Inner nuclear membrane protein Man1 (LEM domain-containing protein 3)

Overview
NameInner nuclear membrane protein Man1 (LEM domain-containing protein 3)
Smed IDSMED30015850
Length (bp)2118
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Inner nuclear membrane protein Man1 (LEM domain-containing protein 3) (SMED30015850) t-SNE clustered cells

Violin plots show distribution of expression levels for Inner nuclear membrane protein Man1 (LEM domain-containing protein 3) (SMED30015850) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Inner nuclear membrane protein Man1 (LEM domain-containing protein 3) (SMED30015850) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Inner nuclear membrane protein Man1 (LEM domain-containing protein 3) (SMED30015850) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30015850

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 1

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
parenchymaSMED30015850SMESG000070263.1 SMESG000070262.1 SMESG000070249.1 dd_Smed_v4_3626_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Inner nuclear membrane protein Man1 (LEM domain-containing protein 3) vs. Ensembl Human
Match: LEMD3 (LEM domain containing 3 [Source:HGNC Symbol;Acc:HGNC:28887])

HSP 1 Score: 99.7525 bits (247), Expect = 6.555e-21
Identity = 98/473 (20.72%), Postives = 206/473 (43.55%), Query Frame = 3
Query:  711 LSDNEDNLMTRLRRNYFKKTGCSDVDAXXXXXXXXXXXXXXXFINWNHLPNILLGIVIVFSVLLFLSYILMKNRYSNLELELAMDGLTDKIGSKDRFTVEELPQLKFYLAKLYDILSEYSGEKTCEFLPDKRLSFTKARDILNHKLKREKSKSVSEGNWSQLMKMVILLPTD-KLNIAGYNKDNEIVGIDGLPEHITYLEGLVPKLSMFCRLKMFAVHILNGIFYIACVIVGILLVLITGYFMNIYRVKRKQRNEKLVNEMREIISCISSLLQDQLRQAEYSQTTNKFLTVSKVRSILQKTYPKLQDEPYWEELKNFMYKIEPLIEMK-ETLAHGEILEWK--------------SHLGWQGSAVQSDCQVKFGKGPTECLKIRNM--DLINFDEEGENYLRQEVRNRLRDAGEIKDVQFLRKGSKVIVYVLCGSREVAGKAFRKVNANYFNGNLLNVKFIRLDKYLERFPES 2075
            LS+ E+ L+ + +R     TG                       + ++L   LL    +F ++L L+Y+ M+    + + EL+++    +   K + + + L     Y  KL+D L++ +G+  C     + LS  +A   L   L  E      EG ++  ++ ++    D  +   G+  + E+  I      + +L+   P +S +CR +   V + + +  +    +G+++V +   +M      R  + E+   +M +++  I  +L+      + ++    ++ +  VR  L + + + + +  W+   +F+   E  +  +   +   + L W+                  WQG A   D +       T CLKIRNM   ++   ++    +++ +  +  D   I  +   +   +  VYV C S E AGKAF+ ++ ++F+G L+ VK++RLD+Y  RFP++
Sbjct:  446 LSEPEEELLQQFKREEVSPTGS---------------------FSAHYLSMFLLTAACLFFLILGLTYLGMRGTGVSEDGELSIENPFGETFGKIQESEKTLMMNTLY--KLHDRLAQLAGDHECGSSSQRTLSVQEAAAYLK-DLGPEY-----EGIFNTSLQWILENGKDVGIRCVGFGPEEELTNIT----DVQFLQSTRPLMSFWCRFRRAFVTVTHRLLLLC---LGVVMVCVVLRYMKY----RWTKEEEETRQMYDMVVKIIDVLRSHNEACQENKDLQPYMPIPHVRDSLIQPHDRKKMKKVWDRAVDFLAANESRVRTETRRIGGADFLVWRWIQPSASCDKILVIPSKVWQGQAFHLDRRNSPPNSLTPCLKIRNMFDPVMEIGDQWHLAIQEAILEKCSDNDGIVHIAVDKNSREGCVYVKCLSPEYAGKAFKALHGSWFDGKLVTVKYLRLDRYHHRFPQA 878          
BLAST of Inner nuclear membrane protein Man1 (LEM domain-containing protein 3) vs. Ensembl Fly
Match: MAN1 (gene:FBgn0034962 transcript:FBtr0072167)

HSP 1 Score: 67.0106 bits (162), Expect = 3.371e-11
Identity = 69/247 (27.94%), Postives = 116/247 (46.96%), Query Frame = 3
Query: 1392 VIVGILLVLITGYFMN-----IYRVKRK-------QRNEKLVNEMREIISCISSLLQDQLRQAEYSQTTNKFLTVSKVRSILQKTYPKLQDEPYWEELKNFMYKIEPLIEMKETLAHGEILEWKSHLG----WQGSAVQSDCQVKFGKGPTECLKIRNMDLINFDEEGENYLRQE-VRNRLRDAG---EIKDVQFLRKGSKVIVYVLCGSREVAGKAFRKVNANYFNGNLLNVKFIRLDKYLERFPE 2072
             ++G LL+++ G+ +      IYRVK+K       Q  + ++NE+  + S      Q +  +   +Q   KFL   K RS L  ++ K   +    + +     +    +   T+A    ++ K  +G    WQ  A   D   K    PT CLKIR+M   +  E  +  L+Q  V + +   G   +I DVQ         VY+ C S E AG   +++N  +F+  L+++KF+RL++YL RFP+
Sbjct:  400 TVIGALLLIVAGFLIVYVAVVIYRVKQKEALLAVDQFQKDIINELIYLSS------QSESPEVVINQLQEKFLPAKK-RSKLLSSWNKALKQLEKNDSRVLFGMVNRDGKAMRTIAWNRNVD-KKDVGLVKKWQSPAF--DNSNKIANPPTPCLKIRHM--FDSSEVDQANLKQSIVESIIEKVGTRCKICDVQL--DVQSCCVYIRCASEEDAGTIHKEINGWWFDKRLISIKFLRLERYLSRFPK 632          
BLAST of Inner nuclear membrane protein Man1 (LEM domain-containing protein 3) vs. Ensembl Fly
Match: MAN1 (gene:FBgn0034962 transcript:FBtr0345949)

HSP 1 Score: 67.0106 bits (162), Expect = 3.371e-11
Identity = 69/247 (27.94%), Postives = 116/247 (46.96%), Query Frame = 3
Query: 1392 VIVGILLVLITGYFMN-----IYRVKRK-------QRNEKLVNEMREIISCISSLLQDQLRQAEYSQTTNKFLTVSKVRSILQKTYPKLQDEPYWEELKNFMYKIEPLIEMKETLAHGEILEWKSHLG----WQGSAVQSDCQVKFGKGPTECLKIRNMDLINFDEEGENYLRQE-VRNRLRDAG---EIKDVQFLRKGSKVIVYVLCGSREVAGKAFRKVNANYFNGNLLNVKFIRLDKYLERFPE 2072
             ++G LL+++ G+ +      IYRVK+K       Q  + ++NE+  + S      Q +  +   +Q   KFL   K RS L  ++ K   +    + +     +    +   T+A    ++ K  +G    WQ  A   D   K    PT CLKIR+M   +  E  +  L+Q  V + +   G   +I DVQ         VY+ C S E AG   +++N  +F+  L+++KF+RL++YL RFP+
Sbjct:  400 TVIGALLLIVAGFLIVYVAVVIYRVKQKEALLAVDQFQKDIINELIYLSS------QSESPEVVINQLQEKFLPAKK-RSKLLSSWNKALKQLEKNDSRVLFGMVNRDGKAMRTIAWNRNVD-KKDVGLVKKWQSPAF--DNSNKIANPPTPCLKIRHM--FDSSEVDQANLKQSIVESIIEKVGTRCKICDVQL--DVQSCCVYIRCASEEDAGTIHKEINGWWFDKRLISIKFLRLERYLSRFPK 632          
BLAST of Inner nuclear membrane protein Man1 (LEM domain-containing protein 3) vs. Ensembl Fly
Match: MAN1 (gene:FBgn0034962 transcript:FBtr0072166)

HSP 1 Score: 67.0106 bits (162), Expect = 3.371e-11
Identity = 69/247 (27.94%), Postives = 116/247 (46.96%), Query Frame = 3
Query: 1392 VIVGILLVLITGYFMN-----IYRVKRK-------QRNEKLVNEMREIISCISSLLQDQLRQAEYSQTTNKFLTVSKVRSILQKTYPKLQDEPYWEELKNFMYKIEPLIEMKETLAHGEILEWKSHLG----WQGSAVQSDCQVKFGKGPTECLKIRNMDLINFDEEGENYLRQE-VRNRLRDAG---EIKDVQFLRKGSKVIVYVLCGSREVAGKAFRKVNANYFNGNLLNVKFIRLDKYLERFPE 2072
             ++G LL+++ G+ +      IYRVK+K       Q  + ++NE+  + S      Q +  +   +Q   KFL   K RS L  ++ K   +    + +     +    +   T+A    ++ K  +G    WQ  A   D   K    PT CLKIR+M   +  E  +  L+Q  V + +   G   +I DVQ         VY+ C S E AG   +++N  +F+  L+++KF+RL++YL RFP+
Sbjct:  400 TVIGALLLIVAGFLIVYVAVVIYRVKQKEALLAVDQFQKDIINELIYLSS------QSESPEVVINQLQEKFLPAKK-RSKLLSSWNKALKQLEKNDSRVLFGMVNRDGKAMRTIAWNRNVD-KKDVGLVKKWQSPAF--DNSNKIANPPTPCLKIRHM--FDSSEVDQANLKQSIVESIIEKVGTRCKICDVQL--DVQSCCVYIRCASEEDAGTIHKEINGWWFDKRLISIKFLRLERYLSRFPK 632          
BLAST of Inner nuclear membrane protein Man1 (LEM domain-containing protein 3) vs. Ensembl Zebrafish
Match: lemd3 (LEM domain containing 3 [Source:ZFIN;Acc:ZDB-GENE-030131-490])

