Dual specificity tyrosine-phosphorylation-regulated kinase 4

Overview
NameDual specificity tyrosine-phosphorylation-regulated kinase 4
Smed IDSMED30015820
Length (bp)1995
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Dual specificity tyrosine-phosphorylation-regulated kinase 4 (SMED30015820) t-SNE clustered cells

Violin plots show distribution of expression levels for Dual specificity tyrosine-phosphorylation-regulated kinase 4 (SMED30015820) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Dual specificity tyrosine-phosphorylation-regulated kinase 4 (SMED30015820) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Dual specificity tyrosine-phosphorylation-regulated kinase 4 (SMED30015820) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30015820

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 6

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
headSMED30015820SMESG000042374.1 SmedASXL_013992SmedAsxl_ww_GCZZ01PMID:27034770
Currie et al., 2016
whole organism asexual adult RNA-sequencing evidence
pharynxSMED30015820SMESG000042374.1 dd_Smed_v4_12591_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
gutSMED30015820SMESG000042374.1 dd_Smed_v4_12591_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
epidermal cellSMED30015820SMESG000042374.1 dd_Smed_v4_12591_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
epidermisSMED30015820SMESG000042374.1 dd_Smed_v4_12591_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
dorsal region of the epidermisSMED30015820SMESG000042374.1 dd_Smed_v4_12591_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Dual specificity tyrosine-phosphorylation-regulated kinase 4 vs. Ensembl Human
Match: DYRK4 (dual specificity tyrosine phosphorylation regulated kinase 4 [Source:HGNC Symbol;Acc:HGNC:3095])

HSP 1 Score: 409.838 bits (1052), Expect = 8.457e-136
Identity = 190/388 (48.97%), Postives = 277/388 (71.39%), Query Frame = 2
Query:  545 SLKVSPHNYQDHSP--HGFPMGPRSALQNYRFQLTSLEQEEISHFNQIWFLGLNSKKTEAIKGSSPNNGYDDETGAYIKVPHDHIAFRYEILETLGKGSFGQVFKAIDHQTGINVAVKVIRNKKRFHQQSFVEVNIXXXXXXXXXXXXTSFHVIHLLNSFFFRNHPCLVFELLGENLYDVIKRNNFRGFSLSSIQKMSYSILSCLSVLRRENIIHCDLKPENILVMNNNSSEIKIIDFGSSCFYNEKIYTYIQSRFYRSPEVILGIPYTTQIDIWSFGCLLPELLTGRPLFPGESEMDQLLCIMEVYDLPPKSVLEESTRKKLFFDNKGEPRSLHNSKGRRRVPNSQTIQSTMKMNADSKFVDLIHSCLEWDARVRIQPDDALKHSWF 1702
            S+K      ++ SP      +    AL+ ++ QL+  EQ EI  + ++WFLGL +KK +          +DDE G Y+KV HDHIA+RYE+LET+GKGSFGQV K +DH+    VA+K+IRNKKRFHQQ+ +E+ IL+ L++K++    +++V+H+ + F+FRNH C+ FELLG NLY+++K NNF+GFSLS +++ + S+L CL +L  E IIHCDLKPENI++     + +K+IDFGSSC+ ++K+YTYIQSRFYRSPEVILG PY   ID+WS GC+  EL TG PLFPGE+E++QL CIMEV  LPP   ++ ++R++ FFD+KG P+++ N++G++R P+S+ +   +K   D+ F+D +  CL W+  +R+ PD ALKH+W 
Sbjct:   16 SIKTQDPKAEEKSPKKQKVTLTAAEALKLFKNQLSPYEQSEILGYAELWFLGLEAKKLDTAPEKFSKTSFDDEHGFYLKVLHDHIAYRYEVLETIGKGSFGQVAKCLDHKNNELVALKIIRNKKRFHQQALMELKILEALRKKDKD--NTYNVVHMKDFFYFRNHFCITFELLGINLYELMKNNNFQGFSLSIVRRFTLSVLKCLQMLSVEKIIHCDLKPENIVLYQKGQASVKVIDFGSSCYEHQKVYTYIQSRFYRSPEVILGHPYDVAIDMWSLGCITAELYTGYPLFPGENEVEQLACIMEVLGLPPAGFIQTASRRQTFFDSKGFPKNITNNRGKKRYPDSKDLTMVLK-TYDTSFLDFLRRCLVWEPSLRMTPDQALKHAWI 400          
BLAST of Dual specificity tyrosine-phosphorylation-regulated kinase 4 vs. Ensembl Human
Match: DYRK4 (dual specificity tyrosine phosphorylation regulated kinase 4 [Source:HGNC Symbol;Acc:HGNC:3095])

HSP 1 Score: 409.838 bits (1052), Expect = 8.457e-136
Identity = 190/388 (48.97%), Postives = 277/388 (71.39%), Query Frame = 2
Query:  545 SLKVSPHNYQDHSP--HGFPMGPRSALQNYRFQLTSLEQEEISHFNQIWFLGLNSKKTEAIKGSSPNNGYDDETGAYIKVPHDHIAFRYEILETLGKGSFGQVFKAIDHQTGINVAVKVIRNKKRFHQQSFVEVNIXXXXXXXXXXXXTSFHVIHLLNSFFFRNHPCLVFELLGENLYDVIKRNNFRGFSLSSIQKMSYSILSCLSVLRRENIIHCDLKPENILVMNNNSSEIKIIDFGSSCFYNEKIYTYIQSRFYRSPEVILGIPYTTQIDIWSFGCLLPELLTGRPLFPGESEMDQLLCIMEVYDLPPKSVLEESTRKKLFFDNKGEPRSLHNSKGRRRVPNSQTIQSTMKMNADSKFVDLIHSCLEWDARVRIQPDDALKHSWF 1702
            S+K      ++ SP      +    AL+ ++ QL+  EQ EI  + ++WFLGL +KK +          +DDE G Y+KV HDHIA+RYE+LET+GKGSFGQV K +DH+    VA+K+IRNKKRFHQQ+ +E+ IL+ L++K++    +++V+H+ + F+FRNH C+ FELLG NLY+++K NNF+GFSLS +++ + S+L CL +L  E IIHCDLKPENI++     + +K+IDFGSSC+ ++K+YTYIQSRFYRSPEVILG PY   ID+WS GC+  EL TG PLFPGE+E++QL CIMEV  LPP   ++ ++R++ FFD+KG P+++ N++G++R P+S+ +   +K   D+ F+D +  CL W+  +R+ PD ALKH+W 
Sbjct:   16 SIKTQDPKAEEKSPKKQKVTLTAAEALKLFKNQLSPYEQSEILGYAELWFLGLEAKKLDTAPEKFSKTSFDDEHGFYLKVLHDHIAYRYEVLETIGKGSFGQVAKCLDHKNNELVALKIIRNKKRFHQQALMELKILEALRKKDKD--NTYNVVHMKDFFYFRNHFCITFELLGINLYELMKNNNFQGFSLSIVRRFTLSVLKCLQMLSVEKIIHCDLKPENIVLYQKGQASVKVIDFGSSCYEHQKVYTYIQSRFYRSPEVILGHPYDVAIDMWSLGCITAELYTGYPLFPGENEVEQLACIMEVLGLPPAGFIQTASRRQTFFDSKGFPKNITNNRGKKRYPDSKDLTMVLK-TYDTSFLDFLRRCLVWEPSLRMTPDQALKHAWI 400          
BLAST of Dual specificity tyrosine-phosphorylation-regulated kinase 4 vs. Ensembl Human
Match: DYRK4 (dual specificity tyrosine phosphorylation regulated kinase 4 [Source:HGNC Symbol;Acc:HGNC:3095])

HSP 1 Score: 410.994 bits (1055), Expect = 8.530e-135
Identity = 190/388 (48.97%), Postives = 277/388 (71.39%), Query Frame = 2
Query:  545 SLKVSPHNYQDHSP--HGFPMGPRSALQNYRFQLTSLEQEEISHFNQIWFLGLNSKKTEAIKGSSPNNGYDDETGAYIKVPHDHIAFRYEILETLGKGSFGQVFKAIDHQTGINVAVKVIRNKKRFHQQSFVEVNIXXXXXXXXXXXXTSFHVIHLLNSFFFRNHPCLVFELLGENLYDVIKRNNFRGFSLSSIQKMSYSILSCLSVLRRENIIHCDLKPENILVMNNNSSEIKIIDFGSSCFYNEKIYTYIQSRFYRSPEVILGIPYTTQIDIWSFGCLLPELLTGRPLFPGESEMDQLLCIMEVYDLPPKSVLEESTRKKLFFDNKGEPRSLHNSKGRRRVPNSQTIQSTMKMNADSKFVDLIHSCLEWDARVRIQPDDALKHSWF 1702
            S+K      ++ SP      +    AL+ ++ QL+  EQ EI  + ++WFLGL +KK +          +DDE G Y+KV HDHIA+RYE+LET+GKGSFGQV K +DH+    VA+K+IRNKKRFHQQ+ +E+ IL+ L++K++    +++V+H+ + F+FRNH C+ FELLG NLY+++K NNF+GFSLS +++ + S+L CL +L  E IIHCDLKPENI++     + +K+IDFGSSC+ ++K+YTYIQSRFYRSPEVILG PY   ID+WS GC+  EL TG PLFPGE+E++QL CIMEV  LPP   ++ ++R++ FFD+KG P+++ N++G++R P+S+ +   +K   D+ F+D +  CL W+  +R+ PD ALKH+W 
Sbjct:  131 SIKTQDPKAEEKSPKKQKVTLTAAEALKLFKNQLSPYEQSEILGYAELWFLGLEAKKLDTAPEKFSKTSFDDEHGFYLKVLHDHIAYRYEVLETIGKGSFGQVAKCLDHKNNELVALKIIRNKKRFHQQALMELKILEALRKKDKD--NTYNVVHMKDFFYFRNHFCITFELLGINLYELMKNNNFQGFSLSIVRRFTLSVLKCLQMLSVEKIIHCDLKPENIVLYQKGQASVKVIDFGSSCYEHQKVYTYIQSRFYRSPEVILGHPYDVAIDMWSLGCITAELYTGYPLFPGENEVEQLACIMEVLGLPPAGFIQTASRRQTFFDSKGFPKNITNNRGKKRYPDSKDLTMVLK-TYDTSFLDFLRRCLVWEPSLRMTPDQALKHAWI 515          
BLAST of Dual specificity tyrosine-phosphorylation-regulated kinase 4 vs. Ensembl Human
Match: DYRK2 (dual specificity tyrosine phosphorylation regulated kinase 2 [Source:HGNC Symbol;Acc:HGNC:3093])

HSP 1 Score: 392.889 bits (1008), Expect = 4.021e-129
Identity = 188/386 (48.70%), Postives = 264/386 (68.39%), Query Frame = 2
Query:  596 PMGPRSALQNYRFQLTSLEQEEISHFNQIWFLGLNSKKTEAIKGSSPNNGYDDETGAYIKVPHDHIAFRYEILETLGKGSFGQVFKAIDHQTGINVAVKVIRNKKRFHQQSFVEVNIXXXXXXXXXXXXTSFHVIHLLNSFFFRNHPCLVFELLGENLYDVIKRNNFRGFSLSSIQKMSYSILSCLSVLRRENIIHCDLKPENILVMNNNSSEIKIIDFGSSCFYNEKIYTYIQSRFYRSPEVILGIPYTTQIDIWSFGCLLPELLTGRPLFPGESEMDQLLCIMEVYDLPPKSVLEESTRKKLFFDNKGEPR------------SLHNSKGRRRV----PNSQTIQSTMKMNADSKFVDLIHSCLEWDARVRIQPDDALKHSWFQ 1705
            PM P  A++ Y  +LT+ E  EI  + +I+FLGLN+KK + + G   N GYDD+ G+Y++VPHDH+A+RYE+L+ +GKGSFGQV KA DH+   +VA+K++RN+KRFH+Q+  E+ IL+HL+++++    + +VIH+L +F FRNH C+ FELL  NLY++IK+N F+GFSL  ++K ++SIL CL  L +  IIHCDLKPENIL+     S IK+IDFGSSC+ ++++YTYIQSRFYR+PEVILG  Y   ID+WS GC+L ELLTG PL PGE E DQL C++E+  +P + +L+ S R K F  +KG PR             L+  + RR      P S+   + +K   D  F+D +  CLEWD  VR+ P  AL+H W +
Sbjct:   80 PMTPEQAMKQYMQKLTAFEHHEIFSYPEIYFLGLNAKKRQGMTGGPNNGGYDDDQGSYVQVPHDHVAYRYEVLKVIGKGSFGQVVKAYDHKVHQHVALKMVRNEKRFHRQAAEEIRILEHLRKQDKD--NTMNVIHMLENFTFRNHICMTFELLSMNLYELIKKNKFQGFSLPLVRKFAHSILQCLDALHKNRIIHCDLKPENILLKQQGRSGIKVIDFGSSCYEHQRVYTYIQSRFYRAPEVILGARYGMPIDMWSLGCILAELLTGYPLLPGEDEGDQLACMIELLGMPSQKLLDASKRAKNFVSSKGYPRYCTVTTLSDGSVVLNGGRSRRGKLRGPPESREWGNALKGCDDPLFLDFLKQCLEWDPAVRMTPGQALRHPWLR 463          
BLAST of Dual specificity tyrosine-phosphorylation-regulated kinase 4 vs. Ensembl Human
Match: DYRK2 (dual specificity tyrosine phosphorylation regulated kinase 2 [Source:HGNC Symbol;Acc:HGNC:3093])

HSP 1 Score: 393.66 bits (1010), Expect = 1.830e-128
Identity = 188/386 (48.70%), Postives = 264/386 (68.39%), Query Frame = 2
Query:  596 PMGPRSALQNYRFQLTSLEQEEISHFNQIWFLGLNSKKTEAIKGSSPNNGYDDETGAYIKVPHDHIAFRYEILETLGKGSFGQVFKAIDHQTGINVAVKVIRNKKRFHQQSFVEVNIXXXXXXXXXXXXTSFHVIHLLNSFFFRNHPCLVFELLGENLYDVIKRNNFRGFSLSSIQKMSYSILSCLSVLRRENIIHCDLKPENILVMNNNSSEIKIIDFGSSCFYNEKIYTYIQSRFYRSPEVILGIPYTTQIDIWSFGCLLPELLTGRPLFPGESEMDQLLCIMEVYDLPPKSVLEESTRKKLFFDNKGEPR------------SLHNSKGR----RRVPNSQTIQSTMKMNADSKFVDLIHSCLEWDARVRIQPDDALKHSWFQ 1705
            PM P  A++ Y  +LT+ E  EI  + +I+FLGLN+KK + + G   N GYDD+ G+Y++VPHDH+A+RYE+L+ +GKGSFGQV KA DH+   +VA+K++RN+KRFH+Q+  E+ IL+HL+++++    + +VIH+L +F FRNH C+ FELL  NLY++IK+N F+GFSL  ++K ++SIL CL  L +  IIHCDLKPENIL+     S IK+IDFGSSC+ ++++YTYIQSRFYR+PEVILG  Y   ID+WS GC+L ELLTG PL PGE E DQL C++E+  +P + +L+ S R K F  +KG PR             L+  + R    R  P S+   + +K   D  F+D +  CLEWD  VR+ P  AL+H W +
Sbjct:  153 PMTPEQAMKQYMQKLTAFEHHEIFSYPEIYFLGLNAKKRQGMTGGPNNGGYDDDQGSYVQVPHDHVAYRYEVLKVIGKGSFGQVVKAYDHKVHQHVALKMVRNEKRFHRQAAEEIRILEHLRKQDKD--NTMNVIHMLENFTFRNHICMTFELLSMNLYELIKKNKFQGFSLPLVRKFAHSILQCLDALHKNRIIHCDLKPENILLKQQGRSGIKVIDFGSSCYEHQRVYTYIQSRFYRAPEVILGARYGMPIDMWSLGCILAELLTGYPLLPGEDEGDQLACMIELLGMPSQKLLDASKRAKNFVSSKGYPRYCTVTTLSDGSVVLNGGRSRRGKLRGPPESREWGNALKGCDDPLFLDFLKQCLEWDPAVRMTPGQALRHPWLR 536          
BLAST of Dual specificity tyrosine-phosphorylation-regulated kinase 4 vs. Ensembl Celegans
Match: mbk-2 (Dual specificity tyrosine-phosphorylation-regulated kinase mbk-2 [Source:UniProtKB/Swiss-Prot;Acc:Q9XTF3])

HSP 1 Score: 373.244 bits (957), Expect = 1.137e-122
Identity = 181/383 (47.26%), Postives = 254/383 (66.32%), Query Frame = 2
Query:  605 PRSALQNYRFQLTSLEQEEISHFNQIWFLGLNSKKTEAIKGSSPNNGYDDETGAYIKVPHDHIAFRYEILETLGKGSFGQVFKAIDHQTGINVAVKVIRNKKRFHQQSFVEVNIXXXXXXXXXXXXTSFHVIHLLNSFFFRNHPCLVFELLGENLYDVIKRNNFRGFSLSSIQKMSYSILSCLSVLRRENIIHCDLKPENILVMNNNSSEIKIIDFGSSCFYNEKIYTYIQSRFYRSPEVILGIPYTTQIDIWSFGCLLPELLTGRPLFPGESEMDQLLCIMEVYDLPPKSVLEESTRKKLFFDNKGEPR---------------SLHNSKGRRRV-PNSQTIQSTMKMNADSKFVDLIHSCLEWDARVRIQPDDALKHSWFQ 1705
            P  A+Q +  +L   E+ EI ++ +++F+G ++KK   + G + N GYDDE G+Y  V HDHIA+RYE+L+ +GKGSFGQV KA DH+    VA+K++RN+KRFH+Q+  E+ IL HL+ ++     + ++IH+L+ F FRNH C+ FELL  NLY++IKRN F+GFSL  ++K +YS+L CL +L++  +IHCDLKPEN+L+     S IK+IDFGSSCF +++IYTYIQSRFYR+PEVILG  Y   ID+WS GC+L ELLTG PL PGE E DQL  I+E+  +PP   LE + R + F  +KG PR                  + +G+ R  P S++  + +K   D  FVD +  CL+WD   R+ P  ALKH W +
Sbjct:   68 PEDAVQTFGAKLVPFEKNEIYNYTRVFFVGSHAKKQAGVIGGANNGGYDDENGSYQLVVHDHIAYRYEVLKVIGKGSFGQVIKAFDHKYQQYVALKLVRNEKRFHRQADEEIRILDHLRRQDSD--GTHNIIHMLDYFNFRNHKCITFELLSINLYELIKRNKFQGFSLMLVRKFAYSMLLCLDLLQKNRLIHCDLKPENVLLKQQGRSGIKVIDFGSSCFDDQRIYTYIQSRFYRAPEVILGTKYGMPIDMWSLGCILAELLTGYPLLPGEDENDQLALIIELLGMPPPKSLETAKRARTFITSKGYPRYCTATSMPDGSVVLAGARSKRGKMRGPPASRSWSTALKNMGDELFVDFLKRCLDWDPETRMTPAQALKHKWLR 448          
BLAST of Dual specificity tyrosine-phosphorylation-regulated kinase 4 vs. Ensembl Celegans
Match: mbk-2 (Dual specificity tyrosine-phosphorylation-regulated kinase mbk-2 [Source:UniProtKB/Swiss-Prot;Acc:Q9XTF3])

HSP 1 Score: 373.244 bits (957), Expect = 1.137e-122
Identity = 181/383 (47.26%), Postives = 254/383 (66.32%), Query Frame = 2
Query:  605 PRSALQNYRFQLTSLEQEEISHFNQIWFLGLNSKKTEAIKGSSPNNGYDDETGAYIKVPHDHIAFRYEILETLGKGSFGQVFKAIDHQTGINVAVKVIRNKKRFHQQSFVEVNIXXXXXXXXXXXXTSFHVIHLLNSFFFRNHPCLVFELLGENLYDVIKRNNFRGFSLSSIQKMSYSILSCLSVLRRENIIHCDLKPENILVMNNNSSEIKIIDFGSSCFYNEKIYTYIQSRFYRSPEVILGIPYTTQIDIWSFGCLLPELLTGRPLFPGESEMDQLLCIMEVYDLPPKSVLEESTRKKLFFDNKGEPR---------------SLHNSKGRRRV-PNSQTIQSTMKMNADSKFVDLIHSCLEWDARVRIQPDDALKHSWFQ 1705
            P  A+Q +  +L   E+ EI ++ +++F+G ++KK   + G + N GYDDE G+Y  V HDHIA+RYE+L+ +GKGSFGQV KA DH+    VA+K++RN+KRFH+Q+  E+ IL HL+ ++     + ++IH+L+ F FRNH C+ FELL  NLY++IKRN F+GFSL  ++K +YS+L CL +L++  +IHCDLKPEN+L+     S IK+IDFGSSCF +++IYTYIQSRFYR+PEVILG  Y   ID+WS GC+L ELLTG PL PGE E DQL  I+E+  +PP   LE + R + F  +KG PR                  + +G+ R  P S++  + +K   D  FVD +  CL+WD   R+ P  ALKH W +
Sbjct:   68 PEDAVQTFGAKLVPFEKNEIYNYTRVFFVGSHAKKQAGVIGGANNGGYDDENGSYQLVVHDHIAYRYEVLKVIGKGSFGQVIKAFDHKYQQYVALKLVRNEKRFHRQADEEIRILDHLRRQDSD--GTHNIIHMLDYFNFRNHKCITFELLSINLYELIKRNKFQGFSLMLVRKFAYSMLLCLDLLQKNRLIHCDLKPENVLLKQQGRSGIKVIDFGSSCFDDQRIYTYIQSRFYRAPEVILGTKYGMPIDMWSLGCILAELLTGYPLLPGEDENDQLALIIELLGMPPPKSLETAKRARTFITSKGYPRYCTATSMPDGSVVLAGARSKRGKMRGPPASRSWSTALKNMGDELFVDFLKRCLDWDPETRMTPAQALKHKWLR 448          
BLAST of Dual specificity tyrosine-phosphorylation-regulated kinase 4 vs. Ensembl Celegans
Match: mbk-2 (Dual specificity tyrosine-phosphorylation-regulated kinase mbk-2 [Source:UniProtKB/Swiss-Prot;Acc:Q9XTF3])

HSP 1 Score: 373.244 bits (957), Expect = 1.137e-122
Identity = 181/383 (47.26%), Postives = 254/383 (66.32%), Query Frame = 2
Query:  605 PRSALQNYRFQLTSLEQEEISHFNQIWFLGLNSKKTEAIKGSSPNNGYDDETGAYIKVPHDHIAFRYEILETLGKGSFGQVFKAIDHQTGINVAVKVIRNKKRFHQQSFVEVNIXXXXXXXXXXXXTSFHVIHLLNSFFFRNHPCLVFELLGENLYDVIKRNNFRGFSLSSIQKMSYSILSCLSVLRRENIIHCDLKPENILVMNNNSSEIKIIDFGSSCFYNEKIYTYIQSRFYRSPEVILGIPYTTQIDIWSFGCLLPELLTGRPLFPGESEMDQLLCIMEVYDLPPKSVLEESTRKKLFFDNKGEPR---------------SLHNSKGRRRV-PNSQTIQSTMKMNADSKFVDLIHSCLEWDARVRIQPDDALKHSWFQ 1705
            P  A+Q +  +L   E+ EI ++ +++F+G ++KK   + G + N GYDDE G+Y  V HDHIA+RYE+L+ +GKGSFGQV KA DH+    VA+K++RN+KRFH+Q+  E+ IL HL+ ++     + ++IH+L+ F FRNH C+ FELL  NLY++IKRN F+GFSL  ++K +YS+L CL +L++  +IHCDLKPEN+L+     S IK+IDFGSSCF +++IYTYIQSRFYR+PEVILG  Y   ID+WS GC+L ELLTG PL PGE E DQL  I+E+  +PP   LE + R + F  +KG PR                  + +G+ R  P S++  + +K   D  FVD +  CL+WD   R+ P  ALKH W +
Sbjct:   68 PEDAVQTFGAKLVPFEKNEIYNYTRVFFVGSHAKKQAGVIGGANNGGYDDENGSYQLVVHDHIAYRYEVLKVIGKGSFGQVIKAFDHKYQQYVALKLVRNEKRFHRQADEEIRILDHLRRQDSD--GTHNIIHMLDYFNFRNHKCITFELLSINLYELIKRNKFQGFSLMLVRKFAYSMLLCLDLLQKNRLIHCDLKPENVLLKQQGRSGIKVIDFGSSCFDDQRIYTYIQSRFYRAPEVILGTKYGMPIDMWSLGCILAELLTGYPLLPGEDENDQLALIIELLGMPPPKSLETAKRARTFITSKGYPRYCTATSMPDGSVVLAGARSKRGKMRGPPASRSWSTALKNMGDELFVDFLKRCLDWDPETRMTPAQALKHKWLR 448          
BLAST of Dual specificity tyrosine-phosphorylation-regulated kinase 4 vs. Ensembl Celegans
Match: mbk-2 (Dual specificity tyrosine-phosphorylation-regulated kinase mbk-2 [Source:UniProtKB/Swiss-Prot;Acc:Q9XTF3])

HSP 1 Score: 373.244 bits (957), Expect = 1.687e-122
Identity = 181/383 (47.26%), Postives = 254/383 (66.32%), Query Frame = 2
Query:  605 PRSALQNYRFQLTSLEQEEISHFNQIWFLGLNSKKTEAIKGSSPNNGYDDETGAYIKVPHDHIAFRYEILETLGKGSFGQVFKAIDHQTGINVAVKVIRNKKRFHQQSFVEVNIXXXXXXXXXXXXTSFHVIHLLNSFFFRNHPCLVFELLGENLYDVIKRNNFRGFSLSSIQKMSYSILSCLSVLRRENIIHCDLKPENILVMNNNSSEIKIIDFGSSCFYNEKIYTYIQSRFYRSPEVILGIPYTTQIDIWSFGCLLPELLTGRPLFPGESEMDQLLCIMEVYDLPPKSVLEESTRKKLFFDNKGEPR---------------SLHNSKGRRRV-PNSQTIQSTMKMNADSKFVDLIHSCLEWDARVRIQPDDALKHSWFQ 1705
            P  A+Q +  +L   E+ EI ++ +++F+G ++KK   + G + N GYDDE G+Y  V HDHIA+RYE+L+ +GKGSFGQV KA DH+    VA+K++RN+KRFH+Q+  E+ IL HL+ ++     + ++IH+L+ F FRNH C+ FELL  NLY++IKRN F+GFSL  ++K +YS+L CL +L++  +IHCDLKPEN+L+     S IK+IDFGSSCF +++IYTYIQSRFYR+PEVILG  Y   ID+WS GC+L ELLTG PL PGE E DQL  I+E+  +PP   LE + R + F  +KG PR                  + +G+ R  P S++  + +K   D  FVD +  CL+WD   R+ P  ALKH W +
Sbjct:   68 PEDAVQTFGAKLVPFEKNEIYNYTRVFFVGSHAKKQAGVIGGANNGGYDDENGSYQLVVHDHIAYRYEVLKVIGKGSFGQVIKAFDHKYQQYVALKLVRNEKRFHRQADEEIRILDHLRRQDSD--GTHNIIHMLDYFNFRNHKCITFELLSINLYELIKRNKFQGFSLMLVRKFAYSMLLCLDLLQKNRLIHCDLKPENVLLKQQGRSGIKVIDFGSSCFDDQRIYTYIQSRFYRAPEVILGTKYGMPIDMWSLGCILAELLTGYPLLPGEDENDQLALIIELLGMPPPKSLETAKRARTFITSKGYPRYCTATSMPDGSVVLAGARSKRGKMRGPPASRSWSTALKNMGDELFVDFLKRCLDWDPETRMTPAQALKHKWLR 448          
BLAST of Dual specificity tyrosine-phosphorylation-regulated kinase 4 vs. Ensembl Celegans
Match: mbk-2 (Dual specificity tyrosine-phosphorylation-regulated kinase mbk-2 [Source:UniProtKB/Swiss-Prot;Acc:Q9XTF3])

