slc3a-1

Overview
Nameslc3a-1 (AKN21406.1)
Smed IDSMED30015813
Length (bp)1961
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of slc3a-1 (SMED30015813) t-SNE clustered cells

Violin plots show distribution of expression levels for slc3a-1 (SMED30015813) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of slc3a-1 (SMED30015813) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for slc3a-1 (SMED30015813) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30015813

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 7

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
neuronSMED30015813SMESG000019192.1 SMESG000019184.1 dd_Smed_v4_2113_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
neuronSMED30015813SMESG000019192.1 SMESG000019184.1 dd_Smed_v4_2113_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult colorimetric in situ hybridization evidence
muscle cellSMED30015813SMESG000019192.1 SMESG000019184.1 dd_Smed_v4_2113_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
parenchymal cellSMED30015813SMESG000019192.1 SMESG000019184.1 dd_Smed_v4_2113_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
muscle progenitor cellSMED30015813SMESG000019192.1 SMESG000019184.1 dd_Smed_v6_2113_0dd_Smed_v6PMID:29674432
Plass et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
glial cellSMED30015813SMESG000019192.1 SMESG000019184.1 dd_Smed_v6_2113_0dd_Smed_v6PMID:29674432
Plass et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
epidermisSMED30015813SMESG000019192.1 SMESG000019184.1 dd_Smed_v4_2113_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of slc3a-1 vs. Ensembl Human
Match: SLC3A2 (solute carrier family 3 member 2 [Source:HGNC Symbol;Acc:HGNC:11026])

HSP 1 Score: 84.7297 bits (208), Expect = 1.976e-16
Identity = 99/370 (26.76%), Postives = 159/370 (42.97%), Query Frame = 2
Query:  200 EFRGLTKEELEKFAKDPFWVKLRLILFILFWIVWATMLVAAILIVVFSKKCPKRPKLEFWQQKTGYWV-DPYAFVDTDQNLVGDFKGIMTKLDYIQKKVGAGYIILNPVFKGQYIKENQISEFVEIFRNVDPKLGSIESFKELVKDARKRGIEIXXXXXXXXXXXXXKFMADLNLKSDSVLTEIKESIKIWLNYGVRGFLFTNLGMYAENGTKPDRKCKNDSISSPYSTIDVQMLLKEIRKTMDEVAKSTDKSRLLIVDAGDVGLEVGKADPLLQYLGKKENLADMIISREFLKYRGWETNCGSKQSSISNYLSTVP--------SDKRKMVGLTSATLFSPRTNDLMKIVSPFLLEGNSILYYGSEINM 1282
            +F GL+KEEL K A  P WV+ R  L +LFW+ W  ML  A++I+V + +C + P  ++W     Y + D  AF     +  G+  G+  +LDY+      G ++L P+ K Q     Q          +DP  GS E F  L++ A+K+ I ++L +  N    +S F    + + D+V T++K++++ WL  GV GF   ++    EN                    D    L E +     + K   + RLLI       L+        Q L   E+  D++++  +L   G  +     +S ++ YL+           S  R +     A L   R   LM     F L G  +  YG EI +
Sbjct:  129 KFTGLSKEELLKVAGSPGWVRTRWALLLLFWLGWLGMLAGAVVIIVRAPRCRELPAQKWWHTGALYRIGDLQAF---QGHGAGNLAGLKGRLDYLSSLKVKG-LVLGPIHKNQKDDVAQTD-----LLQIDPNFGSKEDFDSLLQSAKKKSIRVILDLTPNYRGENSWF----STQVDTVATKVKDALEFWLQAGVDGFQVRDI----EN------------------LKDASSFLAEWQN----ITKGFSEDRLLIAGTNSSDLQ--------QILSLLESNKDLLLTSSYLSDSG--STGEHTKSLVTQYLNATGNRWCSWSLSQARLLTSFLPAQLL--RLYQLML----FTLPGTPVFSYGDEIGL 443          
BLAST of slc3a-1 vs. Ensembl Human
Match: SLC3A2 (solute carrier family 3 member 2 [Source:HGNC Symbol;Acc:HGNC:11026])