HSP 1 Score: 100.138 bits (248), Expect = 2.823e-21
Identity = 106/435 (24.37%), Postives = 204/435 (46.90%), Query Frame = 3
Query:  849 NHLPNILLGIVIVFSVLLFLSYILMKNRYSNLELELAMDGLTDKIGSK--DRFTVEELPQLKFYLAKLYDILSEYSGEKTCEFLPD---KRLSFTKARDILNHKLKREKSKSVSEGNWSQLMKMVILLPTDKLNIAGYNKDNEIVGIDGLPEHITYLEGLVPKLSMFCRLKMFAVHILNGIFYIACVIVGILLVLITGYFMNIYRVKRKQRNEKLVNEMREIISCISSLLQDQLRQAEYSQTTNKFLTVSKVRSILQKTYPKLQDEPYWEELKNFMYKIEPLIEM-KETLAHGEILEWK--------------SHLGWQGSAVQSDCQVKFGKGPTECLKIRNMDLINFD---EEGENY---LRQEVRNRLRDAGEIKDVQFLRKGSKVIVYVLCGSREVAGKAFRKVNANYFNGNLLNVKFIRLDKYLERFPES 2075
            ++L   LL    +F VLL L Y+ M+   + +   + M       G++   ++ V+E   +   L  L++ L+  +GE  C    +   + +SF+ A   L  KL+ E  +++ E +   +MK   ++    + + G + D+ I  +      I+ LE + P++S FCR +     +   I+ +  ++ GI +V+   Y+M  YR +++   E+    M +++  I  +L+      + ++    +L +  VR  L +   + + +  W+   +F+   E  I   K+ +   + + W+                  WQG A   D +       T CLKIRNM    FD   E GEN+   +++ +  +  D   I  +   +   +  VYV C S E +GKAF+ ++ ++F+G L+ VK++RLD+Y +RFP++
Sbjct:  396 HYLSMFLLTAACLFFVLLGLMYLRMRGSGTAVGDAVIMQ---HPFGAEFDKQYDVKERELILNLLLSLHEHLASVAGEHDCGDFKNPLNRSVSFSDASKYL--KLQNEAYENLIETSLEWVMKTKDVV---GIRLIGGDPDHPIEDV----SEISRLESIHPRMSFFCRFRRAFFTV---IYRVLLILAGIGVVVGLVYYMK-YRWRKE---EEETRHMYDMVERIIDVLRSHNEACQENKDLQAYLPIPHVRDSLVQPQERKRMKKVWDRAVSFLSANESRIRTEKQRIGGADFMVWRWLQPSMSPDKMCNMPSKVWQGQAFPLDRRNSPPNSLTPCLKIRNM----FDPVMEVGENWHLAIQEAILEKCSDNDGIVHIAVDKNSREGCVYVKCLSAEHSGKAFKALHGSWFDGKLVTVKYLRLDRYHQRFPQA 807          
BLAST of Inner nuclear membrane protein Man1 (LEM domain-containing protein 3) vs. Ensembl Xenopus
Match: lemd3 (LEM domain containing 3 [Source:NCBI gene;Acc:100038042])

HSP 1 Score: 89.7373 bits (221), Expect = 5.999e-18
Identity = 93/428 (21.73%), Postives = 181/428 (42.29%), Query Frame = 3
Query:  849 NHLPNILLGIVIVFSVLLFLSYILMKNRYSNLELELAMDGLTDKIGSKDRFTVEELPQLKFYLAKLYDILSEYSGEKTCEFLPDKRLSFTKARDILNHKLKREKSKSVSEGNWSQLMKMVILLPTDKLNIAGYNKDNEIVGIDGLPEHITYLEGLVPKLSMFCRLKMFAVHILN--GIFYIACVIVGILLVLITGYFMNIYRVKRKQRNEKLVNEMREIISCISSLLQDQLRQAEYSQTTNKFLTVSKVRSILQKTYPKLQDEPYWEELKNFMYKIEPLIEMK-ETLAHGEILEWK--------------SHLGWQGSAVQSDCQVKFGKGPTECLKIRNM--DLINFDEEGENYLRQEVRNRLRDAGEIKDVQFLRKGSKVIVYVLCGSREVAGKAFRKVNANYFNGNLLNVKFIRLDKYLERFPES 2075
            ++L   LL    +F +LL L+Y+ M+          ++ G  +    +D    +    L   L KL++ LS+ +G+  C     + +S  +A   L    K  + +  +   W     ++    T  + I   +    I+ I      + YLE  +P++S  CR++   + + +   IF I    VG+L  ++       Y   R  + E+   +M +++  I  +L+      + ++    +  +  VR  L     + + +  W+    F+   E  +  + + +   +   WK                  WQG A   D +       T CLKIRNM   ++   +  +  +++ +  +  D   I  +   +   +  VYV C S E AGKAF+ ++ ++F+G L+ VK++RLD+Y  RFP++
Sbjct:  348 HYLSMFLLTAACLFFLLLGLTYLRMRG--------TSLTGEENLRSPEDLNVDQSTIVLMNTLQKLHEKLSKTAGDYICGDTDRRNVSVQEASQYLKTLGKEYEDEFNNTVAW-----ILQHSATRDVGIKCSSDPGSILNITS----VKYLESTLPRMSFMCRIRRAVITVAHRSSIFLIG---VGVLFGVLR------YMKYRWAKEEEETKQMYDMVVKIIDVLKSHNEACQENKDLEPYTPIPHVRDSLILPQDRKKMKKVWDRAVEFLDANESRVRTETQKIGGADFQVWKWIQPSSTCDKISVMPSKVWQGQAFHLDRRNSPPNSLTPCLKIRNMFDPVMEIGDHWDLAIQEAILEKCSDNEGIVHIAVDKNSREGCVYVKCLSPEFAGKAFKALHGSWFDGKLVTVKYLRLDRYHHRFPQA 749          
BLAST of Inner nuclear membrane protein Man1 (LEM domain-containing protein 3) vs. Ensembl Xenopus
Match: lemd3 (LEM domain containing 3 [Source:NCBI gene;Acc:100038042])

HSP 1 Score: 64.6994 bits (156), Expect = 4.342e-10
Identity = 83/408 (20.34%), Postives = 165/408 (40.44%), Query Frame = 3
Query:  849 NHLPNILLGIVIVFSVLLFLSYILMKNRYSNLELELAMDGLTDKIGSKDRFTVEELPQLKFYLAKLYDILSEYSGEKTCEFLPDKRLSFTKARDILNHKLKREKSKSVSEGNWSQLMKMVILLPTDKLNIAGYNKDNEIVGIDGLPEHITYLEGLVPKLSMFCRLKMFAVHILN--GIFYIACVIVGILLVLITGYFMNIYRVKRKQRNEKLVNEMREIISCISSLLQDQLRQAEYSQTTNKFLTVSKVRSILQKTYPKLQDEPYWEELKNFMYKIEPLIEMK-ETLAHGEILEWK--------------SHLGWQGSAVQSDCQVKFGKGPTECLKIRNM--DLINFDEEGENYLRQEVRNRLRDAGEIKDVQFLRKGSKVIVYVLCGSREVAGKAFRKVNANYFNG 2015
            ++L   LL    +F +LL L+Y+ M+          ++ G  +    +D    +    L   L KL++ LS+ +G+  C     + +S  +A   L    K  + +  +   W     ++    T  + I   +    I+ I      + YLE  +P++S  CR++   + + +   IF I    VG+L  ++       Y   R  + E+   +M +++  I  +L+      + ++    +  +  VR  L     + + +  W+    F+   E  +  + + +   +   WK                  WQG A   D +       T CLKIRNM   ++   +  +  +++ +  +  D   I  +   +   +  VYV C S E AGKAF+ ++ ++F+G
Sbjct:  348 HYLSMFLLTAACLFFLLLGLTYLRMRG--------TSLTGEENLRSPEDLNVDQSTIVLMNTLQKLHEKLSKTAGDYICGDTDRRNVSVQEASQYLKTLGKEYEDEFNNTVAW-----ILQHSATRDVGIKCSSDPGSILNITS----VKYLESTLPRMSFMCRIRRAVITVAHRSSIFLIG---VGVLFGVLR------YMKYRWAKEEEETKQMYDMVVKIIDVLKSHNEACQENKDLEPYTPIPHVRDSLILPQDRKKMKKVWDRAVEFLDANESRVRTETQKIGGADFQVWKWIQPSSTCDKISVMPSKVWQGQAFHLDRRNSPPNSLTPCLKIRNMFDPVMEIGDHWDLAIQEAILEKCSDNEGIVHIAVDKNSREGCVYVKCLSPEFAGKAFKALHGSWFDG 729          
BLAST of Inner nuclear membrane protein Man1 (LEM domain-containing protein 3) vs. Ensembl Mouse
Match: Lemd3 (LEM domain containing 3 [Source:MGI Symbol;Acc:MGI:3580376])

HSP 1 Score: 80.8777 bits (198), Expect = 3.634e-15
Identity = 93/430 (21.63%), Postives = 184/430 (42.79%), Query Frame = 3
Query:  849 NHLPNILLGIVIVFSVLLFLSYILMKNRYSNLELELAMDGLTDKIGSKDRFTVEELPQLKFYLAKLYDILSEYSGEKTCEFLPDKRLSFTKARDILNHKLKREKSKSVSEGNWSQLMKMVILLPTDKLNIAGYNKDNEIVGIDGLPEHITYLEGLVPKLSMFCRLKMFAVHILNGIFYIACVIVGILLVLITGYFMNIYRVKRKQRNEKLVNEMREIISCISSLLQDQLRQAEYSQTTNKFLTVSKVRSILQKTYPKLQDEPYWEELKNFMYKIEPLIEMKETLAHG-EILEWK--------------SHLGWQGSAVQSDCQVKFGKGPTECLKIRNMDLINFD---EEGENY---LRQEVRNRLRDAGEIKDVQFLRKGSKVIVYVLCGSREVAGKAFRKVNANYFNGNLLNVKFIRLDKYLERFPES 2075
            ++L   LL    +F ++L L+Y+ M+      +  L  +   +  G   +    E   L   L KL+D L++ +G+  C     + LS  +A   L + L  E     +    + L+ +        +   GY  + ++  I      + +L+   P++  +CR +   + + + +  +   +V + + L        Y   R  + E+   +M +++  I  +L+      + ++    ++ +  VR  L +   + + +  W+   +F+   E  +  +     G + L W+                  WQG A   D +       T CLKIRNM    FD   E G+++   +++ +  +  D   I  +   R   +  VYV C S E AGKAF+ ++ ++F+G L+ VK++RLD+Y  RFP++
Sbjct:  479 HYLSMFLLTAACLFFLILGLTYLGMRGTGVPEDGGLIKNPFDETFG---KIQESEKNLLMSTLYKLHDRLAQIAGDHECGSSSQRMLSVQEAAAYLKN-LGPEYEDVFN----TSLLWIFKNGKDVGIRCVGYGPEEDLTNI----TDVQFLQSTRPQMPFWCRFRRAFITVTHRLLLLCLGVVLVCVALR-------YMRYRWTKEEEETRQMYDMVVKIIDVLRSHNEACQETKDLQPYMPLPHVRDSLIQPQDRKKMKKVWDRAVDFLAANESRVRTETRRVGGADFLVWRWIQPSASCDKTLVIPSKVWQGQAFHLDRRNSPPNSLTPCLKIRNM----FDPVMEIGDHWHLAIQEAILEKCSDNDGIVHIAVDRNSREGCVYVKCLSPEYAGKAFKALHGSWFDGKLVTVKYLRLDRYHHRFPQA 885          
BLAST of Inner nuclear membrane protein Man1 (LEM domain-containing protein 3) vs. Ensembl Mouse
Match: Lemd3 (LEM domain containing 3 [Source:MGI Symbol;Acc:MGI:3580376])

