXXXXXXXTADLVTPLHLASFHGHVGVMKLL 398
            AA AG    VR L+     I+++   G+T L++AA+  H EIVK LL NG N +V T D  TPL +A   GH  V+ LL
Sbjct:   84 AALAGQTDIVRVLVEFGANINAQSQNGFTPLYMAAQENHLEIVKFLLDNGANQSVATEDGFTPLAVALQQGHEQVVGLL 162          
BLAST of SMED30015853 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000000093.1 (pep scaffold:Pmarinus_7.0:GL477582:20502:66045:1 gene:ENSPMAG00000000080.1 transcript:ENSPMAT00000000093.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 57.3806 bits (137), Expect = 8.579e-10
Identity = 40/106 (37.74%), Postives = 57/106 (53.77%), Query Frame = 3
Query:  144 EYELCKAASAGDFKSVRKLLSENVKIDSRDPEGYTSLHLAAKHGHYEIVKIXXXXXXXXXXXTADLVTPLHLASFHGHVGVMKLLALSKADLNATTKSGCKPIDFA 461
            E  L  A+ AG  + V+ LL    ++  +  E  T LH+A++ G  EIV++LL  G + N  TA   TPL+ AS  GH  V  LL  + AD++  TK G  P+  A
Sbjct:  444 ETPLHMASRAGQLEVVKTLLQSGARVGVKAREDQTPLHIASRLGKAEIVQLLLQRGSDPNAPTASGSTPLYFASREGHGDVASLLLENGADISPVTKKGFTPLHIA 549          

HSP 2 Score: 56.225 bits (134), Expect = 1.796e-9
Identity = 34/100 (34.00%), Postives = 59/100 (59.00%), Query Frame = 3
Query:  162 AASAGDFKSVRKLLSENVKIDSRDPEGYTSLHLAAKHGHYEIVKIXXXXXXXXXXXTADLVTPLHLASFHGHVGVMKLLALSKADLNATTKSGCKPIDFA 461
            AA  G ++  + LL    + ++R   G+T LH+A K    +++++LL +G +++  T   +TP+H+ASF GH+ V++LL  + A  NAT   G  P+  A
Sbjct:  351 AAHCGHYRVAKLLLDRGGEPNARALNGFTPLHIACKKNRIKVMELLLKHGASIHTTTESGLTPIHVASFMGHLNVVQLLLQNGASSNATNVRGETPLHMA 450          

HSP 3 Score: 53.5286 bits (127), Expect = 1.351e-8
Identity = 37/100 (37.00%), Postives = 54/100 (54.00%), Query Frame = 3
Query:  162 AASAGDFKSVRKLLSENVKIDSRDPEGYTSLHLAAKHGHYEIVKIXXXXXXXXXXXTADLVTPLHLASFHGHVGVMKLLALSKADLNATTKSGCKPIDFA 461
            AA  G+      LL+    +D     G T LH+AAK G+  +VK+LL  G  ++  T D +TPLH A+  GH  V+++L    A + A TK+G  P+  A
Sbjct:  219 AAHYGNMNVATLLLNLGAAVDFTARNGITPLHVAAKRGNNNMVKLLLDRGAKIDTKTRDGLTPLHCAARSGHEKVIEMLLERDAPILAKTKNGLSPLHMA 318          

HSP 4 Score: 51.9878 bits (123), Expect = 4.975e-8
Identity = 31/102 (30.39%), Postives = 56/102 (54.90%), Query Frame = 3
Query:  162 AASAGDFKSVRKLLSENVKIDSRDPEGYTSLHLAAKHGHYEIVKIXXXXXXXXXXXTADLVTPLHLASFHGHVGVMKLLALSKADLNATTKSGCKPIDFAPY 467
            AA  G+   V+ LL    KID++  +G T LH AA+ GH +++++LL     +   T + ++PLH+A+   H+  ++LL   +A ++  T     P+  A +
Sbjct:  252 AAKRGNNNMVKLLLDRGAKIDTKTRDGLTPLHCAARSGHEKVIEMLLERDAPILAKTKNGLSPLHMATQGEHLACVQLLLGRQAPVDDVTLDYLTPLHVAAH 353          

HSP 5 Score: 51.9878 bits (123), Expect = 5.114e-8
Identity = 37/100 (37.00%), Postives = 54/100 (54.00%), Query Frame = 3
Query:  162 AASAGDFKSVRKLLSENVKIDSRDPEGYTSLHLAAKHGHYEIVKIXXXXXXXXXXXTADLVTPLHLASFHGHVGVMKLLALSKADLNATTKSGCKPIDFA 461
            A+  G    V+ LL      ++ +  G T LH+A++ G  E+VK LL +G  V V   +  TPLH+AS  G   +++LL    +D NA T SG  P+ FA
Sbjct:  417 ASFMGHLNVVQLLLQNGASSNATNVRGETPLHMASRAGQLEVVKTLLQSGARVGVKAREDQTPLHIASRLGKAEIVQLLLQRGSDPNAPTASGSTPLYFA 516          

HSP 6 Score: 50.0618 bits (118), Expect = 1.964e-7
Identity = 34/93 (36.56%), Postives = 48/93 (51.61%), Query Frame = 3
Query:  189 VRKLLSENVKIDSRDPEGYTSLHLAAKHGHYEIVKIXXXXXXXXXXXTADLVTPLHLASFHGHVGVMKLLALSKADLNATTKSGCKPIDFAPY 467
            V+ LL     +D    +  T LH+AA  GHY + K+LL  G   N    +  TPLH+A     + VM+LL    A ++ TT+SG  PI  A +
Sbjct:  327 VQLLLGRQAPVDDVTLDYLTPLHVAAHCGHYRVAKLLLDRGGEPNARALNGFTPLHIACKKNRIKVMELLLKHGASIHTTTESGLTPIHVASF 419          

HSP 7 Score: 49.6766 bits (117), Expect = 3.101e-7
Identity = 35/100 (35.00%), Postives = 52/100 (52.00%), Query Frame = 3
Query:  162 AASAGDFKSVRKLLSENVKIDSRDPEGYTSLHLAAKHGHYEIVKIXXXXXXXXXXXTADLVTPLHLASFHGHVGVMKLLALSKADLNATTKSGCKPIDFA 461
            AA +G  K +  LL  +  I ++   G + LH+A +  H   V++LL     V+ VT D +TPLH+A+  GH  V KLL     + NA   +G  P+  A
Sbjct:  285 AARSGHEKVIEMLLERDAPILAKTKNGLSPLHMATQGEHLACVQLLLGRQAPVDDVTLDYLTPLHVAAHCGHYRVAKLLLDRGGEPNARALNGFTPLHIA 384          