HSP 1 Score: 373.244 bits (957), Expect = 1.687e-122
Identity = 181/383 (47.26%), Postives = 254/383 (66.32%), Query Frame = 2
Query:  605 PRSALQNYRFQLTSLEQEEISHFNQIWFLGLNSKKTEAIKGSSPNNGYDDETGAYIKVPHDHIAFRYEILETLGKGSFGQVFKAIDHQTGINVAVKVIRNKKRFHQQSFVEVNIXXXXXXXXXXXXTSFHVIHLLNSFFFRNHPCLVFELLGENLYDVIKRNNFRGFSLSSIQKMSYSILSCLSVLRRENIIHCDLKPENILVMNNNSSEIKIIDFGSSCFYNEKIYTYIQSRFYRSPEVILGIPYTTQIDIWSFGCLLPELLTGRPLFPGESEMDQLLCIMEVYDLPPKSVLEESTRKKLFFDNKGEPR---------------SLHNSKGRRRV-PNSQTIQSTMKMNADSKFVDLIHSCLEWDARVRIQPDDALKHSWFQ 1705
            P  A+Q +  +L   E+ EI ++ +++F+G ++KK   + G + N GYDDE G+Y  V HDHIA+RYE+L+ +GKGSFGQV KA DH+    VA+K++RN+KRFH+Q+  E+ IL HL+ ++     + ++IH+L+ F FRNH C+ FELL  NLY++IKRN F+GFSL  ++K +YS+L CL +L++  +IHCDLKPEN+L+     S IK+IDFGSSCF +++IYTYIQSRFYR+PEVILG  Y   ID+WS GC+L ELLTG PL PGE E DQL  I+E+  +PP   LE + R + F  +KG PR                  + +G+ R  P S++  + +K   D  FVD +  CL+WD   R+ P  ALKH W +
Sbjct:   68 PEDAVQTFGAKLVPFEKNEIYNYTRVFFVGSHAKKQAGVIGGANNGGYDDENGSYQLVVHDHIAYRYEVLKVIGKGSFGQVIKAFDHKYQQYVALKLVRNEKRFHRQADEEIRILDHLRRQDSD--GTHNIIHMLDYFNFRNHKCITFELLSINLYELIKRNKFQGFSLMLVRKFAYSMLLCLDLLQKNRLIHCDLKPENVLLKQQGRSGIKVIDFGSSCFDDQRIYTYIQSRFYRAPEVILGTKYGMPIDMWSLGCILAELLTGYPLLPGEDENDQLALIIELLGMPPPKSLETAKRARTFITSKGYPRYCTATSMPDGSVVLAGARSKRGKMRGPPASRSWSTALKNMGDELFVDFLKRCLDWDPETRMTPAQALKHKWLR 448          
BLAST of Dual specificity tyrosine-phosphorylation-regulated kinase 4 vs. Ensembl Fly
Match: Dyrk2 (gene:FBgn0016930 transcript:FBtr0100447)

HSP 1 Score: 410.223 bits (1053), Expect = 1.225e-133
Identity = 196/373 (52.55%), Postives = 266/373 (71.31%), Query Frame = 2
Query:  596 PMGPRSALQNYRFQLTSLEQEEISHFNQIWFLGLNSKKT---EAIKGSSPNNGYDDETGAYIKVPHDHIAFRYEILETLGKGSFGQVFKAIDHQTGINVAVKVIRNKKRFHQQSFVEVNIXXXXXXXXXXXXTSFHVIHLLNSFFFRNHPCLVFELLGENLYDVIKRNNFRGFSLSSIQKMSYSILSCLSVLRRENIIHCDLKPENILVMNNNSSEIKIIDFGSSCFYNEKIYTYIQSRFYRSPEVILGIPYTTQIDIWSFGCLLPELLTGRPLFPGESEMDQLLCIMEVYDLPPKSVLEESTRKKLFFDNKGEPRSLHNSKGRRRVPNSQTIQSTMKMNADSKFVDLIHSCLEWDARVRIQPDDALKHSWFQ 1705
            PM P   ++ +R  LT LE EE+  + ++W+ G ++ K     A   ++ N GYDD+ G Y  + HDHIAFRYEILE +GKGSFGQV +A+DH+T  +VA+K+IRNKKRF  Q+ VE+NIL  L+EK+     S +VIH+L+  +FR H C+ FEL+  NLY++IK+NN+ GFS+S I++   SI+ CL +L +ENIIHCDLKPENIL+    SS IK+IDFGSSC+ + KIYTYIQSRFYRSPEVILG+ Y T ID+WS GC+L EL TG PLFPGE+E++QL CIMEV  LPPK ++  + R++LFFD++  PR + N+KGR+R P S+++   +    D  F+D +  CLEWD   R+ PD+A  H + Q
Sbjct:  126 PMTPSELVKKFRNYLTDLEFEELKVYKEVWYFGQHASKNYNKPAPTANTTNLGYDDDNGNYKIIEHDHIAFRYEILEVIGKGSFGQVIRALDHKTNTHVAIKIIRNKKRFLNQAVVELNILDELREKDADG--SHNVIHMLDYTYFRKHLCITFELMSLNLYELIKKNNYNGFSMSLIRRFCNSIVKCLRLLYKENIIHCDLKPENILLKQRGSSSIKVIDFGSSCYVDRKIYTYIQSRFYRSPEVILGLQYGTAIDMWSLGCILAELYTGFPLFPGENEVEQLACIMEVLGLPPKVLISVARRRRLFFDSRDAPRCITNTKGRKRSPGSKSLAHILHCQ-DRYFIDFLQRCLEWDPAERMTPDEAAHHEFLQ 495          
BLAST of Dual specificity tyrosine-phosphorylation-regulated kinase 4 vs. Ensembl Fly
Match: Dyrk2 (gene:FBgn0016930 transcript:FBtr0089289)

HSP 1 Score: 410.223 bits (1053), Expect = 1.225e-133
Identity = 196/373 (52.55%), Postives = 266/373 (71.31%), Query Frame = 2
Query:  596 PMGPRSALQNYRFQLTSLEQEEISHFNQIWFLGLNSKKT---EAIKGSSPNNGYDDETGAYIKVPHDHIAFRYEILETLGKGSFGQVFKAIDHQTGINVAVKVIRNKKRFHQQSFVEVNIXXXXXXXXXXXXTSFHVIHLLNSFFFRNHPCLVFELLGENLYDVIKRNNFRGFSLSSIQKMSYSILSCLSVLRRENIIHCDLKPENILVMNNNSSEIKIIDFGSSCFYNEKIYTYIQSRFYRSPEVILGIPYTTQIDIWSFGCLLPELLTGRPLFPGESEMDQLLCIMEVYDLPPKSVLEESTRKKLFFDNKGEPRSLHNSKGRRRVPNSQTIQSTMKMNADSKFVDLIHSCLEWDARVRIQPDDALKHSWFQ 1705
            PM P   ++ +R  LT LE EE+  + ++W+ G ++ K     A   ++ N GYDD+ G Y  + HDHIAFRYEILE +GKGSFGQV +A+DH+T  +VA+K+IRNKKRF  Q+ VE+NIL  L+EK+     S +VIH+L+  +FR H C+ FEL+  NLY++IK+NN+ GFS+S I++   SI+ CL +L +ENIIHCDLKPENIL+    SS IK+IDFGSSC+ + KIYTYIQSRFYRSPEVILG+ Y T ID+WS GC+L EL TG PLFPGE+E++QL CIMEV  LPPK ++  + R++LFFD++  PR + N+KGR+R P S+++   +    D  F+D +  CLEWD   R+ PD+A  H + Q
Sbjct:  126 PMTPSELVKKFRNYLTDLEFEELKVYKEVWYFGQHASKNYNKPAPTANTTNLGYDDDNGNYKIIEHDHIAFRYEILEVIGKGSFGQVIRALDHKTNTHVAIKIIRNKKRFLNQAVVELNILDELREKDADG--SHNVIHMLDYTYFRKHLCITFELMSLNLYELIKKNNYNGFSMSLIRRFCNSIVKCLRLLYKENIIHCDLKPENILLKQRGSSSIKVIDFGSSCYVDRKIYTYIQSRFYRSPEVILGLQYGTAIDMWSLGCILAELYTGFPLFPGENEVEQLACIMEVLGLPPKVLISVARRRRLFFDSRDAPRCITNTKGRKRSPGSKSLAHILHCQ-DRYFIDFLQRCLEWDPAERMTPDEAAHHEFLQ 495          
BLAST of Dual specificity tyrosine-phosphorylation-regulated kinase 4 vs. Ensembl Fly
Match: Dyrk2 (gene:FBgn0016930 transcript:FBtr0100448)

HSP 1 Score: 410.223 bits (1053), Expect = 1.225e-133
Identity = 196/373 (52.55%), Postives = 266/373 (71.31%), Query Frame = 2
Query:  596 PMGPRSALQNYRFQLTSLEQEEISHFNQIWFLGLNSKKT---EAIKGSSPNNGYDDETGAYIKVPHDHIAFRYEILETLGKGSFGQVFKAIDHQTGINVAVKVIRNKKRFHQQSFVEVNIXXXXXXXXXXXXTSFHVIHLLNSFFFRNHPCLVFELLGENLYDVIKRNNFRGFSLSSIQKMSYSILSCLSVLRRENIIHCDLKPENILVMNNNSSEIKIIDFGSSCFYNEKIYTYIQSRFYRSPEVILGIPYTTQIDIWSFGCLLPELLTGRPLFPGESEMDQLLCIMEVYDLPPKSVLEESTRKKLFFDNKGEPRSLHNSKGRRRVPNSQTIQSTMKMNADSKFVDLIHSCLEWDARVRIQPDDALKHSWFQ 1705
            PM P   ++ +R  LT LE EE+  + ++W+ G ++ K     A   ++ N GYDD+ G Y  + HDHIAFRYEILE +GKGSFGQV +A+DH+T  +VA+K+IRNKKRF  Q+ VE+NIL  L+EK+     S +VIH+L+  +FR H C+ FEL+  NLY++IK+NN+ GFS+S I++   SI+ CL +L +ENIIHCDLKPENIL+    SS IK+IDFGSSC+ + KIYTYIQSRFYRSPEVILG+ Y T ID+WS GC+L EL TG PLFPGE+E++QL CIMEV  LPPK ++  + R++LFFD++  PR + N+KGR+R P S+++   +    D  F+D +  CLEWD   R+ PD+A  H + Q
Sbjct:  126 PMTPSELVKKFRNYLTDLEFEELKVYKEVWYFGQHASKNYNKPAPTANTTNLGYDDDNGNYKIIEHDHIAFRYEILEVIGKGSFGQVIRALDHKTNTHVAIKIIRNKKRFLNQAVVELNILDELREKDADG--SHNVIHMLDYTYFRKHLCITFELMSLNLYELIKKNNYNGFSMSLIRRFCNSIVKCLRLLYKENIIHCDLKPENILLKQRGSSSIKVIDFGSSCYVDRKIYTYIQSRFYRSPEVILGLQYGTAIDMWSLGCILAELYTGFPLFPGENEVEQLACIMEVLGLPPKVLISVARRRRLFFDSRDAPRCITNTKGRKRSPGSKSLAHILHCQ-DRYFIDFLQRCLEWDPAERMTPDEAAHHEFLQ 495          
BLAST of Dual specificity tyrosine-phosphorylation-regulated kinase 4 vs. Ensembl Fly
Match: Dyrk2 (gene:FBgn0016930 transcript:FBtr0089288)

HSP 1 Score: 410.223 bits (1053), Expect = 1.225e-133
Identity = 196/373 (52.55%), Postives = 266/373 (71.31%), Query Frame = 2
Query:  596 PMGPRSALQNYRFQLTSLEQEEISHFNQIWFLGLNSKKT---EAIKGSSPNNGYDDETGAYIKVPHDHIAFRYEILETLGKGSFGQVFKAIDHQTGINVAVKVIRNKKRFHQQSFVEVNIXXXXXXXXXXXXTSFHVIHLLNSFFFRNHPCLVFELLGENLYDVIKRNNFRGFSLSSIQKMSYSILSCLSVLRRENIIHCDLKPENILVMNNNSSEIKIIDFGSSCFYNEKIYTYIQSRFYRSPEVILGIPYTTQIDIWSFGCLLPELLTGRPLFPGESEMDQLLCIMEVYDLPPKSVLEESTRKKLFFDNKGEPRSLHNSKGRRRVPNSQTIQSTMKMNADSKFVDLIHSCLEWDARVRIQPDDALKHSWFQ 1705
            PM P   ++ +R  LT LE EE+  + ++W+ G ++ K     A   ++ N GYDD+ G Y  + HDHIAFRYEILE +GKGSFGQV +A+DH+T  +VA+K+IRNKKRF  Q+ VE+NIL  L+EK+     S +VIH+L+  +FR H C+ FEL+  NLY++IK+NN+ GFS+S I++   SI+ CL +L +ENIIHCDLKPENIL+    SS IK+IDFGSSC+ + KIYTYIQSRFYRSPEVILG+ Y T ID+WS GC+L EL TG PLFPGE+E++QL CIMEV  LPPK ++  + R++LFFD++  PR + N+KGR+R P S+++   +    D  F+D +  CLEWD   R+ PD+A  H + Q
Sbjct:  126 PMTPSELVKKFRNYLTDLEFEELKVYKEVWYFGQHASKNYNKPAPTANTTNLGYDDDNGNYKIIEHDHIAFRYEILEVIGKGSFGQVIRALDHKTNTHVAIKIIRNKKRFLNQAVVELNILDELREKDADG--SHNVIHMLDYTYFRKHLCITFELMSLNLYELIKKNNYNGFSMSLIRRFCNSIVKCLRLLYKENIIHCDLKPENILLKQRGSSSIKVIDFGSSCYVDRKIYTYIQSRFYRSPEVILGLQYGTAIDMWSLGCILAELYTGFPLFPGENEVEQLACIMEVLGLPPKVLISVARRRRLFFDSRDAPRCITNTKGRKRSPGSKSLAHILHCQ-DRYFIDFLQRCLEWDPAERMTPDEAAHHEFLQ 495          
BLAST of Dual specificity tyrosine-phosphorylation-regulated kinase 4 vs. Ensembl Fly
Match: Dyrk2 (gene:FBgn0016930 transcript:FBtr0089290)

HSP 1 Score: 410.223 bits (1053), Expect = 1.225e-133
Identity = 196/373 (52.55%), Postives = 266/373 (71.31%), Query Frame = 2
Query:  596 PMGPRSALQNYRFQLTSLEQEEISHFNQIWFLGLNSKKT---EAIKGSSPNNGYDDETGAYIKVPHDHIAFRYEILETLGKGSFGQVFKAIDHQTGINVAVKVIRNKKRFHQQSFVEVNIXXXXXXXXXXXXTSFHVIHLLNSFFFRNHPCLVFELLGENLYDVIKRNNFRGFSLSSIQKMSYSILSCLSVLRRENIIHCDLKPENILVMNNNSSEIKIIDFGSSCFYNEKIYTYIQSRFYRSPEVILGIPYTTQIDIWSFGCLLPELLTGRPLFPGESEMDQLLCIMEVYDLPPKSVLEESTRKKLFFDNKGEPRSLHNSKGRRRVPNSQTIQSTMKMNADSKFVDLIHSCLEWDARVRIQPDDALKHSWFQ 1705
            PM P   ++ +R  LT LE EE+  + ++W+ G ++ K     A   ++ N GYDD+ G Y  + HDHIAFRYEILE +GKGSFGQV +A+DH+T  +VA+K+IRNKKRF  Q+ VE+NIL  L+EK+     S +VIH+L+  +FR H C+ FEL+  NLY++IK+NN+ GFS+S I++   SI+ CL +L +ENIIHCDLKPENIL+    SS IK+IDFGSSC+ + KIYTYIQSRFYRSPEVILG+ Y T ID+WS GC+L EL TG PLFPGE+E++QL CIMEV  LPPK ++  + R++LFFD++  PR + N+KGR+R P S+++   +    D  F+D +  CLEWD   R+ PD+A  H + Q
Sbjct:  126 PMTPSELVKKFRNYLTDLEFEELKVYKEVWYFGQHASKNYNKPAPTANTTNLGYDDDNGNYKIIEHDHIAFRYEILEVIGKGSFGQVIRALDHKTNTHVAIKIIRNKKRFLNQAVVELNILDELREKDADG--SHNVIHMLDYTYFRKHLCITFELMSLNLYELIKKNNYNGFSMSLIRRFCNSIVKCLRLLYKENIIHCDLKPENILLKQRGSSSIKVIDFGSSCYVDRKIYTYIQSRFYRSPEVILGLQYGTAIDMWSLGCILAELYTGFPLFPGENEVEQLACIMEVLGLPPKVLISVARRRRLFFDSRDAPRCITNTKGRKRSPGSKSLAHILHCQ-DRYFIDFLQRCLEWDPAERMTPDEAAHHEFLQ 495          
BLAST of Dual specificity tyrosine-phosphorylation-regulated kinase 4 vs. Ensembl Zebrafish
Match: dyrk4 (dual-specificity tyrosine-(Y)-phosphorylation regulated kinase 4 [Source:ZFIN;Acc:ZDB-GENE-091015-3])

HSP 1 Score: 449.514 bits (1155), Expect = 2.517e-150
Identity = 203/376 (53.99%), Postives = 281/376 (74.73%), Query Frame = 2
Query:  593 FPMGPRSALQNYRFQLTSLEQEEISHFNQIWFLGLNSKKTEAIKGSSPNNGYDDETGAYIKVPHDHIAFRYEILETLGKGSFGQVFKAIDHQTGINVAVKVIRNKKRFHQQSFVEVNIXXXXXXXXXXXXTSFHVIHLLNSFFFRNHPCLVFELLGENLYDVIKRNNFRGFSLSSIQKMSYSILSCLSVLRRENIIHCDLKPENILVMNNNSSEIKIIDFGSSCFYNEKIYTYIQSRFYRSPEVILGIPYTTQIDIWSFGCLLPELLTGRPLFPGESEMDQLLCIMEVYDLPPKSVLEESTRKKLFFDNKGEPRSLHNSKGRRRVPNSQTIQSTMKMNADSKFVDLIHSCLEWDARVRIQPDDALKHSWFQDFHAN 1720
             PM P +AL++++ QLT  E+EEI  +++IW+LGL++KK E  +GS  N GYDDE G+Y+KV HDHI +RYE+LE +GKGSFGQV K +DH+T   VA+K+IRNKKRFH Q+ VE+ IL  ++ ++R      +VIH+   F+FRNH C+ FELLG NLY++IK+NNF+GFSL  I++ ++S+L CL +L +E IIHCDLKPENIL+       IK++DFGSSC+  +++YTYIQSRFYRSPEVILG PY+  ID+WS GC+L EL TG PLFPGESE++Q+ CIME+  LPP   ++ ++R++LFFD+KG PR++ NSKG++R P+S+ + S +K N D  F+D I  CL WD   R+ PD+A++H W  +   N
Sbjct:  107 LPMSPTTALKHFQNQLTEYEREEIMDYSEIWYLGLDTKKIEGSQGSPQNAGYDDEHGSYLKVLHDHIGYRYEVLEVIGKGSFGQVLKCLDHKTNETVAIKIIRNKKRFHHQALVELKILDAVRRRDRD--NCHNVIHMKEYFYFRNHLCISFELLGANLYELIKKNNFQGFSLGLIRRFAHSLLKCLQMLHKEKIIHCDLKPENILLSQRGQGNIKVVDFGSSCYEQQRVYTYIQSRFYRSPEVILGHPYSMAIDMWSLGCILAELYTGYPLFPGESEVEQIACIMEIMGLPPNDFVQTASRRRLFFDSKGNPRNITNSKGKKRRPSSKDLASVLKTN-DPLFLDFIQRCLVWDPTKRMTPDEAMQHEWITEGRLN 479          
BLAST of Dual specificity tyrosine-phosphorylation-regulated kinase 4 vs. Ensembl Zebrafish
Match: dyrk4 (dual-specificity tyrosine-(Y)-phosphorylation regulated kinase 4 [Source:ZFIN;Acc:ZDB-GENE-091015-3])

HSP 1 Score: 449.514 bits (1155), Expect = 3.334e-150
Identity = 203/376 (53.99%), Postives = 281/376 (74.73%), Query Frame = 2
Query:  593 FPMGPRSALQNYRFQLTSLEQEEISHFNQIWFLGLNSKKTEAIKGSSPNNGYDDETGAYIKVPHDHIAFRYEILETLGKGSFGQVFKAIDHQTGINVAVKVIRNKKRFHQQSFVEVNIXXXXXXXXXXXXTSFHVIHLLNSFFFRNHPCLVFELLGENLYDVIKRNNFRGFSLSSIQKMSYSILSCLSVLRRENIIHCDLKPENILVMNNNSSEIKIIDFGSSCFYNEKIYTYIQSRFYRSPEVILGIPYTTQIDIWSFGCLLPELLTGRPLFPGESEMDQLLCIMEVYDLPPKSVLEESTRKKLFFDNKGEPRSLHNSKGRRRVPNSQTIQSTMKMNADSKFVDLIHSCLEWDARVRIQPDDALKHSWFQDFHAN 1720
             PM P +AL++++ QLT  E+EEI  +++IW+LGL++KK E  +GS  N GYDDE G+Y+KV HDHI +RYE+LE +GKGSFGQV K +DH+T   VA+K+IRNKKRFH Q+ VE+ IL  ++ ++R      +VIH+   F+FRNH C+ FELLG NLY++IK+NNF+GFSL  I++ ++S+L CL +L +E IIHCDLKPENIL+       IK++DFGSSC+  +++YTYIQSRFYRSPEVILG PY+  ID+WS GC+L EL TG PLFPGESE++Q+ CIME+  LPP   ++ ++R++LFFD+KG PR++ NSKG++R P+S+ + S +K N D  F+D I  CL WD   R+ PD+A++H W  +   N
Sbjct:  117 LPMSPTTALKHFQNQLTEYEREEIMDYSEIWYLGLDTKKIEGSQGSPQNAGYDDEHGSYLKVLHDHIGYRYEVLEVIGKGSFGQVLKCLDHKTNETVAIKIIRNKKRFHHQALVELKILDAVRRRDRD--NCHNVIHMKEYFYFRNHLCISFELLGANLYELIKKNNFQGFSLGLIRRFAHSLLKCLQMLHKEKIIHCDLKPENILLSQRGQGNIKVVDFGSSCYEQQRVYTYIQSRFYRSPEVILGHPYSMAIDMWSLGCILAELYTGYPLFPGESEVEQIACIMEIMGLPPNDFVQTASRRRLFFDSKGNPRNITNSKGKKRRPSSKDLASVLKTN-DPLFLDFIQRCLVWDPTKRMTPDEAMQHEWITEGRLN 489          
BLAST of Dual specificity tyrosine-phosphorylation-regulated kinase 4 vs. Ensembl Zebrafish
Match: dyrk4 (dual-specificity tyrosine-(Y)-phosphorylation regulated kinase 4 [Source:ZFIN;Acc:ZDB-GENE-091015-3])

HSP 1 Score: 449.899 bits (1156), Expect = 4.177e-150
Identity = 203/376 (53.99%), Postives = 281/376 (74.73%), Query Frame = 2
Query:  593 FPMGPRSALQNYRFQLTSLEQEEISHFNQIWFLGLNSKKTEAIKGSSPNNGYDDETGAYIKVPHDHIAFRYEILETLGKGSFGQVFKAIDHQTGINVAVKVIRNKKRFHQQSFVEVNIXXXXXXXXXXXXTSFHVIHLLNSFFFRNHPCLVFELLGENLYDVIKRNNFRGFSLSSIQKMSYSILSCLSVLRRENIIHCDLKPENILVMNNNSSEIKIIDFGSSCFYNEKIYTYIQSRFYRSPEVILGIPYTTQIDIWSFGCLLPELLTGRPLFPGESEMDQLLCIMEVYDLPPKSVLEESTRKKLFFDNKGEPRSLHNSKGRRRVPNSQTIQSTMKMNADSKFVDLIHSCLEWDARVRIQPDDALKHSWFQDFHAN 1720
             PM P +AL++++ QLT  E+EEI  +++IW+LGL++KK E  +GS  N GYDDE G+Y+KV HDHI +RYE+LE +GKGSFGQV K +DH+T   VA+K+IRNKKRFH Q+ VE+ IL  ++ ++R      +VIH+   F+FRNH C+ FELLG NLY++IK+NNF+GFSL  I++ ++S+L CL +L +E IIHCDLKPENIL+       IK++DFGSSC+  +++YTYIQSRFYRSPEVILG PY+  ID+WS GC+L EL TG PLFPGESE++Q+ CIME+  LPP   ++ ++R++LFFD+KG PR++ NSKG++R P+S+ + S +K N D  F+D I  CL WD   R+ PD+A++H W  +   N
Sbjct:  135 LPMSPTTALKHFQNQLTEYEREEIMDYSEIWYLGLDTKKIEGSQGSPQNAGYDDEHGSYLKVLHDHIGYRYEVLEVIGKGSFGQVLKCLDHKTNETVAIKIIRNKKRFHHQALVELKILDAVRRRDRD--NCHNVIHMKEYFYFRNHLCISFELLGANLYELIKKNNFQGFSLGLIRRFAHSLLKCLQMLHKEKIIHCDLKPENILLSQRGQGNIKVVDFGSSCYEQQRVYTYIQSRFYRSPEVILGHPYSMAIDMWSLGCILAELYTGYPLFPGESEVEQIACIMEIMGLPPNDFVQTASRRRLFFDSKGNPRNITNSKGKKRRPSSKDLASVLKTN-DPLFLDFIQRCLVWDPTKRMTPDEAMQHEWITEGRLN 507          
BLAST of Dual specificity tyrosine-phosphorylation-regulated kinase 4 vs. Ensembl Zebrafish
Match: dyrk4 (dual-specificity tyrosine-(Y)-phosphorylation regulated kinase 4 [Source:ZFIN;Acc:ZDB-GENE-091015-3])