HSP 1 Score: 80.1073 bits (196), Expect = 6.111e-15
Identity = 99/443 (22.35%), Postives = 190/443 (42.89%), Query Frame = 3
Query:  849 NHLPNILLGIVIVFSVLLFLSYILMKNRYSNLELELAMDGLTDKIGSKDRFTVEELPQLKFYLAKLYDILSEYSGEKTCEFLPDKRLSFTKARDILN----HKLKREKS--KSVSEGNWSQLMKMVILLPTDKLNIAGYNKDNEIVGIDGLPEH-------ITYLEGLVPKLSMFCRLKMFAVHILNGIFYIACVIVGILLVLITGYFMNIYRVKRKQRNEKLVNEMREIISCISSLLQDQLRQAEYSQTTNKFLTVSKVRSILQKTYPKLQDEPYWEELKNFMYKIEPLIEMKETLAHG-EILEWK--------------SHLGWQGSAVQSDCQVKFGKGPTECLKIRNMDLINFD---EEGENY---LRQEVRNRLRDAGEIKDVQFLRKGSKVIVYVLCGSREVAGKAFRKVNANYFNGNLLNVKFIRLDKYLERFPES 2075
            ++L   LL    +F ++L L+Y+ M+      +  L  +   +  G   +    E   L   L KL+D L++ +G+  C     + LS  +A   L      K+  E    K++S+ + +   +   +  T  L I    KD  I  +   PE        + +L+   P++  +CR +   + + + +  +   +V + + L        Y   R  + E+   +M +++  I  +L+      + ++    ++ +  VR  L +   + + +  W+   +F+   E  +  +     G + L W+                  WQG A   D +       T CLKIRNM    FD   E G+++   +++ +  +  D   I  +   R   +  VYV C S E AGKAF+ ++ ++F+G L+ VK++RLD+Y  RFP++
Sbjct:  479 HYLSMFLLTAACLFFLILGLTYLGMRGTGVPEDGGLIKNPFDETFG---KIQESEKNLLMSTLYKLHDRLAQIAGDHECGSSSQRMLSVQEAAAYLKVHLVFKITAENLCFKTLSDASNNLGPEYEDVFNTSLLWIFKNGKDVGIRCVGYGPEEDLTNITDVQFLQSTRPQMPFWCRFRRAFITVTHRLLLLCLGVVLVCVALR-------YMRYRWTKEEEETRQMYDMVVKIIDVLRSHNEACQETKDLQPYMPLPHVRDSLIQPQDRKKMKKVWDRAVDFLAANESRVRTETRRVGGADFLVWRWIQPSASCDKTLVIPSKVWQGQAFHLDRRNSPPNSLTPCLKIRNM----FDPVMEIGDHWHLAIQEAILEKCSDNDGIVHIAVDRNSREGCVYVKCLSPEYAGKAFKALHGSWFDGKLVTVKYLRLDRYHHRFPQA 907          
BLAST of Inner nuclear membrane protein Man1 (LEM domain-containing protein 3) vs. UniProt/SwissProt
Match: sp|Q9Y2U8|MAN1_HUMAN (Inner nuclear membrane protein Man1 OS=Homo sapiens OX=9606 GN=LEMD3 PE=1 SV=2)

HSP 1 Score: 99.7525 bits (247), Expect = 3.148e-20
Identity = 98/473 (20.72%), Postives = 206/473 (43.55%), Query Frame = 3
Query:  711 LSDNEDNLMTRLRRNYFKKTGCSDVDAXXXXXXXXXXXXXXXFINWNHLPNILLGIVIVFSVLLFLSYILMKNRYSNLELELAMDGLTDKIGSKDRFTVEELPQLKFYLAKLYDILSEYSGEKTCEFLPDKRLSFTKARDILNHKLKREKSKSVSEGNWSQLMKMVILLPTD-KLNIAGYNKDNEIVGIDGLPEHITYLEGLVPKLSMFCRLKMFAVHILNGIFYIACVIVGILLVLITGYFMNIYRVKRKQRNEKLVNEMREIISCISSLLQDQLRQAEYSQTTNKFLTVSKVRSILQKTYPKLQDEPYWEELKNFMYKIEPLIEMK-ETLAHGEILEWK--------------SHLGWQGSAVQSDCQVKFGKGPTECLKIRNM--DLINFDEEGENYLRQEVRNRLRDAGEIKDVQFLRKGSKVIVYVLCGSREVAGKAFRKVNANYFNGNLLNVKFIRLDKYLERFPES 2075
            LS+ E+ L+ + +R     TG                       + ++L   LL    +F ++L L+Y+ M+    + + EL+++    +   K + + + L     Y  KL+D L++ +G+  C     + LS  +A   L   L  E      EG ++  ++ ++    D  +   G+  + E+  I      + +L+   P +S +CR +   V + + +  +    +G+++V +   +M      R  + E+   +M +++  I  +L+      + ++    ++ +  VR  L + + + + +  W+   +F+   E  +  +   +   + L W+                  WQG A   D +       T CLKIRNM   ++   ++    +++ +  +  D   I  +   +   +  VYV C S E AGKAF+ ++ ++F+G L+ VK++RLD+Y  RFP++
Sbjct:  446 LSEPEEELLQQFKREEVSPTGS---------------------FSAHYLSMFLLTAACLFFLILGLTYLGMRGTGVSEDGELSIENPFGETFGKIQESEKTLMMNTLY--KLHDRLAQLAGDHECGSSSQRTLSVQEAAAYLK-DLGPEY-----EGIFNTSLQWILENGKDVGIRCVGFGPEEELTNIT----DVQFLQSTRPLMSFWCRFRRAFVTVTHRLLLLC---LGVVMVCVVLRYMKY----RWTKEEEETRQMYDMVVKIIDVLRSHNEACQENKDLQPYMPIPHVRDSLIQPHDRKKMKKVWDRAVDFLAANESRVRTETRRIGGADFLVWRWIQPSASCDKILVIPSKVWQGQAFHLDRRNSPPNSLTPCLKIRNMFDPVMEIGDQWHLAIQEAILEKCSDNDGIVHIAVDKNSREGCVYVKCLSPEYAGKAFKALHGSWFDGKLVTVKYLRLDRYHHRFPQA 878          
BLAST of Inner nuclear membrane protein Man1 (LEM domain-containing protein 3) vs. UniProt/SwissProt
Match: sp|Q9WU40|MAN1_MOUSE (Inner nuclear membrane protein Man1 OS=Mus musculus OX=10090 GN=Lemd3 PE=1 SV=2)

HSP 1 Score: 81.2629 bits (199), Expect = 1.884e-14
Identity = 93/430 (21.63%), Postives = 184/430 (42.79%), Query Frame = 3
Query:  849 NHLPNILLGIVIVFSVLLFLSYILMKNRYSNLELELAMDGLTDKIGSKDRFTVEELPQLKFYLAKLYDILSEYSGEKTCEFLPDKRLSFTKARDILNHKLKREKSKSVSEGNWSQLMKMVILLPTDKLNIAGYNKDNEIVGIDGLPEHITYLEGLVPKLSMFCRLKMFAVHILNGIFYIACVIVGILLVLITGYFMNIYRVKRKQRNEKLVNEMREIISCISSLLQDQLRQAEYSQTTNKFLTVSKVRSILQKTYPKLQDEPYWEELKNFMYKIEPLIEMKETLAHG-EILEWK--------------SHLGWQGSAVQSDCQVKFGKGPTECLKIRNMDLINFD---EEGENY---LRQEVRNRLRDAGEIKDVQFLRKGSKVIVYVLCGSREVAGKAFRKVNANYFNGNLLNVKFIRLDKYLERFPES 2075
            ++L   LL    +F ++L L+Y+ M+      +  L  +   +  G   +    E   L   L KL+D L++ +G+  C     + LS  +A   L + L  E     +    + L+ +        +   GY  + ++  I      + +L+   P++  +CR +   + + + +  +   +V + + L        Y   R  + E+   +M +++  I  +L+      + ++    ++ +  VR  L +   + + +  W+   +F+   E  +  +     G + L W+                  WQG A   D +       T CLKIRNM    FD   E G+++   +++ +  +  D   I  +   R   +  VYV C S E AGKAF+ ++ ++F+G L+ VK++RLD+Y  RFP++
Sbjct:  482 HYLSMFLLTAACLFFLILGLTYLGMRGTGVPEDGGLIKNPFDETFG---KIQESEKNLLMSTLYKLHDRLAQIAGDHECGSSSQRMLSVQEAAAYLKN-LGPEYEDVFN----TSLLWIFKNGKDVGIRCVGYGPEEDLTNI----TDVQFLQSTRPQMPFWCRFRRAFITVTHRLLLLCLGVVLVCVALR-------YMRYRWTKEEEETRQMYDMVVKIIDVLRSHNEACQETKDLQPYMPLPHVRDSLIQPQDRKKMKKVWDRAVDFLAANESRVRTETRRVGGADFLVWRWIQPSASCDKTLVIPSKVWQGQAFHLDRRNSPPNSLTPCLKIRNM----FDPVMEIGDHWHLAIQEAILEKCSDNDGIVHIAVDRNSREGCVYVKCLSPEYAGKAFKALHGSWFDGKLVTVKYLRLDRYHHRFPQA 888          
BLAST of Inner nuclear membrane protein Man1 (LEM domain-containing protein 3) vs. UniProt/SwissProt
Match: sp|Q7JRE4|MAN1_DROME (Inner nuclear membrane protein Man1 OS=Drosophila melanogaster OX=7227 GN=MAN1 PE=1 SV=1)

HSP 1 Score: 67.0106 bits (162), Expect = 3.379e-10
Identity = 69/247 (27.94%), Postives = 116/247 (46.96%), Query Frame = 3
Query: 1392 VIVGILLVLITGYFMN-----IYRVKRK-------QRNEKLVNEMREIISCISSLLQDQLRQAEYSQTTNKFLTVSKVRSILQKTYPKLQDEPYWEELKNFMYKIEPLIEMKETLAHGEILEWKSHLG----WQGSAVQSDCQVKFGKGPTECLKIRNMDLINFDEEGENYLRQE-VRNRLRDAG---EIKDVQFLRKGSKVIVYVLCGSREVAGKAFRKVNANYFNGNLLNVKFIRLDKYLERFPE 2072
             ++G LL+++ G+ +      IYRVK+K       Q  + ++NE+  + S      Q +  +   +Q   KFL   K RS L  ++ K   +    + +     +    +   T+A    ++ K  +G    WQ  A   D   K    PT CLKIR+M   +  E  +  L+Q  V + +   G   +I DVQ         VY+ C S E AG   +++N  +F+  L+++KF+RL++YL RFP+
Sbjct:  400 TVIGALLLIVAGFLIVYVAVVIYRVKQKEALLAVDQFQKDIINELIYLSS------QSESPEVVINQLQEKFLPAKK-RSKLLSSWNKALKQLEKNDSRVLFGMVNRDGKAMRTIAWNRNVD-KKDVGLVKKWQSPAF--DNSNKIANPPTPCLKIRHM--FDSSEVDQANLKQSIVESIIEKVGTRCKICDVQL--DVQSCCVYIRCASEEDAGTIHKEINGWWFDKRLISIKFLRLERYLSRFPK 632          
BLAST of Inner nuclear membrane protein Man1 (LEM domain-containing protein 3) vs. TrEMBL
Match: A0A068XUB9 (Inner nuclear membrane protein man1 OS=Echinococcus multilocularis OX=6211 GN=EmuJ_001188000 PE=4 SV=1)