HSP 8 Score: 48.9062 bits (115), Expect = 4.269e-7
Identity = 40/128 (31.25%), Postives = 68/128 (53.12%), Query Frame = 3
Query:   81 NDENLIDESKIIREIKSVNFDEYE-LCKAASAGDFKSVRKLLSENVKIDSRDPEGYTSLHLAAKHGHYEIVKIXXXXXXXXXXXTADLVTPLHLASFHGHVGVMKLLALSKADLNATTKSGCKPIDFA 461
            N E L+D  K   +I + N +    L  A+  G    V +LL    +ID+    G T+LH+AA  G  +IV++L+  G N+N  + +  TPL++A+   H+ ++K L  + A+ +  T+ G  P+  A
Sbjct:   22 NLERLMDHLKGGMDINTCNQNGLNALHLASKEGHVDVVTELLKREAEIDTATKVGNTALHIAALAGQTDIVRVLVEFGANINAQSQNGFTPLYMAAQENHLEIVKFLLDNGANQSVATEDGFTPLAVA 149          

HSP 9 Score: 48.1358 bits (113), Expect = 7.863e-7
Identity = 32/97 (32.99%), Postives = 52/97 (53.61%), Query Frame = 3
Query:  162 AASAGDFKSVRKLLSENVKIDSRDPEGYTSLHLAAKHGHYEIVKIXXXXXXXXXXXTADLVTPLHLASFHGHVGVMKLLALSKADLNATTKSGCKPI 452
            AA  G    V  LL  +  I      G T++HLAA+     + +IL  +  +VN  T    TPLH+AS +G++ ++  L  ++A +NA T++G  P+
Sbjct:  648 AAQEGHADMVALLLGRHASISLATKGGLTAMHLAAQEDKVNVAEILTKHKADVNTTTKLCYTPLHVASHYGNIKMVNFLLRNRALVNAKTRNGYTPL 744          

HSP 10 Score: 47.3654 bits (111), Expect = 1.674e-6
Identity = 29/101 (28.71%), Postives = 55/101 (54.46%), Query Frame = 3
Query:  159 KAASAGDFKSVRKLLSENVKIDSRDPEGYTSLHLAAKHGHYEIVKIXXXXXXXXXXXTADLVTPLHLASFHGHVGVMKLLALSKADLNATTKSGCKPIDFA 461
            +AA  G+ + +   L   + I++ +  G  +LHLA+K GH ++V  LL     ++  T    T LH+A+  G   ++++L    A++NA +++G  P+  A
Sbjct:   16 RAARNGNLERLMDHLKGGMDINTCNQNGLNALHLASKEGHVDVVTELLKREAEIDTATKVGNTALHIAALAGQTDIVRVLVEFGANINAQSQNGFTPLYMA 116          

HSP 11 Score: 46.9802 bits (110), Expect = 1.850e-6
Identity = 33/88 (37.50%), Postives = 45/88 (51.14%), Query Frame = 3
Query:  198 LLSENVKIDSRDPEGYTSLHLAAKHGHYEIVKIXXXXXXXXXXXTADLVTPLHLASFHGHVGVMKLLALSKADLNATTKSGCKPIDFA 461
            LL +     S    GYT LH+AAK    E+ K+LL  G   N++T   V PLHLA+  GH  ++ LL    A ++  TK G   +  A
Sbjct:  594 LLDKGASPHSTAKNGYTPLHIAAKKNQLEVGKVLLELGAETNMLTQQGVAPLHLAAQEGHADMVALLLGRHASISLATKGGLTAMHLA 681          

HSP 12 Score: 46.2098 bits (108), Expect = 3.249e-6
Identity = 32/102 (31.37%), Postives = 53/102 (51.96%), Query Frame = 3
Query:  162 AASAGDFKSVRKLLSENVKIDSRDPEGYTSLHLAAKHGHYEIVKIXXXXXXXXXXXTADLVTPLHLASFHGHVGVMKLLALSKADLNATTKSGCKPIDFAPY 467
            AA     +  + LL    + +    +G   LHLAA+ GH ++V +LL    ++++ T   +T +HLA+    V V ++L   KAD+N TTK    P+  A +
Sbjct:  615 AAKKNQLEVGKVLLELGAETNMLTQQGVAPLHLAAQEGHADMVALLLGRHASISLATKGGLTAMHLAAQEDKVNVAEILTKHKADVNTTTKLCYTPLHVASH 716          

HSP 13 Score: 45.8246 bits (107), Expect = 4.305e-6
Identity = 35/79 (44.30%), Postives = 46/79 (58.23%), Query Frame = 3
Query:  162 AASAGDFKSVRKLLSENVKIDSRDPEGYTSLHLAAKHGHYEIVKIXXXXXXXXXXXTADLVTPLHLASFHGHVGVMKLL 398
            AA AG    VR L+     I+++   G+T L++AA+  H EIVK LL NG N +V T D  TPL +A   GH  V+ LL
Sbjct:   83 AALAGQTDIVRVLVEFGANINAQSQNGFTPLYMAAQENHLEIVKFLLDNGANQSVATEDGFTPLAVALQQGHEQVVGLL 161          

HSP 14 Score: 45.8246 bits (107), Expect = 4.505e-6
Identity = 31/96 (32.29%), Postives = 50/96 (52.08%), Query Frame = 3
Query:  174 GDFKSVRKLLSENVKIDSRDPEGYTSLHLAAKHGHYEIVKIXXXXXXXXXXXTADLVTPLHLASFHGHVGVMKLLALSKADLNATTKSGCKPIDFA 461
            GD  S+  LL     I     +G+T LH+A+K+G  E+  +LL    + +    + +TPLH+A+ + H  V  LL    A  ++T K+G  P+  A
Sbjct:  522 GDVASL--LLENGADISPVTKKGFTPLHIASKYGRLEVATLLLEKYASADPKGKNGLTPLHVATHYDHQKVALLLLDKGASPHSTAKNGYTPLHIA 615          
BLAST of SMED30015853 vs. Ensembl Nematostella
Match: EDO49485 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RG84])