HSP 1 Score: 448.743 bits (1153), Expect = 4.725e-150
Identity = 203/376 (53.99%), Postives = 281/376 (74.73%), Query Frame = 2
Query:  593 FPMGPRSALQNYRFQLTSLEQEEISHFNQIWFLGLNSKKTEAIKGSSPNNGYDDETGAYIKVPHDHIAFRYEILETLGKGSFGQVFKAIDHQTGINVAVKVIRNKKRFHQQSFVEVNIXXXXXXXXXXXXTSFHVIHLLNSFFFRNHPCLVFELLGENLYDVIKRNNFRGFSLSSIQKMSYSILSCLSVLRRENIIHCDLKPENILVMNNNSSEIKIIDFGSSCFYNEKIYTYIQSRFYRSPEVILGIPYTTQIDIWSFGCLLPELLTGRPLFPGESEMDQLLCIMEVYDLPPKSVLEESTRKKLFFDNKGEPRSLHNSKGRRRVPNSQTIQSTMKMNADSKFVDLIHSCLEWDARVRIQPDDALKHSWFQDFHAN 1720
             PM P +AL++++ QLT  E+EEI  +++IW+LGL++KK E  +GS  N GYDDE G+Y+KV HDHI +RYE+LE +GKGSFGQV K +DH+T   VA+K+IRNKKRFH Q+ VE+ IL  ++ ++R      +VIH+   F+FRNH C+ FELLG NLY++IK+NNF+GFSL  I++ ++S+L CL +L +E IIHCDLKPENIL+       IK++DFGSSC+  +++YTYIQSRFYRSPEVILG PY+  ID+WS GC+L EL TG PLFPGESE++Q+ CIME+  LPP   ++ ++R++LFFD+KG PR++ NSKG++R P+S+ + S +K N D  F+D I  CL WD   R+ PD+A++H W  +   N
Sbjct:  114 LPMSPTTALKHFQNQLTEYEREEIMDYSEIWYLGLDTKKIEGSQGSPQNAGYDDEHGSYLKVLHDHIGYRYEVLEVIGKGSFGQVLKCLDHKTNETVAIKIIRNKKRFHHQALVELKILDAVRRRDRD--NCHNVIHMKEYFYFRNHLCISFELLGANLYELIKKNNFQGFSLGLIRRFAHSLLKCLQMLHKEKIIHCDLKPENILLSQRGQGNIKVVDFGSSCYEQQRVYTYIQSRFYRSPEVILGHPYSMAIDMWSLGCILAELYTGYPLFPGESEVEQIACIMEIMGLPPNDFVQTASRRRLFFDSKGNPRNITNSKGKKRRPSSKDLASVLKTN-DPLFLDFIQRCLVWDPTKRMTPDEAMQHEWITEGRLN 486          
BLAST of Dual specificity tyrosine-phosphorylation-regulated kinase 4 vs. Ensembl Zebrafish
Match: dyrk4 (dual-specificity tyrosine-(Y)-phosphorylation regulated kinase 4 [Source:ZFIN;Acc:ZDB-GENE-091015-3])

HSP 1 Score: 448.743 bits (1153), Expect = 7.756e-150
Identity = 203/376 (53.99%), Postives = 281/376 (74.73%), Query Frame = 2
Query:  593 FPMGPRSALQNYRFQLTSLEQEEISHFNQIWFLGLNSKKTEAIKGSSPNNGYDDETGAYIKVPHDHIAFRYEILETLGKGSFGQVFKAIDHQTGINVAVKVIRNKKRFHQQSFVEVNIXXXXXXXXXXXXTSFHVIHLLNSFFFRNHPCLVFELLGENLYDVIKRNNFRGFSLSSIQKMSYSILSCLSVLRRENIIHCDLKPENILVMNNNSSEIKIIDFGSSCFYNEKIYTYIQSRFYRSPEVILGIPYTTQIDIWSFGCLLPELLTGRPLFPGESEMDQLLCIMEVYDLPPKSVLEESTRKKLFFDNKGEPRSLHNSKGRRRVPNSQTIQSTMKMNADSKFVDLIHSCLEWDARVRIQPDDALKHSWFQDFHAN 1720
             PM P +AL++++ QLT  E+EEI  +++IW+LGL++KK E  +GS  N GYDDE G+Y+KV HDHI +RYE+LE +GKGSFGQV K +DH+T   VA+K+IRNKKRFH Q+ VE+ IL  ++ ++R      +VIH+   F+FRNH C+ FELLG NLY++IK+NNF+GFSL  I++ ++S+L CL +L +E IIHCDLKPENIL+       IK++DFGSSC+  +++YTYIQSRFYRSPEVILG PY+  ID+WS GC+L EL TG PLFPGESE++Q+ CIME+  LPP   ++ ++R++LFFD+KG PR++ NSKG++R P+S+ + S +K N D  F+D I  CL WD   R+ PD+A++H W  +   N
Sbjct:  124 LPMSPTTALKHFQNQLTEYEREEIMDYSEIWYLGLDTKKIEGSQGSPQNAGYDDEHGSYLKVLHDHIGYRYEVLEVIGKGSFGQVLKCLDHKTNETVAIKIIRNKKRFHHQALVELKILDAVRRRDRD--NCHNVIHMKEYFYFRNHLCISFELLGANLYELIKKNNFQGFSLGLIRRFAHSLLKCLQMLHKEKIIHCDLKPENILLSQRGQGNIKVVDFGSSCYEQQRVYTYIQSRFYRSPEVILGHPYSMAIDMWSLGCILAELYTGYPLFPGESEVEQIACIMEIMGLPPNDFVQTASRRRLFFDSKGNPRNITNSKGKKRRPSSKDLASVLKTN-DPLFLDFIQRCLVWDPTKRMTPDEAMQHEWITEGRLN 496          
BLAST of Dual specificity tyrosine-phosphorylation-regulated kinase 4 vs. Ensembl Xenopus
Match: dyrk3 (dual specificity tyrosine-(Y)-phosphorylation regulated kinase 3 [Source:NCBI gene;Acc:493520])

HSP 1 Score: 386.341 bits (991), Expect = 2.114e-126
Identity = 194/384 (50.52%), Postives = 264/384 (68.75%), Query Frame = 2
Query:  599 MGPRSALQNYRFQLTSLEQEEISHFNQIWFLGLNSKKTEAIKGSSPNNGYDDETGAYIKVPHDHIAFRYEILETLGKGSFGQVFKAIDHQTGINVAVKVIRNKKRFHQQSFVEVNIXXXXXXXXXXXXTSFHVIHLLNSFFFRNHPCLVFELLGENLYDVIKRNNFRGFSLSSIQKMSYSILSCLSVLRRENIIHCDLKPENILVMNNNSSEIKIIDFGSSCFYNEKIYTYIQSRFYRSPEVILGIPYTTQIDIWSFGCLLPELLTGRPLFPGESEMDQLLCIMEVYDLPPKSVLEESTRKKLFFDNKGEPR------------SLHNSKGR----RRVPNSQTIQSTMKMNADSKFVDLIHSCLEWDARVRIQPDDALKHSWF 1702
            + P  A++ Y+ QL++ E +EIS F++I+F+G N+KK + + G   N GYDD+ G Y  VPHDH+A+RYE+L+ +GKGSFGQV K  DH+   ++A+K++RN+KRFH+Q+  E+ IL+HLK++++    S +VIH+L SF FRNH C+ FELL  NLY++IKRN F+GFSL  ++K ++SIL CL  L R  IIHCDLKPENIL+     S IK+IDFGSSCF ++++YTYIQSRFYR+PEVILG  Y   ID+WSFGC+L ELLTG PLFPGE E DQL C+ME+   PP  +LE++ R K F ++KG PR             L+ S+ R    R  P S+   + +K   DS F+D +  CL WD   R+ P  AL+H W 
Sbjct:  100 LTPDQAVKQYKHQLSAYELQEISSFSEIYFVGPNAKKRQGVVGGPNNGGYDDDQGGYNLVPHDHVAYRYEVLKVIGKGSFGQVAKVYDHKLHQHLALKMVRNEKRFHRQAAEEIRILEHLKKQDKT--GSMNVIHMLESFTFRNHICMTFELLSMNLYELIKRNKFQGFSLQLVRKFAHSILQCLEALYRNKIIHCDLKPENILLKQQGRSGIKVIDFGSSCFDHQRVYTYIQSRFYRAPEVILGSRYGMPIDMWSFGCILVELLTGYPLFPGEDEGDQLACMMELLGAPPPKLLEQAKRAKNFINSKGYPRYCTVTTLPNGTTVLNGSRSRRGKMRGAPGSKDWVAALKGCEDSLFIDFLKGCLTWDPVARMTPSQALRHQWI 481          
BLAST of Dual specificity tyrosine-phosphorylation-regulated kinase 4 vs. Ensembl Xenopus
Match: dyrk3 (dual specificity tyrosine-(Y)-phosphorylation regulated kinase 3 [Source:NCBI gene;Acc:493520])

HSP 1 Score: 385.571 bits (989), Expect = 2.835e-126
Identity = 194/384 (50.52%), Postives = 264/384 (68.75%), Query Frame = 2
Query:  599 MGPRSALQNYRFQLTSLEQEEISHFNQIWFLGLNSKKTEAIKGSSPNNGYDDETGAYIKVPHDHIAFRYEILETLGKGSFGQVFKAIDHQTGINVAVKVIRNKKRFHQQSFVEVNIXXXXXXXXXXXXTSFHVIHLLNSFFFRNHPCLVFELLGENLYDVIKRNNFRGFSLSSIQKMSYSILSCLSVLRRENIIHCDLKPENILVMNNNSSEIKIIDFGSSCFYNEKIYTYIQSRFYRSPEVILGIPYTTQIDIWSFGCLLPELLTGRPLFPGESEMDQLLCIMEVYDLPPKSVLEESTRKKLFFDNKGEPR------------SLHNSKGR----RRVPNSQTIQSTMKMNADSKFVDLIHSCLEWDARVRIQPDDALKHSWF 1702
            + P  A++ Y+ QL++ E +EIS F++I+F+G N+KK + + G   N GYDD+ G Y  VPHDH+A+RYE+L+ +GKGSFGQV K  DH+   ++A+K++RN+KRFH+Q+  E+ IL+HLK++++    S +VIH+L SF FRNH C+ FELL  NLY++IKRN F+GFSL  ++K ++SIL CL  L R  IIHCDLKPENIL+     S IK+IDFGSSCF ++++YTYIQSRFYR+PEVILG  Y   ID+WSFGC+L ELLTG PLFPGE E DQL C+ME+   PP  +LE++ R K F ++KG PR             L+ S+ R    R  P S+   + +K   DS F+D +  CL WD   R+ P  AL+H W 
Sbjct:   83 LTPDQAVKQYKHQLSAYELQEISSFSEIYFVGPNAKKRQGVVGGPNNGGYDDDQGGYNLVPHDHVAYRYEVLKVIGKGSFGQVAKVYDHKLHQHLALKMVRNEKRFHRQAAEEIRILEHLKKQDKT--GSMNVIHMLESFTFRNHICMTFELLSMNLYELIKRNKFQGFSLQLVRKFAHSILQCLEALYRNKIIHCDLKPENILLKQQGRSGIKVIDFGSSCFDHQRVYTYIQSRFYRAPEVILGSRYGMPIDMWSFGCILVELLTGYPLFPGEDEGDQLACMMELLGAPPPKLLEQAKRAKNFINSKGYPRYCTVTTLPNGTTVLNGSRSRRGKMRGAPGSKDWVAALKGCEDSLFIDFLKGCLTWDPVARMTPSQALRHQWI 464          
BLAST of Dual specificity tyrosine-phosphorylation-regulated kinase 4 vs. Ensembl Xenopus
Match: dyrk3 (dual specificity tyrosine-(Y)-phosphorylation regulated kinase 3 [Source:NCBI gene;Acc:493520])

HSP 1 Score: 386.726 bits (992), Expect = 2.895e-126
Identity = 194/384 (50.52%), Postives = 264/384 (68.75%), Query Frame = 2
Query:  599 MGPRSALQNYRFQLTSLEQEEISHFNQIWFLGLNSKKTEAIKGSSPNNGYDDETGAYIKVPHDHIAFRYEILETLGKGSFGQVFKAIDHQTGINVAVKVIRNKKRFHQQSFVEVNIXXXXXXXXXXXXTSFHVIHLLNSFFFRNHPCLVFELLGENLYDVIKRNNFRGFSLSSIQKMSYSILSCLSVLRRENIIHCDLKPENILVMNNNSSEIKIIDFGSSCFYNEKIYTYIQSRFYRSPEVILGIPYTTQIDIWSFGCLLPELLTGRPLFPGESEMDQLLCIMEVYDLPPKSVLEESTRKKLFFDNKGEPR------------SLHNSKGR----RRVPNSQTIQSTMKMNADSKFVDLIHSCLEWDARVRIQPDDALKHSWF 1702
            + P  A++ Y+ QL++ E +EIS F++I+F+G N+KK + + G   N GYDD+ G Y  VPHDH+A+RYE+L+ +GKGSFGQV K  DH+   ++A+K++RN+KRFH+Q+  E+ IL+HLK++++    S +VIH+L SF FRNH C+ FELL  NLY++IKRN F+GFSL  ++K ++SIL CL  L R  IIHCDLKPENIL+     S IK+IDFGSSCF ++++YTYIQSRFYR+PEVILG  Y   ID+WSFGC+L ELLTG PLFPGE E DQL C+ME+   PP  +LE++ R K F ++KG PR             L+ S+ R    R  P S+   + +K   DS F+D +  CL WD   R+ P  AL+H W 
Sbjct:  122 LTPDQAVKQYKHQLSAYELQEISSFSEIYFVGPNAKKRQGVVGGPNNGGYDDDQGGYNLVPHDHVAYRYEVLKVIGKGSFGQVAKVYDHKLHQHLALKMVRNEKRFHRQAAEEIRILEHLKKQDKT--GSMNVIHMLESFTFRNHICMTFELLSMNLYELIKRNKFQGFSLQLVRKFAHSILQCLEALYRNKIIHCDLKPENILLKQQGRSGIKVIDFGSSCFDHQRVYTYIQSRFYRAPEVILGSRYGMPIDMWSFGCILVELLTGYPLFPGEDEGDQLACMMELLGAPPPKLLEQAKRAKNFINSKGYPRYCTVTTLPNGTTVLNGSRSRRGKMRGAPGSKDWVAALKGCEDSLFIDFLKGCLTWDPVARMTPSQALRHQWI 503          
BLAST of Dual specificity tyrosine-phosphorylation-regulated kinase 4 vs. Ensembl Xenopus
Match: dyrk3 (dual specificity tyrosine-(Y)-phosphorylation regulated kinase 3 [Source:NCBI gene;Acc:493520])

HSP 1 Score: 385.185 bits (988), Expect = 5.805e-126
Identity = 194/384 (50.52%), Postives = 264/384 (68.75%), Query Frame = 2
Query:  599 MGPRSALQNYRFQLTSLEQEEISHFNQIWFLGLNSKKTEAIKGSSPNNGYDDETGAYIKVPHDHIAFRYEILETLGKGSFGQVFKAIDHQTGINVAVKVIRNKKRFHQQSFVEVNIXXXXXXXXXXXXTSFHVIHLLNSFFFRNHPCLVFELLGENLYDVIKRNNFRGFSLSSIQKMSYSILSCLSVLRRENIIHCDLKPENILVMNNNSSEIKIIDFGSSCFYNEKIYTYIQSRFYRSPEVILGIPYTTQIDIWSFGCLLPELLTGRPLFPGESEMDQLLCIMEVYDLPPKSVLEESTRKKLFFDNKGEPR------------SLHNSKGR----RRVPNSQTIQSTMKMNADSKFVDLIHSCLEWDARVRIQPDDALKHSWF 1702
            + P  A++ Y+ QL++ E +EIS F++I+F+G N+KK + + G   N GYDD+ G Y  VPHDH+A+RYE+L+ +GKGSFGQV K  DH+   ++A+K++RN+KRFH+Q+  E+ IL+HLK++++    S +VIH+L SF FRNH C+ FELL  NLY++IKRN F+GFSL  ++K ++SIL CL  L R  IIHCDLKPENIL+     S IK+IDFGSSCF ++++YTYIQSRFYR+PEVILG  Y   ID+WSFGC+L ELLTG PLFPGE E DQL C+ME+   PP  +LE++ R K F ++KG PR             L+ S+ R    R  P S+   + +K   DS F+D +  CL WD   R+ P  AL+H W 
Sbjct:   93 LTPDQAVKQYKHQLSAYELQEISSFSEIYFVGPNAKKRQGVVGGPNNGGYDDDQGGYNLVPHDHVAYRYEVLKVIGKGSFGQVAKVYDHKLHQHLALKMVRNEKRFHRQAAEEIRILEHLKKQDKT--GSMNVIHMLESFTFRNHICMTFELLSMNLYELIKRNKFQGFSLQLVRKFAHSILQCLEALYRNKIIHCDLKPENILLKQQGRSGIKVIDFGSSCFDHQRVYTYIQSRFYRAPEVILGSRYGMPIDMWSFGCILVELLTGYPLFPGEDEGDQLACMMELLGAPPPKLLEQAKRAKNFINSKGYPRYCTVTTLPNGTTVLNGSRSRRGKMRGAPGSKDWVAALKGCEDSLFIDFLKGCLTWDPVARMTPSQALRHQWI 474          
BLAST of Dual specificity tyrosine-phosphorylation-regulated kinase 4 vs. Ensembl Xenopus
Match: DYRK2 (dual specificity tyrosine phosphorylation regulated kinase 2 [Source:NCBI gene;Acc:100485120])

HSP 1 Score: 385.571 bits (989), Expect = 5.140e-125
Identity = 186/385 (48.31%), Postives = 264/385 (68.57%), Query Frame = 2
Query:  599 MGPRSALQNYRFQLTSLEQEEISHFNQIWFLGLNSKKTEAIKGSSPNNGYDDETGAYIKVPHDHIAFRYEILETLGKGSFGQVFKAIDHQTGINVAVKVIRNKKRFHQQSFVEVNIXXXXXXXXXXXXTSFHVIHLLNSFFFRNHPCLVFELLGENLYDVIKRNNFRGFSLSSIQKMSYSILSCLSVLRRENIIHCDLKPENILVMNNNSSEIKIIDFGSSCFYNEKIYTYIQSRFYRSPEVILGIPYTTQIDIWSFGCLLPELLTGRPLFPGESEMDQLLCIMEVYDLPPKSVLEESTRKKLFFDNKGEPR------------SLHNSKGR----RRVPNSQTIQSTMKMNADSKFVDLIHSCLEWDARVRIQPDDALKHSWFQ 1705
            + P  A++ Y  +LT+ E  EI ++ +I+FLG N+KK + + G   N GYDD+ G+Y++VPHDH+A+RYE+L+ +GKGSFGQV KA DH+   +VA+K++RN+KRFH+Q+  E+ IL+HLK++++    + +VIH+L +F FRNH C+ FELL  NLY++IK+N F+GFSL  ++K ++SIL CL  L +  IIHCDLKPENIL+     S IK+IDFGSSC+ ++++YTYIQSRFYR+PEVILG  Y   ID+WS GC+L ELLTG PL PGE E DQL C++E+  +P + +L+ S R K FF +KG PR             L+  + R    R  P S+   + +K   D  F+D +  CLEWD  +R+ P  AL+H W +
Sbjct:  178 LTPEQAMKQYMQKLTAFEHHEIFNYPEIYFLGPNAKKRQGVIGGPNNGGYDDDQGSYVQVPHDHVAYRYEVLKVIGKGSFGQVVKAYDHKLHQHVALKMVRNEKRFHRQAAEEIRILEHLKKQDKD--NNMNVIHMLENFTFRNHICMTFELLSMNLYELIKKNKFQGFSLPLVRKFAHSILQCLDALHKNRIIHCDLKPENILLKQQGRSGIKVIDFGSSCYEHQRVYTYIQSRFYRAPEVILGGRYGMPIDMWSLGCILAELLTGYPLLPGEDEGDQLACMIELLGMPSQKLLDASKRGKNFFSSKGYPRYCTVTSLPDGSVVLNGGRSRRGKLRGPPGSRDWVTALKGCDDPLFLDFLTQCLEWDPSLRMTPSQALRHHWLR 560          
BLAST of Dual specificity tyrosine-phosphorylation-regulated kinase 4 vs. Ensembl Mouse
Match: Dyrk4 (dual-specificity tyrosine-(Y)-phosphorylation regulated kinase 4 [Source:MGI Symbol;Acc:MGI:1330292])

HSP 1 Score: 407.912 bits (1047), Expect = 8.267e-134
Identity = 195/424 (45.99%), Postives = 291/424 (68.63%), Query Frame = 2
Query:  458 NQKPSWGSVNISQS---NCVDDSSRSTNQLDSSLKVSPHNYQDH----SPHGFPMGPRSALQNYRFQLTSLEQEEISHFNQIWFLGLNSKKTEAIKGSSPNNGYDDETGAYIKVPHDHIAFRYEILETLGKGSFGQVFKAIDHQTGINVAVKVIRNKKRFHQQSFVEVNIXXXXXXXXXXXXTSFHVIHLLNSFFFRNHPCLVFELLGENLYDVIKRNNFRGFSLSSIQKMSYSILSCLSVLRRENIIHCDLKPENILVMNNNSSEIKIIDFGSSCFYNEKIYTYIQSRFYRSPEVILGIPYTTQIDIWSFGCLLPELLTGRPLFPGESEMDQLLCIMEVYDLPPKSVLEESTRKKLFFDNKGEPRSLHNSKGRRRVPNSQTIQSTMKMNADSKFVDLIHSCLEWDARVRIQPDDALKHSWFQD 1708
            N+ PS G +   ++   N V  S   T+++  ++     + + H      H  P+    AL+ ++ QL+  EQ EI  ++++WFLGL +KK   +        +DDE G+Y+KV HDHIA+RYE+LE +GKGSFGQV K +DH+    VA+K+IRNKKRFH Q+ VE+ IL+ L+ K++    + +V+H+ + F+FRNH C+ FELLG NLY+++K N+F GF+LS +++ ++SIL CL +L  E IIHCDLKPENI++       +K+IDFGSSC+ ++K+YTYIQSRFYRSPEVILG PY   ID+WS GC++ EL TG PLFPGE+E++QL CIMEV  LPP    + ++R+++FFD+KG P++++N++G +R P+S+ +   +K   DS F+D +  CL W+  +R+ P+ ALKH+W  +
Sbjct:   97 NKVPSKGPMQYQENQIHNQVLSSELKTSEIPFNINTKAQDTKPHPELQKKHKVPLTVAEALKFFKNQLSPYEQSEILGYSELWFLGLEAKKLNVVPEKFSKTSFDDEHGSYMKVLHDHIAYRYEVLEMIGKGSFGQVAKCLDHKNNELVALKIIRNKKRFHHQALVELKILEALRRKDKD--NNHNVVHMKDFFYFRNHLCITFELLGINLYELMKNNSFHGFNLSIVRRFTFSILKCLHMLYVEKIIHCDLKPENIVLYQRGQVTVKVIDFGSSCYEHQKVYTYIQSRFYRSPEVILGHPYNMAIDMWSLGCIMAELYTGYPLFPGENEVEQLACIMEVLGLPPAHFTQTASRRQVFFDSKGLPKNINNNRGGKRYPDSKDLTMVVK-TYDSSFLDFLRRCLVWEPSLRMTPEQALKHAWIHE 517          
BLAST of Dual specificity tyrosine-phosphorylation-regulated kinase 4 vs. Ensembl Mouse
Match: Dyrk3 (dual-specificity tyrosine-(Y)-phosphorylation regulated kinase 3 [Source:MGI Symbol;Acc:MGI:1330300])

HSP 1 Score: 391.734 bits (1005), Expect = 4.820e-128
Identity = 196/426 (46.01%), Postives = 278/426 (65.26%), Query Frame = 2
Query:  485 NISQSNCVDDSSRST----NQLDSSLKVSPHNYQDHSPHGFPMGPRSALQNYRFQLTSLEQEEISHFNQIWFLGLNSKKTEAIKGSSPNNGYDDETGAYIKVPHDHIAFRYEILETLGKGSFGQVFKAIDHQTGINVAVKVIRNKKRFHQQSFVEVNIXXXXXXXXXXXXTSFHVIHLLNSFFFRNHPCLVFELLGENLYDVIKRNNFRGFSLSSIQKMSYSILSCLSVLRRENIIHCDLKPENILVMNNNSSEIKIIDFGSSCFYNEKIYTYIQSRFYRSPEVILGIPYTTQIDIWSFGCLLPELLTGRPLFPGESEMDQLLCIMEVYDLPPKSVLEESTRKKLFFDNKGEPRSLHNS---------------KGRRR-VPNSQTIQSTMKMNADSKFVDLIHSCLEWDARVRIQPDDALKHSWF 1702
            N  QS+ + +S +S+     +   SL     N         P+ P  AL+ Y+  LT+ E+ EI  + +I+F+G N+KK + + G   N GYDD  GAYI VP DH+A+RYE+L+ +GKGSFGQV +  DH+    VA+K++RN+KRFH+Q+  E+ IL+HLK++++    S +VIH+L SF FRNH C+ FELL  +LY++IK+N F+GFS+  ++K + SIL  L  L +  IIHCDLKPENIL+ ++  S  K+IDFGSSCF  +K+YTYIQSRFYR+PE+ILG  Y+T IDIWSFGC+L ELLTG+PLFPGE E DQL C++E+  +PP+ +LE+S R K F ++KG PR    S               +G++R  P S+   + +K   D  F++ +  CL+WD   R+ P  AL+H W 
Sbjct:   98 NTLQSDGISNSEKSSPASQGKSSESLSAVKCNLSSRPSKVLPLTPEQALKQYKHHLTAYEKLEIVSYPEIYFVGPNAKKRQGVIGGPNNGGYDDADGAYIHVPRDHLAYRYEVLKIIGKGSFGQVARVYDHKLRQYVALKMVRNEKRFHRQAAEEIRILEHLKKQDKT--GSMNVIHMLESFTFRNHVCMAFELLSIDLYELIKKNKFQGFSVQLVRKFAQSILQSLDALHKNKIIHCDLKPENILLKHHGRSATKVIDFGSSCFEYQKLYTYIQSRFYRAPEIILGCRYSTPIDIWSFGCILAELLTGQPLFPGEDEGDQLACMIELLGMPPQKLLEQSKRAKYFINSKGLPRYCSVSTQTDGRVVLLGGRSRRGKKRGPPGSKDWATALKGCGDYLFIEFLKRCLQWDPSARLTPAQALRHPWI 521          
BLAST of Dual specificity tyrosine-phosphorylation-regulated kinase 4 vs. Ensembl Mouse
Match: Dyrk2 (dual-specificity tyrosine-(Y)-phosphorylation regulated kinase 2 [Source:MGI Symbol;Acc:MGI:1330301])

HSP 1 Score: 391.349 bits (1004), Expect = 9.292e-128
Identity = 187/386 (48.45%), Postives = 263/386 (68.13%), Query Frame = 2
Query:  596 PMGPRSALQNYRFQLTSLEQEEISHFNQIWFLGLNSKKTEAIKGSSPNNGYDDETGAYIKVPHDHIAFRYEILETLGKGSFGQVFKAIDHQTGINVAVKVIRNKKRFHQQSFVEVNIXXXXXXXXXXXXTSFHVIHLLNSFFFRNHPCLVFELLGENLYDVIKRNNFRGFSLSSIQKMSYSILSCLSVLRRENIIHCDLKPENILVMNNNSSEIKIIDFGSSCFYNEKIYTYIQSRFYRSPEVILGIPYTTQIDIWSFGCLLPELLTGRPLFPGESEMDQLLCIMEVYDLPPKSVLEESTRKKLFFDNKGEPR------------SLHNSKGR----RRVPNSQTIQSTMKMNADSKFVDLIHSCLEWDARVRIQPDDALKHSWFQ 1705
            PM P  A++ Y  +LT+ E  EI  + +I+FLG N+KK + + G   N GYDD+ G+Y++VPHDH+A+RYE+L+ +GKGSFGQV KA DH+   +VA+K++RN+KRFH+Q+  E+ IL+HL+++++    + +VIH+L +F FRNH C+ FELL  NLY++IK+N F+GFSL  ++K ++SIL CL  L +  IIHCDLKPENIL+     S IK+IDFGSSC+ ++++YTYIQSRFYR+PEVILG  Y   ID+WS GC+L ELLTG PL PGE E DQL C++E+  +P + +L+ S R K F  +KG PR             L+  + R    R  P S+   + +K   D  F+D +  CLEWD  VR+ P  AL+H W +
Sbjct:  151 PMTPEQAMKQYMQKLTAFEHHEIFSYPEIYFLGPNAKKRQGMTGGPNNGGYDDDQGSYVQVPHDHVAYRYEVLKVIGKGSFGQVVKAYDHKVHQHVALKMVRNEKRFHRQAAEEIRILEHLRKQDKD--NTMNVIHMLENFTFRNHICMTFELLSMNLYELIKKNKFQGFSLPLVRKFAHSILQCLDALHKNRIIHCDLKPENILLKQQGRSSIKVIDFGSSCYEHQRVYTYIQSRFYRAPEVILGARYGMPIDMWSLGCILAELLTGYPLLPGEDEGDQLACMIELLGMPSQKLLDASKRAKNFVSSKGYPRYCTVTTLSDGSVVLNGGRSRRGKLRGPPESREWGNALKGCDDPLFLDFLKQCLEWDPAVRMTPGQALRHPWLR 534          
BLAST of Dual specificity tyrosine-phosphorylation-regulated kinase 4 vs. Ensembl Mouse
Match: Dyrk1b (dual-specificity tyrosine-(Y)-phosphorylation regulated kinase 1b [Source:MGI Symbol;Acc:MGI:1330302])