HSP 1 Score: 189.119 bits (479), Expect = 3.155e-47
Identity = 127/439 (28.93%), Postives = 224/439 (51.03%), Query Frame = 3
Query:  849 NHLPNILLGIVIVFSVLLFLSYILMKNRYSN------------LELELAMDGLTDKIGSKDRFTVEELPQLKFYLAKLYDILSEYSGEKTC-EFLPDKRLSFTKARDILNHKLKREKSKSVS----EGNWSQLMKMVILLPTDKLNIAGYNKDNEIVGIDGLPE----HITYLEGLVPKLSMFCRLKMFA---VHILNGIFYIACVIVGILLVLITGYFMNIYRVKRKQRN--EKLVNEMREIISCISSLLQDQLRQAEYSQTTNKFLTVSKVRSILQKTYPKLQDEPYWEELKNFMYKIEPLIEMKETLAHGEILEWKSHLGWQGSAVQSDCQ-VKFGKGPTECLKIRNM---DLINFDEEGENYLRQEVRNRLRDAGEIKDVQFLRKGSKVIVYVLCGSREVAGKAFRKVNANYFNGNLLNVKFIRLDKYLERFPES 2075
            N +PN++L   IV   ++  SY+L+K+++SN            L  E +   +   +        ++LP +   +  L++ILS ++GE  C E +   R+    A+ ++        + SV     +  WS ++ ++  +    L IA Y+ +       G P     ++  LE L P +   CRL++     +H L+ + ++       +L  + G+   IYR+K+ Q+N  +K    +REI+  +S +LQ QL+  + + T   ++ VS ++  L  T P L +   W E++++++ +E  I ++E    GE  +W++  GWQGSA+    Q + F   PTECLK+RNM   DL+  D   +  L +E+ NR+   G I  +    + ++ +VY+ C S  VAG+ F  +NANYF+ +LL VKF+R  KY  RFP++
Sbjct:  269 NQVPNLILFCGIVLLAVIVSSYLLLKDKHSNVGRIADLQKVVCLPEEHSERRMVAVLSRPSCINSQDLPPVLKIVHSLFEILSRFAGEHFCGESVESSRMEVETAKRLVESYFANHPAASVPVDQVDALWSSVLIIITEVGQRHLQIAAYDAN-------GQPSPDWSNVVELESLRPYIPGGCRLRLLTNSVLHFLSNLLWLL-----FILSAVGGFCYVIYRIKQSQQNRTKKRTMRIREIVREVSCILQQQLQHRKSNPTEPPYVPVSMIKERLSHTNPDLAE--LWTEVEHYVHLVEGSILVQEWRGVGETWQWQAGSGWQGSALLGKSQNLPFTTPPTECLKVRNMFTTDLM--DVSAKRRLIRELLNRVAMCGPILHIGLDSQNNQGLVYIKCASPVVAGRVFEAINANYFDSHLLTVKFLRASKYHLRFPDA 691          
BLAST of Inner nuclear membrane protein Man1 (LEM domain-containing protein 3) vs. TrEMBL
Match: A0A0R3X4M0 (LEM domain-containing protein OS=Hydatigena taeniaeformis OX=6205 GN=TTAC_LOCUS8351 PE=4 SV=1)

HSP 1 Score: 182.57 bits (462), Expect = 1.053e-44
Identity = 142/533 (26.64%), Postives = 242/533 (45.40%), Query Frame = 3
Query:  714 SDNEDNLMTRLRRNYFKKTGCSDVDAXXXXXXXXXXXXXXXFINWNHLPNILLGIVIVFSVLLFLSYILMKNRYSNLE-----------LELAMDGLTDKIGSKDR-FTVEELPQLKFYLAKLYDILSEYSGEKTC-EFLPDKRLSFTKARDILNHKLKREKSKSVSEGN----WSQLMKMVILLPTDKLNIAGYNKDNEIVGIDGLPEH-ITYLEGLVPKLSMFCRLKMFA---VHILNGIFYIACVIVGILLVLITGYFMNIYRVKRKQRN--EKLVNEMREIISCISSLLQDQLRQAEYSQTTNKFLTVSKVRSILQKTYPKLQDEPYWEELKNFMYKIEPLIEMKETLAHGEILEWKSHLGWQGSA-----------------------------VQSDCQVK----------FGKGPTECLKIRNM-----DLI--------NFDEEGENYLRQEVRNRLRDAGEIKDVQFLRKGSKVIVYVLCGSREVAGKAFRKVNANYFNGNLLNVKFIRLDKYLERFPESKIYV 2087
            SD   N    L    F+K+ CS +                 F   N +PN++L   I    ++  SY+L+K+++SN+             E     +T  + S+    + +ELP +   +  L++ILS ++GE  C + +   R+    A+ ++        + SVS       WS+++ M+  +    L IA Y+ D    G   +  H +  LE L P +   CRL++FA   +H LN + ++      ++L  + G+   IYR+K+ Q+N  +K    +REI+  +S +LQ QL+  + +     ++ VS ++  L  T   L +  +W E++++++ +E  I ++E    GE  +W++  GWQGS                                S C V+          F   PTECLKIRNM     D+         + D   +  L +E+ NR+   G I  +    + ++ +VY+ C S  VAG+ F  +NANYF+ +LL VKF+R  KY  RFP++   V
Sbjct:  272 SDKSSNCCQPLSEESFEKSICSKL---------------FGFSFGNQVPNLILFCGITLLAVIVSSYLLLKDKHSNVGRIADFQKVICLPEGHHKPVTTAVSSRQTCVSSQELPVILRIIHSLFEILSRFAGEYFCGDSVESSRMEVETAKRLVESYFADHPATSVSVNQVDDLWSKVLIMIAEVGQKHLQIAAYDSD----GHPSVNCHDVVELESLRPYIPGSCRLRLFAHSVLHFLNNLLWVL-----VILSAVGGFCYVIYRIKQSQQNRSKKRAMRVREIVREVSCILQQQLQHRQSNPPEPPYVPVSVIKERLSHTNSDLAE--FWTEVEHYVHLVEGSILVQEWRGVGETWQWQAGSGWQGSGKHLSVSSPHSSTTIANTANSLEGQPRSYTANSSCAVETLQGKSPHLPFTTPPTECLKIRNMFTRDADVFILTHLSRSSMDASAKRRLIRELLNRVAGCGPILHIGLDSQNNQGLVYMKCASPAVAGRVFEVINANYFDSHLLTVKFLRASKYHLRFPDAHSVV 778          
BLAST of Inner nuclear membrane protein Man1 (LEM domain-containing protein 3) vs. TrEMBL
Match: A0A0X3NR98 (LEM domain-containing protein OS=Schistocephalus solidus OX=70667 GN=TR137371 PE=4 SV=1)

HSP 1 Score: 181.03 bits (458), Expect = 1.849e-44
Identity = 125/425 (29.41%), Postives = 218/425 (51.29%), Query Frame = 3
Query:  852 HLPNILLGIVIVFSVLLFLSYILMKNRYSNLELELAMDGLTDKIGSKDRFTVEEL--PQ---LKFYLAK-LYDILSEYSGEKTC-EFLPDKRLSFTKARDILNHKLKREKSK------SVSEGNWSQLMKMVILLPTDKLNIAGYNKDNEIVGIDGLPEHITYLEGLVPKLSMFCRLKMFAVHILNGIFYIACVIVGILLVLITGYFMNIYRVKRKQRNEKLVNEMREIISCISSLLQDQLRQAEYSQTTNKFLTVSKVRSILQKTYPKLQDEPYWEELKNFMYKIEPLIEMKETLAHGEILEWKSHLGWQGSAVQSDCQ-VKFGKGPTECLKIRNM---DLINFDEEGENYLRQEVRNRLRDAGEIKDVQFLRKGSKVIVYVLCGSREVAGKAFRKVNANYFNGNLLNVKFIRLDKYLERFPES 2075
            H+PN++L       ++L   Y L+K+++ N+     +  L+  +G  +    E    PQ   +   LA  L +ILS Y+GE  C       R+    AR ++ + L    S+       + EG W  L+ ++  +    L+IA ++ D +  G     + I  LE L P +   CRL++     L  +  +  V+    +V +  + +  +R   K++ ++  + +RE++  ++ +LQ QL+  E +Q    ++ VS +RS L+++   + D   W EL+  ++ +E  I ++E    GE  +W+   GWQGSA+    Q + F   PTECLKIRNM   D ++FD   +  L++E+  R+   G I  +    + ++ +VY+ C   EVAG  ++ V+ANYF+ +LLNVKF+R  KY  RFPE+
Sbjct:  289 HVPNLILLAGFTLFIVLLSCYFLLKDKHGNVGRIADLQKLSCPVGDLEAHPREHCLNPQELSVSLNLAHILVEILSRYAGEHRCGHSAASPRMDVNTARRLVAYHLSAPDSRYSLRPSDLDEGGWRNLLFLIRHVGRKHLDIAPFSADGDDPGAY---KEIFELESLQPYIPGRCRLRLLFFSFLRLLATLLWVLFIFTVVGLCIFAVYRFRQSNKRQRDRRASRIRELVHQVTDILQQQLKNREVNQMEPPYVPVSTIRSTLRRSNSDVDD--LWSELEQHVHLVEGCILVQEWRGVGETWQWQGGSGWQGSALLDQTQRLPFTVPPTECLKIRNMFTMDKLDFD--AQKRLKREILKRVSGCGPIFHIGLDNQDNEGLVYLKCAGPEVAGNVYQAVHANYFDSHLLNVKFLRASKYYIRFPEA 706          
BLAST of Inner nuclear membrane protein Man1 (LEM domain-containing protein 3) vs. TrEMBL
Match: A0A183QIE2 (LEM domain-containing protein OS=Schistosoma rodhaini OX=6188 PE=4 SV=1)