HSP 1 Score: 56.225 bits (134), Expect = 1.059e-9
Identity = 37/108 (34.26%), Postives = 54/108 (50.00%), Query Frame = 3
Query:  162 AASAGDFKSVRKLLSENVKIDSRDPEGYTSLHLAAKHGH---YEIVKIXXXXXXXXXXXTADLVTPLHLASFHGHVGVMKLLALSKADLNATTKSGCKPIDFAPYDSE 476
            AAS  D K V  LL        RD +GY+++H A+ +GH    E++  +  N +      +  VTPLHLA+FHGH   +++L  S  DL      G  P+D A +   
Sbjct:  107 AASDLDAKCVEHLLRNRGNASKRDKQGYSAVHYASANGHKLAIEMLLDVSANDLLNRSSGSPCVTPLHLAAFHGHKPALEVLIKSFNDLEVRDDRGRTPLDLASFQGH 214          
BLAST of SMED30015853 vs. Ensembl Nematostella
Match: EDO43381 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RYU3])

HSP 1 Score: 55.0694 bits (131), Expect = 8.389e-9
Identity = 37/100 (37.00%), Postives = 51/100 (51.00%), Query Frame = 3
Query:  162 AASAGDFKSVRKLLSENVKIDSRDPEGYTSLHLAAKHGHYEIVKIXXXXXXXXXXXTADLVTPLHLASFHGHVGVMKLLALSKADLNATTKSGCKPIDFA 461
            A+S G    V+ L    V +    P GYT++HLAA  GH   + IL   G  VN  T D  TPLHLA+  GH+  +K L  +++   A   +G   +D A
Sbjct:  942 ASSNGHLDCVKWLAVSGVDLGQETPTGYTAIHLAAMGGHVNCMMILSAMGSVVNCKTVDDQTPLHLAAMSGHLECVKWLLANRSRTEAEDSNGRTALDIA 1041          
BLAST of SMED30015853 vs. Ensembl Nematostella
Match: EDO43690 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RXV8])

HSP 1 Score: 51.9878 bits (123), Expect = 4.482e-8
Identity = 34/100 (34.00%), Postives = 58/100 (58.00%), Query Frame = 3
Query:  162 AASAGDFKSVRKLLSENVKIDSRDPEGYTSLHLAAKHGHYEIVKIXXXXXXXXXXXTADLVTPLHLASFHGHVGVMKLLALSKADLNATTKSGCKPIDFA 461
            A S+GD   V+KLL++   I+ ++ +G T+LH A    ++++VK+L+  G +++V   +  T LH A+  G V + K L  + AD+ A    G  P+D A
Sbjct:   56 AVSSGDVDEVKKLLAKGADINYQNVDGLTALHQACIDENFDLVKVLVDKGASMDVRDNEGWTSLHAAASCGSVEIAKYLIENGADVAAVNNEGELPLDLA 155          
BLAST of SMED30015853 vs. Ensembl Nematostella
Match: EDO47171 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RMV9])

HSP 1 Score: 50.0618 bits (118), Expect = 1.403e-7
Identity = 35/101 (34.65%), Postives = 53/101 (52.48%), Query Frame = 3
Query:  165 ASAGDFKSVRKLLSE---------NVKIDSRDPEGYTSLHLAAKHGHYEIVKIXXXXXXXXXXXTADLVTPLHLASFHGHVGVMKLLALSKADLNATTKSG 440
            A+ GD  S+R+L  +         + +++ R+P+G +++ LAA  G  E+V+ LL  G  VN  T    T LH+A+  G VG +K L  S ADL      G
Sbjct:    9 ATEGDIDSIRQLFEDPESPYVTDASTELNKRNPDGKSAIDLAAMLGRNEVVRELLERGAEVNSKTKKGYTCLHIAACWGQVGCLKALVASGADLQIRNAHG 109          
BLAST of SMED30015853 vs. Ensembl Nematostella
Match: EDO38702 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SC57])

HSP 1 Score: 50.8322 bits (120), Expect = 1.639e-7
Identity = 39/106 (36.79%), Postives = 53/106 (50.00%), Query Frame = 3
Query:  162 AASAGDFKSVRKLLSENVKIDSRDPEGYTSLHLAAKHGHYEIVKIXXXXXXXXXXXTADLVTPLHLASFHGHVGVMKLLALSKADLNATTKSGCKPIDFAPYDSER 479
            AA  G    V++LL     ID+R+   +T L  AA  G  E+  ILL     V+       TPLHLAS  GHV ++KLL   KA++  T  +G   +D A   S +
Sbjct:  324 AALHGHAAVVKELLYRGGAIDARNATLWTPLDCAAARGMVEVANILLDEDAPVDPTDKAKTTPLHLASREGHVEMVKLLLSRKANITLTDSAGRNCLDIAIESSHK 429          
BLAST of SMED30015853 vs. Ensembl Medaka
Match: ankrd11 (ankyrin repeat domain 11 [Source:NCBI gene;Acc:101169347])

HSP 1 Score: 62.3882 bits (150), Expect = 9.699e-11
Identity = 40/106 (37.74%), Postives = 59/106 (55.66%), Query Frame = 3
Query:  144 EYELCKAASAGDFKSVRKLLSENVKIDSRDPEGYTSLHLAAKHGHYEIVKIXXXXXXXXXXXTADLVTPLHLASFHGHVGVMKLLALSKADLNATTKSGCKPIDFA 461
            E  L +AA  G+ + +++L+SE   ++ +D  G+T+LH A   G+YE+ K LL  G  VN    D  TPLH AS +GH  V+KLL     D   + + G  P+  A
Sbjct:  167 ETRLHRAAIRGEVRRIKELISEGADVNVKDFAGWTALHEACNRGYYEVAKQLLAAGAEVNTKGLDDDTPLHDASNNGHFKVVKLLLRYGGDPRQSNRRGETPLKVA 272          
BLAST of SMED30015853 vs. Ensembl Medaka
Match: ENSORLT00000016201.2 (caskin-2 [Source:NCBI gene;Acc:101167247])

HSP 1 Score: 62.003 bits (149), Expect = 1.020e-10
Identity = 52/152 (34.21%), Postives = 82/152 (53.95%), Query Frame = 3
Query:   90 NLIDESKIIREIKSVNFDEYELCKAASAGDFKSVRKLLSENVKIDSRDPEGYTSLHLAAKHGHYEIV-KIXXXXXXXXXXXTAD---------LVTPLHLASFHGHVGVMKLLALSKADLNATTKSGCKPIDFAPY-DSERWRILRDASLNI 512
            +L+ E++   +IK VN     L  AA  G   SV  LL     ++S   +G   LHL+A++GHYE+V ++LL + +   ++  D           TPLHLA+ +GH  ++KLL  +  D+N  TK+G    + A Y  +E  R+L DA +N+
Sbjct:   91 SLLLEAQATVDIKDVN-GMRPLHYAAWQGKSDSVLLLLRAGASVNSLSCDGQIPLHLSAQYGHYEVVAQLLLSSNMVTTLLEGDGGGDSSDWPSTTPLHLAARNGHKDIIKLLLKAGIDMNRATKAGTSLHEAALYGKTEVVRLLLDAGINV 241          
BLAST of SMED30015853 vs. Ensembl Medaka
Match: si:ch211-189e2.2 (ankyrin repeat domain-containing protein 66 [Source:NCBI gene;Acc:101160136])