HSP 1 Score: 271.552 bits (693), Expect = 1.391e-81
Identity = 156/409 (38.14%), Postives = 233/409 (56.97%), Query Frame = 2
Query:  584 PHGFPMGPRSALQNYRFQLTSLEQEEISHFNQIWFLGLNSKKTEAIKGSSP------------NNGYDDETGAYIKVPHDHIAFRYEILETLGKGSFGQVFKAIDHQTGINVAVKVIRNKKRFHQQSFVEVNIXXXXXXXXXXXXTSFHVIHLLNSFFFRNHPCLVFELLGENLYDVIKRNNFRGFSLSSIQKMSYSILSCLSVLRRE--NIIHCDLKPENILVMNNNSSEIKIIDFGSSCFYNEKIYTYIQSRFYRSPEVILGIPYTTQIDIWSFGCLLPELLTGRPLFPGESEMDQLLCIMEVYDLPPKSVLEESTRKKLFFDN-KGEPRSLHNSKGRRR---VPNSQTIQSTMKMNADS-----------------KFVDLIHSCLEWDARVRIQPDDALKHSWFQ 1705
            P   P+  R A      +L+    +   H N++++    +KK    + + P            N+GYDD+   YI    +    RYEI   +GKGSFGQV KA DHQT   VA+K+I+NKK F  Q+ +E+ +L+ + + + +    ++++HL   F FRNH CLVFELL  NLYD+++  +FRG SL+  +K++  + + L  L     +IIHCDLKPENIL+ N   S IKI+DFGSSC   ++IY YIQSRFYRSPEV+LG PY   ID+WS GC+L E+ TG PLF G +E+DQ+  I+EV  +PP  +LE++ + + +F+   G   +L  +K  R+    P ++ +Q  + +                     +F DL+   LE++   RI P  AL+H +F+
Sbjct:   30 PRRLPLAFRDAASAPLRKLSVDLIKTYKHINEVYY----AKKKRRAQQAPPQDSSTKKEKKVLNHGYDDDNHDYIVRSGERWLERYEIDSLIGKGSFGQVVKAYDHQTQELVAIKIIKNKKAFLNQAQIELRLLELMNQHDTE--MKYYIVHLKRHFMFRNHLCLVFELLSYNLYDLLRNTHFRGVSLNLTRKLAQQLCTALLFLATPELSIIHCDLKPENILLCNPKRSAIKIVDFGSSCQLGQRIYQYIQSRFYRSPEVLLGTPYDLAIDMWSLGCILVEMHTGEPLFSGSNEVDQMSRIVEVLGIPPAPMLEQAPKARKYFERLPGGGWTLRRTKELRKDYQGPGTRRLQEVLGVQTGGPGGRRAGEPGHSPADYLRFQDLVLRMLEYEPAARISPLGALQHGFFR 432          
BLAST of Dual specificity tyrosine-phosphorylation-regulated kinase 4 vs. Ensembl Mouse
Match: Dyrk1b (dual-specificity tyrosine-(Y)-phosphorylation regulated kinase 1b [Source:MGI Symbol;Acc:MGI:1330302])

HSP 1 Score: 268.855 bits (686), Expect = 6.459e-81
Identity = 153/389 (39.33%), Postives = 226/389 (58.10%), Query Frame = 2
Query:  584 PHGFPMGPRSALQNYRFQLTSLEQEEISHFNQIWFLGLNSKKTEAIKGSSP------------NNGYDDETGAYIKVPHDHIAFRYEILETLGKGSFGQVFKAIDHQTGINVAVKVIRNKKRFHQQSFVEVNIXXXXXXXXXXXXTSFHVIHLLNSFFFRNHPCLVFELLGENLYDVIKRNNFRGFSLSSIQKMSYSILSCLSVLRRE--NIIHCDLKPENILVMNNNSSEIKIIDFGSSCFYNEKIYTYIQSRFYRSPEVILGIPYTTQIDIWSFGCLLPELLTGRPLFPGESEMDQLLCIMEVYDLPPKSVLEESTRKKLFFDNKGEPRSLHNSKGRRRVPNSQ-TIQSTMKMNADSKFVDLIHSCLEWDARVRIQPDDALKHSWFQ 1705
            P   P+  R A      +L+    +   H N++++    +KK    + + P            N+GYDD+   YI    +    RYEI   +GKGSFGQV KA DHQT   VA+K+I+NKK F  Q+ +E+ +L+ + + + +    ++++HL   F FRNH CLVFELL  NLYD+++  +FRG SL+  +K++  + + L  L     +IIHCDLKPENIL+ N   S IKI+DFGSSC   ++IY YIQSRFYRSPEV+LG PY   ID+WS GC+L E+ TG PLF G +E+DQ+  I+EV  +PP  +LE++ + + +F+               R+P    T++ T ++       DL+   LE++   RI P  AL+H +F+
Sbjct:   30 PRRLPLAFRDAASAPLRKLSVDLIKTYKHINEVYY----AKKKRRAQQAPPQDSSTKKEKKVLNHGYDDDNHDYIVRSGERWLERYEIDSLIGKGSFGQVVKAYDHQTQELVAIKIIKNKKAFLNQAQIELRLLELMNQHDTE--MKYYIVHLKRHFMFRNHLCLVFELLSYNLYDLLRNTHFRGVSLNLTRKLAQQLCTALLFLATPELSIIHCDLKPENILLCNPKRSAIKIVDFGSSCQLGQRIYQYIQSRFYRSPEVLLGTPYDLAIDMWSLGCILVEMHTGEPLFSGSNEVDQMSRIVEVLGIPPAPMLEQAPKARKYFE---------------RLPGGGWTLRRTKELRK-----DLVLRMLEYEPAARISPLGALQHGFFR 392          
BLAST of Dual specificity tyrosine-phosphorylation-regulated kinase 4 vs. UniProt/SwissProt
Match: sp|Q9NR20|DYRK4_HUMAN (Dual specificity tyrosine-phosphorylation-regulated kinase 4 OS=Homo sapiens OX=9606 GN=DYRK4 PE=1 SV=2)

HSP 1 Score: 409.838 bits (1052), Expect = 4.061e-135
Identity = 190/388 (48.97%), Postives = 277/388 (71.39%), Query Frame = 2
Query:  545 SLKVSPHNYQDHSP--HGFPMGPRSALQNYRFQLTSLEQEEISHFNQIWFLGLNSKKTEAIKGSSPNNGYDDETGAYIKVPHDHIAFRYEILETLGKGSFGQVFKAIDHQTGINVAVKVIRNKKRFHQQSFVEVNIXXXXXXXXXXXXTSFHVIHLLNSFFFRNHPCLVFELLGENLYDVIKRNNFRGFSLSSIQKMSYSILSCLSVLRRENIIHCDLKPENILVMNNNSSEIKIIDFGSSCFYNEKIYTYIQSRFYRSPEVILGIPYTTQIDIWSFGCLLPELLTGRPLFPGESEMDQLLCIMEVYDLPPKSVLEESTRKKLFFDNKGEPRSLHNSKGRRRVPNSQTIQSTMKMNADSKFVDLIHSCLEWDARVRIQPDDALKHSWF 1702
            S+K      ++ SP      +    AL+ ++ QL+  EQ EI  + ++WFLGL +KK +          +DDE G Y+KV HDHIA+RYE+LET+GKGSFGQV K +DH+    VA+K+IRNKKRFHQQ+ +E+ IL+ L++K++    +++V+H+ + F+FRNH C+ FELLG NLY+++K NNF+GFSLS +++ + S+L CL +L  E IIHCDLKPENI++     + +K+IDFGSSC+ ++K+YTYIQSRFYRSPEVILG PY   ID+WS GC+  EL TG PLFPGE+E++QL CIMEV  LPP   ++ ++R++ FFD+KG P+++ N++G++R P+S+ +   +K   D+ F+D +  CL W+  +R+ PD ALKH+W 
Sbjct:   16 SIKTQDPKAEEKSPKKQKVTLTAAEALKLFKNQLSPYEQSEILGYAELWFLGLEAKKLDTAPEKFSKTSFDDEHGFYLKVLHDHIAYRYEVLETIGKGSFGQVAKCLDHKNNELVALKIIRNKKRFHQQALMELKILEALRKKDKD--NTYNVVHMKDFFYFRNHFCITFELLGINLYELMKNNNFQGFSLSIVRRFTLSVLKCLQMLSVEKIIHCDLKPENIVLYQKGQASVKVIDFGSSCYEHQKVYTYIQSRFYRSPEVILGHPYDVAIDMWSLGCITAELYTGYPLFPGENEVEQLACIMEVLGLPPAGFIQTASRRQTFFDSKGFPKNITNNRGKKRYPDSKDLTMVLK-TYDTSFLDFLRRCLVWEPSLRMTPDQALKHAWI 400          
BLAST of Dual specificity tyrosine-phosphorylation-regulated kinase 4 vs. UniProt/SwissProt
Match: sp|Q8BI55|DYRK4_MOUSE (Dual specificity tyrosine-phosphorylation-regulated kinase 4 OS=Mus musculus OX=10090 GN=Dyrk4 PE=2 SV=1)

HSP 1 Score: 407.912 bits (1047), Expect = 5.782e-133
Identity = 195/424 (45.99%), Postives = 291/424 (68.63%), Query Frame = 2
Query:  458 NQKPSWGSVNISQS---NCVDDSSRSTNQLDSSLKVSPHNYQDH----SPHGFPMGPRSALQNYRFQLTSLEQEEISHFNQIWFLGLNSKKTEAIKGSSPNNGYDDETGAYIKVPHDHIAFRYEILETLGKGSFGQVFKAIDHQTGINVAVKVIRNKKRFHQQSFVEVNIXXXXXXXXXXXXTSFHVIHLLNSFFFRNHPCLVFELLGENLYDVIKRNNFRGFSLSSIQKMSYSILSCLSVLRRENIIHCDLKPENILVMNNNSSEIKIIDFGSSCFYNEKIYTYIQSRFYRSPEVILGIPYTTQIDIWSFGCLLPELLTGRPLFPGESEMDQLLCIMEVYDLPPKSVLEESTRKKLFFDNKGEPRSLHNSKGRRRVPNSQTIQSTMKMNADSKFVDLIHSCLEWDARVRIQPDDALKHSWFQD 1708
            N+ PS G +   ++   N V  S   T+++  ++     + + H      H  P+    AL+ ++ QL+  EQ EI  ++++WFLGL +KK   +        +DDE G+Y+KV HDHIA+RYE+LE +GKGSFGQV K +DH+    VA+K+IRNKKRFH Q+ VE+ IL+ L+ K++    + +V+H+ + F+FRNH C+ FELLG NLY+++K N+F GF+LS +++ ++SIL CL +L  E IIHCDLKPENI++       +K+IDFGSSC+ ++K+YTYIQSRFYRSPEVILG PY   ID+WS GC++ EL TG PLFPGE+E++QL CIMEV  LPP    + ++R+++FFD+KG P++++N++G +R P+S+ +   +K   DS F+D +  CL W+  +R+ P+ ALKH+W  +
Sbjct:   97 NKVPSKGPMQYQENQIHNQVLSSELKTSEIPFNINTKAQDTKPHPELQKKHKVPLTVAEALKFFKNQLSPYEQSEILGYSELWFLGLEAKKLNVVPEKFSKTSFDDEHGSYMKVLHDHIAYRYEVLEMIGKGSFGQVAKCLDHKNNELVALKIIRNKKRFHHQALVELKILEALRRKDKD--NNHNVVHMKDFFYFRNHLCITFELLGINLYELMKNNSFHGFNLSIVRRFTFSILKCLHMLYVEKIIHCDLKPENIVLYQRGQVTVKVIDFGSSCYEHQKVYTYIQSRFYRSPEVILGHPYNMAIDMWSLGCIMAELYTGYPLFPGENEVEQLACIMEVLGLPPAHFTQTASRRQVFFDSKGLPKNINNNRGGKRYPDSKDLTMVVK-TYDSSFLDFLRRCLVWEPSLRMTPEQALKHAWIHE 517          
BLAST of Dual specificity tyrosine-phosphorylation-regulated kinase 4 vs. UniProt/SwissProt
Match: sp|Q9V3D5|DYRK2_DROME (Dual specificity tyrosine-phosphorylation-regulated kinase 2 OS=Drosophila melanogaster OX=7227 GN=Dyrk2 PE=1 SV=1)

HSP 1 Score: 410.223 bits (1053), Expect = 1.228e-132
Identity = 196/373 (52.55%), Postives = 266/373 (71.31%), Query Frame = 2
Query:  596 PMGPRSALQNYRFQLTSLEQEEISHFNQIWFLGLNSKKT---EAIKGSSPNNGYDDETGAYIKVPHDHIAFRYEILETLGKGSFGQVFKAIDHQTGINVAVKVIRNKKRFHQQSFVEVNIXXXXXXXXXXXXTSFHVIHLLNSFFFRNHPCLVFELLGENLYDVIKRNNFRGFSLSSIQKMSYSILSCLSVLRRENIIHCDLKPENILVMNNNSSEIKIIDFGSSCFYNEKIYTYIQSRFYRSPEVILGIPYTTQIDIWSFGCLLPELLTGRPLFPGESEMDQLLCIMEVYDLPPKSVLEESTRKKLFFDNKGEPRSLHNSKGRRRVPNSQTIQSTMKMNADSKFVDLIHSCLEWDARVRIQPDDALKHSWFQ 1705
            PM P   ++ +R  LT LE EE+  + ++W+ G ++ K     A   ++ N GYDD+ G Y  + HDHIAFRYEILE +GKGSFGQV +A+DH+T  +VA+K+IRNKKRF  Q+ VE+NIL  L+EK+     S +VIH+L+  +FR H C+ FEL+  NLY++IK+NN+ GFS+S I++   SI+ CL +L +ENIIHCDLKPENIL+    SS IK+IDFGSSC+ + KIYTYIQSRFYRSPEVILG+ Y T ID+WS GC+L EL TG PLFPGE+E++QL CIMEV  LPPK ++  + R++LFFD++  PR + N+KGR+R P S+++   +    D  F+D +  CLEWD   R+ PD+A  H + Q
Sbjct:  126 PMTPSELVKKFRNYLTDLEFEELKVYKEVWYFGQHASKNYNKPAPTANTTNLGYDDDNGNYKIIEHDHIAFRYEILEVIGKGSFGQVIRALDHKTNTHVAIKIIRNKKRFLNQAVVELNILDELREKDADG--SHNVIHMLDYTYFRKHLCITFELMSLNLYELIKKNNYNGFSMSLIRRFCNSIVKCLRLLYKENIIHCDLKPENILLKQRGSSSIKVIDFGSSCYVDRKIYTYIQSRFYRSPEVILGLQYGTAIDMWSLGCILAELYTGFPLFPGENEVEQLACIMEVLGLPPKVLISVARRRRLFFDSRDAPRCITNTKGRKRSPGSKSLAHILHCQ-DRYFIDFLQRCLEWDPAERMTPDEAAHHEFLQ 495          
BLAST of Dual specificity tyrosine-phosphorylation-regulated kinase 4 vs. UniProt/SwissProt
Match: sp|Q92630|DYRK2_HUMAN (Dual specificity tyrosine-phosphorylation-regulated kinase 2 OS=Homo sapiens OX=9606 GN=DYRK2 PE=1 SV=3)

HSP 1 Score: 393.66 bits (1010), Expect = 8.787e-128
Identity = 188/386 (48.70%), Postives = 264/386 (68.39%), Query Frame = 2
Query:  596 PMGPRSALQNYRFQLTSLEQEEISHFNQIWFLGLNSKKTEAIKGSSPNNGYDDETGAYIKVPHDHIAFRYEILETLGKGSFGQVFKAIDHQTGINVAVKVIRNKKRFHQQSFVEVNIXXXXXXXXXXXXTSFHVIHLLNSFFFRNHPCLVFELLGENLYDVIKRNNFRGFSLSSIQKMSYSILSCLSVLRRENIIHCDLKPENILVMNNNSSEIKIIDFGSSCFYNEKIYTYIQSRFYRSPEVILGIPYTTQIDIWSFGCLLPELLTGRPLFPGESEMDQLLCIMEVYDLPPKSVLEESTRKKLFFDNKGEPR------------SLHNSKGR----RRVPNSQTIQSTMKMNADSKFVDLIHSCLEWDARVRIQPDDALKHSWFQ 1705
            PM P  A++ Y  +LT+ E  EI  + +I+FLGLN+KK + + G   N GYDD+ G+Y++VPHDH+A+RYE+L+ +GKGSFGQV KA DH+   +VA+K++RN+KRFH+Q+  E+ IL+HL+++++    + +VIH+L +F FRNH C+ FELL  NLY++IK+N F+GFSL  ++K ++SIL CL  L +  IIHCDLKPENIL+     S IK+IDFGSSC+ ++++YTYIQSRFYR+PEVILG  Y   ID+WS GC+L ELLTG PL PGE E DQL C++E+  +P + +L+ S R K F  +KG PR             L+  + R    R  P S+   + +K   D  F+D +  CLEWD  VR+ P  AL+H W +
Sbjct:  153 PMTPEQAMKQYMQKLTAFEHHEIFSYPEIYFLGLNAKKRQGMTGGPNNGGYDDDQGSYVQVPHDHVAYRYEVLKVIGKGSFGQVVKAYDHKVHQHVALKMVRNEKRFHRQAAEEIRILEHLRKQDKD--NTMNVIHMLENFTFRNHICMTFELLSMNLYELIKKNKFQGFSLPLVRKFAHSILQCLDALHKNRIIHCDLKPENILLKQQGRSGIKVIDFGSSCYEHQRVYTYIQSRFYRAPEVILGARYGMPIDMWSLGCILAELLTGYPLLPGEDEGDQLACMIELLGMPSQKLLDASKRAKNFVSSKGYPRYCTVTTLSDGSVVLNGGRSRRGKLRGPPESREWGNALKGCDDPLFLDFLKQCLEWDPAVRMTPGQALRHPWLR 536          
BLAST of Dual specificity tyrosine-phosphorylation-regulated kinase 4 vs. UniProt/SwissProt
Match: sp|Q922Y0|DYRK3_MOUSE (Dual specificity tyrosine-phosphorylation-regulated kinase 3 OS=Mus musculus OX=10090 GN=Dyrk3 PE=1 SV=1)

HSP 1 Score: 391.734 bits (1005), Expect = 3.372e-127
Identity = 196/426 (46.01%), Postives = 278/426 (65.26%), Query Frame = 2
Query:  485 NISQSNCVDDSSRST----NQLDSSLKVSPHNYQDHSPHGFPMGPRSALQNYRFQLTSLEQEEISHFNQIWFLGLNSKKTEAIKGSSPNNGYDDETGAYIKVPHDHIAFRYEILETLGKGSFGQVFKAIDHQTGINVAVKVIRNKKRFHQQSFVEVNIXXXXXXXXXXXXTSFHVIHLLNSFFFRNHPCLVFELLGENLYDVIKRNNFRGFSLSSIQKMSYSILSCLSVLRRENIIHCDLKPENILVMNNNSSEIKIIDFGSSCFYNEKIYTYIQSRFYRSPEVILGIPYTTQIDIWSFGCLLPELLTGRPLFPGESEMDQLLCIMEVYDLPPKSVLEESTRKKLFFDNKGEPRSLHNS---------------KGRRR-VPNSQTIQSTMKMNADSKFVDLIHSCLEWDARVRIQPDDALKHSWF 1702
            N  QS+ + +S +S+     +   SL     N         P+ P  AL+ Y+  LT+ E+ EI  + +I+F+G N+KK + + G   N GYDD  GAYI VP DH+A+RYE+L+ +GKGSFGQV +  DH+    VA+K++RN+KRFH+Q+  E+ IL+HLK++++    S +VIH+L SF FRNH C+ FELL  +LY++IK+N F+GFS+  ++K + SIL  L  L +  IIHCDLKPENIL+ ++  S  K+IDFGSSCF  +K+YTYIQSRFYR+PE+ILG  Y+T IDIWSFGC+L ELLTG+PLFPGE E DQL C++E+  +PP+ +LE+S R K F ++KG PR    S               +G++R  P S+   + +K   D  F++ +  CL+WD   R+ P  AL+H W 
Sbjct:   98 NTLQSDGISNSEKSSPASQGKSSESLSAVKCNLSSRPSKVLPLTPEQALKQYKHHLTAYEKLEIVSYPEIYFVGPNAKKRQGVIGGPNNGGYDDADGAYIHVPRDHLAYRYEVLKIIGKGSFGQVARVYDHKLRQYVALKMVRNEKRFHRQAAEEIRILEHLKKQDKT--GSMNVIHMLESFTFRNHVCMAFELLSIDLYELIKKNKFQGFSVQLVRKFAQSILQSLDALHKNKIIHCDLKPENILLKHHGRSATKVIDFGSSCFEYQKLYTYIQSRFYRAPEIILGCRYSTPIDIWSFGCILAELLTGQPLFPGEDEGDQLACMIELLGMPPQKLLEQSKRAKYFINSKGLPRYCSVSTQTDGRVVLLGGRSRRGKKRGPPGSKDWATALKGCGDYLFIEFLKRCLQWDPSARLTPAQALRHPWI 521          
BLAST of Dual specificity tyrosine-phosphorylation-regulated kinase 4 vs. TrEMBL
Match: A0A2B4SBZ4 (Dual specificity tyrosine-phosphorylation-regulated kinase 4 OS=Stylophora pistillata OX=50429 GN=DYRK4 PE=4 SV=1)

HSP 1 Score: 479.559 bits (1233), Expect = 7.451e-159
Identity = 216/379 (56.99%), Postives = 297/379 (78.36%), Query Frame = 2
Query:  572 QDHSPHGFPMGPRSALQNYRFQLTSLEQEEISHFNQIWFLGLNSKKTEAIKGSSPNNGYDDETGAYIKVPHDHIAFRYEILETLGKGSFGQVFKAIDHQTGINVAVKVIRNKKRFHQQSFVEVNIXXXXXXXXXXXXTSFHVIHLLNSFFFRNHPCLVFELLGENLYDVIKRNNFRGFSLSSIQKMSYSILSCLSVLRRENIIHCDLKPENILVMNNNSSEIKIIDFGSSCFYNEKIYTYIQSRFYRSPEVILGIPYTTQIDIWSFGCLLPELLTGRPLFPGESEMDQLLCIMEVYDLPPKSVLEESTRKKLFFDNKGEPRSLHNSKGRRRVPNSQTIQSTMKMNADSKFVDLIHSCLEWDARVRIQPDDALKHSWFQD 1708
            +D + H  PM P  A++NY  ++++ EQ EI  F  +WFLGL +KK E + G+  NNGYDDE+G+Y+K  HDH+ +RYE+LE LGKGSFGQV KA+DH+TG +VAVK+IRNKKRFHQQ+ VEV IL+HL +K+++   ++++IH+++ F+FRNH C+ FEL+G NLY++IK+NNF+GFSL+ I++ +YS+L CL VL +E IIHCDLKPENIL+     S IK+IDFGSSC+ ++++YTYIQSRFYRSPEVILGIPY   ID+WSFGC+L EL TG PLFPGE+E++QL CIME+   PP +VLE ++R+++FFD+KG PRS+ NSKG++R  N + + + +K N D+ FVD I  CLEWD   R+ PD+A++H W Q+
Sbjct:   80 RDPNGHKLPMSPSVAIKNYGDKMSTFEQSEILDFPDVWFLGLEAKKIEGVPGAPQNNGYDDESGSYLKALHDHLVYRYEVLEVLGKGSFGQVVKALDHKTGQHVAVKIIRNKKRFHQQALVEVKILEHLLKKDKE--NNYNLIHMIDYFYFRNHLCISFELMGMNLYELIKKNNFQGFSLALIRRFAYSLLQCLRVLDKEKIIHCDLKPENILLRQRGQSSIKVIDFGSSCYEHQRVYTYIQSRFYRSPEVILGIPYNMAIDMWSFGCILVELYTGYPLFPGENEVEQLACIMEILGKPPPNVLEPASRRRIFFDSKGNPRSMTNSKGKKRQVNGKELGAALKTN-DALFVDFIRGCLEWDPAARLTPDEAIQHEWIQE 455          
BLAST of Dual specificity tyrosine-phosphorylation-regulated kinase 4 vs. TrEMBL
Match: A0A4E0QUJ3 (Dual specificity tyrosine-phosphorylation-regulated kinase 2 (Fragment) OS=Fasciola hepatica OX=6192 GN=D915_010713 PE=3 SV=1)

HSP 1 Score: 459.529 bits (1181), Expect = 5.131e-154
Identity = 211/383 (55.09%), Postives = 297/383 (77.55%), Query Frame = 2
Query:  581 SPHGFPMGPRSALQNYRFQLTSLEQEEISHFNQIWFLGLNSKKTEAIKGSSPNNGYDDETGAYIKVPHDHIAFRYEILETLGKGSFGQVFKAIDHQTGINVAVKVIRNKKRFHQQSFVEVNIXXXXXXXXXXXXTSFHVIHLLNSFFFRNHPCLVFELLGENLYDVIKRNNFRGFSLSSIQKMSYSILSCLSVLRRENIIHCDLKPENILVMNNNSSEIKIIDFGSSCFYNEKIYTYIQSRFYRSPEVILGIPYTTQIDIWSFGCLLPELLTGRPLFPGESEMDQLLCIMEVYDLPPKSVLEESTRKKLFFDNKGEPRSLHNSKGRRRVPNSQTIQSTMKMNADSKFVDLIHSCLEWDARVRIQPDDALKHSWFQDFHANDDC 1729
            SP  F     +A+  Y   LT+ E++E+  +++IWFLGL ++K   I G+  N GYDDE G+Y+KV +DH+A+RYE+LETLGKGSFG+V +A DH+TG  VAVK+IRNKKRFHQQ+ +EV +L+ LK+ +     S H+IH+ + F FR+H C+VF+L+G+NLY+V+K+N+FRGF++ S++K++  +LSCL  LR+  IIHCDLKPENIL+   NSS++ +IDFGSSC+ N+++YTYIQSRFYR+PE+ILG+PY T IDIWSFGC+LPEL TGRPLFPGE+E +QL CIMEV+  PP+++LE++ R+++FFD+KG PR+L NSKGR+R+P  +T+Q  +K ++D KF+DLI  CL W+   RI P+ AL H WF++  +   C
Sbjct:   11 SPIFFGSLYTAAVNRYGKNLTAFERQEVESYSEIWFLGLQAEKIHGIPGAPLNAGYDDEHGSYLKVTNDHLAYRYEVLETLGKGSFGRVVRAKDHRTGNFVAVKIIRNKKRFHQQAQIEVTVLEELKKVDSN--NSCHIIHIRDHFVFRDHLCIVFDLMGQNLYEVLKKNDFRGFTMHSLRKIATKLLSCLCALRKRGIIHCDLKPENILIGTKNSSDLCVIDFGSSCYTNKRVYTYIQSRFYRAPEIILGLPYGTPIDIWSFGCILPELFTGRPLFPGENENEQLACIMEVFGQPPENILEKANRRRIFFDSKGNPRNLVNSKGRKRLPGCRTLQELVK-SSDPKFLDLIQQCLRWNPDERITPEVALNHDWFREVTSQAKC 390          
BLAST of Dual specificity tyrosine-phosphorylation-regulated kinase 4 vs. TrEMBL
Match: C3Y4L0 (Protein kinase domain-containing protein OS=Branchiostoma floridae OX=7739 GN=BRAFLDRAFT_211971 PE=3 SV=1)