HSP 1 Score: 181.415 bits (459), Expect = 2.752e-44
Identity = 123/431 (28.54%), Postives = 213/431 (49.42%), Query Frame = 3
Query:  849 NHLPNILLGIVIVFSVLLFLSYILMKNRYSNLE-----LELAMDGLTDKIGSKDRFTVE------ELPQLKFYLAKLYDILSEYSGEKTCEF--LPDKRLSFTKARDILNHKLKREKSKSVSEGN----WSQLMKMVILLPTDKLNIAGYNKDNEIVGIDGLPEHITYLEGLVPKLSMFCRLK---MFAVHILNGIFYIACVIVGILLVLITGYFMNIYRVKRKQRNEKLVNEMREIISCISSLLQDQLRQAEYSQTTNKFLTVSKVRSILQKTYPKLQDEPYWEELKNFMYKIEPLIEMKETLAHGEILEWKSHLGWQGSAVQSDCQ-VKFGKGPTECLKIRNM-DLINFDEEGENYLRQEVRNRLRDAGEIKDVQFLRKGSKVIVYVLCGSREVAGKAFRKVNANYFNGNLLNVKFIRLDKYLERFPES 2075
            +++PN++L   I+   +L  SY+++K+ +  +       +L        IG      ++      +L    + L  LYDILS Y+GE  C+   L   RL  + A  ++ H L+ +   + S+ +    W   + +++ +     ++   +     +G       IT LE L P     CRL+    +   +    F++  V    L++    Y + + R K+ +  E+    +RE+++ +  LLQDQLR+ E +     ++ V  +R  L++ +  L  +  W E+  ++Y++E  I ++E    GE  +W+S  GWQGSA+    Q   F   PTECLKIRNM    + DE G   +++E+  +L   G I  +     G+  +VY+ CG  E AG+ F  ++ANYF+G LL VKF+R +KY  RFPE+
Sbjct:  359 SNIPNLILISSIIVCFVLVASYLVLKDHHGEVGKMADVQKLLCRSSVRPIGCNSHLFIQRCLHEDDLTASLWVLGILYDILSRYAGEFYCKVGVLTSPRLDVSSAERLVEHSLQMKGWPTFSKTDFRRVWDNTLYVLLHVGKAHFSLVAVDVSKSELGPLNRVIQITELESLKPYFPGVCRLRRCFQWFAGVCVAFFWVVLVC---LIIFGVCYGVYLLRCKKLRALERQNCRVRELVAEVVYLLQDQLRENEANANQPPYVPVYMIRERLRQKHHDL--DRLWPEVTRYVYEVETCIGVQEWRGVGETWQWQSGTGWQGSALMDTSQKPSFIVPPTECLKIRNMFSTESIDERGRKRIKRELLKKLAPCGPILHIGLDSVGTNGLVYIKCGDPETAGRVFHSIHANYFDGRLLTVKFLRDNKYCLRFPEA 784          
BLAST of Inner nuclear membrane protein Man1 (LEM domain-containing protein 3) vs. TrEMBL
Match: G4VBH6 (Putative peptide chain release factor OS=Schistosoma mansoni OX=6183 GN=Smp_211100 PE=4 SV=1)

HSP 1 Score: 179.104 bits (453), Expect = 1.653e-43
Identity = 122/430 (28.37%), Postives = 211/430 (49.07%), Query Frame = 3
Query:  849 NHLPNILLGIVIVFSVLLFLSYILMKNRYSNLELELAMDGLTDKI----------GSKDRFTVEELPQLKFYLAKLYDILSEYSGEKTCEF--LPDKRLSFTKARDILNHKLKREKSKSVSEGN----WSQLMKMVILLPTDKLNIAGYNKDNEIVGIDGLPEHITYLEGLVPKLSMFCRLK---MFAVHILNGIFYIACVIVGILLVLITGYFMNIYRVKRKQRNEKLVNEMREIISCISSLLQDQLRQAEYSQTTNKFLTVSKVRSILQKTYPKLQDEPYWEELKNFMYKIEPLIEMKETLAHGEILEWKSHLGWQGSAVQSDCQ-VKFGKGPTECLKIRNM-DLINFDEEGENYLRQEVRNRLRDAGEIKDVQFLRKGSKVIVYVLCGSREVAGKAFRKVNANYFNGNLLNVKFIRLDKYLERFPES 2075
            +++PN++L   I+   +L  SY+++K+ +  +     +  L  +           G       ++L    + L  LYDILS Y+GE  C+   L   RL  + A  ++ H L+ +   + S+ +    W   + +++ +     ++   +     +G       IT LE L P     CRL+    +   +    F++  V    L++    Y + + R K+ +  E+    +RE+++ +  LLQDQLR+ E       ++ V  +R  L++ +  L  +  W E+  ++Y++E  I ++E    GE  +W+S  GWQGSA+    Q   F   PTECLKIRNM    + DE G   +++E+  +L   G I  +     G+  +VY+ CG  E AG+ F  ++ANYF+G LL VKF+R +KY  RFPE+
Sbjct:  357 SNIPNLILISSIIVCFVLVASYLVLKDHHGEVGKMADVQKLLCRSSGDYNNSLTKGLHRCLHEDDLTASLWVLGILYDILSRYAGEFYCKVGVLTSPRLDVSSAERLVEHSLQMKGWPTFSKTDFRRVWDNTLYVLLHVGKAHFSLVAVDVSKSELGPLNRVIQITELESLKPYFPGVCRLRRCFQWFAGVCVAFFWVVLVC---LIIFGVCYGVYLLRCKKLRALERQNCRVRELVAEVVHLLQDQLRENEADANQPPYVPVYMIRERLRQKHHDL--DRLWPEVTRYVYEVETCIGVQEWRGVGETWQWQSGTGWQGSALMDTSQKPSFIVPPTECLKIRNMFSTESIDERGRKRIKRELLKKLAPCGPILHIGLDSVGTNGLVYIKCGDPETAGRVFHSIHANYFDGRLLTVKFLRDNKYCLRFPEA 781          
BLAST of Inner nuclear membrane protein Man1 (LEM domain-containing protein 3) vs. Ensembl Cavefish
Match: lemd3 (LEM domain containing 3 [Source:NCBI gene;Acc:103030525])

HSP 1 Score: 92.0485 bits (227), Expect = 9.785e-19
Identity = 75/283 (26.50%), Postives = 132/283 (46.64%), Query Frame = 3
Query: 1293 ITYLEGLVPKLSMFCRLKMFAVHILNGIFYIACVIVGILLVLITGYFMNIYRVK-RKQRNEKLVNEMREIISCISSLLQDQLRQAEYSQTTNKFLTVSKVRSILQKTYPKLQDEPYWEELKNFMYKIEPLIEMK-ETLAHGEILEWK--------SHLG------WQGSAVQSDCQVKFGKGPTECLKIRNMDLINFD---EEGENY---LRQEVRNRLRDAGEIKDVQFLRKGSKVIVYVLCGSREVAGKAFRKVNANYFNGNLLNVKFIRLDKYLERFPES 2075
            I+ LE   P+LS  CR +          F+     V ++L  + G++  +Y +K R +R E+   +M +++  I  +L+      + +     +L +  VR  L +   + + +  W+    F+   E  I  + + +   + L W+          +G      WQG A   D +       T CLKIRNM    FD   E GEN+   + + +  +  D   I  +   +   +  VYV C S E AGKAF+ ++ ++F+G L+ VK++RLD+Y +RFP++
Sbjct:  582 ISRLESTHPRLSFVCRFRR--------AFFTVIYRVVLVLAAVGGFWGLVYYMKYRWRREEEETRQMYDMVERIIDVLRSHNEACQENNDLQPYLPIVHVRDSLVQPQDRRKMKKVWDRSMTFLSANESRIRTETQRIGGADFLVWRWLQPSMSCDKMGSIPSKMWQGKAFPLDRRNSPPNSLTPCLKIRNM----FDPVMEVGENWHLAIHEAILEKCSDNDGIVHIAVDKNSREGCVYVKCLSAEHAGKAFKALHGSWFDGKLVTVKYLRLDRYHQRFPQA 852          
BLAST of Inner nuclear membrane protein Man1 (LEM domain-containing protein 3) vs. Ensembl Cavefish
Match: lemd3 (LEM domain containing 3 [Source:NCBI gene;Acc:103030525])

HSP 1 Score: 91.6633 bits (226), Expect = 1.059e-18
Identity = 75/283 (26.50%), Postives = 132/283 (46.64%), Query Frame = 3
Query: 1293 ITYLEGLVPKLSMFCRLKMFAVHILNGIFYIACVIVGILLVLITGYFMNIYRVK-RKQRNEKLVNEMREIISCISSLLQDQLRQAEYSQTTNKFLTVSKVRSILQKTYPKLQDEPYWEELKNFMYKIEPLIEMK-ETLAHGEILEWK--------SHLG------WQGSAVQSDCQVKFGKGPTECLKIRNMDLINFD---EEGENY---LRQEVRNRLRDAGEIKDVQFLRKGSKVIVYVLCGSREVAGKAFRKVNANYFNGNLLNVKFIRLDKYLERFPES 2075
            I+ LE   P+LS  CR +          F+     V ++L  + G++  +Y +K R +R E+   +M +++  I  +L+      + +     +L +  VR  L +   + + +  W+    F+   E  I  + + +   + L W+          +G      WQG A   D +       T CLKIRNM    FD   E GEN+   + + +  +  D   I  +   +   +  VYV C S E AGKAF+ ++ ++F+G L+ VK++RLD+Y +RFP++
Sbjct:  582 ISRLESTHPRLSFVCRFRR--------AFFTVIYRVVLVLAAVGGFWGLVYYMKYRWRREEEETRQMYDMVERIIDVLRSHNEACQENNDLQPYLPIVHVRDSLVQPQDRRKMKKVWDRSMTFLSANESRIRTETQRIGGADFLVWRWLQPSMSCDKMGSIPSKMWQGKAFPLDRRNSPPNSLTPCLKIRNM----FDPVMEVGENWHLAIHEAILEKCSDNDGIVHIAVDKNSREGCVYVKCLSAEHAGKAFKALHGSWFDGKLVTVKYLRLDRYHQRFPQA 852          
BLAST of Inner nuclear membrane protein Man1 (LEM domain-containing protein 3) vs. Ensembl Sea Lamprey
Match: ENSPMAT00000005194.1 (pep scaffold:Pmarinus_7.0:GL478719:15016:34097:-1 gene:ENSPMAG00000004690.1 transcript:ENSPMAT00000005194.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 92.4337 bits (228), Expect = 5.862e-20
Identity = 97/395 (24.56%), Postives = 172/395 (43.54%), Query Frame = 3
Query:  966 GLTDKIGSKDRFTVEELPQLKFYLAKLYDILSEYSGEKTCE---FLPDKRLSFTKARDILNHKLKREKSKSVSEGNWSQLMKMVILLPTD-KLNIAGYNKDNEIVGIDGLPEHITYLEGLVPKLSMFCRLKMFAVHILNGIFYIACVIVGILLVLITGYFMNIYRVKRKQRNEKLVNEMREIISCISSLLQDQLRQAEYSQTTNKFLTVSKVRSILQKTYPKLQDEPYWEELKNFMYKIEPLIEMKETLAHGE---ILEWKSHLG------------WQGSAVQSDCQVKFGKGPTECLKIRNMDLINFD---EEGENY---LRQEVRNRLRDAGEIKDVQFLRKGSKVIVYVLCGSREVAGKAFRKVNANYFNGNLLNVKFIRLDKYLERFPES 2075
            GLT ++  KD++ +  +      L KLYD L+  +G+  C     +  +R+SF  A   +        S  V+E  ++  ++ +I    D  + + G + + E+  +      + YLE   P+ S  CRL+   + +L+ +F I    VGI+L ++       Y   R ++ E+    M +++  I  +L+        +++    L +  VR  L     + +    W     F+   E  +  +     GE   +  W                 WQG A   D +       T CLKIRNM    FD   E GE +   +   +  +  D G I  ++  +   +  VYV C S E AGKAF+ ++ ++F+G L+ VK++ L++Y +RFP +
Sbjct:   98 GLTARL--KDKYFLLSM------LNKLYDHLATIAGDLDCGDHVHIKSRRISFVDAYAFIT-----STSPLVNESMFNASLQTIIGSEADLGIRLLGEDTEQEVANLVD----VRYLESTHPQRSFICRLRRAFLTVLHKMF-IVFAGVGIVLGVLA------YMKYRWRKEEEETRNMYDLVERIIDMLRSHSENCVENKSLQPVLPLPHVRDTLIPLQERRRMGRVWRRAVAFIAANESRVRTERQRMAGEDCEVWRWTQAAATAPPPGKLPAKIWQGKAFHLDRRNSPLHSLTPCLKIRNM----FDPDMEIGEKWHLSIHDAIMEKCHDNGGIVHIEVDKTSHEGCVYVKCLSPEHAGKAFKSLHGSWFDGKLVTVKYLWLERYHQRFPHA 464          
BLAST of Inner nuclear membrane protein Man1 (LEM domain-containing protein 3) vs. Ensembl Sea Lamprey
Match: ENSPMAT00000002717.1 (pep scaffold:Pmarinus_7.0:GL501202:12393:14583:1 gene:ENSPMAG00000002478.1 transcript:ENSPMAT00000002717.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 46.2098 bits (108), Expect = 3.777e-6
Identity = 39/158 (24.68%), Postives = 73/158 (46.20%), Query Frame = 3
Query: 1293 ITYLEGLVPKLSMFCRLKMFAVHILNGIFYIACVIVGILLVLITGYFMNIY-RVKRKQRNEKLVNEMREIISCISSLLQDQLRQAEYSQTTNKFLTVSKVRSILQKTYPKLQDEPYWEELKNFMYKIEPLIEMKETLAHG---EILEWKSHLGWQGSA 1754
            + +LE +  + S  CRL+       N +      ++ I LV+   + + +Y ++  KQ+ E+   ++ E++  IS ++Q Q+  ++ +     FL +  VR  L K   + +  P WE+   F+   E  I  +  L HG   E+  W S     GS+
Sbjct:   16 VKFLESIHLQRSFVCRLR-------NAVVQTIVRLLLIFLVIAVLWGLYLYAKLWLKQKRER-KTQVFELVEKISEMVQQQMLDSQTNWRVEPFLPIPHVRDSLIKPQDRDRMRPVWEQAVQFIDAGESRIRTENQLLHGQDCEVWRWTSLPTSPGSS 165          
BLAST of Inner nuclear membrane protein Man1 (LEM domain-containing protein 3) vs. Ensembl Nematostella
Match: EDO41725 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S3H2])