HSP 1 Score: 59.3066 bits (142), Expect = 1.185e-10
Identity = 39/107 (36.45%), Postives = 61/107 (57.01%), Query Frame = 3
Query:  150 ELCKAASAGDFKSVRKLLSENV---KIDSRDPEGYTSLHLAAKHGHYEIVKIXXXXXXXXXXXTADLVTPLHLASFHGHVGVMKLLALSKADLNATTKSGCKPIDFA 461
            EL +AA+AGDFK V +LL++      +   D    T+LH AA+ GH E V++L+ +G   ++ T D  TP H A+  G + V++LL    A ++   + G KP+  A
Sbjct:    3 ELHQAAAAGDFKKVEELLTQQRCGPNLRDADWGNKTALHWAAREGHTETVRLLIQHGARPSLRTQDGWTPAHCAAEFGRLSVLRLLHSLHAPIDQEDRCGDKPLRIA 109          
BLAST of SMED30015853 vs. Ensembl Medaka
Match: ankk1 (ankyrin repeat and kinase domain containing 1 [Source:NCBI gene;Acc:101168311])

HSP 1 Score: 60.8474 bits (146), Expect = 2.572e-10
Identity = 39/114 (34.21%), Postives = 64/114 (56.14%), Query Frame = 3
Query:  162 AASAGDFKSVRKLLSENVKIDSRDPEGYTSLHLAAKHGHYEIVKIXXXXXXXXXXXTADLV---TPLHLASFHGHVGVMKLLALSKADLNATTKSGCKPIDFAPYDSERWRILR 494
            AA  GD +  R LL +    + R+  G+  LHLA+++GH  +V++L+      +VV  +     TP+HLASF+GH+ ++KLL   KAD N T  +   P+  +    +  R++R
Sbjct:  407 AAQNGDDRIARILLDKGASPNGREKSGWMPLHLASQNGHESVVRLLISRSSEEDVVEREEEHGRTPIHLASFYGHLNIVKLLLTLKADPNGTDLALSTPLHLSAERGQN-RVVR 519          
BLAST of SMED30015853 vs. Ensembl Medaka
Match: ankk1 (ankyrin repeat and kinase domain containing 1 [Source:NCBI gene;Acc:101168311])

HSP 1 Score: 60.8474 bits (146), Expect = 2.611e-10
Identity = 39/114 (34.21%), Postives = 64/114 (56.14%), Query Frame = 3
Query:  162 AASAGDFKSVRKLLSENVKIDSRDPEGYTSLHLAAKHGHYEIVKIXXXXXXXXXXXTADLV---TPLHLASFHGHVGVMKLLALSKADLNATTKSGCKPIDFAPYDSERWRILR 494
            AA  GD +  R LL +    + R+  G+  LHLA+++GH  +V++L+      +VV  +     TP+HLASF+GH+ ++KLL   KAD N T  +   P+  +    +  R++R
Sbjct:  412 AAQNGDDRIARILLDKGASPNGREKSGWMPLHLASQNGHESVVRLLISRSSEEDVVEREEEHGRTPIHLASFYGHLNIVKLLLTLKADPNGTDLALSTPLHLSAERGQN-RVVR 524          
BLAST of SMED30015853 vs. Planmine SMEST
Match: SMESG000069882.1 (SMESG000069882.1)

HSP 1 Score: 319.701 bits (818), Expect = 4.518e-110
Identity = 167/167 (100.00%), Postives = 167/167 (100.00%), Query Frame = 3
Query:   75 QVNDENLIDESKIIREIKSVNFDEYELCKAASAGDFKSVRKLLSENVKIDSRDPEGYTSLHLAAKHGHYEIVKIXXXXXXXXXXXTADLVTPLHLASFHGHVGVMKLLALSKADLNATTKSGCKPIDFAPYDSERWRILRDASLNILPYSELLKETLDLPVLPAFAM 575
            QVNDENLIDESKIIREIKSVNFDEYELCKAASAGDFKSVRKLLSENVKIDSRDPEGYTSLHLAAKHGHYEIVKILLLNGVNVNVVTADLVTPLHLASFHGHVGVMKLLALSKADLNATTKSGCKPIDFAPYDSERWRILRDASLNILPYSELLKETLDLPVLPAFAM
Sbjct:   17 QVNDENLIDESKIIREIKSVNFDEYELCKAASAGDFKSVRKLLSENVKIDSRDPEGYTSLHLAAKHGHYEIVKILLLNGVNVNVVTADLVTPLHLASFHGHVGVMKLLALSKADLNATTKSGCKPIDFAPYDSERWRILRDASLNILPYSELLKETLDLPVLPAFAM 183          
BLAST of SMED30015853 vs. Planmine SMEST
Match: SMESG000013046.1 (SMESG000013046.1)

HSP 1 Score: 117.087 bits (292), Expect = 2.462e-32
Identity = 60/151 (39.74%), Postives = 95/151 (62.91%), Query Frame = 3
Query:  123 IKSVNFDEYELCKAASAGDFKSVRKLLSENVKIDSRDPEGYTSLHLAAKHGHYEIVKIXXXXXXXXXXXTADLVTPLHLASFHGHVGVMKLLALSKADLNATTKSGCKPIDFAPYDSERWRILRDASLNILPYSELLKETLDLPVLPAFAM 575
            +K+  + EY    AAS G  +++ +L  E + ++ RD  G T+LH A ++GH++IVK LL N    ++V ADL+TPLHLA+ + H+  ++LL L+K+D+N+ TKSGC+P D  PY+S+ W +L  A     P   +     DLP +P +A+
Sbjct:   12 VKTSYYLEYVFVAAASEGKMRALARLNGERIDVNCRDALGRTALHWACQNGHFDIVKYLLANKAEKDIVDADLITPLHLAALNQHLKCVQLLVLAKSDMNSCTKSGCRPKDLCPYESDCWWVLTHAEEGEYPDPLVFPGPSDLPFVPKYAL 162          
BLAST of SMED30015853 vs. Planmine SMEST
Match: SMESG000026756.1 (SMESG000026756.1)