HSP 1 Score: 84.7297 bits (208), Expect = 2.067e-16
Identity = 99/370 (26.76%), Postives = 159/370 (42.97%), Query Frame = 2
Query:  200 EFRGLTKEELEKFAKDPFWVKLRLILFILFWIVWATMLVAAILIVVFSKKCPKRPKLEFWQQKTGYWV-DPYAFVDTDQNLVGDFKGIMTKLDYIQKKVGAGYIILNPVFKGQYIKENQISEFVEIFRNVDPKLGSIESFKELVKDARKRGIEIXXXXXXXXXXXXXKFMADLNLKSDSVLTEIKESIKIWLNYGVRGFLFTNLGMYAENGTKPDRKCKNDSISSPYSTIDVQMLLKEIRKTMDEVAKSTDKSRLLIVDAGDVGLEVGKADPLLQYLGKKENLADMIISREFLKYRGWETNCGSKQSSISNYLSTVP--------SDKRKMVGLTSATLFSPRTNDLMKIVSPFLLEGNSILYYGSEINM 1282
            +F GL+KEEL K A  P WV+ R  L +LFW+ W  ML  A++I+V + +C + P  ++W     Y + D  AF     +  G+  G+  +LDY+      G ++L P+ K Q     Q          +DP  GS E F  L++ A+K+ I ++L +  N    +S F    + + D+V T++K++++ WL  GV GF   ++    EN                    D    L E +     + K   + RLLI       L+        Q L   E+  D++++  +L   G  +     +S ++ YL+           S  R +     A L   R   LM     F L G  +  YG EI +
Sbjct:  160 KFTGLSKEELLKVAGSPGWVRTRWALLLLFWLGWLGMLAGAVVIIVRAPRCRELPAQKWWHTGALYRIGDLQAF---QGHGAGNLAGLKGRLDYLSSLKVKG-LVLGPIHKNQKDDVAQTD-----LLQIDPNFGSKEDFDSLLQSAKKKSIRVILDLTPNYRGENSWF----STQVDTVATKVKDALEFWLQAGVDGFQVRDI----EN------------------LKDASSFLAEWQN----ITKGFSEDRLLIAGTNSSDLQ--------QILSLLESNKDLLLTSSYLSDSG--STGEHTKSLVTQYLNATGNRWCSWSLSQARLLTSFLPAQLL--RLYQLML----FTLPGTPVFSYGDEIGL 474          
BLAST of slc3a-1 vs. Ensembl Human
Match: SLC3A2 (solute carrier family 3 member 2 [Source:HGNC Symbol;Acc:HGNC:11026])

HSP 1 Score: 84.7297 bits (208), Expect = 2.182e-16
Identity = 99/370 (26.76%), Postives = 159/370 (42.97%), Query Frame = 2
Query:  200 EFRGLTKEELEKFAKDPFWVKLRLILFILFWIVWATMLVAAILIVVFSKKCPKRPKLEFWQQKTGYWV-DPYAFVDTDQNLVGDFKGIMTKLDYIQKKVGAGYIILNPVFKGQYIKENQISEFVEIFRNVDPKLGSIESFKELVKDARKRGIEIXXXXXXXXXXXXXKFMADLNLKSDSVLTEIKESIKIWLNYGVRGFLFTNLGMYAENGTKPDRKCKNDSISSPYSTIDVQMLLKEIRKTMDEVAKSTDKSRLLIVDAGDVGLEVGKADPLLQYLGKKENLADMIISREFLKYRGWETNCGSKQSSISNYLSTVP--------SDKRKMVGLTSATLFSPRTNDLMKIVSPFLLEGNSILYYGSEINM 1282
            +F GL+KEEL K A  P WV+ R  L +LFW+ W  ML  A++I+V + +C + P  ++W     Y + D  AF     +  G+  G+  +LDY+      G ++L P+ K Q     Q          +DP  GS E F  L++ A+K+ I ++L +  N    +S F    + + D+V T++K++++ WL  GV GF   ++    EN                    D    L E +     + K   + RLLI       L+        Q L   E+  D++++  +L   G  +     +S ++ YL+           S  R +     A L   R   LM     F L G  +  YG EI +
Sbjct:  161 KFTGLSKEELLKVAGSPGWVRTRWALLLLFWLGWLGMLAGAVVIIVRAPRCRELPAQKWWHTGALYRIGDLQAF---QGHGAGNLAGLKGRLDYLSSLKVKG-LVLGPIHKNQKDDVAQTD-----LLQIDPNFGSKEDFDSLLQSAKKKSIRVILDLTPNYRGENSWF----STQVDTVATKVKDALEFWLQAGVDGFQVRDI----EN------------------LKDASSFLAEWQN----ITKGFSEDRLLIAGTNSSDLQ--------QILSLLESNKDLLLTSSYLSDSG--STGEHTKSLVTQYLNATGNRWCSWSLSQARLLTSFLPAQLL--RLYQLML----FTLPGTPVFSYGDEIGL 475          
BLAST of slc3a-1 vs. Ensembl Human
Match: SLC3A2 (solute carrier family 3 member 2 [Source:HGNC Symbol;Acc:HGNC:11026])