HSP 1 Score: 461.07 bits (1185), Expect = 7.441e-154
Identity = 209/365 (57.26%), Postives = 286/365 (78.36%), Query Frame = 2
Query:  614 ALQNYRFQLTSLEQEEISHFNQIWFLGLNSKKTEAIKGSSPNNGYDDETGAYIKVPHDHIAFRYEILETLGKGSFGQVFKAIDHQTGINVAVKVIRNKKRFHQQSFVEVNIXXXXXXXXXXXXTSFHVIHLLNSFFFRNHPCLVFELLGENLYDVIKRNNFRGFSLSSIQKMSYSILSCLSVLRRENIIHCDLKPENILVMNNNSSEIKIIDFGSSCFYNEKIYTYIQSRFYRSPEVILGIPYTTQIDIWSFGCLLPELLTGRPLFPGESEMDQLLCIMEVYDLPPKSVLEESTRKKLFFDNKGEPRSLHNSKGRRRVPNSQTIQSTMKMNADSKFVDLIHSCLEWDARVRIQPDDALKHSWFQD 1708
            AL+ Y+ +LT  EQ EI  +N++WF+G  ++K E I+GS  NNGYDDE G+Y+KV HDH+A+RYE+LE +GKGSFGQV KAIDH+TG ++AVK+IRNKKRFH Q+ VEV IL  L+ K+R    + +VIH++  F+FRNH C+ FELLG NLY++IK+NNF+GFSL+ I++ ++++L C+ VL +E IIHCDLKPENIL+ +   S IK+IDFGSSC+  +++YTYIQSRFYRSPEVILGIPY+  ID+WSFGC+L EL TG PLFPGE+E++QL CIMEV  LPP  +++++ R++LFFD++G+PR + NSKG++R PNS+ +   ++  +D  FVD I  CLEWD  +R  P++A+KH W  D
Sbjct:   21 ALKFYKGKLTGFEQSEILDYNEVWFVGAEARKIEGIQGSPQNNGYDDENGSYLKVIHDHLAYRYEVLEVIGKGSFGQVVKAIDHKTGEHIAVKIIRNKKRFHHQALVEVKILDALRRKDRD--GTMNVIHMVEYFYFRNHLCITFELLGMNLYELIKKNNFQGFSLALIRRFAHALLQCMKVLYKERIIHCDLKPENILLKSKGQSAIKVIDFGSSCYEFQRVYTYIQSRFYRSPEVILGIPYSMAIDMWSFGCILAELYTGYPLFPGENEVEQLACIMEVLGLPPMRLIDDAQRRRLFFDSRGQPRCVTNSKGKKRRPNSKDLAQAIR-TSDPLFVDFIRRCLEWDPNLRWTPEEAMKHEWITD 382          
BLAST of Dual specificity tyrosine-phosphorylation-regulated kinase 4 vs. TrEMBL
Match: A0A1E1XNC6 (Putative mitogen-activated protein kinase erk-a (Fragment) OS=Amblyomma sculptum OX=1581419 PE=2 SV=1)

HSP 1 Score: 462.611 bits (1189), Expect = 8.351e-154
Identity = 221/395 (55.95%), Postives = 294/395 (74.43%), Query Frame = 2
Query:  584 PHG--FPMGPRSALQNYRFQLTSLEQEEISHFNQIWFLGLNSKKTEAIKGSSPNNGYDDETGAYIKVPHDHIAFRYEILETLGKGSFGQVFKAIDHQTGINVAVKVIRNKKRFHQQSFVEVNIXXXXXXXXXXXXTSFH-VIHLLNSFFFRNHPCLVFELLGENLYDVIKRNNFRGFSLSSIQKMSYSILSCLSVLRRENIIHCDLKPENILVMNNNSSEIKIIDFGSSCFYNEKIYTYIQSRFYRSPEVILGIPYTTQIDIWSFGCLLPELLTGRPLFPGESEMDQLLCIMEVYDLPPKSVLEESTRKKLFFDNKGEPRSLHNSKGRRRVPNSQTIQSTMKMNADSKFVDLIHSCLEWDARVRIQPDDALKHSWFQDFHANDDCFKENQNSDIK 1759
            PHG   P+ P  A+  Y  +L++ E+ E+S +  IW+LGL++ K E  +G+  N GYDDETG+YIKV HDHIA+RYEILE +GKGSFGQV +A DH+T  +VA+K+IRNKKRFHQQ+ +EV IL HLK+K++    ++H VIH+ + F+FRNH C+ FEL+G NLY++IK NN++GFSL+ I++ +YS++ CL +L RE IIHCDLKPENIL+    SS IK+IDFGSSCF ++++YTYIQSRFYRSPEVILG+PY T IDIWS GC+L EL TG PLFPGE E DQL CIMEV  +PP +VLE +TR++LFFD+K  PR   NSKG++R PNS+T+ + +  N D +FVD +  CL W+   R+ PD+AL+HSW      +   +K  Q   +K
Sbjct:    9 PHGRRLPLSPAEAILYYGTRLSNYERSEVSQYRDIWYLGLDASKIEFDEGAGQNGGYDDETGSYIKVMHDHIAYRYEILEVIGKGSFGQVIRAYDHKTKEHVALKIIRNKKRFHQQALIEVKILDHLKKKDK---DAYHNVIHMYDYFYFRNHLCITFELMGMNLYELIKNNNYQGFSLNLIRRFAYSLVQCLRLLHREKIIHCDLKPENILLKQRGSSAIKVIDFGSSCFVHQRVYTYIQSRFYRSPEVILGLPYGTAIDIWSLGCILAELYTGFPLFPGEHEADQLACIMEVLGVPPVAVLELATRRRLFFDSKNVPRLTQNSKGKKRKPNSKTLAAVLGCN-DEEFVDFLSLCLVWNPETRVTPDEALRHSWLAMPKDSRQIYKTVQAITVK 399          
BLAST of Dual specificity tyrosine-phosphorylation-regulated kinase 4 vs. TrEMBL
Match: A0A4Z2CUC2 (Dual specificity tyrosine-phosphorylation-regulated kinase 4 OS=Schistosoma japonicum OX=6182 GN=EWB00_007409 PE=4 SV=1)

HSP 1 Score: 469.929 bits (1208), Expect = 1.054e-152
Identity = 214/377 (56.76%), Postives = 302/377 (80.11%), Query Frame = 2
Query:  593 FPMGPRSALQNYRFQLTSLEQEEISHFNQIWFLGLNSKKTEAIKGSSPNNGYDDETGAYIKVPHDHIAFRYEILETLGKGSFGQVFKAIDHQTGINVAVKVIRNKKRFHQQSFVEVNIXXXXXXXXXXXXTSFHVIHLLNSFFFRNHPCLVFELLGENLYDVIKRNNFRGFSLSSIQKMSYSILSCLSVLRRENIIHCDLKPENILVMNNNSSEIKIIDFGSSCFYNEKIYTYIQSRFYRSPEVILGIPYTTQIDIWSFGCLLPELLTGRPLFPGESEMDQLLCIMEVYDLPPKSVLEESTRKKLFFDNKGEPRSLHNSKGRRRVPNSQTIQSTMKMNADSKFVDLIHSCLEWDARVRIQPDDALKHSWFQDFHAND 1723
             PM PR+AL  Y  +LT+ E+EEI  F++IW+LGL+++K + I+GSS N+GYDD+ G Y+K+ HDHIA+R++ LETLGKGSFG+V +AIDH++G  VA+K+IRNKKRFHQQ+ VEV IL++LK+ + K   + ++IH+ + F FRNH C+VF+LLG NLYD++++N+FRGF++ S++K++  +L+CL +LR++ IIHCDLKPENIL+  NNSSE+K+IDFGSSCF N+K YTYIQSRFYR+PE+ILGI Y   ID+WS GC+LPEL TGRPLFPGE+E +QL CIMEV  +P + +LE+++R+++FFD+K  PR L NS+GR+R+P S+TI++ +K   DSKF++L++ CL WD   R+ P++AL H W    H N+
Sbjct:  375 IPMTPRTALDMYSKKLTTFEREEILSFSKIWYLGLSAQKIDGIQGSSNNHGYDDDNGGYLKITHDHIAYRFQTLETLGKGSFGRVIRAIDHKSGFPVAIKIIRNKKRFHQQAQVEVAILENLKKADHK--NTHNIIHIRDHFTFRNHLCIVFDLLGSNLYDLLRKNDFRGFTIHSLKKITVKLLNCLCLLRKQGIIHCDLKPENILIGLNNSSELKVIDFGSSCFTNQKTYTYIQSRFYRAPEIILGISYGPPIDMWSLGCILPELYTGRPLFPGENENEQLACIMEVLGVPSELLLEKASRRRVFFDSKRTPRYLTNSRGRKRIPGSETIENLVKT-VDSKFINLLNQCLTWDPDERLTPNEALNHEWI--LHENE 746          
BLAST of Dual specificity tyrosine-phosphorylation-regulated kinase 4 vs. Ensembl Cavefish
Match: dyrk4 (dual specificity tyrosine phosphorylation regulated kinase 4 [Source:NCBI gene;Acc:103029392])

HSP 1 Score: 459.529 bits (1181), Expect = 6.155e-154
Identity = 207/372 (55.65%), Postives = 284/372 (76.34%), Query Frame = 2
Query:  593 FPMGPRSALQNYRFQLTSLEQEEISHFNQIWFLGLNSKKTEAIKGSSPNNGYDDETGAYIKVPHDHIAFRYEILETLGKGSFGQVFKAIDHQTGINVAVKVIRNKKRFHQQSFVEVNIXXXXXXXXXXXXTSFHVIHLLNSFFFRNHPCLVFELLGENLYDVIKRNNFRGFSLSSIQKMSYSILSCLSVLRRENIIHCDLKPENILVMNNNSSEIKIIDFGSSCFYNEKIYTYIQSRFYRSPEVILGIPYTTQIDIWSFGCLLPELLTGRPLFPGESEMDQLLCIMEVYDLPPKSVLEESTRKKLFFDNKGEPRSLHNSKGRRRVPNSQTIQSTMKMNADSKFVDLIHSCLEWDARVRIQPDDALKHSWFQD 1708
             PM P +AL++++ QLT  EQEEI  +++IW+LGL++KK E  +GS  N+GYDDE G+Y+KV HDHIA+RYE+LE +GKGSFGQV K +DH+T   VA+K+IRNKKRFHQQ+ VE+ IL  ++ K+R   +  +VIH+   F+FRNH C+ FELLG NLY++IK+NNF+GFSL+ I++ ++S+L CL +L RE IIHCDLKPENIL+       IK++DFGSSC+  +++YTYIQSRFYRSPEVILG PY+  ID+WS GC+L EL TG PLFPGESE++Q+ CIMEV  +PP   ++ ++R++LFFD+KG PR++ NSKG++R PNS+ + S +K N D  F+D I  CL WD   R+ PD+ ++H W  +
Sbjct:  129 LPMSPTAALKHFQSQLTEYEQEEIMDYSEIWYLGLDTKKIEGCQGSPQNSGYDDEHGSYLKVLHDHIAYRYEVLEVIGKGSFGQVLKCLDHKTNEMVAIKIIRNKKRFHQQALVELKILDAVRRKDRD--SCHNVIHMKEYFYFRNHLCISFELLGANLYELIKKNNFQGFSLALIRRFAHSLLKCLQMLHREKIIHCDLKPENILLSQRGQGNIKVVDFGSSCYEQQRVYTYIQSRFYRSPEVILGHPYSMAIDMWSLGCILAELYTGYPLFPGESEVEQIACIMEVMGMPPNDFVQTASRRRLFFDSKGNPRNVTNSKGKKRRPNSKELASVLKTN-DPLFLDFIRRCLVWDPTKRMTPDEGMQHEWITE 497          
BLAST of Dual specificity tyrosine-phosphorylation-regulated kinase 4 vs. Ensembl Cavefish
Match: dyrk4 (dual specificity tyrosine phosphorylation regulated kinase 4 [Source:NCBI gene;Acc:103029392])

HSP 1 Score: 459.529 bits (1181), Expect = 9.279e-154
Identity = 207/372 (55.65%), Postives = 284/372 (76.34%), Query Frame = 2
Query:  593 FPMGPRSALQNYRFQLTSLEQEEISHFNQIWFLGLNSKKTEAIKGSSPNNGYDDETGAYIKVPHDHIAFRYEILETLGKGSFGQVFKAIDHQTGINVAVKVIRNKKRFHQQSFVEVNIXXXXXXXXXXXXTSFHVIHLLNSFFFRNHPCLVFELLGENLYDVIKRNNFRGFSLSSIQKMSYSILSCLSVLRRENIIHCDLKPENILVMNNNSSEIKIIDFGSSCFYNEKIYTYIQSRFYRSPEVILGIPYTTQIDIWSFGCLLPELLTGRPLFPGESEMDQLLCIMEVYDLPPKSVLEESTRKKLFFDNKGEPRSLHNSKGRRRVPNSQTIQSTMKMNADSKFVDLIHSCLEWDARVRIQPDDALKHSWFQD 1708
             PM P +AL++++ QLT  EQEEI  +++IW+LGL++KK E  +GS  N+GYDDE G+Y+KV HDHIA+RYE+LE +GKGSFGQV K +DH+T   VA+K+IRNKKRFHQQ+ VE+ IL  ++ K+R   +  +VIH+   F+FRNH C+ FELLG NLY++IK+NNF+GFSL+ I++ ++S+L CL +L RE IIHCDLKPENIL+       IK++DFGSSC+  +++YTYIQSRFYRSPEVILG PY+  ID+WS GC+L EL TG PLFPGESE++Q+ CIMEV  +PP   ++ ++R++LFFD+KG PR++ NSKG++R PNS+ + S +K N D  F+D I  CL WD   R+ PD+ ++H W  +
Sbjct:  137 LPMSPTAALKHFQSQLTEYEQEEIMDYSEIWYLGLDTKKIEGCQGSPQNSGYDDEHGSYLKVLHDHIAYRYEVLEVIGKGSFGQVLKCLDHKTNEMVAIKIIRNKKRFHQQALVELKILDAVRRKDRD--SCHNVIHMKEYFYFRNHLCISFELLGANLYELIKKNNFQGFSLALIRRFAHSLLKCLQMLHREKIIHCDLKPENILLSQRGQGNIKVVDFGSSCYEQQRVYTYIQSRFYRSPEVILGHPYSMAIDMWSLGCILAELYTGYPLFPGESEVEQIACIMEVMGMPPNDFVQTASRRRLFFDSKGNPRNVTNSKGKKRRPNSKELASVLKTN-DPLFLDFIRRCLVWDPTKRMTPDEGMQHEWITE 505          
BLAST of Dual specificity tyrosine-phosphorylation-regulated kinase 4 vs. Ensembl Cavefish
Match: dyrk4 (dual specificity tyrosine phosphorylation regulated kinase 4 [Source:NCBI gene;Acc:103029392])

HSP 1 Score: 458.373 bits (1178), Expect = 1.632e-153
Identity = 207/372 (55.65%), Postives = 284/372 (76.34%), Query Frame = 2
Query:  593 FPMGPRSALQNYRFQLTSLEQEEISHFNQIWFLGLNSKKTEAIKGSSPNNGYDDETGAYIKVPHDHIAFRYEILETLGKGSFGQVFKAIDHQTGINVAVKVIRNKKRFHQQSFVEVNIXXXXXXXXXXXXTSFHVIHLLNSFFFRNHPCLVFELLGENLYDVIKRNNFRGFSLSSIQKMSYSILSCLSVLRRENIIHCDLKPENILVMNNNSSEIKIIDFGSSCFYNEKIYTYIQSRFYRSPEVILGIPYTTQIDIWSFGCLLPELLTGRPLFPGESEMDQLLCIMEVYDLPPKSVLEESTRKKLFFDNKGEPRSLHNSKGRRRVPNSQTIQSTMKMNADSKFVDLIHSCLEWDARVRIQPDDALKHSWFQD 1708
             PM P +AL++++ QLT  EQEEI  +++IW+LGL++KK E  +GS  N+GYDDE G+Y+KV HDHIA+RYE+LE +GKGSFGQV K +DH+T   VA+K+IRNKKRFHQQ+ VE+ IL  ++ K+R   +  +VIH+   F+FRNH C+ FELLG NLY++IK+NNF+GFSL+ I++ ++S+L CL +L RE IIHCDLKPENIL+       IK++DFGSSC+  +++YTYIQSRFYRSPEVILG PY+  ID+WS GC+L EL TG PLFPGESE++Q+ CIMEV  +PP   ++ ++R++LFFD+KG PR++ NSKG++R PNS+ + S +K N D  F+D I  CL WD   R+ PD+ ++H W  +
Sbjct:  126 LPMSPTAALKHFQSQLTEYEQEEIMDYSEIWYLGLDTKKIEGCQGSPQNSGYDDEHGSYLKVLHDHIAYRYEVLEVIGKGSFGQVLKCLDHKTNEMVAIKIIRNKKRFHQQALVELKILDAVRRKDRD--SCHNVIHMKEYFYFRNHLCISFELLGANLYELIKKNNFQGFSLALIRRFAHSLLKCLQMLHREKIIHCDLKPENILLSQRGQGNIKVVDFGSSCYEQQRVYTYIQSRFYRSPEVILGHPYSMAIDMWSLGCILAELYTGYPLFPGESEVEQIACIMEVMGMPPNDFVQTASRRRLFFDSKGNPRNVTNSKGKKRRPNSKELASVLKTN-DPLFLDFIRRCLVWDPTKRMTPDEGMQHEWITE 494          
BLAST of Dual specificity tyrosine-phosphorylation-regulated kinase 4 vs. Ensembl Cavefish
Match: dyrk4 (dual specificity tyrosine phosphorylation regulated kinase 4 [Source:NCBI gene;Acc:103029392])

HSP 1 Score: 459.144 bits (1180), Expect = 2.214e-153
Identity = 207/372 (55.65%), Postives = 284/372 (76.34%), Query Frame = 2
Query:  593 FPMGPRSALQNYRFQLTSLEQEEISHFNQIWFLGLNSKKTEAIKGSSPNNGYDDETGAYIKVPHDHIAFRYEILETLGKGSFGQVFKAIDHQTGINVAVKVIRNKKRFHQQSFVEVNIXXXXXXXXXXXXTSFHVIHLLNSFFFRNHPCLVFELLGENLYDVIKRNNFRGFSLSSIQKMSYSILSCLSVLRRENIIHCDLKPENILVMNNNSSEIKIIDFGSSCFYNEKIYTYIQSRFYRSPEVILGIPYTTQIDIWSFGCLLPELLTGRPLFPGESEMDQLLCIMEVYDLPPKSVLEESTRKKLFFDNKGEPRSLHNSKGRRRVPNSQTIQSTMKMNADSKFVDLIHSCLEWDARVRIQPDDALKHSWFQD 1708
             PM P +AL++++ QLT  EQEEI  +++IW+LGL++KK E  +GS  N+GYDDE G+Y+KV HDHIA+RYE+LE +GKGSFGQV K +DH+T   VA+K+IRNKKRFHQQ+ VE+ IL  ++ K+R   +  +VIH+   F+FRNH C+ FELLG NLY++IK+NNF+GFSL+ I++ ++S+L CL +L RE IIHCDLKPENIL+       IK++DFGSSC+  +++YTYIQSRFYRSPEVILG PY+  ID+WS GC+L EL TG PLFPGESE++Q+ CIMEV  +PP   ++ ++R++LFFD+KG PR++ NSKG++R PNS+ + S +K N D  F+D I  CL WD   R+ PD+ ++H W  +
Sbjct:  154 LPMSPTAALKHFQSQLTEYEQEEIMDYSEIWYLGLDTKKIEGCQGSPQNSGYDDEHGSYLKVLHDHIAYRYEVLEVIGKGSFGQVLKCLDHKTNEMVAIKIIRNKKRFHQQALVELKILDAVRRKDRD--SCHNVIHMKEYFYFRNHLCISFELLGANLYELIKKNNFQGFSLALIRRFAHSLLKCLQMLHREKIIHCDLKPENILLSQRGQGNIKVVDFGSSCYEQQRVYTYIQSRFYRSPEVILGHPYSMAIDMWSLGCILAELYTGYPLFPGESEVEQIACIMEVMGMPPNDFVQTASRRRLFFDSKGNPRNVTNSKGKKRRPNSKELASVLKTN-DPLFLDFIRRCLVWDPTKRMTPDEGMQHEWITE 522          
BLAST of Dual specificity tyrosine-phosphorylation-regulated kinase 4 vs. Ensembl Cavefish
Match: dyrk3 (dual specificity tyrosine-phosphorylation-regulated kinase 2 [Source:NCBI gene;Acc:103034036])

HSP 1 Score: 409.838 bits (1052), Expect = 2.893e-135
Identity = 197/387 (50.90%), Postives = 273/387 (70.54%), Query Frame = 2
Query:  590 GFPMGPRSALQNYRFQLTSLEQEEISHFNQIWFLGLNSKKTEAIKGSSPNNGYDDETGAYIKVPHDHIAFRYEILETLGKGSFGQVFKAIDHQTGINVAVKVIRNKKRFHQQSFVEVNIXXXXXXXXXXXXTSFHVIHLLNSFFFRNHPCLVFELLGENLYDVIKRNNFRGFSLSSIQKMSYSILSCLSVLRRENIIHCDLKPENILVMNNNSSEIKIIDFGSSCFYNEKIYTYIQSRFYRSPEVILGIPYTTQIDIWSFGCLLPELLTGRPLFPGESEMDQLLCIMEVYDLPPKSVLEESTRKKLFFDNKGEPR------------SLHNSKGR----RRVPNSQTIQSTMKMNADSKFVDLIHSCLEWDARVRIQPDDALKHSWF 1702
            G P+G   AL+ YR QLT++EQ+E+ ++++I+F+G N+KK +A+ G S N GYDD+ G YI VPHDHIA+RYE L+ +GKGSFGQV K  DH+   ++A+K++RN+KRFH+Q+  E+ IL+HLK++++    S +V+H+L +F FRNH C+ FELL  NLY++IKRN F+GFSL  ++K ++SIL CL  L+R  IIHCDLKPENIL+     S IK+IDFGSSCF ++++YTYIQSRFYR+PEVILG  Y   ID+WSFGC+L ELLTG PLFPGE E DQL C+ME+  +PP+ +LE++ R K F ++KG PR             L+ S+ R    R  P S+   + +K   D  F+D +  CL+W+   R+ P  AL+H W 
Sbjct:  125 GGPLGAEQALKQYRQQLTAMEQQEVHNYSEIFFVGPNAKKRQAVAGGSNNCGYDDDQGGYIHVPHDHIAYRYEFLKVIGKGSFGQVAKVYDHKLHQHLALKMVRNEKRFHRQAAEEIRILEHLKKQDKT--GSMNVVHMLENFTFRNHICMTFELLSMNLYELIKRNKFQGFSLPLVRKFAHSILQCLEALQRHKIIHCDLKPENILLKQQGRSGIKVIDFGSSCFDHQRVYTYIQSRFYRAPEVILGSRYGMPIDMWSFGCILAELLTGYPLFPGEDEGDQLACMMELLGMPPQKLLEQAKRAKNFINSKGHPRYCTVTTLSNGTLVLNGSRSRRGKMRGPPGSKEWVTALKGCDDPTFIDFLRKCLDWEPSTRMTPVSALRHPWL 509          
BLAST of Dual specificity tyrosine-phosphorylation-regulated kinase 4 vs. Ensembl Sea Lamprey
Match: dyrk2 (dual-specificity tyrosine-(Y)-phosphorylation regulated kinase 2 [Source:ZFIN;Acc:ZDB-GENE-030131-2804])

HSP 1 Score: 385.185 bits (988), Expect = 1.310e-126
Identity = 183/381 (48.03%), Postives = 260/381 (68.24%), Query Frame = 2
Query:  605 PRSALQNYRFQLTSLEQEEISHFNQIWFLGLNSKKTEAIKGSSPNNGYDDETGAYIKVPHDHIAFRYEILETLGKGSFGQVFKAIDHQTGINVAVKVIRNKKRFHQQSFVEVNIXXXXXXXXXXXXTSFHVIHLLNSFFFRNHPCLVFELLGENLYDVIKRNNFRGFSLSSIQKMSYSILSCLSVLRRENIIHCDLKPENILVMNNNSSEIKIIDFGSSCFYNEKIYTYIQSRFYRSPEVILGIPYTTQIDIWSFGCLLPELLTGRPLFPGESEMDQLLCIMEVYDLPPKSVLEESTRKKLFFDNKGEPR------------SLHNSKGR----RRVPNSQTIQSTMKMNADSKFVDLIHSCLEWDARVRIQPDDALKHSW 1699
            P  A++ Y  +LT+ E +EI ++ +I+F+G N+KK   + G + N GYDDE G+Y+ V HDH+A+RYE+L+ +GKGSFGQV KA DH+T  +VA+K++RN+KRFH+Q+  E+ IL+HL++++R+   S ++IHLL SF FR H C+ FELL  NLY++IK+N F+GFSL+ ++K ++SIL CL  L R  IIHCDLKPENIL+     S IK+IDFGSSCF ++++YTYIQSRFYR+PEV+LG  Y   ID+WS GC+L ELLTG PL PGE E DQL C ME+  +PP+ +L +  R + F  ++G PR             L+  + R    R  P S+ + + ++   D   +D +  CLEW+   R+ P  AL+H W
Sbjct:   96 PDQAVRLYGQKLTAYEHQEIYNYAEIYFVGHNAKKRPGVVGGASNCGYDDEQGSYVHVAHDHVAYRYEVLKVIGKGSFGQVVKAFDHKTQTHVALKMVRNEKRFHRQAAEEIRILEHLRKQDRE--NSMNIIHLLESFTFRGHVCMTFELLSMNLYELIKKNKFQGFSLALVRKFAHSILQCLDTLHRNRIIHCDLKPENILLKQPGRSGIKVIDFGSSCFEHQRVYTYIQSRFYRAPEVVLGARYGPPIDMWSLGCILAELLTGSPLLPGEDEGDQLACAMELLGMPPQRLLAQGKRSRNFVSSRGHPRYCGVTEAPDGAVVLNAGRSRRGKPRGPPGSRELPAALRGCDDPLLLDFLRGCLEWEPSERLTPAQALRHPW 474          
BLAST of Dual specificity tyrosine-phosphorylation-regulated kinase 4 vs. Ensembl Sea Lamprey
Match: dyrk2 (dual-specificity tyrosine-(Y)-phosphorylation regulated kinase 2 [Source:ZFIN;Acc:ZDB-GENE-030131-2804])