HSP 1 Score: 64.6994 bits (156), Expect = 9.788e-12
Identity = 39/110 (35.45%), Postives = 61/110 (55.45%), Query Frame = 3
Query:  138 FDEYELCKAASAGDFKSVRKLLSENVKIDSRDPEGYTSLHLAAKHGHYEIVKIXXXXXXXXXXXTADLVTPLHLASFHGHVGVMKLLALSKADLNATTKSGCKPIDFAPY 467
            FD   +  A   G    VR L+SE   I+  D +    +H A ++ H EIVK+LL +  N+     + + P+H A FHG+V ++KLL  S+  L+A + +G +PI FA +
Sbjct:  229 FDRCPIHYACQNGHLNVVRLLISEGCSIEICDKDKRKPIHFACQNDHVEIVKLLLKSKCNLEASDKNGLRPIHYACFHGNVEIVKLLISSQCCLDAESLTGSRPIHFASF 338          

HSP 2 Score: 56.6102 bits (135), Expect = 4.536e-9
Identity = 34/102 (33.33%), Postives = 57/102 (55.88%), Query Frame = 3
Query:  162 AASAGDFKSVRKLLSENVKIDSRDPEGYTSLHLAAKHGHYEIVKIXXXXXXXXXXXTADLVTPLHLASFHGHVGVMKLLALSKADLNATTKSGCKPIDFAPY 467
            AA  G   +V  LL  N  I++ D      +H A ++GH  +V++L+  G ++ +   D   P+H A  + HV ++KLL  SK +L A+ K+G +PI +A +
Sbjct:  204 AAQNGHVDAVSLLLKHNSAIEAPDKFDRCPIHYACQNGHLNVVRLLISEGCSIEICDKDKRKPIHFACQNDHVEIVKLLLKSKCNLEASDKNGLRPIHYACF 305          

HSP 3 Score: 50.447 bits (119), Expect = 5.821e-7
Identity = 30/102 (29.41%), Postives = 54/102 (52.94%), Query Frame = 3
Query:  162 AASAGDFKSVRKLLSENVKIDSRDPEGYTSLHLAAKHGHYEIVKIXXXXXXXXXXXTADLVTPLHLASFHGHVGVMKLLALSKADLNATTKSGCKPIDFAPY 467
            A   G    V  LL+++ +I++ D      +H A ++GH EIVK+L+    +  V   + +TP+H A F+G+  VM +L ++   +    K   +PI +A +
Sbjct:  369 ACCRGHLNIVEMLLAQSCEINAGDKNYRRPIHHACQNGHCEIVKLLVSYKCDKEVRDENKLTPIHYACFYGYFDVMTVLLINNFKVEVGDKDDGRPIHYACF 470          

HSP 4 Score: 47.7506 bits (112), Expect = 3.994e-6
Identity = 33/103 (32.04%), Postives = 52/103 (50.49%), Query Frame = 3
Query:  153 LCKAASAGDFKSVRKLLSENVKIDSRDPEGYTSLHLAAKHGHYEIVKIXXXXXXXXXXXTADLVTPLHLASFHGHVGVMKLLALSKADLNATTKSGCKPIDFA 461
            L  A  +G    V  LL+    I+  D      +H A   G Y+IV++L+      ++   D++ PLH AS +GH GV++LL    +++NA  K    PI +A
Sbjct:  103 LHHACRSGHANVVELLLNYYCDIEVHDKSNLRPIHYACLSGSYQIVEMLIDRCQIESLDKHDMM-PLHYASQNGHCGVLELLLSRVSNVNAVDKRSQSPIHYA 204          

HSP 5 Score: 47.7506 bits (112), Expect = 4.578e-6
Identity = 31/100 (31.00%), Postives = 52/100 (52.00%), Query Frame = 3
Query:  162 AASAGDFKSVRKLLSENVKIDSRDPEGYTSLHLAAKHGHYEIVKIXXXXXXXXXXXTADLVTPLHLASFHGHVGVMKLLALSKADLNATTKSGCKPIDFA 461
            A   G  + V+ L+S     + RD    T +H A  +G+++++ +LL+N   V V   D   P+H A F GH+ ++K+L     ++ A TK    P+D A
Sbjct:  402 ACQNGHCEIVKLLVSYKCDKEVRDENKLTPIHYACFYGYFDVMTVLLINNFKVEVGDKDDGRPIHYACFFGHLHIVKILISQNCNIEACTKENWSPLDLA 501          

HSP 6 Score: 47.3654 bits (111), Expect = 6.182e-6
Identity = 33/107 (30.84%), Postives = 54/107 (50.47%), Query Frame = 3
Query:  141 DEYELCKAASAGDFKSVRKLLSENVKIDSRDPEGYTSLHLAAKHGHYEIVKIXXXXXXXXXXXTADLVTPLHLASFHGHVGVMKLLALSKADLNATTKSGCKPIDFA 461
            D+  +  A  +GD+  V+ LLS    I+  D      +H A ++G+++IV++LL N  +      +   PLH A   GH  V++LL     D+    KS  +PI +A
Sbjct:   33 DKRPIHYACESGDYDIVKLLLSYKCNIEVCDINLMRPIHYACQNGYHKIVELLLSNQADKEAKDKNNGRPLHHACRSGHANVVELLLNYYCDIEVHDKSNLRPIHYA 139          
BLAST of SMED30015853 vs. Planmine SMEST
Match: SMESG000026756.1 (SMESG000026756.1)

HSP 1 Score: 64.6994 bits (156), Expect = 1.027e-11
Identity = 39/110 (35.45%), Postives = 61/110 (55.45%), Query Frame = 3
Query:  138 FDEYELCKAASAGDFKSVRKLLSENVKIDSRDPEGYTSLHLAAKHGHYEIVKIXXXXXXXXXXXTADLVTPLHLASFHGHVGVMKLLALSKADLNATTKSGCKPIDFAPY 467
            FD   +  A   G    VR L+SE   I+  D +    +H A ++ H EIVK+LL +  N+     + + P+H A FHG+V ++KLL  S+  L+A + +G +PI FA +
Sbjct:  235 FDRCPIHYACQNGHLNVVRLLISEGCSIEICDKDKRKPIHFACQNDHVEIVKLLLKSKCNLEASDKNGLRPIHYACFHGNVEIVKLLISSQCCLDAESLTGSRPIHFASF 344          