HSP 1 Score: 83.9593 bits (206), Expect = 2.287e-16
Identity = 102/382 (26.70%), Postives = 163/382 (42.67%), Query Frame = 2
Query:  200 EFRGLTKEELEKFAKDPFWVKLRLILFILFWIVWATMLVAAILIVVFSKKCPKRPKLEFWQQKTGYWV-DPYAFVDTDQNLVGDFKGIMTKLDYIQKKVGAGYIILNPVFKGQYIKENQISEFVEIFRNVDPKLGSIESFKELVKDARKRGIEIXXXXXXXXXXXXXKFMADLNLKSDSVLTEIKESIKIWLNYGVRGFLFTNLGMYAENGTKPDRKCKNDSISSPYSTIDVQMLLKEIRKTMDEVAKSTDKSRLLIVDAGDVGLEVGKADPLLQYLGKKENLADMIISREFLKYRGWETNCGSKQSSISNYLSTVP--------SDKRKMVGLTSATLFSPRTNDLMKIVSPFLLEGNSILYYGSEINMPCDGMDLSGSTL 1318
            +F GL+KEEL K A  P WV+ R  L +LFW+ W  ML  A++I+V + +C + P  ++W     Y + D  AF     +  G+  G+  +LDY+      G ++L P+ K Q     Q          +DP  GS E F  L++ A+K+ I ++L +  N    +S F    + + D+V T++K++++ WL  GV GF   ++    EN                    D    L E +     + K   + RLLI       L+        Q L   E+  D++++  +L   G  +     +S ++ YL+           S  R +     A L   R   LM     F L G  +  YG EI +  D   L G  +
Sbjct:   59 KFTGLSKEELLKVAGSPGWVRTRWALLLLFWLGWLGMLAGAVVIIVRAPRCRELPAQKWWHTGALYRIGDLQAF---QGHGAGNLAGLKGRLDYLSSLKVKG-LVLGPIHKNQKDDVAQTD-----LLQIDPNFGSKEDFDSLLQSAKKKSIRVILDLTPNYRGENSWF----STQVDTVATKVKDALEFWLQAGVDGFQVRDI----EN------------------LKDASSFLAEWQN----ITKGFSEDRLLIAGTNSSDLQ--------QILSLLESNKDLLLTSSYLSDSG--STGEHTKSLVTQYLNATGNRWCSWSLSQARLLTSFLPAQLL--RLYQLML----FTLPGTPVFSYGDEIGL--DAAALPGQPM 383          
BLAST of slc3a-1 vs. Ensembl Human
Match: SLC3A2 (solute carrier family 3 member 2 [Source:HGNC Symbol;Acc:HGNC:11026])

HSP 1 Score: 84.3445 bits (207), Expect = 2.408e-16
Identity = 102/382 (26.70%), Postives = 163/382 (42.67%), Query Frame = 2
Query:  200 EFRGLTKEELEKFAKDPFWVKLRLILFILFWIVWATMLVAAILIVVFSKKCPKRPKLEFWQQKTGYWV-DPYAFVDTDQNLVGDFKGIMTKLDYIQKKVGAGYIILNPVFKGQYIKENQISEFVEIFRNVDPKLGSIESFKELVKDARKRGIEIXXXXXXXXXXXXXKFMADLNLKSDSVLTEIKESIKIWLNYGVRGFLFTNLGMYAENGTKPDRKCKNDSISSPYSTIDVQMLLKEIRKTMDEVAKSTDKSRLLIVDAGDVGLEVGKADPLLQYLGKKENLADMIISREFLKYRGWETNCGSKQSSISNYLSTVP--------SDKRKMVGLTSATLFSPRTNDLMKIVSPFLLEGNSILYYGSEINMPCDGMDLSGSTL 1318
            +F GL+KEEL K A  P WV+ R  L +LFW+ W  ML  A++I+V + +C + P  ++W     Y + D  AF     +  G+  G+  +LDY+      G ++L P+ K Q     Q          +DP  GS E F  L++ A+K+ I ++L +  N    +S F    + + D+V T++K++++ WL  GV GF   ++    EN                    D    L E +     + K   + RLLI       L+        Q L   E+  D++++  +L   G  +     +S ++ YL+           S  R +     A L   R   LM     F L G  +  YG EI +  D   L G  +
Sbjct:   98 KFTGLSKEELLKVAGSPGWVRTRWALLLLFWLGWLGMLAGAVVIIVRAPRCRELPAQKWWHTGALYRIGDLQAF---QGHGAGNLAGLKGRLDYLSSLKVKG-LVLGPIHKNQKDDVAQTD-----LLQIDPNFGSKEDFDSLLQSAKKKSIRVILDLTPNYRGENSWF----STQVDTVATKVKDALEFWLQAGVDGFQVRDI----EN------------------LKDASSFLAEWQN----ITKGFSEDRLLIAGTNSSDLQ--------QILSLLESNKDLLLTSSYLSDSG--STGEHTKSLVTQYLNATGNRWCSWSLSQARLLTSFLPAQLL--RLYQLML----FTLPGTPVFSYGDEIGL--DAAALPGQPM 422          
BLAST of slc3a-1 vs. Ensembl Celegans
Match: atgp-1 (Amino acid Transporter GlycoProtein subunit [Source:UniProtKB/TrEMBL;Acc:Q9XVU3])

HSP 1 Score: 119.783 bits (299), Expect = 4.092e-28
Identity = 61/149 (40.94%), Postives = 87/149 (58.39%), Query Frame = 2
Query:  209 GLTKEELEKFAKDPFWVKLRLILFILFWIVWATMLVAAILIVVFSKKCPKRPKLEFWQQKTGYWVDPYAFVDTDQNLVGDFKGIMTKLDYIQKKVGAGYIILNPVFKGQYIKENQISEFVEIFRN-VDPKLGSIESFKELVKDARKRGI 652
            GLTKE+LEK+  DPFW  +R ILF+LFW+ W  M   AI IVV S KC ++ K ++WQ K  Y +    F D+D + VGDF GI  K+D++ +K+G   +   PV K    K+   + +  +  N VD + G+ E FKEL+     R +
Sbjct:   43 GLTKEQLEKYRNDPFWKPVRTILFVLFWLAWVLMFAGAIAIVVLSPKCAEKQKPDWWQTKVSYQLLTATFYDSDNDGVGDFAGISQKIDFL-RKIGVTTVYPTPVIKIH--KDEYFNSYDVVDHNSVDERFGTEEQFKELIDTVHNRAM 188          
BLAST of slc3a-1 vs. Ensembl Celegans
Match: atgp-2 (Amino acid Transporter GlycoProtein subunit [Source:UniProtKB/TrEMBL;Acc:G1K110])