HSP 1 Score: 372.474 bits (955), Expect = 1.025e-121
Identity = 185/391 (47.31%), Postives = 255/391 (65.22%), Query Frame = 2
Query:  584 PHGFPMGPRSALQNYRFQLTSLEQEEISHFNQIWFLGLNSKKTEAIKGSSPNNGYDDETGAYIKVPHDHIAFRYEILETLGKGSFGQVFKAIDHQTGINVAVKVIRNKKRFHQQSFVEVNIXXXXXXXXXXXXTSFHVIHLLNSFFFRNHPCLVFELLGENLYDVIKRNNFRGFSLSSIQKMSYSILSCLSVLRRENIIHCDLKPENILVMNNNSSEIK-IIDFGSSCFYNEKIYTYIQSRFYRSPEVILGIPYTTQIDIWSFGCLLPELLTGRPLFPGESEMDQLLCIMEVYDLPPKSVLEESTRKKLFFDNKGEPR------------SLHNSKGR----RRVPNSQTIQSTMKMNADSKFVDLIHSCLEWDARVRIQPDDALKHSWFQ 1705
            PH   M P  A++ Y  +L+  E  EI ++++++F+G ++KK +A      NNG+DDE G+YI VPHDH+A+RYE+L  +GKGSFGQV KA DH+T   VA+K++RN+KRFH+Q+  E+ I      K++  E + +VIH+L SF FRNH C+ FELL  NLY++IK+N F+GFSL  ++K ++SIL CL+ L +  IIHCDLKPENIL+     S IK IIDFGSSC+ ++++YTYIQSRFYR+P    G+P    ID+WS GC+L ELLTG PL PGE E DQL C ME+   PP  +LE+S R + FF + G PR             L+  + R    R  P+S+   + +K   D  F+D +  CL+WD   R+ P  ALKH W +
Sbjct:   99 PHSTAMSPEQAMRKYMHRLSMFEHHEIFNYHEVYFVGPSAKKRQATLSGVNNNGFDDEQGSYIHVPHDHVAYRYEVLRVIGKGSFGQVVKAYDHRTHQYVALKMVRNEKRFHRQAAEEIRI--LEHLKKQDKENTMNVIHMLESFNFRNHICMTFELLSMNLYELIKKNKFQGFSLQVVRKFAHSILLCLNALHKNRIIHCDLKPENILLRQQGRSGIKIIIDFGSSCYEHQRVYTYIQSRFYRAPGGRYGLP----IDMWSLGCILAELLTGSPLLPGEDEGDQLACAMELTGSPPARLLEQSKRARQFFSSLGHPRYCTVTTLPGGPVVLNGGRTRRGKLRGPPSSRDWTTALKGCDDHLFIDFLKKCLDWDPATRLTPSQALKHPWLR 483          
BLAST of Dual specificity tyrosine-phosphorylation-regulated kinase 4 vs. Ensembl Sea Lamprey
Match: dyrk1aa (dual-specificity tyrosine-(Y)-phosphorylation regulated kinase 1A, a [Source:ZFIN;Acc:ZDB-GENE-050302-29])

HSP 1 Score: 264.618 bits (675), Expect = 2.068e-78
Identity = 148/331 (44.71%), Postives = 202/331 (61.03%), Query Frame = 2
Query:  800 RYEILETLGKGSFGQVFKAIDHQTGINVAVKVIRNKKRFHQQSFVEVNIXXXXXXXXXXXXTSFHVIHLLNSFFFRNHPCLVFELLGENLYDVIKRNNFRGFSLSSIQKMSYSILSCLSVLRRE--NIIHCDLKPENILVMNNNSSEIKIIDFGSSCFYNEKIYTYIQSRFYRSPEVILGIPYTTQIDIWSFGCLLPELLTGRPLFPGESEMDQLLCIMEVYDLPPKSVLEESTRKKLFF--------------DNKGE-----PRSLHN--------SKGRRRVPNSQTIQSTMKMNADSKFVDLIHSCLEWDARVRIQPDDALKHSWFQ 1705
            RYEI   +GKGSFGQV KA DHQ    VA+K+I+NKK F  Q+ +EV +L+ + + +  +   ++++HL   F FRNH CLVFELL  NLYD+++  NFRG SL+  +K +  + + L  L     +IIHCDLKPENIL+ N   S IKI+DFGSSC   ++IY YIQSRFYRSPEV+LGIPY   ID+WS GC+L E+ TG PLF G +E+DQ+  I+EV  LPP  +LE++ + + +F              D+K E      R LH+          GRR      T+   +      KF DLI   L++D + RI P  AL+H++F+
Sbjct:  161 RYEIDSLIGKGSFGQVVKAYDHQEQEWVAIKIIKNKKAFLNQAQIEVRLLELMNKHDTDM--KYYIVHLKRHFMFRNHLCLVFELLSYNLYDLLRNTNFRGVSLNLTRKFAQQMCTALLFLATPELSIIHCDLKPENILLCNPKRSAIKIVDFGSSCQLGQRIYQYIQSRFYRSPEVLLGIPYDLAIDMWSLGCILVEMHTGEPLFSGSNEVDQMNKIVEVLGLPPTHMLEQAPKARKYFERLSDGSWTVKKTKDSKREYKTAGSRKLHDIIGVESGGPGGRRMGEAGHTVADYL------KFKDLILRMLDYDPKTRITPFYALQHNFFK 483          
BLAST of Dual specificity tyrosine-phosphorylation-regulated kinase 4 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000007952.1 (pep scaffold:Pmarinus_7.0:GL476685:157428:173166:-1 gene:ENSPMAG00000007188.1 transcript:ENSPMAT00000007952.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 243.817 bits (621), Expect = 1.473e-75
Identity = 131/312 (41.99%), Postives = 192/312 (61.54%), Query Frame = 2
Query:  773 KVPHDHIAFRYEILETLGKGSFGQVFKAIDHQTGINVAVKVIRNKKRFHQQSFV-EVNIXXXXXXXXXXXXTSFHVIHLLNSFFFRNHPCLVFELLGENLYDVIKRNNFRGFSLSSIQKMSYSILSCLSVLRRENIIHCDLKPENILVMNNNSSEIKIIDFGSSCFYNEKIYTYIQSRFYRSPEVILGIPYTTQIDIWSFGCLLPELLTGRPLFPGESEMDQLLCIMEVYDLPPKSVLEESTRKKLFFDNKGEPRSLHNSKGRRRVPNSQTIQSTMKMNADSKFVDLIHSCLEWDARVRIQPDDALKHSWFQ 1705
            KV H+H+ +RYE+LE LG+GSFG+V K +DH++   VA+KV+ N+ RF++     E+ ILK L+        S  +I ++  F FR   C+VFELL  NL   +K  + +GF L  ++  + S+L  L  LR  N+IH DLKP NI + +  + E+K+ DFG SCF +E+ +T IQ+R YR+PEVIL + Y+   D+WS GC L EL +G+ LFPG +  DQL  IMEV+ LPP+ ++EES  +  FF  K    ++  ++G  RVP S+ +   ++   D  F D I SCL+WD   R+ P  A+ H W +
Sbjct:    1 KVWHEHLLYRYEVLEVLGQGSFGKVLKCLDHKSKEFVAIKVL-NRARFNESVHRREIEILKRLQTAR----ESSKIIRMMEHFSFRGRECVVFELLNGNLRSQLKLTHRQGFGLEMVRLFAISLLKSLEQLRDANVIHGDLKPGNIGICSYEAGEVKLFDFGCSCFDHEEHFTKIQTRHYRAPEVILDLGYSFPADMWSLGCTLAELHSGQKLFPGHTNEDQLHSIMEVFGLPPQDMIEESRVQLGFFACKDFSSNVRLNRGLVRVPGSRALPLALR-TTDEHFTDFIRSCLQWDPEWRLTPHGAMDHEWVR 306          
BLAST of Dual specificity tyrosine-phosphorylation-regulated kinase 4 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000007958.1 (pep scaffold:Pmarinus_7.0:GL476685:157443:173166:-1 gene:ENSPMAG00000007188.1 transcript:ENSPMAT00000007958.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 243.047 bits (619), Expect = 2.276e-75
Identity = 132/313 (42.17%), Postives = 192/313 (61.34%), Query Frame = 2
Query:  773 KVPHDHIAFRYEILETLGKGSFGQVFKAIDHQTGINVAVKVIRNKKRFHQQSFV-EVNIXXXXXXXXXXXXTSFHVIHLLNSFFFRNHPCLVFELLGENLYDVIKRNNFRGFSLSSIQKMSYSILSCLSVLRRENIIHCDLKPENILVMNNNSSEIKIIDFGSSCFYNEKIYTYIQSRFYRSPEVILGIPYTTQIDIWSFGCLLPELLTGRPLFPGESEMDQLLCIMEVYDLPPKSVLEESTRKKLFFD-NKGEPRSLHNSKGRRRVPNSQTIQSTMKMNADSKFVDLIHSCLEWDARVRIQPDDALKHSWFQ 1705
            KV H+H+ +RYE+LE LG+GSFG+V K +DH++   VA+KV+ N+ RF++     E+ ILK L+        S  +I ++  F FR   C+VFELL  NL   +K  + +GF L  ++  + S+L  L  LR  N+IH DLKP NI + +  + E+K+ DFG SCF +E+ +T IQ+R YR+PEVIL + Y+   D+WS GC L EL +G+ LFPG +  DQL  IMEV+ LPP+ ++EES  +  FF   K     ++N +G  RVP S+ +   ++   D  F D I SCL+WD   R+ P  A+ H W +
Sbjct:    1 KVWHEHLLYRYEVLEVLGQGSFGKVLKCLDHKSKEFVAIKVL-NRARFNESVHRREIEILKRLQTAR----ESSKIIRMMEHFSFRGRECVVFELLNGNLRSQLKLTHRQGFGLEMVRLFAISLLKSLEQLRDANVIHGDLKPGNIGICSYEAGEVKLFDFGCSCFDHEEHFTKIQTRHYRAPEVILDLGYSFPADMWSLGCTLAELHSGQKLFPGHTNEDQLHSIMEVFGLPPQDMIEESRVQLGFFAITKPTHWDINNHRGLVRVPGSRALPLALR-TTDEHFTDFIRSCLQWDPEWRLTPHGAMDHEWVR 307          
BLAST of Dual specificity tyrosine-phosphorylation-regulated kinase 4 vs. Ensembl Yeast
Match: YAK1 (Serine-threonine protein kinase; component of a glucose-sensing system that inhibits growth in response to glucose availability; upon nutrient deprivation Yak1p phosphorylates Pop2p to regulate mRNA deadenylation, the co-repressor Crf1p to inhibit transcription of ribosomal genes, and the stress-responsive transcription factors Hsf1p and Msn2p; nuclear localization negatively regulated by the Ras/PKA signaling pathway in the presence of glucose [Source:SGD;Acc:S000003677])

HSP 1 Score: 226.868 bits (577), Expect = 1.063e-64
Identity = 115/254 (45.28%), Postives = 163/254 (64.17%), Query Frame = 2
Query:  737 NNGYDDETGAYIKVPHDHIAF----RYEILETLGKGSFGQVFKAIDHQTGINVAVKVIRNKKRFHQQSFVEVNIXXXXXXXXXXXXTSFHVIHLLNSFFFRNHPCLVFELLGENLYDVIKRNNFRGFSLSSIQKMSYSILSCLSVLRRENIIHCDLKPENILVMNNNSSEIKIIDFGSSCFYNEKIYTYIQSRFYRSPEVILGIPYTTQIDIWSFGCLLPELLTGRPLFPGESEMDQLLCIMEVYDLPPKSVLE 1486
            NNG+D+    YI   +D +      +Y +L+ LG+G+FGQV K  +  T   +AVKV++++  +  QS  E  IL+ L +K        H + + +SF  +NH CLVFELL  NLY+++K+N F G S+  I+  +  IL  L VL+   +IHCDLKPENIL+   +  E+KIIDFGSSC     +YTYIQSRFYR+PE+ILGIPY+T ID+WS GC++ EL  G P+FPG SE +QL  I++    PP  +++
Sbjct:  343 NNGFDNINSDYILYVNDVLGVEQNRKYLVLDILGQGTFGQVVKCQNLLTKEILAVKVVKSRTEYLTQSITEAKILELLNQKIDPT-NKHHFLRMYDSFVHKNHLCLVFELLSNNLYELLKQNKFHGLSIQLIRTFTTQILDSLCVLKESKLIHCDLKPENILLCAPDKPELKIIDFGSSCEEARTVYTYIQSRFYRAPEIILGIPYSTSIDMWSLGCIVAELFLGIPIFPGASEYNQLTRIIDTLGYPPSWMID 595          
BLAST of Dual specificity tyrosine-phosphorylation-regulated kinase 4 vs. Ensembl Yeast
Match: PHO85 (Cyclin-dependent kinase; has ten cyclin partners; involved in regulating the cellular response to nutrient levels and environmental conditions and progression through the cell cycle; human lissencephaly-associated homolog CDK5 functionally complements null mutation [Source:SGD;Acc:S000005952])

HSP 1 Score: 139.428 bits (350), Expect = 2.573e-37
Identity = 90/315 (28.57%), Postives = 157/315 (49.84%), Query Frame = 2
Query:  800 RYEILETLGKGSFGQVFKAIDHQTGINVAVKVIRNKKRFHQQSFVEVNIXXXXXXXXXXXXTSFHVIHLLNSFFFRNHPCLVFELLGENLYDVIKR----NNFRGFSLSSIQKMSYSILSCLSVLRRENIIHCDLKPENILVMNNNSSEIKIIDFGSSCFYNEKIYTY---IQSRFYRSPEVILGI-PYTTQIDIWSFGCLLPELLTGRPLFPGESEMDQLLCIMEVYDLPPKSVLEESTRKKLFFDN--KGEPRSLHNSKGRRRVPNSQTIQSTMKMNADSKFVDLIHSCLEWDARVRIQPDDALKHSWFQDFH 1714
            +++ LE LG G++  V+K ++  TG+ VA+K ++        S     I    + K   +   + VIH  N         LVFE +  +L   +      N  RG  L+ ++   + +L  L+      I+H DLKP+N+L+  N   ++K+ DFG +  +   + T+   + + +YR+P+V++G   Y+T IDIWS GC+L E++TG+PLFPG ++ +QL  I ++   P +S+    T+   +  N  +  PR L            Q +Q   K   D   +D +H  L+ +  +R+    AL H WF +++
Sbjct:    6 QFKQLEKLGNGTYATVYKGLNKTTGVYVALKEVKLDSEEGTPSTAIREISLMKELKHENIVRLYDVIHTENKL------TLVFEFMDNDLKKYMDSRTVGNTPRGLELNLVKYFQWQLLQGLAFCHENKILHRDLKPQNLLI--NKRGQLKLGDFGLARAFGIPVNTFSSEVVTLWYRAPDVLMGSRTYSTSIDIWSCGCILAEMITGKPLFPGTNDEEQLKLIFDIMGTPNESLWPSVTKLPKYNPNIQQRPPRDLR-----------QVLQPHTKEPLDGNLMDFLHGLLQLNPDMRLSAKQALHHPWFAEYY 301          
BLAST of Dual specificity tyrosine-phosphorylation-regulated kinase 4 vs. Ensembl Yeast
Match: KNS1 (Protein kinase involved in negative regulation of PolIII transcription; effector kinase of the TOR signaling pathway and phosphorylates Rpc53p to regulate ribosome and tRNA biosynthesis; member of the LAMMER family of protein kinases, which are serine/threonine kinases also capable of phosphorylating tyrosine residues; capable of autophosphorylation [Source:SGD;Acc:S000003942])

HSP 1 Score: 139.813 bits (351), Expect = 5.064e-35
Identity = 90/291 (30.93%), Postives = 147/291 (50.52%), Query Frame = 2
Query:  752 DETGAYIKVPHDHIAF--RYEILETLGKGSFGQVFKAIDHQTGIN-VAVKVIRNKKRFHQQSFVEVNIXXXXXXXXXXXXTSFHVIHLLNSFFFRNHPCLVFELLGENLYDVIKRNNFRGFSLSSIQKMSYSILSCLSVLRRENIIHCDLKPENILVMNNN------------------------------SSEIKIIDFGSSCFYNEKIYTYIQSRFYRSPEVILGIPYTTQIDIWSFGCLLPELLTGRPLFPGESEMDQLLCIMEVYDLP-PKSVLEESTRKKLFFDNK 1522
            D+ G Y+   +D      R+ + + LG+G+FG+V K ID++   N VAVKVIR   R+ + +  E+ IL+ +   + +    F  + L   F ++NH CLV +L G ++YD +  N    F  S IQ ++  ++  +  L    IIH DLKPENIL+ +                                + EIKIIDFGS+ F+ E     I +R YR+PE++LG+ ++   DIWS  C+L EL+ G  L+P    ++ +  +  +   P P  +++     K+F+ +K
Sbjct:  294 DKDGHYVYQENDIFGSGGRFVVKDLLGQGTFGKVLKCIDNKYEPNYVAVKVIRAVDRYREAAKTELRILQTILNNDPQG--QFQCLLLRECFDYKNHICLVTDLYGRSIYDFMCSNGIARFPGSHIQAIARQLIRSVCFLHDLGIIHTDLKPENILICDETHIAQKLPLKTVQSLSKRRREASKGKRKILKNPEIKIIDFGSAIFHYEYHPPVISTRHYRAPEIVLGLGWSFPCDIWSIACVLVELVIGESLYPIHENLEHMAMMQRINGTPFPTDIID-----KMFYKSK 577          
BLAST of Dual specificity tyrosine-phosphorylation-regulated kinase 4 vs. Ensembl Yeast
Match: KSS1 (Mitogen-activated protein kinase (MAPK); involved in signal transduction pathways that control filamentous growth and pheromone response; regulates septum assembly, and may directly phosphorylate Bni4p; the KSS1 gene is nonfunctional in S288C strains and functional in W303 strains [Source:SGD;Acc:S000003272])

HSP 1 Score: 133.65 bits (335), Expect = 1.325e-34
Identity = 105/337 (31.16%), Postives = 174/337 (51.63%), Query Frame = 2
Query:  791 IAFRYEILETLGKGSFGQVFKAIDHQTGINVAVKVIR--NKKRFHQQSFVEVNIXXXXXXXXXXXXTSFH----VIHLLN-----SFFFRNHPCLVFELLGENLYDVIKRNNFRGFSLSS---IQKMSYSILSCLSVLRRENIIHCDLKPENILVMNNNSSEIKIIDFG-SSCFYNEK---------IYTYIQSRFYRSPEVILGI-PYTTQIDIWSFGCLLPELLTGRPLFPGESEMDQLLCIMEVYDLPPKSVLEESTRKKLFFDNKGEPRSLHNSKGRRRVPNSQTIQSTMKMNADSKFVDLIHSCLEWDARVRIQPDDALKHSWFQDFHANDD 1726
            I  +Y++++ +G+G++G V  AI   +GI VA+K I+  +KK F  ++  E+ +L++           FH    +I +L+     S    N   LV EL+  +L  VI   N  GFS  S   +Q  +Y IL  L  +    +IH D+KP N+L+  N++ ++K+ DFG + C  +           +  Y+ +R+YR+PE++L    YTT +DIWS GC+L E+++G+PLFPG     QL  I+EV   P     E+  + K    +K     + N   R  +P  +T+ S   +N D   +DL+   L+++   RI   +AL+H +   +H   D
Sbjct:    9 IPSQYKLVDLIGEGAYGTVCSAIHKPSGIKVAIKKIQPFSKKLFVTRTIREIKLLRY-----------FHEHENIISILDKVRPVSIDKLNAVYLVEELMETDLQKVINNQN-SGFSTLSDDHVQYFTYQILRALKSIHSAQVIHRDIKPSNLLL--NSNCDLKVCDFGLARCLASSSDSRETLVGFMTEYVATRWYRAPEIMLTFQEYTTAMDIWSCGCILAEMVSGKPLFPGRDYHHQLWLILEVLGTPS---FEDFNQIK----SKRAKEYIANLPMRPPLP-WETVWSKTDLNPD--MIDLLDKMLQFNPDKRISAAEALRHPYLAMYHDPSD 321          
BLAST of Dual specificity tyrosine-phosphorylation-regulated kinase 4 vs. Ensembl Yeast
Match: HOG1 (Mitogen-activated protein kinase involved in osmoregulation; controls global reallocation of RNAPII during osmotic shock; mediates recruitment/activation of RNAPII at Hot1p-dependent promoters; binds calmodulin; stimulates antisense transcription to activate CDC28; defines novel S-phase checkpoint with Mrc1p that prevent replication/transcription conflicts; nuclear form represses pseudohyphal growth; autophosphorylates; protein abundance increases under DNA replication stress [Source:SGD;Acc:S000004103])

HSP 1 Score: 123.635 bits (309), Expect = 9.298e-31
Identity = 91/312 (29.17%), Postives = 153/312 (49.04%), Query Frame = 2
Query:  791 IAFRYEILETLGKGSFGQVFKAIDHQTGINVAVKVIR---NKKRFHQQSFVEVNIXXXXXXXXXXXXTSFHVIHLLNSFFFRNHPCLVFELLGENLYDVIKRNNFRGFSLSSIQKMSYSILSCLSVLRRENIIHCDLKPENILVMNNNSSEIKIIDFGSSCFYNEKIYTYIQSRFYRSPEVILGI-PYTTQIDIWSFGCLLPELLTGRPLFPGESEMDQLLCIMEVYDLPPKSVLEESTRKKLFFDNKGEPRSLHNSKGRRRVPNSQTIQSTMKMNADSKFVDLIHSCLEWDARVRIQPDDALKHSWFQDFH 1714
            I  RY  L  +G G+FG V  A D  T   VA+K I    +     ++++ E+ +LKHL+ +         +  L + +F       V EL G +L+ +++    R      +Q   Y IL  L  +    +IH DLKP NIL+  N + ++KI DFG +   + ++  Y+ +R+YR+PE++L    Y  ++DIWS GC+  E++ G+PLFPG+  + Q   I ++   PPK V+     +          + + +   R  +P S+  ++      +   VDL+   L +D + RI   DAL H +   +H
Sbjct:   19 ITNRYNDLNPVGMGAFGLVCSATDTLTSQPVAIKKIMKPFSTAVLAKRTYRELKLLKHLRHENLICLQDIFLSPLEDIYF-------VTELQGTDLHRLLQT---RPLEKQFVQYFLYQILRGLKYVHSAGVIHRDLKPSNILI--NENCDLKICDFGLARIQDPQMTGYVSTRYYRAPEIMLTWQKYDVEVDIWSAGCIFAEMIEGKPLFPGKDHVHQFSIITDLLGSPPKDVINTICSENTL-------KFVTSLPHRDPIPFSERFKT-----VEPDAVDLLEKMLVFDPKKRITAADALAHPYSAPYH 306          
BLAST of Dual specificity tyrosine-phosphorylation-regulated kinase 4 vs. Ensembl Nematostella
Match: EDO36294 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SJ45])

HSP 1 Score: 421.009 bits (1081), Expect = 1.568e-143
Identity = 190/338 (56.21%), Postives = 270/338 (79.88%), Query Frame = 2
Query:  635 QLTSLEQEEISHFNQIWFLGLNSKKTEAIKGSSPNNGYDDETGAYIKVPHDHIAFRYEILETLGKGSFGQVFKAIDHQTGINVAVKVIRNKKRFHQQSFVEVNIXXXXXXXXXXXXTSFHVIHLLNSFFFRNHPCLVFELLGENLYDVIKRNNFRGFSLSSIQKMSYSILSCLSVLRRENIIHCDLKPENILVMNNNSSEIKIIDFGSSCFYNEKIYTYIQSRFYRSPEVILGIPYTTQIDIWSFGCLLPELLTGRPLFPGESEMDQLLCIMEVYDLPPKSVLEESTRKKLFFDNKGEPRSLHNSKGRRRVPNSQTIQSTMKMNADSKFVDLIHSCLE 1648
            ++T+ EQ EI  + ++WFLGL++KK + + G+  NN YDD+ G+Y+K  HDH+A+RYE+LE LGKGSFGQV KA+DH+TG +VAVK+IRNKKRFHQQ+ VEV IL +L++K++    + ++IH++  F+FRNH C+ FEL+G NLY++IK+NNF+GFSL+ I++ ++++L CL V+ +E IIHCDLKPENIL+     + IK+IDFGSSC+ ++++YTYIQSRFYRSPEVILG+PY+  ID+WSFGC+L EL TG PLFPGE+E++QL CIMEV  LP   ++E ++R++LFFD+KG PR + NSKG++R P+S+ I + +K N D+ F+D +  CLE
Sbjct:    4 RITTFEQSEILDYPEVWFLGLDAKKIDGVPGAPQNNNYDDDNGSYLKALHDHLAYRYEVLEVLGKGSFGQVVKALDHKTGQHVAVKIIRNKKRFHQQALVEVKILDNLRKKDKD--NTHNLIHMIEHFYFRNHLCITFELMGMNLYELIKKNNFQGFSLALIRRFAFALLHCLKVIHKEKIIHCDLKPENILLRQRGQTSIKVIDFGSSCYEHQRVYTYIQSRFYRSPEVILGLPYSMAIDMWSFGCILAELYTGYPLFPGENEVEQLACIMEVLGLPSPKLIESASRRRLFFDSKGIPRCITNSKGKKRRPSSRDISAALKTN-DALFLDFLKQCLE 338          
BLAST of Dual specificity tyrosine-phosphorylation-regulated kinase 4 vs. Ensembl Nematostella
Match: EDO46144 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RQP1])

HSP 1 Score: 391.734 bits (1005), Expect = 4.385e-129
Identity = 192/380 (50.53%), Postives = 262/380 (68.95%), Query Frame = 2
Query:  614 ALQNYRFQLTSLEQEEISHFNQIWFLGLNSKKTEAIKGSSPNNGYDDETGAYIKVPHDHIAFRYEILETLGKGSFGQVFKAIDHQTGINVAVKVIRNKKRFHQQSFVEVNIXXXXXXXXXXXXTSFHVIHLLNSFFFRNHPCLVFELLGENLYDVIKRNNFRGFSLSSIQKMSYSILSCLSVLRRENIIHCDLKPENILVMNNNSSEIKIIDFGSSCFYNEKIYTYIQSRFYRSPEVILGIPYTTQIDIWSFGCLLPELLTGRPLFPGESEMDQLLCIMEVYDLPPKSVLEESTRKKLFFDNKGEPR----------SLHNSKGRRR------VPNSQTIQSTMKMNADSKFVDLIHSCLEWDARVRIQPDDALKHSWFQ 1705
            A++ Y  +L+  E  EI +++QI+F+G  +KK + + G + N GYDDE G+YI VP DHIA+RYE+L+ +GKGSFGQV KA+DH+T  +VA+K++RN+KRFH+Q+  E+ IL+HLK++++    + ++IH+L  F FRNH C+ FELL  NLY++IK+N F+GFSL  ++K ++SIL CL  L +  IIHCDLKPENIL+     S IK+IDFGSSC+ +++IYTYIQSRFYR+PEVILG  Y   ID+WSFGC+L ELLTG PLFPGE E DQL C ME+    P+ + E S R K F ++KG PR          S+  S GR R       PNS+T    +K   D+ F+D +  CLEWD   R+ P  AL+H W +
Sbjct:  104 AMKQYMHKLSGYETHEIFNYSQIYFVGEAAKKRQGVVGGANNCGYDDEQGSYIHVPKDHIAYRYEVLKIIGKGSFGQVVKALDHKTNTHVALKMVRNEKRFHRQAQEEIRILEHLKKQDKD--NTHNIIHMLEHFTFRNHVCMTFELLSMNLYELIKKNKFQGFSLPLVRKFAHSILQCLDALHKNRIIHCDLKPENILLKQQGRSGIKVIDFGSSCYEHQRIYTYIQSRFYRAPEVILGARYGMPIDMWSFGCILAELLTGYPLFPGEDEGDQLACNMELLGYIPEKLRETSKRAKNFINSKGYPRYCTITTLPDGSVAVSGGRSRRGKTRGAPNSKTFVQALKGCDDAMFIDFLKRCLEWDPSARMTPSQALRHPWLR 481          
BLAST of Dual specificity tyrosine-phosphorylation-regulated kinase 4 vs. Ensembl Nematostella
Match: EDO45187 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RTC8])