HSP 2 Score: 56.6102 bits (135), Expect = 4.671e-9
Identity = 34/102 (33.33%), Postives = 57/102 (55.88%), Query Frame = 3
Query:  162 AASAGDFKSVRKLLSENVKIDSRDPEGYTSLHLAAKHGHYEIVKIXXXXXXXXXXXTADLVTPLHLASFHGHVGVMKLLALSKADLNATTKSGCKPIDFAPY 467
            AA  G   +V  LL  N  I++ D      +H A ++GH  +V++L+  G ++ +   D   P+H A  + HV ++KLL  SK +L A+ K+G +PI +A +
Sbjct:  210 AAQNGHVDAVSLLLKHNSAIEAPDKFDRCPIHYACQNGHLNVVRLLISEGCSIEICDKDKRKPIHFACQNDHVEIVKLLLKSKCNLEASDKNGLRPIHYACF 311          

HSP 3 Score: 50.447 bits (119), Expect = 5.938e-7
Identity = 30/102 (29.41%), Postives = 54/102 (52.94%), Query Frame = 3
Query:  162 AASAGDFKSVRKLLSENVKIDSRDPEGYTSLHLAAKHGHYEIVKIXXXXXXXXXXXTADLVTPLHLASFHGHVGVMKLLALSKADLNATTKSGCKPIDFAPY 467
            A   G    V  LL+++ +I++ D      +H A ++GH EIVK+L+    +  V   + +TP+H A F+G+  VM +L ++   +    K   +PI +A +
Sbjct:  375 ACCRGHLNIVEMLLAQSCEINAGDKNYRRPIHHACQNGHCEIVKLLVSYKCDKEVRDENKLTPIHYACFYGYFDVMTVLLINNFKVEVGDKDDGRPIHYACF 476          

HSP 4 Score: 47.7506 bits (112), Expect = 4.302e-6
Identity = 33/103 (32.04%), Postives = 52/103 (50.49%), Query Frame = 3
Query:  153 LCKAASAGDFKSVRKLLSENVKIDSRDPEGYTSLHLAAKHGHYEIVKIXXXXXXXXXXXTADLVTPLHLASFHGHVGVMKLLALSKADLNATTKSGCKPIDFA 461
            L  A  +G    V  LL+    I+  D      +H A   G Y+IV++L+      ++   D++ PLH AS +GH GV++LL    +++NA  K    PI +A
Sbjct:  109 LHHACRSGHANVVELLLNYYCDIEVHDKSNLRPIHYACLSGSYQIVEMLIDRCQIESLDKHDMM-PLHYASQNGHCGVLELLLSRVSNVNAVDKRSQSPIHYA 210          

HSP 5 Score: 47.7506 bits (112), Expect = 4.712e-6
Identity = 31/100 (31.00%), Postives = 52/100 (52.00%), Query Frame = 3
Query:  162 AASAGDFKSVRKLLSENVKIDSRDPEGYTSLHLAAKHGHYEIVKIXXXXXXXXXXXTADLVTPLHLASFHGHVGVMKLLALSKADLNATTKSGCKPIDFA 461
            A   G  + V+ L+S     + RD    T +H A  +G+++++ +LL+N   V V   D   P+H A F GH+ ++K+L     ++ A TK    P+D A
Sbjct:  408 ACQNGHCEIVKLLVSYKCDKEVRDENKLTPIHYACFYGYFDVMTVLLINNFKVEVGDKDDGRPIHYACFFGHLHIVKILISQNCNIEACTKENWSPLDLA 507          

HSP 6 Score: 46.9802 bits (110), Expect = 6.719e-6
Identity = 33/107 (30.84%), Postives = 54/107 (50.47%), Query Frame = 3
Query:  141 DEYELCKAASAGDFKSVRKLLSENVKIDSRDPEGYTSLHLAAKHGHYEIVKIXXXXXXXXXXXTADLVTPLHLASFHGHVGVMKLLALSKADLNATTKSGCKPIDFA 461
            D+  +  A  +GD+  V+ LLS    I+  D      +H A ++G+++IV++LL N  +      +   PLH A   GH  V++LL     D+    KS  +PI +A
Sbjct:   39 DKRPIHYACESGDYDIVKLLLSYKCNIEVCDINLMRPIHYACQNGYHKIVELLLSNQADKEAKDKNNGRPLHHACRSGHANVVELLLNYYCDIEVHDKSNLRPIHYA 145          
BLAST of SMED30015853 vs. Planmine SMEST
Match: SMESG000040665.1 (SMESG000040665.1)

HSP 1 Score: 63.1586 bits (152), Expect = 2.758e-11
Identity = 31/100 (31.00%), Postives = 55/100 (55.00%), Query Frame = 3
Query:  162 AASAGDFKSVRKLLSENVKIDSRDPEGYTSLHLAAKHGHYEIVKIXXXXXXXXXXXTADLVTPLHLASFHGHVGVMKLLALSKADLNATTKSGCKPIDFA 461
            A+  G    VR L+  N  I+  D E +  +H A+++GH ++V++L+    N+     +   P+H A ++GH  +++LL L+K  +   TK G  P+D A
Sbjct:  169 ASWNGHADVVRLLIDRNCNIECEDNEQWRPIHWASRYGHADVVRLLIDRNCNIECEDDEQRRPIHYACWNGHAEIIQLLMLNKCQIECKTKGGKTPLDLA 268          

HSP 2 Score: 57.7658 bits (138), Expect = 1.575e-9
Identity = 34/119 (28.57%), Postives = 63/119 (52.94%), Query Frame = 3
Query:  162 AASAGDFKSVRKLLSENVKIDSRDPEGYTSLHLAAKHGHYEIVKIXXXXXXXXXXXTADLVTPLHLASFHGHVGVMKLLALSKADLNATTKSGCKPIDFAPYD--SERWRILRDASLNI 512
            A   G F  V+ L+  N  I+  D      +H A+++GH ++V++L+    N+     + V P+H AS++GH  V++LL     ++    K   +PI +A ++  ++  R+L D + NI
Sbjct:   37 ACEKGFFSIVQLLMEHNCNIECEDKLQRRPIHWASRYGHADVVRLLIDRNCNIECEDDEQVRPIHYASWNGHADVVRLLIDRNCNIECEDKWQRRPIHYASWNGHADVVRLLIDRNCNI 155          