HSP 1 Score: 83.5741 bits (205), Expect = 1.586e-16
Identity = 49/150 (32.67%), Postives = 81/150 (54.00%), Query Frame = 2
Query:  209 GLTKEELEKFAKDPFWVKLRLILFILFWIVWATMLVAAILIVVFSKKCPKRPKLEFWQQKTGYWVDPYAFVDTDQNLVGDFKGIMTKLDYIQKKVGAGYIILNPVFKGQYIKENQISEFVEIFRNVDPKLGSIESFKELVKDARKRGIEI 658
            GL+++ELE+F  DP W  +R +LF+LFW++W  +   AIL+V FS  C  R K  +WQ    Y V   +F D+D + VGD  G++ +LD ++K        +  V+   ++  +     V  F  +DPK+G  +   EL+    ++ + I
Sbjct:   78 GLSEQELEQFRNDPCWKFIRTVLFVLFWLIWLALFAVAILLVCFSPTCVLRAKPNWWQTAVAYHVWVPSFQDSDGDGVGDVDGLINRLDQLRKSG------VQTVWPSPFLISDDEKTAVRSFSQMDPKIGVNQKADELINKIHEKEMNI 221          
BLAST of slc3a-1 vs. Ensembl Celegans
Match: atgp-2 (Amino acid Transporter GlycoProtein subunit [Source:UniProtKB/TrEMBL;Acc:G1K110])

HSP 1 Score: 83.5741 bits (205), Expect = 1.595e-16
Identity = 49/150 (32.67%), Postives = 81/150 (54.00%), Query Frame = 2
Query:  209 GLTKEELEKFAKDPFWVKLRLILFILFWIVWATMLVAAILIVVFSKKCPKRPKLEFWQQKTGYWVDPYAFVDTDQNLVGDFKGIMTKLDYIQKKVGAGYIILNPVFKGQYIKENQISEFVEIFRNVDPKLGSIESFKELVKDARKRGIEI 658
            GL+++ELE+F  DP W  +R +LF+LFW++W  +   AIL+V FS  C  R K  +WQ    Y V   +F D+D + VGD  G++ +LD ++K        +  V+   ++  +     V  F  +DPK+G  +   EL+    ++ + I
Sbjct:   34 GLSEQELEQFRNDPCWKFIRTVLFVLFWLIWLALFAVAILLVCFSPTCVLRAKPNWWQTAVAYHVWVPSFQDSDGDGVGDVDGLINRLDQLRKSG------VQTVWPSPFLISDDEKTAVRSFSQMDPKIGVNQKADELINKIHEKEMNI 177          
BLAST of slc3a-1 vs. Ensembl Fly
Match: CD98hc (gene:FBgn0037533 transcript:FBtr0081824)

HSP 1 Score: 75.0998 bits (183), Expect = 8.481e-14
Identity = 30/61 (49.18%), Postives = 43/61 (70.49%), Query Frame = 2
Query:  203 FRGLTKEELEKFAKDPFWVKLRLILFILFWIVWATMLVAAILIVVFSKKCPKRPKLEFWQQ 385
            F G++KEEL K+A DPFWV+LR I F+ FW +W  MLV AILI++ + KC     L ++++
Sbjct:   60 FTGMSKEELMKYANDPFWVRLRWIFFVCFWAIWVGMLVGAILIIIGAPKCAAPQPLPWYKR 120          
BLAST of slc3a-1 vs. Ensembl Fly
Match: CD98hc (gene:FBgn0037533 transcript:FBtr0331342)

HSP 1 Score: 75.0998 bits (183), Expect = 8.481e-14
Identity = 30/61 (49.18%), Postives = 43/61 (70.49%), Query Frame = 2
Query:  203 FRGLTKEELEKFAKDPFWVKLRLILFILFWIVWATMLVAAILIVVFSKKCPKRPKLEFWQQ 385
            F G++KEEL K+A DPFWV+LR I F+ FW +W  MLV AILI++ + KC     L ++++
Sbjct:   60 FTGMSKEELMKYANDPFWVRLRWIFFVCFWAIWVGMLVGAILIIIGAPKCAAPQPLPWYKR 120          
BLAST of slc3a-1 vs. Ensembl Fly
Match: CD98hc (gene:FBgn0037533 transcript:FBtr0332157)

HSP 1 Score: 75.0998 bits (183), Expect = 8.481e-14
Identity = 30/61 (49.18%), Postives = 43/61 (70.49%), Query Frame = 2
Query:  203 FRGLTKEELEKFAKDPFWVKLRLILFILFWIVWATMLVAAILIVVFSKKCPKRPKLEFWQQ 385
            F G++KEEL K+A DPFWV+LR I F+ FW +W  MLV AILI++ + KC     L ++++
Sbjct:   60 FTGMSKEELMKYANDPFWVRLRWIFFVCFWAIWVGMLVGAILIIIGAPKCAAPQPLPWYKR 120          
BLAST of slc3a-1 vs. Ensembl Fly
Match: CD98hc (gene:FBgn0037533 transcript:FBtr0331344)