HSP 1 Score: 271.937 bits (694), Expect = 2.654e-84
Identity = 158/382 (41.36%), Postives = 217/382 (56.81%), Query Frame = 2
Query:  668 HFNQIWFLGLNSKKTEAIKGSSP-------NNGYDDETGAYIKVPHDHIAFRYEILETLGKGSFGQVFKAIDHQTGINVAVKVIRNKKRFHQQSFVEVNIXXXXXXXXXXXXTSFHVIHLLNSFFFRNHPCLVFELLGENLYDVIKRNNFRGFSLSSIQKMSYSILSCLSVLRRE--NIIHCDLKPENILVMNNNSSEIKIIDFGSSCFYNEKIYTYIQSRFYRSPEVILGIPYTTQIDIWSFGCLLPELLTGRPLFPGESEMDQLLCIMEVYDLPPKSVLEESTRKKLFFDNKGE-------------------PRSLHN--------SKGRRRVPNSQTIQSTMKMNADSKFVDLIHSCLEWDARVRIQPDDALKHSWFQ 1705
            H N++++      K E      P       N+GYDDE   YI    +    RYEI   +GKGSFGQV KA DHQ   ++AVK+I+NKK F  Q+ +EV +L+ + + +      ++++ L   F +RNH CLVFELL  NLYD+++  NFRG SL+  +K +  + + L  L     +IIHCDLKPENIL+ N   S IKI+DFGSSC   ++IY YIQSRFYRSPEV+LGIPY   ID+WS GC+L E+ TG PLF G +E DQ++ I+EV  +PPK +L+ + + + FFD   +                    R LH+          GRR      T+Q  +      KF DLI   L++D + RI P  AL H +F+
Sbjct:   27 HINEVYYANKKRPKPEEPDPVRPKKRPPQYNDGYDDENYDYIVKAGEKWFDRYEIESLIGKGSFGQVCKAYDHQEKEHIAVKIIKNKKPFLNQAQIEVKLLELMNKNDPD--GKYYIVRLKRHFMWRNHLCLVFELLSYNLYDLLRNTNFRGVSLNLTRKFAQQMCTALLFLCSPELSIIHCDLKPENILLCNPKRSAIKIVDFGSSCQIGQRIYQYIQSRFYRSPEVLLGIPYNLAIDMWSLGCILVEMHTGEPLFSGANEFDQMMKIVEVLGMPPKDILDNAPKARKFFDRLPDGSYQCLKVKDGVKEYLSPGSRKLHDILGCETGGPGGRRLGEAGHTLQDYL------KFKDLILRMLDYDRKTRIVPYAALHHCFFK 400          
BLAST of Dual specificity tyrosine-phosphorylation-regulated kinase 4 vs. Ensembl Nematostella
Match: EDO49238 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RGV4])

HSP 1 Score: 187.963 bits (476), Expect = 7.348e-54
Identity = 113/339 (33.33%), Postives = 183/339 (53.98%), Query Frame = 2
Query:  809 ILETLGKGSFGQVFKAIDHQTGINVAVKVIRNKKRFHQQSFVEVNIXXXXXXXXXXXXTSFHVIHLLNSFFFRNHPCLVFELLGENLYDVIKRNNFRGFSLSSIQKMSYSILSCLSVLRRENIIHCDLKPENILVMNNNSS--EIKIIDFGSSCFYNEKIY-TYIQSRFYRSPEVILGIPYTTQIDIWSFGCLLPELLTGRPLFPGESEMDQLLCIMEVYDLPPKSVLEESTRKKLFFDNKGEPRS------LHNSKGRRR---VPNSQ-------TIQSTMKMNADS---------------KFVDLIHSCLEWDARVRIQPDDALKHSWFQDFHAND 1723
            +LE LG+G+FGQV K     T   VA+K++++   + +Q  +E++IL  L  +  +   +++ +  +  F  +NH CLVFE+L +NLYD +K++ F    L  I+ +   +L  LS LR   +IH DLKPENI++++ +     +K+IDFGS+   ++ +  TY+QSR+YR+PEVILG+P+   ID+WS GC++ EL  G PL+PG SE DQ+  I++   LP   +L  +T+   FF       +      L N+    R   +P+ +       ++    ++N  S               +FV L+   L  D   RI P++AL H +    H  D
Sbjct:    1 VLEFLGRGTFGQVVKCWKKGTNELVAIKILKDHPSYARQGQIEISILAKLSAENSE---AYNFVRAIECFQHKNHTCLVFEMLQQNLYDYLKQSKFNPLPLKHIRPIVQQVLVALSKLRTLGLIHADLKPENIMLVDPDKQPFRVKVIDFGSATHVSKVVCSTYLQSRYYRAPEVILGLPFCESIDMWSLGCVIAELFLGWPLYPGSSEFDQIRYIIQTQGLPYDHLLNNATKTSRFFKKAINTHTGVLEWKLKNANEHERETKIPSKEARKYIFNSLDDIAQVNLSSSLTGNERIAEKIDRYEFVSLLKRMLTIDQEKRITPEEALSHQFVTLSHLVD 336          
BLAST of Dual specificity tyrosine-phosphorylation-regulated kinase 4 vs. Ensembl Nematostella
Match: EDO33758 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SR83])

HSP 1 Score: 174.481 bits (441), Expect = 6.048e-48
Identity = 109/346 (31.50%), Postives = 186/346 (53.76%), Query Frame = 2
Query:  749 DDETGAYIKVPHDHIAFRYEILETLGKGSFGQVFKAIDHQTGINVAVKVIRNKKRFHQQSFVEVNIXXXXXXXXXXXXTSFHVIHLLNSFFFRNHPCLVFELLGENLYDVIKRNNFRGFSLSSIQKMSYSILSCLSVLRRENIIHCDLKPENILVMNNN-----------------SSEIKIIDFGSSCFYNEKIYTYIQSRFYRSPEVILGIPYTTQIDIWSFGCLLPELLTGRPLFPGESEMDQLLCIMEVYDLPPKSVLEESTRKKLFFDNKGEPRSLHNSKGRRRVPNSQTIQSTMKMNADSK--FVDLIHSCLEWDARVRIQPDDALKHSWFQDFHANDDC 1729
            DDE G  I    D +  RYE+   LG+G+FG+V +  D +TG  VAVKVI+N +++ + + +E+ +L+ + +K R  ++    I +L+ F    H CLVFE +G +++D +K NN+  + L  ++ +SY ++  +  L    + H DLKPEN+L +N++                 SS +++IDFGS+ F +E   T + +R YR+PEVIL + ++   DIWS GC++ EL TG  LF      + L  +  +    P    ++S + K F+  K E     +S G+    N + ++  M  +++    F +L+   LE+D   RI   +A++H +F   +   DC
Sbjct:  107 DDEDGHLIYHKGDQLHSRYEVHCLLGEGTFGKVLECYDKKTGDVVAVKVIKNIEKYREAAKLEIKVLEKINQKNRYGKSL--CIKMLDWFNHHGHMCLVFEKMGLSVFDFMKDNNYEPYPLDQVRHISYQLIVAVKFLHEMKLTHTDLKPENMLFVNSDCDVFYNKDTKQDQRYVKSSHMRLIDFGSATFEHEHHSTTVSTRHYRAPEVILELGWSYPCDIWSIGCIMFELYTGFTLFQTHENREHLAMMERIIGPIPSDFAKKSRKTKYFYKGKLEWDE-KSSSGKYVRENCKPLKKYMLSDSEGHQLFFNLLDYLLEYDPEKRITAKEAMQHPFFNSMYY--DC 447          
BLAST of Dual specificity tyrosine-phosphorylation-regulated kinase 4 vs. Ensembl Medaka
Match: dyrk4 (dual specificity tyrosine-phosphorylation-regulated kinase 4 [Source:NCBI gene;Acc:101159741])

HSP 1 Score: 444.891 bits (1143), Expect = 2.135e-148
Identity = 201/370 (54.32%), Postives = 279/370 (75.41%), Query Frame = 2
Query:  593 FPMGPRSALQNYRFQLTSLEQEEISHFNQIWFLGLNSKKTEAIKGSSPNNGYDDETGAYIKVPHDHIAFRYEILETLGKGSFGQVFKAIDHQTGINVAVKVIRNKKRFHQQSFVEVNIXXXXXXXXXXXXTSFHVIHLLNSFFFRNHPCLVFELLGENLYDVIKRNNFRGFSLSSIQKMSYSILSCLSVLRRENIIHCDLKPENILVMNNNSSEIKIIDFGSSCFYNEKIYTYIQSRFYRSPEVILGIPYTTQIDIWSFGCLLPELLTGRPLFPGESEMDQLLCIMEVYDLPPKSVLEESTRKKLFFDNKGEPRSLHNSKGRRRVPNSQTIQSTMKMNADSKFVDLIHSCLEWDARVRIQPDDALKHSWF 1702
             PM P  AL N++ +LT  EQEEI+ + ++WFLGL S+K E  +G+  N+GYDDE G+YI+V HDHIA+R+E+LE +GKGSFGQV K +DH+T   VA+K+IRNKKRFH Q+ VE+ IL+ +K+K++      +VIH+   F+FRNH C+ FELLG NLY++IK+NNF+GFSL+ I++ ++++L CL +L +E IIHCDLKPENIL+       IK++DFGSSC+  +++YTYIQSRFYRSPEVILG PY+  ID+WS GC+L EL TG PLFPGESE++Q+ CIMEV  +PP   ++ ++R+KLFFD+KG PR++ NSKG++R PNS+ + + +K   D  F++ I  CL WD   R+ PD+ L+H W 
Sbjct:  130 LPMSPSEALNNFQERLTEFEQEEINAYAEVWFLGLGSQKIEGSQGAPHNSGYDDEHGSYIRVLHDHIAYRFEVLEVIGKGSFGQVLKCLDHKTNELVAIKMIRNKKRFHHQALVELKILEVIKKKDKDNL--HNVIHMKEYFYFRNHLCISFELLGVNLYELIKKNNFQGFSLALIRRFAHALLRCLQMLHKEKIIHCDLKPENILLSQRGPGNIKVVDFGSSCYEQQRVYTYIQSRFYRSPEVILGHPYSMAIDMWSLGCILAELHTGYPLFPGESEVEQIACIMEVLGMPPNDFVQSASRRKLFFDSKGNPRNITNSKGKKRRPNSKELSAALK-TTDPLFLEFIKGCLTWDPTKRMTPDEGLQHQWI 496          
BLAST of Dual specificity tyrosine-phosphorylation-regulated kinase 4 vs. Ensembl Medaka
Match: dyrk4 (dual specificity tyrosine-phosphorylation-regulated kinase 4 [Source:NCBI gene;Acc:101159741])

HSP 1 Score: 444.506 bits (1142), Expect = 4.349e-148
Identity = 201/370 (54.32%), Postives = 279/370 (75.41%), Query Frame = 2
Query:  593 FPMGPRSALQNYRFQLTSLEQEEISHFNQIWFLGLNSKKTEAIKGSSPNNGYDDETGAYIKVPHDHIAFRYEILETLGKGSFGQVFKAIDHQTGINVAVKVIRNKKRFHQQSFVEVNIXXXXXXXXXXXXTSFHVIHLLNSFFFRNHPCLVFELLGENLYDVIKRNNFRGFSLSSIQKMSYSILSCLSVLRRENIIHCDLKPENILVMNNNSSEIKIIDFGSSCFYNEKIYTYIQSRFYRSPEVILGIPYTTQIDIWSFGCLLPELLTGRPLFPGESEMDQLLCIMEVYDLPPKSVLEESTRKKLFFDNKGEPRSLHNSKGRRRVPNSQTIQSTMKMNADSKFVDLIHSCLEWDARVRIQPDDALKHSWF 1702
             PM P  AL N++ +LT  EQEEI+ + ++WFLGL S+K E  +G+  N+GYDDE G+YI+V HDHIA+R+E+LE +GKGSFGQV K +DH+T   VA+K+IRNKKRFH Q+ VE+ IL+ +K+K++      +VIH+   F+FRNH C+ FELLG NLY++IK+NNF+GFSL+ I++ ++++L CL +L +E IIHCDLKPENIL+       IK++DFGSSC+  +++YTYIQSRFYRSPEVILG PY+  ID+WS GC+L EL TG PLFPGESE++Q+ CIMEV  +PP   ++ ++R+KLFFD+KG PR++ NSKG++R PNS+ + + +K   D  F++ I  CL WD   R+ PD+ L+H W 
Sbjct:  145 LPMSPSEALNNFQERLTEFEQEEINAYAEVWFLGLGSQKIEGSQGAPHNSGYDDEHGSYIRVLHDHIAYRFEVLEVIGKGSFGQVLKCLDHKTNELVAIKMIRNKKRFHHQALVELKILEVIKKKDKDNL--HNVIHMKEYFYFRNHLCISFELLGVNLYELIKKNNFQGFSLALIRRFAHALLRCLQMLHKEKIIHCDLKPENILLSQRGPGNIKVVDFGSSCYEQQRVYTYIQSRFYRSPEVILGHPYSMAIDMWSLGCILAELHTGYPLFPGESEVEQIACIMEVLGMPPNDFVQSASRRKLFFDSKGNPRNITNSKGKKRRPNSKELSAALK-TTDPLFLEFIKGCLTWDPTKRMTPDEGLQHQWI 511          
BLAST of Dual specificity tyrosine-phosphorylation-regulated kinase 4 vs. Ensembl Medaka
Match: dyrk3 (dual specificity tyrosine-phosphorylation-regulated kinase 2 [Source:NCBI gene;Acc:101157613])

HSP 1 Score: 395.586 bits (1015), Expect = 3.533e-130
Identity = 196/385 (50.91%), Postives = 259/385 (67.27%), Query Frame = 2
Query:  596 PMGPRSALQNYRFQLTSLEQEEISHFNQIWFLGLNSKKTEAIKGSSPNNGYDDETGAYIKVPHDHIAFRYEILETLGKGSFGQVFKAIDHQTGINVAVKVIRNKKRFHQQSFVEVNIXXXXXXXXXXXXTSFHVIHLLNSFFFRNHPCLVFELLGENLYDVIKRNNFRGFSLSSIQKMSYSILSCLSVLRRENIIHCDLKPENILVMNNNSSEIKIIDFGSSCFYNEKIYTYIQSRFYRSPEVILGIPYTTQIDIWSFGCLLPELLTGRPLFPGESEMDQLLCIMEVYDLPPKSVLEESTRKKLFFDNKGEPR------------SLHNSKGR----RRVPNSQTIQSTMKMNADSKFVDLIHSCLEWDARVRIQPDDALKHSWF 1702
            P+ P  AL+ YR QL+ +E  EI  +  ++F+G N+KK  A+ G S N GYDDE G YI VPHDH+A+RYE L+ +GKGSFGQV K  DH+   ++A+K++RN+KRFH+Q+  E+ IL+HL +++R    + +V+H+L +F FRNH C+ FELL  NLY++IKRN F+GFSL  ++K ++SIL CL  L R  IIHCDLKPENIL+     S IK+IDFGSSCF ++++YTYIQSRFYR+PEVILG  Y   ID+WSFGC+L ELLTG PLFPGE E DQL C ME+  +PP  VLE++ R K F ++KG PR             L  S+ R    R  P S+     +K   D  F+D I  CL+WD   R+ P  AL+H W 
Sbjct:   91 PLTPDQALRLYRSQLSPMELSEIHSYPDVYFVGPNAKKRPAVAGGSNNCGYDDEQGGYIHVPHDHLAYRYEFLKIIGKGSFGQVAKVYDHKLQQHLALKMVRNEKRFHRQAQEEIRILEHLHKQDRN--GTMNVVHMLENFTFRNHICMTFELLSMNLYELIKRNKFQGFSLPLVRKFAHSILQCLEALSRHRIIHCDLKPENILLKQQGRSGIKVIDFGSSCFEHQRVYTYIQSRFYRAPEVILGSRYGLPIDMWSFGCILAELLTGYPLFPGEDESDQLACAMELLGMPPLKVLEQAKRAKNFINSKGHPRYCGYNTLPTGATVLTGSRSRRGKMRGPPASKDWNVALKGCEDPTFIDFIKKCLDWDPLSRLTPSQALRHPWL 473          
BLAST of Dual specificity tyrosine-phosphorylation-regulated kinase 4 vs. Ensembl Medaka
Match: dyrk3 (dual specificity tyrosine-phosphorylation-regulated kinase 2 [Source:NCBI gene;Acc:101157613])

HSP 1 Score: 395.971 bits (1016), Expect = 1.440e-129
Identity = 196/385 (50.91%), Postives = 259/385 (67.27%), Query Frame = 2
Query:  596 PMGPRSALQNYRFQLTSLEQEEISHFNQIWFLGLNSKKTEAIKGSSPNNGYDDETGAYIKVPHDHIAFRYEILETLGKGSFGQVFKAIDHQTGINVAVKVIRNKKRFHQQSFVEVNIXXXXXXXXXXXXTSFHVIHLLNSFFFRNHPCLVFELLGENLYDVIKRNNFRGFSLSSIQKMSYSILSCLSVLRRENIIHCDLKPENILVMNNNSSEIKIIDFGSSCFYNEKIYTYIQSRFYRSPEVILGIPYTTQIDIWSFGCLLPELLTGRPLFPGESEMDQLLCIMEVYDLPPKSVLEESTRKKLFFDNKGEPR------------SLHNSKGR----RRVPNSQTIQSTMKMNADSKFVDLIHSCLEWDARVRIQPDDALKHSWF 1702
            P+ P  AL+ YR QL+ +E  EI  +  ++F+G N+KK  A+ G S N GYDDE G YI VPHDH+A+RYE L+ +GKGSFGQV K  DH+   ++A+K++RN+KRFH+Q+  E+ IL+HL +++R    + +V+H+L +F FRNH C+ FELL  NLY++IKRN F+GFSL  ++K ++SIL CL  L R  IIHCDLKPENIL+     S IK+IDFGSSCF ++++YTYIQSRFYR+PEVILG  Y   ID+WSFGC+L ELLTG PLFPGE E DQL C ME+  +PP  VLE++ R K F ++KG PR             L  S+ R    R  P S+     +K   D  F+D I  CL+WD   R+ P  AL+H W 
Sbjct:  149 PLTPDQALRLYRSQLSPMELSEIHSYPDVYFVGPNAKKRPAVAGGSNNCGYDDEQGGYIHVPHDHLAYRYEFLKIIGKGSFGQVAKVYDHKLQQHLALKMVRNEKRFHRQAQEEIRILEHLHKQDRN--GTMNVVHMLENFTFRNHICMTFELLSMNLYELIKRNKFQGFSLPLVRKFAHSILQCLEALSRHRIIHCDLKPENILLKQQGRSGIKVIDFGSSCFEHQRVYTYIQSRFYRAPEVILGSRYGLPIDMWSFGCILAELLTGYPLFPGEDESDQLACAMELLGMPPLKVLEQAKRAKNFINSKGHPRYCGYNTLPTGATVLTGSRSRRGKMRGPPASKDWNVALKGCEDPTFIDFIKKCLDWDPLSRLTPSQALRHPWL 531          
BLAST of Dual specificity tyrosine-phosphorylation-regulated kinase 4 vs. Ensembl Medaka
Match: dyrk3 (dual specificity tyrosine-phosphorylation-regulated kinase 2 [Source:NCBI gene;Acc:101157613])

HSP 1 Score: 395.971 bits (1016), Expect = 1.440e-129
Identity = 196/385 (50.91%), Postives = 259/385 (67.27%), Query Frame = 2
Query:  596 PMGPRSALQNYRFQLTSLEQEEISHFNQIWFLGLNSKKTEAIKGSSPNNGYDDETGAYIKVPHDHIAFRYEILETLGKGSFGQVFKAIDHQTGINVAVKVIRNKKRFHQQSFVEVNIXXXXXXXXXXXXTSFHVIHLLNSFFFRNHPCLVFELLGENLYDVIKRNNFRGFSLSSIQKMSYSILSCLSVLRRENIIHCDLKPENILVMNNNSSEIKIIDFGSSCFYNEKIYTYIQSRFYRSPEVILGIPYTTQIDIWSFGCLLPELLTGRPLFPGESEMDQLLCIMEVYDLPPKSVLEESTRKKLFFDNKGEPR------------SLHNSKGR----RRVPNSQTIQSTMKMNADSKFVDLIHSCLEWDARVRIQPDDALKHSWF 1702
            P+ P  AL+ YR QL+ +E  EI  +  ++F+G N+KK  A+ G S N GYDDE G YI VPHDH+A+RYE L+ +GKGSFGQV K  DH+   ++A+K++RN+KRFH+Q+  E+ IL+HL +++R    + +V+H+L +F FRNH C+ FELL  NLY++IKRN F+GFSL  ++K ++SIL CL  L R  IIHCDLKPENIL+     S IK+IDFGSSCF ++++YTYIQSRFYR+PEVILG  Y   ID+WSFGC+L ELLTG PLFPGE E DQL C ME+  +PP  VLE++ R K F ++KG PR             L  S+ R    R  P S+     +K   D  F+D I  CL+WD   R+ P  AL+H W 
Sbjct:  149 PLTPDQALRLYRSQLSPMELSEIHSYPDVYFVGPNAKKRPAVAGGSNNCGYDDEQGGYIHVPHDHLAYRYEFLKIIGKGSFGQVAKVYDHKLQQHLALKMVRNEKRFHRQAQEEIRILEHLHKQDRN--GTMNVVHMLENFTFRNHICMTFELLSMNLYELIKRNKFQGFSLPLVRKFAHSILQCLEALSRHRIIHCDLKPENILLKQQGRSGIKVIDFGSSCFEHQRVYTYIQSRFYRAPEVILGSRYGLPIDMWSFGCILAELLTGYPLFPGEDESDQLACAMELLGMPPLKVLEQAKRAKNFINSKGHPRYCGYNTLPTGATVLTGSRSRRGKMRGPPASKDWNVALKGCEDPTFIDFIKKCLDWDPLSRLTPSQALRHPWL 531          
BLAST of Dual specificity tyrosine-phosphorylation-regulated kinase 4 vs. Planmine SMEST
Match: SMESG000042374.1 (SMESG000042374.1)

HSP 1 Score: 1236.09 bits (3197), Expect = 0.000e+0
Identity = 623/629 (99.05%), Postives = 624/629 (99.21%), Query Frame = 2
Query:   86 MLPVPQLLGNIHNGRNYNTTKLGKGQRHLQFNFNSQQMNIPNTSNKTKQISINYPTFPMFDNFKSIHDISNQETNCDGHTQRXXXXXXXXXIRDIFKNSNGMNKNLFEPNNFITKKRVSNLSSINQKPSWGSVNISQSNCVDDSSRSTNQLDSSLKVSPHNYQDHSPHGFPMGPRSALQNYRFQLTSLEQEEISHFNQIWFLGLNSKKTEAIKGSSPNNGYDDETGAYIKVPHDHIAFRYEILETLGKGSFGQVFKAIDHQTGINVAVKVIRNKKRFHQQSFVEVNIXXXXXXXXXXXXTSFHVIHLLNSFFFRNHPCLVFELLGENLYDVIKRNNFRGFSLSSIQKMSYSILSCLSVLRRENIIHCDLKPENILVMNNNSSEIKIIDFGSSCFYNEKIYTYIQSRFYRSPEVILGIPYTTQIDIWSFGCLLPELLTGRPLFPGESEMDQLLCIMEVYDLPPKSVLEESTRKKLFFDNKGEPRSLHNSKGRRRVPNSQTIQSTMKMNADSKFVDLIHSCLEWDARVRIQPDDALKHSWFQDFHANDDCFKENQNSDIKPPLKRPRHRFQNRDKIQFKQLREFNSHYKPNGYLPPIQIGSNKKIENPVSENLQFIEDVMFNKTEFPSLYR 1972
            MLPVPQLLGNIHN RNYNTTKLGKGQRHLQFNFNSQQMNIPNTSNKTKQISINYPTFPMFDNFKSIHD+SNQETNCDGHTQRNQKQNNNKNIRDIFKNSNGMNKNLFEPNNFITKKRVSNLSSINQKPSWGSVNI QSNCVDDSSRSTNQLDSSLKVSPHNYQDHSPHGFPMGPRSALQNYRFQLTSLEQEEISHFNQIWFLGLNSKKTEAIKGSSPNNGYDDETGAYIKVPHDHIAFRYEILETLGKGSFGQVFKAIDHQTGINVAVKVIRNKKRFHQQSFVEVNILKHLKEKERKLETSFHVIHLLNSFFFRNHPCLVFELLGENLYDVIKRNNFRGFSLSSIQKMSYSILSCLSVLRRENIIHCDLKPENILVMNNNSSEIKIIDFGSSCFYNEKIYTYIQSRFYRSPEVILGIPYTTQIDIWSFGCLLPELLTGRPLFPGESEMDQLLCIMEVYDLPPKSVLEESTRKKLFFDNKGEPRSLHNSKGRRRVPNSQTIQSTMKMNADSKFVDLIHSCLEWDARVRIQPDDALKHSWFQDFHANDDCFKENQNSDIKPPLKRPRHR  NRDKIQFKQ REFNSHYKPNGYLPPIQIGSNKKIENPVSENLQFIEDVMFNKTEFPSLYR
Sbjct:    1 MLPVPQLLGNIHNDRNYNTTKLGKGQRHLQFNFNSQQMNIPNTSNKTKQISINYPTFPMFDNFKSIHDMSNQETNCDGHTQRNQKQNNNKNIRDIFKNSNGMNKNLFEPNNFITKKRVSNLSSINQKPSWGSVNIYQSNCVDDSSRSTNQLDSSLKVSPHNYQDHSPHGFPMGPRSALQNYRFQLTSLEQEEISHFNQIWFLGLNSKKTEAIKGSSPNNGYDDETGAYIKVPHDHIAFRYEILETLGKGSFGQVFKAIDHQTGINVAVKVIRNKKRFHQQSFVEVNILKHLKEKERKLETSFHVIHLLNSFFFRNHPCLVFELLGENLYDVIKRNNFRGFSLSSIQKMSYSILSCLSVLRRENIIHCDLKPENILVMNNNSSEIKIIDFGSSCFYNEKIYTYIQSRFYRSPEVILGIPYTTQIDIWSFGCLLPELLTGRPLFPGESEMDQLLCIMEVYDLPPKSVLEESTRKKLFFDNKGEPRSLHNSKGRRRVPNSQTIQSTMKMNADSKFVDLIHSCLEWDARVRIQPDDALKHSWFQDFHANDDCFKENQNSDIKPPLKRPRHRIPNRDKIQFKQSREFNSHYKPNGYLPPIQIGSNKKIENPVSENLQFIEDVMFNKTEFPSLYR 629          
BLAST of Dual specificity tyrosine-phosphorylation-regulated kinase 4 vs. Planmine SMEST
Match: SMESG000081181.1 (SMESG000081181.1)