HSP 1 Score: 92.0485 bits (227), Expect = 3.066e-20
Identity = 85/320 (26.56%), Postives = 146/320 (45.62%), Query Frame = 3
Query: 1203 MVILLPTDKLNIAGYNKDNEIVGIDGLPEHITYLEGLVPKLSMFCRLKMFAVHILNGIFYIACVIVGILLVLITGYFMNIYRVKRKQRNEKLVNEMREIISCISSLLQDQLRQAEYSQTTNKFLTVSKVRSILQKTYPKLQDEPYWEELKNFMYKIEPLIEMKETLAHGEILE-WKS-HLG-------------------WQGSAVQSDCQVKFGK---GPTECLKIRNMDLINFD-----EEGENYLRQE-VRNRLRDAGE-IKDVQFLRKGSKVIVYVLCGSREVAGKAFRKVNANYFNGNLLNVKFIRLDKYLERFP 2069
            M+ L+ + +  +  Y+KDN+       P    ++EG      + CRL+  A  I+ GIF +   ++GIL  +   YF+  +R ++++ + +L   M   +  I  +L+      +  +    +L +  VR +L K   + +    W+    F+   E  I ++     GE  E W+  H+                    WQG A + + Q         PT CLKIRNM    FD     EEG + L Q+ +  +  DAG  I  +   +  ++  VYV C S + AG AF+ ++  +F+G L+ VK++ L +Y +RFP
Sbjct:    1 MLELINSKQWGMKLYDKDNK----SASPSEAYWIEGTHAYKPILCRLRQSASKII-GIFILVTCVLGILCGI---YFLVRHRWRKEEEDVRL---MYTFVENIIDILRKHHNACQNDKDLPPYLPIPHVRDMLIKPANRKKLAKTWQRAVRFLSANESRIRVESQRIAGEDFEVWRWIHIASSRQQSQKMGAMGSPKGKFWQGQAFE-NFQWAVNPPIISPTPCLKIRNM----FDHEVEMEEGWHVLIQDAILEKCSDAGANIVHIAVDKSSNEGCVYVKCDSHDSAGIAFKSLHGCWFDGRLVAVKYLTLKRYHQRFP 304          
BLAST of Inner nuclear membrane protein Man1 (LEM domain-containing protein 3) vs. Ensembl Medaka
Match: lemd3 (LEM domain containing 3 [Source:NCBI gene;Acc:101162412])

HSP 1 Score: 76.2554 bits (186), Expect = 6.060e-14
Identity = 69/283 (24.38%), Postives = 124/283 (43.82%), Query Frame = 3
Query: 1293 ITYLEGLVPKLSMFCRLKMFAVHILNGIFYIACVIVGILLVLITGYFMNIYRVKRKQRNEKLVNEMREIISCISSLLQDQLRQAEYSQTTNKFLTVSKVRSILQKTYPKLQDEPYWEELKNFMYKIEPLIEMK-ETLAHGEILEWK--------------SHLGWQGSAVQSDCQVKFGKGPTECLKIRNMDLINFD---EEGENY---LRQEVRNRLRDAGEIKDVQFLRKGSKVIVYVLCGSREVAGKAFRKVNANYFNGNLLNVKFIRLDKYLERFPESK 2078
            I+ LE   P++   CRL+   V +  G   +       ++  +  Y    +R     R E+   +M +++  I  +L+      + +Q    +L +  VR  L     + + +  W     F+   E  I  + + +   + L W+                  WQG A   D +       T CLKIRNM    FD   E GEN+   + + +  +  D   I  +   +   +  VYV C + E +GKAF+ ++ ++F+G L+ VK++RLD+Y +RFP+++
Sbjct:  507 ISQLESTRPRMPFTCRLRKAFVTV--GSKVLLVAAAAAMVWGVVRYLRFRWR-----RQEEETRQMYDMVERIIDVLRTHGEACQENQDLLPYLPIPHVRDSLVLPQDRKKMKKIWGRAVCFLSANESRIRTETQRIGGADFLVWRWIQPSLSCDKANPMPSKVWQGQAFPLDRRNSPPNSLTPCLKIRNM----FDPVMEVGENWDLAIHEAILEKCSDNDGIVHIAVDKNSREGCVYVKCLTAEHSGKAFKALHGSWFDGKLVTVKYLRLDRYHQRFPQAQ 778          
BLAST of Inner nuclear membrane protein Man1 (LEM domain-containing protein 3) vs. Planmine SMEST
Match: SMESG000070262.1 (SMESG000070262.1)

HSP 1 Score: 1056.97 bits (2732), Expect = 0.000e+0
Identity = 572/581 (98.45%), Postives = 575/581 (98.97%), Query Frame = 3
Query:   12 MADLTNSEIRNILKSYGEEIGPITSTTRNIYLKKIEGLQKSKIHPTKSIRKSEQIPTXXXXXXXXXXXXXXQIAPSNILSINENGNRGKKSQLDTSSETSFRTPLYNNKYTSPYKQNEPRFNHLDSRSSINESYSSMDSDLQIFAEDNYRKELKGKNVSPIQYMKGTGSTFYRLSDYXXXXXXXXXXXXXXXVQAXXXXXXXXXWYNGSFGTISNYFTSRKVNEDLMDISDCDLSDNEDNLMTRLRRNYFKKTGCSDVDAXXXXXXXXXXXXXXXFINWNHLPNILLGIVIVFSVLLFLSYILMKNRYSNLELELAMDGLTDKIGSKDRFTVEELPQLKFYLAKLYDILSEYSGEKTCEFLPDKRLSFTKARDILNHKLKREKSKSVSEGNWSQLMKMVILLPTDKLNIAGYNKDNEIVGIDGLPEHITYLEGLVPKLSMFCRLKMFAVHILNGIFYIACVIVGILLVLITGYFMNIYRVKRKQRNEKLVNEMREIISCISSLLQDQLRQAEYSQTTNKFLTVSKVRSILQKTYPKLQDEPYWEELKNFMYKIEPLIEMKETLAHGEILEWKSHLGWQGSA 1754
            MADLTNSEIRNILKSYGEEIGPITSTTRNIYLKKIEGLQKSKIHPTKSIRKSEQIPTNTSNFSSSKSNVASQIAPSNILSINENGNRGKKSQLDTSSETSFRTPLYNNKYTSPYKQ EPRFNHLDSRSSINESYSSMDSDLQIFAEDNYRKELKGKNVSPIQYMKGTGSTFYRLSDYSPTKSTNKNYTTSNPVQANSSNKNNNKWYNGSFGTISNYFTSRKVNEDLMDISDCDLSDNEDNLMTRLRRNYFKKTG SDVDATKTK KQ S KIESSFINWN+LPNILLGIVIVFSVLLFLSYILMKNRYSNLELELAMDGLTDKIGSKDRFTVEELPQLKFYLAKLYDILSEYSGEKTCEFLPDKRLSFTKARDILNHKLKREK+KSVSEGNWSQLMKMVILLPTDKLNIAGYNKDNEIVGIDGLPEHITYLEGLVPKLSMFCRLKMFAVHILNGIFY+ACVIVGILLVLITGYFMNIYRVKRKQRNEKLVNEMREIISCISSLLQDQLRQAEYSQTTNKFLTVSKVRSILQKTYPKLQDEPYWEELKNFMYKIEPLIEMKETLAHGEILEWKSHLGWQGS 
Sbjct:    1 MADLTNSEIRNILKSYGEEIGPITSTTRNIYLKKIEGLQKSKIHPTKSIRKSEQIPTNTSNFSSSKSNVASQIAPSNILSINENGNRGKKSQLDTSSETSFRTPLYNNKYTSPYKQTEPRFNHLDSRSSINESYSSMDSDLQIFAEDNYRKELKGKNVSPIQYMKGTGSTFYRLSDYSPTKSTNKNYTTSNPVQANSSNKNNNKWYNGSFGTISNYFTSRKVNEDLMDISDCDLSDNEDNLMTRLRRNYFKKTG-SDVDATKTKLKQPSTKIESSFINWNNLPNILLGIVIVFSVLLFLSYILMKNRYSNLELELAMDGLTDKIGSKDRFTVEELPQLKFYLAKLYDILSEYSGEKTCEFLPDKRLSFTKARDILNHKLKREKAKSVSEGNWSQLMKMVILLPTDKLNIAGYNKDNEIVGIDGLPEHITYLEGLVPKLSMFCRLKMFAVHILNGIFYVACVIVGILLVLITGYFMNIYRVKRKQRNEKLVNEMREIISCISSLLQDQLRQAEYSQTTNKFLTVSKVRSILQKTYPKLQDEPYWEELKNFMYKIEPLIEMKETLAHGEILEWKSHLGWQGSG 580          
BLAST of Inner nuclear membrane protein Man1 (LEM domain-containing protein 3) vs. Planmine SMEST
Match: SMESG000070262.1 (SMESG000070262.1)