HSP 1 Score: 75.0998 bits (183), Expect = 8.515e-14
Identity = 30/61 (49.18%), Postives = 43/61 (70.49%), Query Frame = 2
Query:  203 FRGLTKEELEKFAKDPFWVKLRLILFILFWIVWATMLVAAILIVVFSKKCPKRPKLEFWQQ 385
            F G++KEEL K+A DPFWV+LR I F+ FW +W  MLV AILI++ + KC     L ++++
Sbjct:   60 FTGMSKEELMKYANDPFWVRLRWIFFVCFWAIWVGMLVGAILIIIGAPKCAAPQPLPWYKR 120          
BLAST of slc3a-1 vs. Ensembl Fly
Match: Mal-A6 (gene:FBgn0050360 transcript:FBtr0346647)

HSP 1 Score: 58.9214 bits (141), Expect = 1.163e-8
Identity = 30/99 (30.30%), Postives = 61/99 (61.62%), Query Frame = 2
Query:  371 EFWQQKTGYWVDPYAFVDTDQNLVGDFKGIMTKLDYIQKKVGAGYIILNPVFKGQYIKENQISEF---VEIFRNVDPKLGSIESFKELVKDARKRGIEI 658
            ++WQ    Y + P ++ D+D + +GD +GI++KLDY+ K++G     L+P++       + +++F   +  F ++ P+ G++  F EL+ +A+KR I+I
Sbjct:   42 DWWQVAQFYQIYPRSYKDSDGDGIGDLQGIISKLDYL-KEIGVTATWLSPIYS------SPMADFGYDISDFFDIQPEYGTLADFDELIAEAKKRNIKI 133          
BLAST of slc3a-1 vs. Ensembl Zebrafish
Match: si:dkey-202g17.3 (si:dkey-202g17.3 [Source:ZFIN;Acc:ZDB-GENE-131127-371])

HSP 1 Score: 95.9005 bits (237), Expect = 1.829e-20
Identity = 65/233 (27.90%), Postives = 112/233 (48.07%), Query Frame = 2
Query:  125 SDIENIPEVEFKSIKQDAEIVKKDDEFRGLTKEELEKFAKDPFWVKLRLILFILFWIVWATMLVAAILIVVFSKKCPKRPKLEFWQQKTGYWVDPYAFVDTDQNLVGDFKGIMTKLDYIQKKVGAGYIILNPVFKGQYIKENQISEFVEIFRNVDPKLGSIESFKELVKDARKRGIEIXXXXXXXXXXXXXKFMADLNL-----KSDSVL-----TEIKESIKIWLNYGVRGF 793
            +D+E    V   +         +   ++ L++EELE+ A  P W K R  L + FWI W  +L AA+LIV+ S +    P L +WQ+   Y + P  F+D D+        +  +L Y+ K VGAG +IL  +F G       ++E       +D  LG++    +L+ ++RK G+ ++L             + +L+L      +D+ +       I+ S++ WL++GV GF
Sbjct:   20 TDVEGSESVPLLTPGPPPPPPARRRAWKPLSREELERCAGGPQWRKFRRRLVLCFWICWMLLLGAAVLIVIRSPRA-TSPVLHWWQRDLIYRLQPMLFLDADRQQDSRINRVCERLPYL-KSVGAGAVILEGLF-GNSSSSTNLTE-------IDQNLGTLPQLTQLITESRKAGVRVILD------------LCELDLFEQESNNDTAVWSGASESIQYSLRYWLDHGVSGF 230          
BLAST of slc3a-1 vs. Ensembl Zebrafish
Match: slc3a2a (solute carrier family 3 member 2a [Source:ZFIN;Acc:ZDB-GENE-000831-3])

HSP 1 Score: 93.5893 bits (231), Expect = 1.143e-19
Identity = 72/242 (29.75%), Postives = 119/242 (49.17%), Query Frame = 2
Query:   89 EMNDVQKPLMKDS--DIENIPEVEFKSIKQDAEIVKKDDEFRGLTKEELEKFAKDPFWVKLRLILFILFWIVWATMLVAAILIVVFSKKCPKRPKLEFWQQKTGYWVDPYAFVDTDQNLVGDFKGIMTKLDYIQKKVGAGYIILNPVFKGQYIKENQISEFVEIFRNVDPKLGSIESFKELVKDARKRGIEIXXXXXXXXXXXXXKFMADLNLKSDSVLTEIKESIKIWLNYGVRGFLFTNL 808
            EM+  ++P+  ++    E    V+ K + +DAE+     +F GL+KEEL K A    WV+ R  L +LFW+ W  ML  AI+I+V + +C   P++ +W +   Y +      + D       KG+  KLDY+ +    G ++L PV   Q  + + +        +++P  GS      L+  A ++GI IVL +  N    SS F       + SV  ++K++   WLN GV G   ++L
Sbjct:   14 EMDQEKQPMTGETPTGTEKNGSVKVK-VPEDAEV-----KFTGLSKEELMKVAGTAGWVRTRWALLVLFWLGWVGMLAGAIVIIVQAPRCKPIPEMHWWNEGPLYQIS-----NLDAFSKNGLKGVEEKLDYLSQMKVKG-LVLGPVHSVQADQSSALE-----LTSINPDFGSESELTSLLDRAHRKGISIVLDLTPNYRGVSSWFN-----NAASVAEKLKKACVYWLNKGVDGIFLSDL 233          
BLAST of slc3a-1 vs. Ensembl Zebrafish
Match: slc3a2a (solute carrier family 3 member 2a [Source:ZFIN;Acc:ZDB-GENE-000831-3])