HSP 1 Score: 379.407 bits (973), Expect = 8.644e-124
Identity = 188/397 (47.36%), Postives = 266/397 (67.00%), Query Frame = 2
Query:  596 PMGPRSALQNYRFQLTSLEQEEISHFNQIWFLGLNSKKTEAIKGSSPNNGYDDETGAYIKVPHDHIAFRYEILETLGKGSFGQVFKAIDHQTGINVAVKVIRNKKRFHQQSFVEVNIXXXXXXXXXXXXTSFHVIHLLNSFFFRNHPCLVFELLGENLYDVIKRNNFRGFSLSSIQKMSYSILSCLSVLRRENIIHCDLKPENILVMNNNSSEIKIIDFGSSCFYNEKIYTYIQSRFYRSPEVILGIPYTTQIDIWSFGCLLPELLTGRPLFPGESEMDQLLCIMEVYDLPPKSVLEESTRKKLFFDNKGEPR------------SLHNSKGR----RRVPNSQTIQSTMKMNADSK-----------FVDLIHSCLEWDARVRIQPDDALKHSWFQ 1705
            P  P  A++ Y+ +LTS E +EI ++ Q++FLGL++ K   I G   N  YDDE  +YI VPHDHI++R+EIL+ +GKGSFGQV +A DH  G  VA+K++RN+KRF +Q+  E+ IL+HL+ ++       +V+HLL  F FRNH C+ FELL  NLY++IK+N F GFSL  ++K +++IL CL +L R  IIHCDLKPENIL+     S IK+IDFGSSC+ ++K+Y Y+QSRFYR+PEVILG  Y   ID+WS GC+L EL+TG PLFPGE E DQL CI+EV  +PP S+LE S R ++FF ++G PR            ++   K R    R +P S+ +Q+++K+  D++           F+D + SCL W+   R+ P +AL+H+W +
Sbjct:  166 PQSPSVAMRLYKTKLTSYEHQEIFNYPQVYFLGLSANKRSGIIGGGNNCNYDDEQHSYIYVPHDHISYRFEILKIIGKGSFGQVVRAFDHMQGQLVALKIVRNEKRFARQALEEIKILEHLRHEDTD--NGHNVVHLLEHFTFRNHMCMTFELLSYNLYELIKKNKFHGFSLQLVRKFAHAILQCLDLLYRNRIIHCDLKPENILLKQTGRSGIKVIDFGSSCYDHQKVYNYVQSRFYRAPEVILGASYGLSIDMWSLGCILCELVTGYPLFPGEDEGDQLACIIEVLGMPPPSLLEISKRSRVFFTSRGFPRYCVIETDYNGQCAIKPGKSRRGKVRGLPGSRDLQTSLKLLDDNQIENSEYESKLDFLDFVKSCLMWNCEDRLIPREALRHNWLR 560          
BLAST of Dual specificity tyrosine-phosphorylation-regulated kinase 4 vs. Planmine SMEST
Match: SMESG000064198.1 (SMESG000064198.1)

HSP 1 Score: 376.326 bits (965), Expect = 2.057e-123
Identity = 191/413 (46.25%), Postives = 267/413 (64.65%), Query Frame = 2
Query:  596 PMGPRSALQNYRFQLTSLEQEEISHFNQIWFLGLNSKKTEAIKGSSPNNGYDDETGAYIKVPHDHIAFRYEILETLGKGSFGQVFKAIDHQTGINVAVKVIRNKKRFHQQSFVEVNIXXXXXXXXXXXXTSFHVIHLLNSFFFRNHPCLVFELLGENLYDVIKRNNFRGFSLSSIQKMSYSILSCLSVLRRENIIHCDLKPENILVMNNNSSEIKIIDFGSSCFYNEKIYTYIQSRFYRSPEVILGIPYTTQIDIWSFGCLLPELLTGRPLFPGESEMDQLLCIMEVYDLPPKSVLEESTRKKLFFDNKGEPR-------------------------SLHNSKGRRR-VPNSQTIQSTM-KMNAD----------------SKFVDLIHSCLEWDARVRIQPDDALKHSWFQ 1705
            P+ P  A++ Y  +L++ E  EI ++ QI+F+G N+KK   I   + NNGYDDE G+Y  V HDH+++RYEIL+ LGKGSFGQV KA DH+TG+ VA+K++RN+KRF +Q+  E+ IL+ LK +++    +  ++H+L  F FRNH C+ FELL  NLY +IK+N F+GFSL  ++K +YSIL CL +L +  +IHCDLKPENIL+     S IK+IDFGSSC+ +++IYTYIQSRFYR+PEVILG  Y+ QID+WSFGC+L E+LTG PLFPGE EMDQL CI+EV  +PP++ L++  R K FF +KG PR                            + +G+ R  P S+++ S +  MN D                + F++ +  CLEW    R  P +AL+H W +
Sbjct:   77 PLTPDQAMKLYMHRLSTFEHHEIFNYPQIYFVGHNAKKKHGISVGANNNGYDDEHGSYQHVAHDHVSYRYEILKILGKGSFGQVVKAYDHKTGMFVALKMVRNEKRFAKQALEEIKILEQLKIQDKDNNKN--IVHILEHFTFRNHVCMTFELLNINLYSLIKKNKFQGFSLLLVKKFAYSILVCLDLLHKNKVIHCDLKPENILLKQQGRSGIKVIDFGSSCYDHQRIYTYIQSRFYRAPEVILGGKYSVQIDMWSFGCILVEMLTGYPLFPGEDEMDQLACIIEVLGMPPQNFLDQCKRSKEFFCSKGYPRYCQLETETETQSGKTIINGVVFYLKGCKSKRGKYRGSPGSKSLASIVNAMNPDLNSDANIDSEIQLKDFTNFINFLLKCLEWVPDDRFTPKEALRHEWLR 487          
BLAST of Dual specificity tyrosine-phosphorylation-regulated kinase 4 vs. Planmine SMEST
Match: SMESG000058389.1 (SMESG000058389.1)

HSP 1 Score: 376.711 bits (966), Expect = 7.140e-123
Identity = 187/385 (48.57%), Postives = 257/385 (66.75%), Query Frame = 2
Query:  599 MGPRSALQNYRFQLTSLEQEEISHFNQIWFLGLNSKKTEAIKGSSPNNGYDDETGAYIKVPHDHIAFRYEILETLGKGSFGQVFKAIDHQTGINVAVKVIRNKKRFHQQSFVEVNIXXXXXXXXXXXXTSFHVIHLLNSFFFRNHPCLVFELLGENLYDVIKRNNFRGFSLSSIQKMSYSILSCLSVLRRENIIHCDLKPENILVMNNNSSEIKIIDFGSSCFYNEKIYTYIQSRFYRSPEVILGIPYTTQIDIWSFGCLLPELLTGRPLFPGESEMDQLLCIMEVYDLPPKSVLEESTRKKLFFDNKGEPRSLHNS---------------KGR-RRVPNSQTIQSTMKMNADSKFVDLIHSCLEWDARVRIQPDDALKHSWFQ 1705
            + P SA++ +  +LT+ E  EI  +  I+F+G N+KK   + G + N GYDD+  +YI V HDHIA+RYE+L+ LGKGSFGQV KA+DH+TG  VA+K++RN+KRF +Q+  E+ +L+ LK+++    ++ +VIH+++ F FRNH C+ FELL  NLY++IK+N F+GFSL  ++K +YSIL CL +L R  IIHCDLKPENIL+     S IK+IDFGSSC  +++IYTYIQSRFYR+PEVILG  Y   ID+WSFGC+L EL TG P+FPGE E DQL CIME+   PP  + +   R K+FF ++  PR    S               +GR R  P S+T+ + +K   D  F+D    CL W    R+ P +ALKH W +
Sbjct:  147 LSPDSAMRQFMSKLTTYEHHEIFSYPSIFFVGTNAKKRAGVLGGTNNCGYDDDQNSYIHVAHDHIAYRYEVLKLLGKGSFGQVVKALDHKTGECVAIKMVRNEKRFTRQAAEEIRLLELLKKQDPD--SNCNVIHIIDQFIFRNHVCMTFELLSINLYELIKKNKFQGFSLQLVRKFAYSILLCLELLYRNKIIHCDLKPENILLKQQGRSGIKVIDFGSSCCEHQRIYTYIQSRFYRAPEVILGGKYGMPIDMWSFGCILAELYTGYPIFPGEDEGDQLACIMEILGQPPTKLTDICKRTKIFFTSQRYPRYCVQSTDADGSVILKGGRSKRGRFRGPPASKTLSTALKNCDDQLFLDFTLRCLTWIPETRMTPKEALKHPWLR 529          
BLAST of Dual specificity tyrosine-phosphorylation-regulated kinase 4 vs. Planmine SMEST
Match: SMESG000058389.1 (SMESG000058389.1)

HSP 1 Score: 376.711 bits (966), Expect = 7.485e-123
Identity = 187/385 (48.57%), Postives = 257/385 (66.75%), Query Frame = 2
Query:  599 MGPRSALQNYRFQLTSLEQEEISHFNQIWFLGLNSKKTEAIKGSSPNNGYDDETGAYIKVPHDHIAFRYEILETLGKGSFGQVFKAIDHQTGINVAVKVIRNKKRFHQQSFVEVNIXXXXXXXXXXXXTSFHVIHLLNSFFFRNHPCLVFELLGENLYDVIKRNNFRGFSLSSIQKMSYSILSCLSVLRRENIIHCDLKPENILVMNNNSSEIKIIDFGSSCFYNEKIYTYIQSRFYRSPEVILGIPYTTQIDIWSFGCLLPELLTGRPLFPGESEMDQLLCIMEVYDLPPKSVLEESTRKKLFFDNKGEPRSLHNS---------------KGR-RRVPNSQTIQSTMKMNADSKFVDLIHSCLEWDARVRIQPDDALKHSWFQ 1705
            + P SA++ +  +LT+ E  EI  +  I+F+G N+KK   + G + N GYDD+  +YI V HDHIA+RYE+L+ LGKGSFGQV KA+DH+TG  VA+K++RN+KRF +Q+  E+ +L+ LK+++    ++ +VIH+++ F FRNH C+ FELL  NLY++IK+N F+GFSL  ++K +YSIL CL +L R  IIHCDLKPENIL+     S IK+IDFGSSC  +++IYTYIQSRFYR+PEVILG  Y   ID+WSFGC+L EL TG P+FPGE E DQL CIME+   PP  + +   R K+FF ++  PR    S               +GR R  P S+T+ + +K   D  F+D    CL W    R+ P +ALKH W +
Sbjct:  150 LSPDSAMRQFMSKLTTYEHHEIFSYPSIFFVGTNAKKRAGVLGGTNNCGYDDDQNSYIHVAHDHIAYRYEVLKLLGKGSFGQVVKALDHKTGECVAIKMVRNEKRFTRQAAEEIRLLELLKKQDPD--SNCNVIHIIDQFIFRNHVCMTFELLSINLYELIKKNKFQGFSLQLVRKFAYSILLCLELLYRNKIIHCDLKPENILLKQQGRSGIKVIDFGSSCCEHQRIYTYIQSRFYRAPEVILGGKYGMPIDMWSFGCILAELYTGYPIFPGEDEGDQLACIMEILGQPPTKLTDICKRTKIFFTSQRYPRYCVQSTDADGSVILKGGRSKRGRFRGPPASKTLSTALKNCDDQLFLDFTLRCLTWIPETRMTPKEALKHPWLR 532          
The following BLAST results are available for this feature:
BLAST of Dual specificity tyrosine-phosphorylation-regulated kinase 4 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
DYRK48.457e-13648.97dual specificity tyrosine phosphorylation regulate... [more]
DYRK48.457e-13648.97dual specificity tyrosine phosphorylation regulate... [more]
DYRK48.530e-13548.97dual specificity tyrosine phosphorylation regulate... [more]
DYRK24.021e-12948.70dual specificity tyrosine phosphorylation regulate... [more]
DYRK21.830e-12848.70dual specificity tyrosine phosphorylation regulate... [more]
back to top
BLAST of Dual specificity tyrosine-phosphorylation-regulated kinase 4 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
mbk-21.137e-12247.26Dual specificity tyrosine-phosphorylation-regulate... [more]
mbk-21.137e-12247.26Dual specificity tyrosine-phosphorylation-regulate... [more]
mbk-21.137e-12247.26Dual specificity tyrosine-phosphorylation-regulate... [more]
mbk-21.687e-12247.26Dual specificity tyrosine-phosphorylation-regulate... [more]
mbk-21.687e-12247.26Dual specificity tyrosine-phosphorylation-regulate... [more]
back to top
BLAST of Dual specificity tyrosine-phosphorylation-regulated kinase 4 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Dyrk21.225e-13352.55gene:FBgn0016930 transcript:FBtr0100447[more]
Dyrk21.225e-13352.55gene:FBgn0016930 transcript:FBtr0089289[more]
Dyrk21.225e-13352.55gene:FBgn0016930 transcript:FBtr0100448[more]
Dyrk21.225e-13352.55gene:FBgn0016930 transcript:FBtr0089288[more]
Dyrk21.225e-13352.55gene:FBgn0016930 transcript:FBtr0089290[more]
back to top
BLAST of Dual specificity tyrosine-phosphorylation-regulated kinase 4 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
dyrk42.517e-15053.99dual-specificity tyrosine-(Y)-phosphorylation regu... [more]
dyrk43.334e-15053.99dual-specificity tyrosine-(Y)-phosphorylation regu... [more]
dyrk44.177e-15053.99dual-specificity tyrosine-(Y)-phosphorylation regu... [more]
dyrk44.725e-15053.99dual-specificity tyrosine-(Y)-phosphorylation regu... [more]
dyrk47.756e-15053.99dual-specificity tyrosine-(Y)-phosphorylation regu... [more]
back to top
BLAST of Dual specificity tyrosine-phosphorylation-regulated kinase 4 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
dyrk32.114e-12650.52dual specificity tyrosine-(Y)-phosphorylation regu... [more]
dyrk32.835e-12650.52dual specificity tyrosine-(Y)-phosphorylation regu... [more]
dyrk32.895e-12650.52dual specificity tyrosine-(Y)-phosphorylation regu... [more]
dyrk35.805e-12650.52dual specificity tyrosine-(Y)-phosphorylation regu... [more]
DYRK25.140e-12548.31dual specificity tyrosine phosphorylation regulate... [more]
back to top
BLAST of Dual specificity tyrosine-phosphorylation-regulated kinase 4 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Dyrk48.267e-13445.99dual-specificity tyrosine-(Y)-phosphorylation regu... [more]
Dyrk34.820e-12846.01dual-specificity tyrosine-(Y)-phosphorylation regu... [more]
Dyrk29.292e-12848.45dual-specificity tyrosine-(Y)-phosphorylation regu... [more]
Dyrk1b1.391e-8138.14dual-specificity tyrosine-(Y)-phosphorylation regu... [more]
Dyrk1b6.459e-8139.33dual-specificity tyrosine-(Y)-phosphorylation regu... [more]
back to top
BLAST of Dual specificity tyrosine-phosphorylation-regulated kinase 4 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q9NR20|DYRK4_HUMAN4.061e-13548.97Dual specificity tyrosine-phosphorylation-regulate... [more]
sp|Q8BI55|DYRK4_MOUSE5.782e-13345.99Dual specificity tyrosine-phosphorylation-regulate... [more]
sp|Q9V3D5|DYRK2_DROME1.228e-13252.55Dual specificity tyrosine-phosphorylation-regulate... [more]
sp|Q92630|DYRK2_HUMAN8.787e-12848.70Dual specificity tyrosine-phosphorylation-regulate... [more]
sp|Q922Y0|DYRK3_MOUSE3.372e-12746.01Dual specificity tyrosine-phosphorylation-regulate... [more]
back to top
BLAST of Dual specificity tyrosine-phosphorylation-regulated kinase 4 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A2B4SBZ47.451e-15956.99Dual specificity tyrosine-phosphorylation-regulate... [more]
A0A4E0QUJ35.131e-15455.09Dual specificity tyrosine-phosphorylation-regulate... [more]
C3Y4L07.441e-15457.26Protein kinase domain-containing protein OS=Branch... [more]
A0A1E1XNC68.351e-15455.95Putative mitogen-activated protein kinase erk-a (F... [more]
A0A4Z2CUC21.054e-15256.76Dual specificity tyrosine-phosphorylation-regulate... [more]
back to top
BLAST of Dual specificity tyrosine-phosphorylation-regulated kinase 4 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
dyrk46.155e-15455.65dual specificity tyrosine phosphorylation regulate... [more]
dyrk49.279e-15455.65dual specificity tyrosine phosphorylation regulate... [more]
dyrk41.632e-15355.65dual specificity tyrosine phosphorylation regulate... [more]
dyrk42.214e-15355.65dual specificity tyrosine phosphorylation regulate... [more]
dyrk32.893e-13550.90dual specificity tyrosine-phosphorylation-regulate... [more]
back to top
BLAST of Dual specificity tyrosine-phosphorylation-regulated kinase 4 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 5
Match NameE-valueIdentityDescription
dyrk21.310e-12648.03dual-specificity tyrosine-(Y)-phosphorylation regu... [more]
dyrk21.025e-12147.31dual-specificity tyrosine-(Y)-phosphorylation regu... [more]
dyrk1aa2.068e-7844.71dual-specificity tyrosine-(Y)-phosphorylation regu... [more]
ENSPMAT00000007952.11.473e-7541.99pep scaffold:Pmarinus_7.0:GL476685:157428:173166:-... [more]
ENSPMAT00000007958.12.276e-7542.17pep scaffold:Pmarinus_7.0:GL476685:157443:173166:-... [more]
back to top
BLAST of Dual specificity tyrosine-phosphorylation-regulated kinase 4 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 5
Match NameE-valueIdentityDescription
YAK11.063e-6445.28Serine-threonine protein kinase; component of a gl... [more]
PHO852.573e-3728.57Cyclin-dependent kinase; has ten cyclin partners; ... [more]
KNS15.064e-3530.93Protein kinase involved in negative regulation of ... [more]
KSS11.325e-3431.16Mitogen-activated protein kinase (MAPK); involved ... [more]
HOG19.298e-3129.17Mitogen-activated protein kinase involved in osmor... [more]
back to top
BLAST of Dual specificity tyrosine-phosphorylation-regulated kinase 4 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
EDO362941.568e-14356.21Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO461444.385e-12950.53Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO451872.654e-8441.36Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO492387.348e-5433.33Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO337586.048e-4831.50Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Dual specificity tyrosine-phosphorylation-regulated kinase 4 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
dyrk42.135e-14854.32dual specificity tyrosine-phosphorylation-regulate... [more]
dyrk44.349e-14854.32dual specificity tyrosine-phosphorylation-regulate... [more]
dyrk33.533e-13050.91dual specificity tyrosine-phosphorylation-regulate... [more]
dyrk31.440e-12950.91dual specificity tyrosine-phosphorylation-regulate... [more]
dyrk31.440e-12950.91dual specificity tyrosine-phosphorylation-regulate... [more]
back to top
BLAST of Dual specificity tyrosine-phosphorylation-regulated kinase 4 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000042374.10.000e+099.05SMESG000042374.1[more]
SMESG000081181.18.644e-12447.36SMESG000081181.1[more]
SMESG000064198.12.057e-12346.25SMESG000064198.1[more]
SMESG000058389.17.140e-12348.57SMESG000058389.1[more]
SMESG000058389.17.485e-12348.57SMESG000058389.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30015820 ID=SMED30015820|Name=Dual specificity tyrosine-phosphorylation-regulated kinase 4|organism=Schmidtea mediterranea sexual|type=transcript|length=1995bp
CTTCCGATCTGTGAAATTCACTTTTAACAACCGTGAATTTACTTATAAAA
TATATTGGATTCAAACAATTTAAGAAAGCAATTCGATGCTCCCAGTTCCG
CAACTATTAGGAAATATCCACAATGGCAGAAATTACAATACAACAAAATT
AGGAAAGGGACAAAGGCATTTGCAATTTAATTTTAATTCTCAGCAAATGA
ATATTCCAAATACCTCCAACAAAACAAAACAAATCTCAATAAATTATCCC
ACATTTCCAATGTTTGATAATTTTAAAAGTATTCACGACATATCAAATCA
AGAAACAAATTGTGATGGTCATACACAGAGAAATCAAAAACAAAATAACA
ATAAAAATATCCGAGACATTTTTAAGAATTCGAATGGAATGAATAAAAAT
TTATTCGAGCCAAATAATTTTATCACAAAAAAACGCGTTTCCAATCTTTC
TTCAATCAATCAAAAACCGTCTTGGGGGTCTGTAAATATTTCTCAATCCA
ATTGTGTCGACGACAGTTCGCGCAGCACTAACCAATTAGATTCGAGTTTA
AAAGTTTCTCCACACAATTACCAAGATCATTCGCCACATGGCTTTCCTAT
GGGACCTCGAAGTGCATTACAGAATTATCGGTTTCAATTAACGAGTCTGG
AGCAGGAAGAAATTTCCCATTTTAATCAGATTTGGTTTCTAGGTTTAAAC
TCGAAGAAAACCGAAGCAATAAAGGGCTCCTCTCCAAATAATGGATATGA
TGATGAAACCGGAGCGTATATTAAAGTTCCACACGATCATATTGCATTCA
GATATGAAATTCTAGAAACCTTGGGGAAAGGATCATTTGGTCAAGTTTTT
AAAGCAATAGATCACCAAACAGGAATAAATGTAGCAGTAAAAGTTATAAG
AAATAAGAAAAGATTTCATCAACAATCATTTGTGGAAGTTAATATATTAA
AACATTTAAAGGAAAAAGAAAGAAAATTAGAGACTTCTTTCCATGTTATT
CATCTTTTAAATAGTTTCTTTTTCCGCAACCACCCTTGTCTTGTTTTTGA
ATTATTAGGGGAGAATTTATATGATGTTATTAAAAGAAACAATTTCCGAG
GATTTAGTCTGTCCTCCATTCAGAAAATGTCATATTCTATCTTATCATGT
CTTTCTGTCTTGCGAAGAGAAAACATTATCCACTGTGATTTAAAACCTGA
AAACATTCTTGTAATGAATAATAATTCTTCGGAAATAAAAATAATTGATT
TCGGATCTAGTTGCTTTTACAATGAAAAAATTTACACATATATCCAATCC
CGGTTCTATAGGTCACCGGAAGTAATTCTCGGTATCCCATATACTACACA
AATTGATATTTGGAGTTTTGGTTGTTTGCTTCCAGAATTGTTAACCGGAA
GACCACTTTTTCCAGGAGAATCTGAAATGGATCAACTTTTATGCATTATG
GAAGTATATGATCTTCCACCGAAATCTGTTTTAGAAGAATCAACAAGGAA
AAAATTATTTTTCGACAACAAAGGAGAACCGAGAAGTCTTCATAATTCAA
AAGGTCGAAGACGAGTTCCGAATTCACAAACAATTCAGTCGACAATGAAA
ATGAACGCGGACTCAAAATTTGTTGATCTTATTCACAGTTGTTTAGAATG
GGATGCTCGAGTACGTATTCAACCTGATGATGCTCTTAAACATTCTTGGT
TTCAAGATTTTCACGCTAATGATGACTGTTTTAAAGAAAATCAGAACTCT
GATATAAAACCTCCCTTGAAAAGACCTAGACATAGATTTCAAAACAGAGA
TAAAATACAATTTAAACAATTACGCGAGTTTAATAGTCATTATAAACCGA
ATGGGTATCTTCCTCCTATACAAATTGGATCTAATAAAAAGATAGAAAAT
CCTGTAAGTGAAAATCTACAATTTATTGAAGATGTAATGTTTAATAAAAC
AGAATTTCCGTCTCTATATCGGTAGATAATAAGTCATTATTACGT
back to top

protein sequence of SMED30015820-orf-1

>SMED30015820-orf-1 ID=SMED30015820-orf-1|Name=SMED30015820-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=630bp
MLPVPQLLGNIHNGRNYNTTKLGKGQRHLQFNFNSQQMNIPNTSNKTKQI
SINYPTFPMFDNFKSIHDISNQETNCDGHTQRNQKQNNNKNIRDIFKNSN
GMNKNLFEPNNFITKKRVSNLSSINQKPSWGSVNISQSNCVDDSSRSTNQ
LDSSLKVSPHNYQDHSPHGFPMGPRSALQNYRFQLTSLEQEEISHFNQIW
FLGLNSKKTEAIKGSSPNNGYDDETGAYIKVPHDHIAFRYEILETLGKGS
FGQVFKAIDHQTGINVAVKVIRNKKRFHQQSFVEVNILKHLKEKERKLET
SFHVIHLLNSFFFRNHPCLVFELLGENLYDVIKRNNFRGFSLSSIQKMSY
SILSCLSVLRRENIIHCDLKPENILVMNNNSSEIKIIDFGSSCFYNEKIY
TYIQSRFYRSPEVILGIPYTTQIDIWSFGCLLPELLTGRPLFPGESEMDQ
LLCIMEVYDLPPKSVLEESTRKKLFFDNKGEPRSLHNSKGRRRVPNSQTI
QSTMKMNADSKFVDLIHSCLEWDARVRIQPDDALKHSWFQDFHANDDCFK
ENQNSDIKPPLKRPRHRFQNRDKIQFKQLREFNSHYKPNGYLPPIQIGSN
KKIENPVSENLQFIEDVMFNKTEFPSLYR*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000016pharynx
PLANA:0000026gut
PLANA:0000034epidermis
PLANA:0000054dorsal region of the epidermis
PLANA:0000418head
PLANA:0002032epidermal cell
Vocabulary: INTERPRO
TermDefinition
IPR042521DYRK
IPR000719Prot_kinase_dom
IPR017441Protein_kinase_ATP_BS
IPR008271Ser/Thr_kinase_AS
IPR011009Kinase-like_dom_sf
Vocabulary: molecular function
TermDefinition
GO:0004672protein kinase activity
GO:0005524ATP binding
GO:0016301kinase activity
Vocabulary: biological process
TermDefinition
GO:0006468protein phosphorylation
GO:0016310phosphorylation
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR000719Protein kinase domainSMARTSM00220serkin_6coord: 240..539
e-value: 2.7E-84
score: 296.0
IPR000719Protein kinase domainPFAMPF00069Pkinasecoord: 240..539
e-value: 4.2E-53
score: 180.4
IPR000719Protein kinase domainPROSITEPS50011PROTEIN_KINASE_DOMcoord: 240..539
score: 39.679
NoneNo IPR availableGENE3DG3DSA:1.10.510.10coord: 296..539
e-value: 3.5E-116
score: 390.0
NoneNo IPR availableGENE3DG3DSA:3.30.200.20coord: 222..323
e-value: 3.5E-116
score: 390.0
NoneNo IPR availablePANTHERPTHR24058DUAL SPECIFICITY PROTEIN KINASEcoord: 71..540
NoneNo IPR availablePANTHERPTHR24058:SF22DUAL SPECIFICITY TYROSINE-PHOSPHORYLATION-REGULATED KINASE 4coord: 71..540
IPR042521Dual specificity tyrosine-phosphorylation-regulated kinaseGENE3DG3DSA:1.10.8.980coord: 134..214
e-value: 4.6E-11
score: 45.0
IPR008271Serine/threonine-protein kinase, active sitePROSITEPS00108PROTEIN_KINASE_STcoord: 364..376
IPR017441Protein kinase, ATP binding sitePROSITEPS00107PROTEIN_KINASE_ATPcoord: 246..269
IPR011009Protein kinase-like domain superfamilySUPERFAMILYSSF56112Protein kinase-like (PK-like)coord: 232..546