HSP 1 Score: 1013.83 bits (2620), Expect = 0.000e+0
Identity = 556/581 (95.70%), Postives = 559/581 (96.21%), Query Frame = 3
Query:   12 MADLTNSEIRNILKSYGEEIGPITSTTRNIYLKKIEGLQKSKIHPTKSIRKSEQIPTXXXXXXXXXXXXXXQIAPSNILSINENGNRGKKSQLDTSSETSFRTPLYNNKYTSPYKQNEPRFNHLDSRSSINESYSSMDSDLQIFAEDNYRKELKGKNVSPIQYMKGTGSTFYRLSDYXXXXXXXXXXXXXXXVQAXXXXXXXXXWYNGSFGTISNYFTSRKVNEDLMDISDCDLSDNEDNLMTRLRRNYFKKTGCSDVDAXXXXXXXXXXXXXXXFINWNHLPNILLGIVIVFSVLLFLSYILMKNRYSNLELELAMDGLTDKIGSKDRFTVEELPQLKFYLAKLYDILSEYSGEKTCEFLPDKRLSFTKARDILNHKLKREKSKSVSEGNWSQLMKMVILLPTDKLNIAGYNKDNEIVGIDGLPEHITYLEGLVPKLSMFCRLKMFAVHILNGIFYIACVIVGILLVLITGYFMNIYRVKRKQRNEKLVNEMREIISCISSLLQDQLRQAEYSQTTNKFLTVSKVRSILQKTYPKLQDEPYWEELKNFMYKIEPLIEMKETLAHGEILEWKSHLGWQGSA 1754
            MADLTNSEIRNILKSYGEEIGPITSTTRNIYLKKIEGLQKSKIHPTKSIRKSEQIPTNTSNFSSSKSNVASQIAPSNILSINENGNRGKKSQLDTSSETSFRTPLYNNKYTSPYKQ EPRFNHLDSRSSINESYSSMDSDLQIFAEDNYRKELKGKNVSPIQYMKGTGSTFYRLSDYSPTKSTNKNYTTSNPVQANSSNKNNN                RKVNEDLMDISDCDLSDNEDNLMTRLRRNYFKKTG SDVDATKTK KQ S KIESSFINWN+LPNILLGIVIVFSVLLFLSYILMKNRYSNLELELAMDGLTDKIGSKDRFTVEELPQLKFYLAKLYDILSEYSGEKTCEFLPDKRLSFTKARDILNHKLKREK+KSVSEGNWSQLMKMVILLPTDKLNIAGYNKDNEIVGIDGLPEHITYLEGLVPKLSMFCRLKMFAVHILNGIFY+ACVIVGILLVLITGYFMNIYRVKRKQRNEKLVNEMREIISCISSLLQDQLRQAEYSQTTNKFLTVSKVRSILQKTYPKLQDEPYWEELKNFMYKIEPLIEMKETLAHGEILEWKSHLGWQGS 
Sbjct:    1 MADLTNSEIRNILKSYGEEIGPITSTTRNIYLKKIEGLQKSKIHPTKSIRKSEQIPTNTSNFSSSKSNVASQIAPSNILSINENGNRGKKSQLDTSSETSFRTPLYNNKYTSPYKQTEPRFNHLDSRSSINESYSSMDSDLQIFAEDNYRKELKGKNVSPIQYMKGTGSTFYRLSDYSPTKSTNKNYTTSNPVQANSSNKNNN--------------KCRKVNEDLMDISDCDLSDNEDNLMTRLRRNYFKKTG-SDVDATKTKLKQPSTKIESSFINWNNLPNILLGIVIVFSVLLFLSYILMKNRYSNLELELAMDGLTDKIGSKDRFTVEELPQLKFYLAKLYDILSEYSGEKTCEFLPDKRLSFTKARDILNHKLKREKAKSVSEGNWSQLMKMVILLPTDKLNIAGYNKDNEIVGIDGLPEHITYLEGLVPKLSMFCRLKMFAVHILNGIFYVACVIVGILLVLITGYFMNIYRVKRKQRNEKLVNEMREIISCISSLLQDQLRQAEYSQTTNKFLTVSKVRSILQKTYPKLQDEPYWEELKNFMYKIEPLIEMKETLAHGEILEWKSHLGWQGSG 566          
BLAST of Inner nuclear membrane protein Man1 (LEM domain-containing protein 3) vs. Planmine SMEST
Match: SMESG000070249.1 (SMESG000070249.1)

HSP 1 Score: 820.461 bits (2118), Expect = 0.000e+0
Identity = 452/472 (95.76%), Postives = 459/472 (97.25%), Query Frame = 3
Query:  339 YTSPYKQNEPRFNHLDSRSSINESYSSMDSDLQIFAEDNYRKELKGKNVSPIQYMKGTGSTFYRLSDYXXXXXXXXXXXXXXXVQAXXXXXXXXXWYNGSFGTISNYFTSRKVNEDLMDISDCDLSDNEDNLMTRLRRNYFKKTGCSDVDAXXXXXXXXXXXXXXXFINWNHLPNILLGIVIVFSVLLFLSYILMKNRYSNLELELAMDGLTDKIGSKDRFTVEELPQLKFYLAKLYDILSEYSGEKTCEFLPDKRLSFTKARDILNHKLKREKSKSVSEGNWSQLMKMVILLPTDKLNIAGYNKDNEIVGIDGLPEHITYLEGLVPKLSMFCRLKMFAVHILNGIFYIACVIVGILLVLITGYFMNIYRVKRKQRNEKLVNEMREIISCISSLLQDQLRQAEYSQTTNKFLTVSKVRSILQKTYPKLQDEPYWEELKNFMYKIEPLIEMKETLAHGEILEWKSHLGWQGSA 1754
            YTSPYK+ EP+FNHLDSRSSINESYSSMDSDLQIFAEDNYRKELKGKNVSPI+YMKGTGSTFYRLSDYSPTK TNKN TTSNPVQ+NSSNKNNNKW NGSFGTISNYFT RKVNEDLMDISD D SD+EDNL+TRLRRNY KKTG SDVDATKTKSKQ S KIESSFINWNHLPNILLGIVIVFSVLLFLSYILMKNRYSNLELELAMDGLTDKIGSKDRFTVEELPQLKFYLAKLYDILSEYSGEKTCEFLPDKRLSFTKARDILNHKLKREK+KSVS GNWSQLMKMVILLPTDKLNIAGYNKDNEIVGIDGLPEHITYLEGLVPKLSMFCRLKMFAVHILNGIFYIACVIVGILLVLITGYFMNIYRVKRKQRNEKLVNEMREIISCISSLLQDQLRQAEYSQTTNKFLTVSKVRSILQKTYPKLQDEPYWEELKNFMYKIEPLIEMKETLAHGEILEWKSHLGWQGS 
Sbjct:   16 YTSPYKRTEPQFNHLDSRSSINESYSSMDSDLQIFAEDNYRKELKGKNVSPIKYMKGTGSTFYRLSDYSPTKFTNKNSTTSNPVQSNSSNKNNNKWNNGSFGTISNYFTGRKVNEDLMDISDSDFSDDEDNLITRLRRNYLKKTGSSDVDATKTKSKQPSTKIESSFINWNHLPNILLGIVIVFSVLLFLSYILMKNRYSNLELELAMDGLTDKIGSKDRFTVEELPQLKFYLAKLYDILSEYSGEKTCEFLPDKRLSFTKARDILNHKLKREKAKSVSGGNWSQLMKMVILLPTDKLNIAGYNKDNEIVGIDGLPEHITYLEGLVPKLSMFCRLKMFAVHILNGIFYIACVIVGILLVLITGYFMNIYRVKRKQRNEKLVNEMREIISCISSLLQDQLRQAEYSQTTNKFLTVSKVRSILQKTYPKLQDEPYWEELKNFMYKIEPLIEMKETLAHGEILEWKSHLGWQGSV 487          
BLAST of Inner nuclear membrane protein Man1 (LEM domain-containing protein 3) vs. Planmine SMEST
Match: SMESG000070263.1 (SMESG000070263.1)