HSP 1 Score: 92.8189 bits (229), Expect = 2.044e-19
Identity = 72/242 (29.75%), Postives = 118/242 (48.76%), Query Frame = 2
Query:   89 EMNDVQKPLMKDS--DIENIPEVEFKSIKQDAEIVKKDDEFRGLTKEELEKFAKDPFWVKLRLILFILFWIVWATMLVAAILIVVFSKKCPKRPKLEFWQQKTGYWVDPYAFVDTDQNLVGDFKGIMTKLDYIQKKVGAGYIILNPVFKGQYIKENQISEFVEIFRNVDPKLGSIESFKELVKDARKRGIEIXXXXXXXXXXXXXKFMADLNLKSDSVLTEIKESIKIWLNYGVRGFLFTNL 808
            EM+  ++P+   +    E    V+ K + +DAE+     +F GL+KEEL K A    WV+ R  L +LFW+ W  ML  AI+I+V + +C   P++ +W +   Y +      + D       KG+  KLDY+ +    G ++L PV   Q  + + +        +++P  GS      L+  A ++GI IVL +  N    SS F       + SV  ++K++   WLN GV G   ++L
Sbjct:   14 EMDQEKQPMTGQTPTGTEKNGSVKVK-VPEDAEV-----KFTGLSKEELMKVAGTAGWVRTRWALLVLFWLGWVGMLAGAIVIIVQAPRCKPIPEMHWWNEGPLYQIS-----NLDAFSKNGLKGVEEKLDYLSQMKVKG-LVLGPVHSVQADQSSALE-----LTSINPDFGSESELTSLLDRAHRKGISIVLDLTPNYRGVSSWFN-----NAASVAEKLKKACVYWLNKGVDGIFLSDL 233          
BLAST of slc3a-1 vs. Ensembl Zebrafish
Match: slc3a2b (solute carrier family 3 member 2b [Source:ZFIN;Acc:ZDB-GENE-040122-2])

HSP 1 Score: 85.1149 bits (209), Expect = 6.059e-17
Identity = 75/245 (30.61%), Postives = 122/245 (49.80%), Query Frame = 2
Query:   83 DVEMNDVQ--KPLMKDSDIEN---IPEVEFKSIKQDAEIVKKDDEFRGLTKEELEKFAKDPFWVKLRLILFILFWIVWATMLVAAILIVVFSKKCPKRPKLEFWQQKTGYWV-DPYAFVDTDQNLVGDFKGIMTKLDYIQKKVGAGYIILNPVFKGQYIKENQISEFVEIFRNVDPKLGSIESFKELVKDARKRGIEIXXXXXXXXXXXXXKFMADLNLKSDSVLTEIKESIKIWLNYGVRGFLF 799
            DVE+N+V+  K  M + D  N   I  V  K+     +I  ++ +F GL+KEEL K A  P WV++R  L ILFW+ W  ML  AI I++ + +C   P++ +W     Y + D  AF  T+ + + D  G +  LD ++ K     +I+ P+      K N+++        +    G +  FKE++  A KRGI ++L +  N       F   +N      + +++ ++  WL  GV GFLF
Sbjct:   11 DVELNEVEQEKQPMTEGDAGNNYAISPVTEKNGIVKVKIPDEESKFTGLSKEELMKVAGTPGWVRVRWALLILFWLGWLGMLAGAIAIIIQAPRCKPLPEMNWWNNGPLYQIGDVGAF--TNSSDIKDLAGKVQALDDLKVK----GLIIGPIHVSSEDKPNELN-----LIKISEDDGVLAQFKEVITAAHKRGISVILDLTPNYKGKDPWFSDAVN-----TVQKVEPALIFWLKQGVDGFLF 239          
BLAST of slc3a-1 vs. Ensembl Zebrafish
Match: zgc:158423 (zgc:158423 [Source:ZFIN;Acc:ZDB-GENE-061215-58])

HSP 1 Score: 81.6481 bits (200), Expect = 6.715e-16
Identity = 64/235 (27.23%), Postives = 121/235 (51.49%), Query Frame = 2
Query:  146 EVEFKSIKQDAEIVKKDD-------------EFRGLTKEELEKFAKDPFWVKLRLILFILFWIVWATMLVAAILIVVFSKKCPKRPKLEFWQQKTGYWV-DPYAFVDTDQNLVGDFKGIMTKLDYIQKKVGAGYIILNPVFKGQYIKENQISEFVEIFRNVDPKLGSIESFKELVKDARKRGIEIXXXXXXXXXXXXXKFMADLNLKSDSVLTEIKESIKIWLNYGVRGFLFTNL 808
            ++E K + Q  +++ +++             ++ GL+K+EL K A  P W+++R  L  LF++ W  ML  AI+I+V + +C   P++ +W +   Y + D  AF ++        KG+  KLDY+ +   AG ++L P+     +K +Q+     I  +V  ++G+    + L+  A K+GI IVL++  N    S+ F        ++V  +IK++   WL+ G+ G   ++L
Sbjct:    3 DIELKEVDQTKQLMTRENGCVKVTVPENTAVKYTGLSKDELVKVAGTPGWIRIRWALLALFFLGWVGMLAGAIVIIVQAPRCKPIPEMHWWNEGPLYQISDVNAFTES------GLKGLEGKLDYLSQMNVAG-VVLGPI---HSLKIDQLDTLNLI--SVQSEVGTENELESLLGLAHKKGIFIVLNLTPNYNKTSAWFN-----NFNAVAEKIKDACTYWLDKGLDGIFLSDL 220          
BLAST of slc3a-1 vs. Ensembl Xenopus
Match: SLC3A2 (solute carrier family 3 (amino acid transporter heavy chain), member 2 [Source:NCBI gene;Acc:493209])