HSP 3 Score: 53.5286 bits (127), Expect = 4.724e-8
Identity = 34/119 (28.57%), Postives = 61/119 (51.26%), Query Frame = 3
Query:  162 AASAGDFKSVRKLLSENVKIDSRDPEGYTSLHLAAKHGHYEIVKIXXXXXXXXXXXTADLVTPLHLASFHGHVGVMKLLALSKADLNATTKSGCKPIDFAPYD--SERWRILRDASLNI 512
            A+  G    VR L+  N  I+  D E    +H A+ +GH ++V++L+    N+         P+H AS++GH  V++LL     ++    K   +PI +A ++  ++  R+L D + NI
Sbjct:   70 ASRYGHADVVRLLIDRNCNIECEDDEQVRPIHYASWNGHADVVRLLIDRNCNIECEDKWQRRPIHYASWNGHADVVRLLIDRNCNIECEDKWQRRPIHYASWNGHADVVRLLIDRNCNI 188          
The following BLAST results are available for this feature:
BLAST of SMED30015853 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
RIPK43.563e-1141.58receptor interacting serine/threonine kinase 4 [So... [more]
RIPK41.075e-1041.58receptor interacting serine/threonine kinase 4 [So... [more]
ANKK12.773e-1035.00ankyrin repeat and kinase domain containing 1 [Sou... [more]
EHMT18.966e-1038.78euchromatic histone lysine methyltransferase 1 [So... [more]
ANKRD171.060e-937.96ankyrin repeat domain 17 [Source:HGNC Symbol;Acc:H... [more]
back to top
BLAST of SMED30015853 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
trp-41.628e-943.56TRP (Transient receptor potential) channel family ... [more]
unc-441.637e-934.65AO49 ankyrin [Source:UniProtKB/TrEMBL;Acc:Q7JP86][more]
unc-441.637e-934.65AO49 ankyrin [Source:UniProtKB/TrEMBL;Acc:Q7JP86][more]
unc-441.913e-934.65AO49 ankyrin [Source:UniProtKB/TrEMBL;Acc:Q7JP86][more]
unc-441.913e-934.65AO49 ankyrin [Source:UniProtKB/TrEMBL;Acc:Q7JP86][more]
back to top
BLAST of SMED30015853 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Ank21.208e-1036.00gene:FBgn0261788 transcript:FBtr0303119[more]
Ank21.337e-1036.00gene:FBgn0261788 transcript:FBtr0334061[more]
Ank21.633e-1036.00gene:FBgn0261788 transcript:FBtr0303113[more]
Ank21.722e-1036.00gene:FBgn0261788 transcript:FBtr0303117[more]
Ank21.725e-1036.00gene:FBgn0261788 transcript:FBtr0303111[more]
back to top
BLAST of SMED30015853 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
BX469921.13.851e-1136.44ankyrin 3a [Source:NCBI gene;Acc:103909035][more]
ank3a3.922e-1136.44ankyrin 3a [Source:ZFIN;Acc:ZDB-GENE-060621-1][more]
ank3a3.922e-1136.44ankyrin 3a [Source:ZFIN;Acc:ZDB-GENE-060621-1][more]
BX469921.16.712e-1136.44ankyrin 3a [Source:NCBI gene;Acc:103909035][more]
ank3a6.713e-1136.44ankyrin 3a [Source:ZFIN;Acc:ZDB-GENE-060621-1][more]
back to top
BLAST of SMED30015853 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
cpsf11.196e-1335.38cleavage and polyadenylation specific factor 1 [So... [more]
fbxo91.079e-1037.14F-box protein 9 [Source:Xenbase;Acc:XB-GENE-100244... [more]
gorasp17.457e-1037.50golgi reassembly stacking protein 1 [Source:Xenbas... [more]
tpm49.328e-1034.75tropomyosin 4 [Source:Xenbase;Acc:XB-GENE-6077097][more]
tpm49.377e-1034.75tropomyosin 4 [Source:Xenbase;Acc:XB-GENE-6077097][more]
back to top
BLAST of SMED30015853 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Ankk12.304e-1134.00ankyrin repeat and kinase domain containing 1 [Sou... [more]
Ripk41.384e-1040.59receptor-interacting serine-threonine kinase 4 [So... [more]
Ankrd176.757e-1037.96ankyrin repeat domain 17 [Source:MGI Symbol;Acc:MG... [more]
Ankrd176.757e-1037.96ankyrin repeat domain 17 [Source:MGI Symbol;Acc:MG... [more]
Ankrd177.097e-1037.96ankyrin repeat domain 17 [Source:MGI Symbol;Acc:MG... [more]
back to top
BLAST of SMED30015853 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q8BZ25|ANKK1_MOUSE1.612e-1034.00Ankyrin repeat and protein kinase domain-containin... [more]
sp|P57078|RIPK4_HUMAN5.163e-1041.58Receptor-interacting serine/threonine-protein kina... [more]
sp|Q9ERK0|RIPK4_MOUSE9.682e-1040.59Receptor-interacting serine/threonine-protein kina... [more]
sp|Q8NFD2|ANKK1_HUMAN1.332e-935.00Ankyrin repeat and protein kinase domain-containin... [more]
sp|Q99NH0|ANR17_MOUSE4.727e-937.96Ankyrin repeat domain-containing protein 17 OS=Mus... [more]
back to top
BLAST of SMED30015853 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A183ARE25.049e-2840.69ANK_REP_REGION domain-containing protein OS=Echino... [more]
A0A4S2MD914.809e-2742.76ANK_REP_REGION domain-containing protein OS=Opisth... [more]
A0A183K1442.677e-2644.14ANK_REP_REGION domain-containing protein OS=Schist... [more]
A0A094ZEP93.645e-2644.14Ankyrin-3 OS=Schistosoma haematobium OX=6185 GN=MS... [more]
A0A430PZS93.969e-2644.14ANK_REP_REGION domain-containing protein OS=Schist... [more]
back to top
BLAST of SMED30015853 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ENSAMXT00000037173.17.024e-1234.96pep primary_assembly:Astyanax_mexicanus-2.0:16:210... [more]
ENSAMXT00000046579.14.014e-1137.14pep primary_assembly:Astyanax_mexicanus-2.0:16:210... [more]
ank3b2.662e-1034.75ankyrin 3b [Source:ZFIN;Acc:ZDB-GENE-060621-2][more]
ank3a4.557e-1039.62ankyrin 3a [Source:ZFIN;Acc:ZDB-GENE-060621-1][more]
ank3a5.272e-1039.62ankyrin 3a [Source:ZFIN;Acc:ZDB-GENE-060621-1][more]
back to top
BLAST of SMED30015853 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ENSPMAT00000007449.11.594e-1238.68pep scaffold:Pmarinus_7.0:GL478728:201453:233342:1... [more]
ENSPMAT00000007446.12.474e-1238.68pep scaffold:Pmarinus_7.0:GL478728:200023:240674:1... [more]
ENSPMAT00000000376.14.478e-1038.68pep scaffold:Pmarinus_7.0:GL476650:183420:196917:-... [more]
ENSPMAT00000000095.17.298e-1037.74pep scaffold:Pmarinus_7.0:GL477582:20897:60453:1 g... [more]
ENSPMAT00000000093.18.579e-1037.74pep scaffold:Pmarinus_7.0:GL477582:20502:66045:1 g... [more]
back to top
BLAST of SMED30015853 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30015853 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
EDO494851.059e-934.26Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO433818.389e-937.00Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO436904.482e-834.00Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO471711.403e-734.65Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO387021.639e-736.79Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of SMED30015853 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ankrd119.699e-1137.74ankyrin repeat domain 11 [Source:NCBI gene;Acc:101... [more]
ENSORLT00000016201.21.020e-1034.21caskin-2 [Source:NCBI gene;Acc:101167247][more]
si:ch211-189e2.21.185e-1036.45ankyrin repeat domain-containing protein 66 [Sourc... [more]
ankk12.572e-1034.21ankyrin repeat and kinase domain containing 1 [Sou... [more]
ankk12.611e-1034.21ankyrin repeat and kinase domain containing 1 [Sou... [more]
back to top
BLAST of SMED30015853 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000069882.14.518e-110100.00SMESG000069882.1[more]
SMESG000013046.12.462e-3239.74SMESG000013046.1[more]
SMESG000026756.19.788e-1235.45SMESG000026756.1[more]
SMESG000026756.11.027e-1135.45SMESG000026756.1[more]
SMESG000040665.12.758e-1131.00SMESG000040665.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30015853 ID=SMED30015853|Name=SMED30015853|organism=Schmidtea mediterranea sexual|type=transcript|length=732bp
TTAAATAAGAAATCTAAATATGAAAAATGTTGGAAACTGACAAAGAAACA
GACGAAGAAATAAAAGAAACTGAACAAGTTAACGATGAAAATTTAATAGA
TGAATCAAAAATTATTCGTGAAATAAAATCAGTGAATTTCGATGAATATG
AGTTATGCAAAGCTGCTTCAGCTGGAGACTTTAAATCCGTTCGAAAATTA
CTATCAGAGAACGTGAAAATAGATTCTAGGGATCCTGAAGGATATACCTC
TCTTCACCTAGCTGCTAAACATGGACATTATGAAATTGTTAAAATCCTGT
TGCTCAACGGTGTCAACGTAAACGTGGTGACAGCTGATTTAGTGACTCCT
CTTCACCTGGCATCTTTCCATGGGCATGTTGGAGTCATGAAATTATTGGC
ACTGTCAAAGGCTGATTTGAATGCCACAACAAAAAGTGGCTGTAAGCCCA
TTGATTTTGCTCCATATGACAGTGAACGATGGCGAATATTGCGAGATGCG
TCTTTAAATATTCTACCGTATTCCGAACTGTTAAAGGAAACTCTGGATTT
ACCAGTTTTACCGGCATTTGCAATGAAATCCGGTGGCAAAGAAGGTGAAA
AAAAGAAAAAAGGTGGGAAAAAGAAAGGAAAAAAATCTGGAAAAAAATCT
GGTAAAAAATCAGGTAAAAAATCGGGAAAAAAAGGAAAGAAGAAAAAATA
ACTTTTTTGGAGATTTTCCTTTAAAAAATGAT
back to top