HSP 1 Score: 184.496 bits (467), Expect = 1.621e-55
Identity = 91/91 (100.00%), Postives = 91/91 (100.00%), Query Frame = 3
Query: 1818 MDLINFDEEGENYLRQEVRNRLRDAGEIKDVQFLRKGSKVIVYVLCGSREVAGKAFRKVNANYFNGNLLNVKFIRLDKYLERFPESKIYVK 2090
            MDLINFDEEGENYLRQEVRNRLRDAGEIKDVQFLRKGSKVIVYVLCGSREVAGKAFRKVNANYFNGNLLNVKFIRLDKYLERFPESKIYVK
Sbjct:    1 MDLINFDEEGENYLRQEVRNRLRDAGEIKDVQFLRKGSKVIVYVLCGSREVAGKAFRKVNANYFNGNLLNVKFIRLDKYLERFPESKIYVK 91          
The following BLAST results are available for this feature:
BLAST of Inner nuclear membrane protein Man1 (LEM domain-containing protein 3) vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 1
Match NameE-valueIdentityDescription
LEMD36.555e-2120.72LEM domain containing 3 [Source:HGNC Symbol;Acc:HG... [more]
back to top
BLAST of Inner nuclear membrane protein Man1 (LEM domain-containing protein 3) vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Inner nuclear membrane protein Man1 (LEM domain-containing protein 3) vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 3
Match NameE-valueIdentityDescription
MAN13.371e-1127.94gene:FBgn0034962 transcript:FBtr0072167[more]
MAN13.371e-1127.94gene:FBgn0034962 transcript:FBtr0345949[more]
MAN13.371e-1127.94gene:FBgn0034962 transcript:FBtr0072166[more]
back to top
BLAST of Inner nuclear membrane protein Man1 (LEM domain-containing protein 3) vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 1
Match NameE-valueIdentityDescription
lemd32.823e-2124.37LEM domain containing 3 [Source:ZFIN;Acc:ZDB-GENE-... [more]
back to top
BLAST of Inner nuclear membrane protein Man1 (LEM domain-containing protein 3) vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 2
Match NameE-valueIdentityDescription
lemd35.999e-1821.73LEM domain containing 3 [Source:NCBI gene;Acc:1000... [more]
lemd34.342e-1020.34LEM domain containing 3 [Source:NCBI gene;Acc:1000... [more]
back to top
BLAST of Inner nuclear membrane protein Man1 (LEM domain-containing protein 3) vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 2
Match NameE-valueIdentityDescription
Lemd33.634e-1521.63LEM domain containing 3 [Source:MGI Symbol;Acc:MGI... [more]
Lemd36.111e-1522.35LEM domain containing 3 [Source:MGI Symbol;Acc:MGI... [more]
back to top
BLAST of Inner nuclear membrane protein Man1 (LEM domain-containing protein 3) vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 3
Match NameE-valueIdentityDescription
sp|Q9Y2U8|MAN1_HUMAN3.148e-2020.72Inner nuclear membrane protein Man1 OS=Homo sapien... [more]
sp|Q9WU40|MAN1_MOUSE1.884e-1421.63Inner nuclear membrane protein Man1 OS=Mus musculu... [more]
sp|Q7JRE4|MAN1_DROME3.379e-1027.94Inner nuclear membrane protein Man1 OS=Drosophila ... [more]
back to top
BLAST of Inner nuclear membrane protein Man1 (LEM domain-containing protein 3) vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A068XUB93.155e-4728.93Inner nuclear membrane protein man1 OS=Echinococcu... [more]
A0A0R3X4M01.053e-4426.64LEM domain-containing protein OS=Hydatigena taenia... [more]
A0A0X3NR981.849e-4429.41LEM domain-containing protein OS=Schistocephalus s... [more]
A0A183QIE22.752e-4428.54LEM domain-containing protein OS=Schistosoma rodha... [more]
G4VBH61.653e-4328.37Putative peptide chain release factor OS=Schistoso... [more]
back to top
BLAST of Inner nuclear membrane protein Man1 (LEM domain-containing protein 3) vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 2
Match NameE-valueIdentityDescription
lemd39.785e-1926.50LEM domain containing 3 [Source:NCBI gene;Acc:1030... [more]
lemd31.059e-1826.50LEM domain containing 3 [Source:NCBI gene;Acc:1030... [more]
back to top
BLAST of Inner nuclear membrane protein Man1 (LEM domain-containing protein 3) vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 2
Match NameE-valueIdentityDescription
ENSPMAT00000005194.15.862e-2024.56pep scaffold:Pmarinus_7.0:GL478719:15016:34097:-1 ... [more]
ENSPMAT00000002717.13.777e-624.68pep scaffold:Pmarinus_7.0:GL501202:12393:14583:1 g... [more]
back to top
BLAST of Inner nuclear membrane protein Man1 (LEM domain-containing protein 3) vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Inner nuclear membrane protein Man1 (LEM domain-containing protein 3) vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 1
Match NameE-valueIdentityDescription
EDO417253.066e-2026.56Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Inner nuclear membrane protein Man1 (LEM domain-containing protein 3) vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 1
Match NameE-valueIdentityDescription
lemd36.060e-1424.38LEM domain containing 3 [Source:NCBI gene;Acc:1011... [more]
back to top
BLAST of Inner nuclear membrane protein Man1 (LEM domain-containing protein 3) vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 4
Match NameE-valueIdentityDescription
SMESG000070262.10.000e+098.45SMESG000070262.1[more]
SMESG000070262.10.000e+095.70SMESG000070262.1[more]
SMESG000070249.10.000e+095.76SMESG000070249.1[more]
SMESG000070263.11.621e-55100.00SMESG000070263.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30015850 ID=SMED30015850|Name=Inner nuclear membrane protein Man1 (LEM domain-containing protein 3)|organism=Schmidtea mediterranea sexual|type=transcript|length=2118bp
TTTAAATTTAGATGGCAGATTTAACAAACTCAGAAATAAGAAATATATTA
AAGTCCTATGGAGAAGAAATTGGTCCGATTACTTCTACTACACGAAATAT
TTATTTGAAAAAAATAGAAGGCCTTCAAAAAAGCAAGATTCATCCGACAA
AATCTATCAGAAAATCGGAACAAATACCTACTAATACGTCAAATTTTTCT
TCATCCAAATCAAATGTAGCCAGTCAAATTGCACCATCCAACATTTTGTC
TATCAATGAAAATGGTAATCGTGGAAAGAAATCACAACTTGATACAAGTA
GTGAAACTTCTTTCAGAACTCCACTATATAACAATAAATATACGAGCCCT
TATAAACAAAATGAACCTCGATTTAATCATCTAGACAGTAGGTCTTCAAT
AAATGAATCATATTCAAGTATGGATTCGGATTTACAAATTTTTGCCGAAG
ATAATTACCGAAAAGAACTTAAAGGAAAAAATGTATCACCAATACAATAT
ATGAAAGGAACAGGTAGCACTTTCTATCGACTCTCAGATTATAGTCCAAC
AAAATCTACTAATAAAAACTATACCACATCAAATCCAGTTCAAGCCAATA
GTAGTAATAAAAATAATAATAAATGGTATAATGGTTCATTTGGAACGATT
TCAAATTATTTTACCAGTCGAAAAGTCAACGAAGATCTAATGGATATTTC
CGATTGTGATTTATCGGACAATGAAGATAACCTAATGACAAGATTACGAA
GAAATTATTTCAAAAAAACCGGTTGTTCTGACGTTGACGCAACGAAAACT
AAATCGAAGCAGACCAGCAAGAAAATCGAATCATCTTTCATTAACTGGAA
CCATTTGCCGAATATTCTTCTTGGAATCGTCATTGTATTTTCTGTTCTCT
TGTTCTTGAGCTACATCCTAATGAAGAATCGATATTCCAACCTGGAACTG
GAACTCGCCATGGATGGTTTAACTGACAAGATCGGATCAAAAGATCGCTT
TACCGTTGAGGAACTACCTCAATTGAAATTTTATCTCGCTAAACTTTATG
ATATTCTCTCGGAATATTCCGGTGAGAAAACCTGTGAGTTTCTACCGGAT
AAGCGGCTGTCGTTTACAAAGGCTCGTGACATTTTGAATCATAAATTGAA
ACGGGAAAAATCCAAATCGGTTTCAGAGGGAAATTGGAGTCAATTAATGA
AAATGGTGATTTTGTTGCCGACAGATAAACTGAACATCGCCGGTTACAAT
AAGGATAATGAAATTGTCGGCATCGACGGGCTCCCCGAACATATCACATA
TCTCGAAGGACTGGTGCCGAAATTGTCGATGTTTTGCCGATTGAAAATGT
TTGCCGTGCATATCCTCAACGGGATATTCTACATAGCATGCGTCATAGTC
GGGATTTTATTGGTATTGATTACTGGATATTTTATGAATATTTATCGCGT
GAAACGGAAACAAAGAAATGAGAAATTGGTCAATGAGATGCGGGAAATCA
TTTCCTGTATCTCATCTCTGTTGCAAGATCAATTACGACAAGCGGAATAC
AGTCAAACAACGAACAAGTTTCTCACAGTATCTAAAGTTCGATCGATTCT
ACAGAAAACCTATCCAAAATTGCAAGACGAACCGTACTGGGAGGAATTGA
AAAATTTTATGTACAAAATTGAACCATTAATTGAAATGAAAGAAACGCTG
GCTCATGGGGAAATCCTTGAGTGGAAATCTCACCTCGGTTGGCAGGGATC
TGCGGTACAAAGTGATTGTCAAGTCAAATTTGGAAAGGGACCTACCGAAT
GCTTAAAAATTCGCAATATGGATTTAATAAATTTTGATGAGGAGGGCGAG
AATTATTTGCGCCAGGAAGTAAGGAATCGACTCAGAGATGCCGGGGAAAT
CAAGGATGTACAATTTCTAAGAAAGGGCTCCAAAGTAATTGTCTATGTGT
TGTGCGGTTCACGAGAGGTAGCAGGAAAGGCGTTTCGAAAGGTCAATGCA
AATTATTTCAATGGTAATCTTCTCAATGTGAAATTCATTCGGCTGGATAA
ATATTTGGAAAGATTTCCAGAATCAAAAATTTATGTTAAATAAATTTGTT
TTTTCATTTTTAAAAAAA
back to top

protein sequence of SMED30015850-orf-1

>SMED30015850-orf-1 ID=SMED30015850-orf-1|Name=SMED30015850-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=694bp
MADLTNSEIRNILKSYGEEIGPITSTTRNIYLKKIEGLQKSKIHPTKSIR
KSEQIPTNTSNFSSSKSNVASQIAPSNILSINENGNRGKKSQLDTSSETS
FRTPLYNNKYTSPYKQNEPRFNHLDSRSSINESYSSMDSDLQIFAEDNYR
KELKGKNVSPIQYMKGTGSTFYRLSDYSPTKSTNKNYTTSNPVQANSSNK
NNNKWYNGSFGTISNYFTSRKVNEDLMDISDCDLSDNEDNLMTRLRRNYF
KKTGCSDVDATKTKSKQTSKKIESSFINWNHLPNILLGIVIVFSVLLFLS
YILMKNRYSNLELELAMDGLTDKIGSKDRFTVEELPQLKFYLAKLYDILS
EYSGEKTCEFLPDKRLSFTKARDILNHKLKREKSKSVSEGNWSQLMKMVI
LLPTDKLNIAGYNKDNEIVGIDGLPEHITYLEGLVPKLSMFCRLKMFAVH
ILNGIFYIACVIVGILLVLITGYFMNIYRVKRKQRNEKLVNEMREIISCI
SSLLQDQLRQAEYSQTTNKFLTVSKVRSILQKTYPKLQDEPYWEELKNFM
YKIEPLIEMKETLAHGEILEWKSHLGWQGSAVQSDCQVKFGKGPTECLKI
RNMDLINFDEEGENYLRQEVRNRLRDAGEIKDVQFLRKGSKVIVYVLCGS
REVAGKAFRKVNANYFNGNLLNVKFIRLDKYLERFPESKIYVK*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: INTERPRO
TermDefinition
IPR035979RBD_domain_sf
IPR018996MSC
IPR011015LEM/LEM-like_dom_sf
IPR003887LEM_dom
IPR012677Nucleotide-bd_a/b_plait_sf
Vocabulary: molecular function
TermDefinition
GO:0003676nucleic acid binding
GO:0000166nucleotide binding
Vocabulary: cellular component
TermDefinition
GO:0005639integral component of nuclear inner membrane
GO:0016020membrane
GO:0016021integral component of membrane
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR003887LEM domainPFAMPF03020LEMcoord: 2..38
e-value: 2.3E-12
score: 46.3
IPR003887LEM domainPROSITEPS50954LEMcoord: 1..42
score: 14.036
IPR012677Nucleotide-binding alpha-beta plait domain superfamilyGENE3DG3DSA:3.30.70.330coord: 592..692
e-value: 2.8E-12
score: 48.5
IPR011015LEM/LEM-like domain superfamilyGENE3DG3DSA:1.10.720.40coord: 1..46
e-value: 3.8E-11
score: 44.1
IPR011015LEM/LEM-like domain superfamilySUPERFAMILYSSF63451LEM domaincoord: 2..41
IPR018996Man1/Src1, C-terminalPFAMPF09402MSCcoord: 343..569
e-value: 3.5E-7
score: 30.0
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 50..69
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 43..69
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 82..117
NoneNo IPR availablePANTHERPTHR13428INNER NUCLEAR MEMBRANE PROTEIN MAN1 LEM DOMAIN CONTAINING PROTEINcoord: 1..688
NoneNo IPR availableCDDcd12934LEMcoord: 4..40
e-value: 4.82995E-11
score: 55.8734
NoneNo IPR availableTMHMMTMhelixcoord: 451..473
NoneNo IPR availableTMHMMTMhelixcoord: 281..303
IPR035979RNA-binding domain superfamilySUPERFAMILYSSF54928RNA-binding domain, RBDcoord: 613..680