HSP 1 Score: 106.301 bits (264), Expect = 1.851e-23
Identity = 73/214 (34.11%), Postives = 115/214 (53.74%), Query Frame = 2
Query:  164 IKQDAEIVKKDDEFRGLTKEELEKFAKDPFWVKLRLILFILFWIVWATMLVAAILIVVFSKKCPKRPKLEFWQQKTGYWV-DPYAFVDTDQNLVGDFKGIMTKLDYIQKKVGAGYIILNPVFKGQYIKENQISEFVEIFRNVDPKLGSIESFKELVKDARKRGIEIXXXXXXXXXXXXXKF-MADLNLKSDSVLTEIKESIKIWLNYGVRGFLF 799
            ++ D  I  K  +F GL+KEEL + A  P WV++R  L ILFW+ WA ML  A++I+V + +C   P +E+W +   Y V DP  F    ++  G+ + I  +L+ +      G II  P+      K+++I +   I  ++DP  G+ E F  L++ ARK+ I+I+L +  N  S  S F   D+N + +     +KE+I  WL  GV G  F
Sbjct:   46 LEDDDAIGTKSQKFTGLSKEELLRVAGTPAWVRVRWALLILFWLGWAGMLAGAVVIIVQAPRCQPLPAMEWWNKGPLYQVGDPATF---QEDGAGNIQSIEKRLESLTSLKIKGLII-GPI---HATKKDEIDK--TILTDIDPNYGTQEQFTSLLEAARKKSIQIILDLTPNYRSEKSWFEKTDINFEDN-----VKEAINTWLERGVGGIYF 245          
BLAST of slc3a-1 vs. Ensembl Mouse
Match: Slc3a2 (solute carrier family 3 (activators of dibasic and neutral amino acid transport), member 2 [Source:MGI Symbol;Acc:MGI:96955])

HSP 1 Score: 97.4413 bits (241), Expect = 1.184e-20
Identity = 83/250 (33.20%), Postives = 133/250 (53.20%), Query Frame = 2
Query:   83 DVEMNDVQ--KPLMKDSDIENIPE----VEFKSIKQDAEIVKKDDEFRGLTKEELEKFAKDPFWVKLRLILFILFWIVWATMLVAAILIVVFSKKCPKRPKLEFWQQKTGYWV-DPYAFVDTDQNLVGDFKGIMTKLDYIQKKVGAGYIILNPVFKGQYIKENQISEFVEIFRNVDPKLGSIESFKELVKDARKRGIEIXXXXXXXXXXXXXKFMADLNLKSDSVLTEIKESIKIWLNYGVRGFLFTNLG 811
            DVE+N+++  K  M  +D     E    V+ K  + + E   K   F GL+KEEL K A  P WV+ R  L +LFW+ W  ML  A++I+V + +C + P   +W +   Y + D  AFV  D    G   G+ + L+Y+      G ++L P+ K Q  + N+        + ++P LGS E FK+L++ A+K+ I I+L +  N    ++ F   L  ++D V T++KE++  WL  GV GF F ++G
Sbjct:   50 DVELNELEPEKQPMNAADGAAAGEKNGLVKIKVAEDETEAGVK---FTGLSKEELLKVAGSPGWVRTRWALLLLFWLGWLGMLAGAVVIIVRAPRCRELPVQRWWHKGALYRIGDLQAFVGRD---AGGIAGLKSHLEYLSTLKVKG-LVLGPIHKNQKDEINETD-----LKQINPTLGSQEDFKDLLQSAKKKSIHIILDLTPNYQGQNAWF---LPAQADIVATKMKEALSSWLQDGVDGFQFRDVG 284          
BLAST of slc3a-1 vs. Ensembl Mouse
Match: Slc3a2 (solute carrier family 3 (activators of dibasic and neutral amino acid transport), member 2 [Source:MGI Symbol;Acc:MGI:96955])