protein sequence of SMED30015853-orf-1

>SMED30015853-orf-1 ID=SMED30015853-orf-1|Name=SMED30015853-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=225bp
MLETDKETDEEIKETEQVNDENLIDESKIIREIKSVNFDEYELCKAASAG
DFKSVRKLLSENVKIDSRDPEGYTSLHLAAKHGHYEIVKILLLNGVNVNV
VTADLVTPLHLASFHGHVGVMKLLALSKADLNATTKSGCKPIDFAPYDSE
RWRILRDASLNILPYSELLKETLDLPVLPAFAMKSGGKEGEKKKKGGKKK
GKKSGKKSGKKSGKKSGKKGKKKK*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000016pharynx
PLANA:0000034epidermis
PLANA:0000099neuron
PLANA:0000418head
PLANA:0002032epidermal cell
Vocabulary: INTERPRO
TermDefinition
IPR036770Ankyrin_rpt-contain_sf
IPR002110Ankyrin_rpt
IPR020683Ankyrin_rpt-contain_dom
Vocabulary: molecular function
TermDefinition
GO:0005515protein binding
GO:0003676nucleic acid binding
GO:0003682chromatin binding
GO:0003723RNA binding
Vocabulary: cellular component
TermDefinition
GO:0000785chromatin
GO:0005634nucleus
GO:0005737cytoplasm
GO:0016020membrane
GO:0031965nuclear membrane
Vocabulary: biological process
TermDefinition
GO:0001955blood vessel maturation
GO:0002376immune system process
GO:0006275regulation of DNA replication
GO:0007492endoderm development
GO:0042742defense response to bacterium
GO:0043123positive regulation of I-kappaB kinase/NF-kappaB signaling
GO:0045087innate immune response
GO:0045787positive regulation of cell cycle
GO:0051151negative regulation of smooth muscle cell differentiation
GO:1900087positive regulation of G1/S transition of mitotic cell cycle
GO:1900245positive regulation of MDA-5 signaling pathway
GO:1900246positive regulation of RIG-I signaling pathway
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR002110Ankyrin repeatPRINTSPR01415ANKYRINcoord: 72..87
score: 45.52
coord: 120..134
score: 30.91
IPR002110Ankyrin repeatSMARTSM00248ANK_2acoord: 38..67
e-value: 860.0
score: 5.5
coord: 104..133
e-value: 0.0026
score: 27.0
coord: 71..100
e-value: 2.1E-7
score: 40.6
IPR002110Ankyrin repeatPROSITEPS50088ANK_REPEATcoord: 71..103
score: 14.613
IPR002110Ankyrin repeatPROSITEPS50088ANK_REPEATcoord: 104..136
score: 10.606
IPR036770Ankyrin repeat-containing domain superfamilyGENE3DG3DSA:1.25.40.20coord: 2..152
e-value: 2.0E-33
score: 117.2
IPR036770Ankyrin repeat-containing domain superfamilySUPERFAMILYSSF48403Ankyrin repeatcoord: 40..146
IPR020683Ankyrin repeat-containing domainPFAMPF12796Ank_2coord: 43..134
e-value: 9.0E-16
score: 58.2
IPR020683Ankyrin repeat-containing domainPROSITEPS50297ANK_REP_REGIONcoord: 38..145
score: 29.68
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 185..224
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 193..224
NoneNo IPR availablePANTHERPTHR24134FAMILY NOT NAMEDcoord: 40..181