HSP 1 Score: 96.6709 bits (239), Expect = 1.354e-20
Identity = 83/250 (33.20%), Postives = 133/250 (53.20%), Query Frame = 2
Query:   83 DVEMNDVQ--KPLMKDSDIENIPE----VEFKSIKQDAEIVKKDDEFRGLTKEELEKFAKDPFWVKLRLILFILFWIVWATMLVAAILIVVFSKKCPKRPKLEFWQQKTGYWV-DPYAFVDTDQNLVGDFKGIMTKLDYIQKKVGAGYIILNPVFKGQYIKENQISEFVEIFRNVDPKLGSIESFKELVKDARKRGIEIXXXXXXXXXXXXXKFMADLNLKSDSVLTEIKESIKIWLNYGVRGFLFTNLG 811
            DVE+N+++  K  M  +D     E    V+ K  + + E   K   F GL+KEEL K A  P WV+ R  L +LFW+ W  ML  A++I+V + +C + P   +W +   Y + D  AFV  D    G   G+ + L+Y+      G ++L P+ K Q  + N+        + ++P LGS E FK+L++ A+K+ I I+L +  N    ++ F   L  ++D V T++KE++  WL  GV GF F ++G
Sbjct:   11 DVELNELEPEKQPMNAADGAAAGEKNGLVKIKVAEDETEAGVK---FTGLSKEELLKVAGSPGWVRTRWALLLLFWLGWLGMLAGAVVIIVRAPRCRELPVQRWWHKGALYRIGDLQAFVGRD---AGGIAGLKSHLEYLSTLKVKG-LVLGPIHKNQKDEINETD-----LKQINPTLGSQEDFKDLLQSAKKKSIHIILDLTPNYQGQNAWF---LPAQADIVATKMKEALSSWLQDGVDGFQFRDVG 245          
BLAST of slc3a-1 vs. Ensembl Mouse
Match: Slc3a2 (solute carrier family 3 (activators of dibasic and neutral amino acid transport), member 2 [Source:MGI Symbol;Acc:MGI:96955])

HSP 1 Score: 82.0333 bits (201), Expect = 4.365e-17
Identity = 76/236 (32.20%), Postives = 124/236 (52.54%), Query Frame = 2
Query:   83 DVEMNDVQ--KPLMKDSDIENIPE----VEFKSIKQDAEIVKKDDEFRGLTKEELEKFAKDPFWVKLRLILFILFWIVWATMLVAAILIVVFSKKCPKRPKLEFWQQKTGYWV-DPYAFVDTDQNLVGDFKGIMTKLDYIQKKVGAGYIILNPVFKGQYIKENQISEFVEIFRNVDPKLGSIESFKELVKDARKRGIEIXXXXXXXXXXXXXKFMADLNLKSDSVLTEIKESIKIW 769
            DVE+N+++  K  M  +D     E    V+ K  + + E   K   F GL+KEEL K A  P WV+ R  L +LFW+ W  ML  A++I+V + +C + P   +W +   Y + D  AFV  D    G   G+ + L+Y+      G ++L P+ K Q  + N+        + ++P LGS E FK+L++ A+K+ I I+L +  N    ++ F   L  ++D V T++KE++  W
Sbjct:   11 DVELNELEPEKQPMNAADGAAAGEKNGLVKIKVAEDETEAGVK---FTGLSKEELLKVAGSPGWVRTRWALLLLFWLGWLGMLAGAVVIIVRAPRCRELPVQRWWHKGALYRIGDLQAFVGRD---AGGIAGLKSHLEYLSTLKVKG-LVLGPIHKNQKDEINETD-----LKQINPTLGSQEDFKDLLQSAKKKSIHIILDLTPNYQGQNAWF---LPAQADIVATKMKEALSSW 231          
BLAST of slc3a-1 vs. Ensembl Mouse
Match: Slc3a1 (solute carrier family 3, member 1 [Source:MGI Symbol;Acc:MGI:1195264])

HSP 1 Score: 67.3958 bits (163), Expect = 3.345e-11
Identity = 47/155 (30.32%), Postives = 83/155 (53.55%), Query Frame = 2
Query:  203 FRGLTKEELEKFAKDPFWVKLRLILFILFWIVWATMLV---AAILIVVFSKKCPKRPKLEFWQQKTGYWVDPYAFVDTDQNLVGDFKGIMTKLDYIQKKVGAGYIILNPVFKGQYIKENQISEFVEIFRNVDPKLGSIESFKELVKDARKRGIEI 658
            + G+ KE L +F+      + R+   ILFW+   ++ +   A I I+V S KC     L++WQ    Y + P +F D+D++  GD KGI  KLDYI   +    + +   +K   +K+ + +  VE F+ +DP  G+++ F+ LV     +G+++
Sbjct:   64 YAGMPKEVLFQFSGQ---ARYRVPREILFWLTVVSVFLLIGATIAIIVISPKC-----LDWWQAGPIYQIYPRSFKDSDKDGNGDLKGIQEKLDYI-TALNIKTLWITSFYKSS-LKDFRYA--VEDFKEIDPIFGTMKDFENLVAAIHDKGLKL 206          
BLAST of slc3a-1 vs. UniProt/SwissProt
Match: sp|Q7YQK3|4F2_RABIT (4F2 cell-surface antigen heavy chain OS=Oryctolagus cuniculus OX=9986 GN=SLC3A2 PE=1 SV=2)

HSP 1 Score: 109.768 bits (273), Expect = 6.821e-24
Identity = 99/371 (26.68%), Postives = 166/371 (44.74%), Query Frame = 2
Query:  200 EFRGLTKEELEKFAKDPFWVKLRLILFILFWIVWATMLVAAILIVVFSKKCPKRPKLEFWQQKTGYWV-DPYAFVDTDQNLVGDFKGIMTKLDYIQKKVGAGYIILNPVFKGQYIKENQISEFVEIFRNVDPKLGSIESFKELVKDARKRGIEIXXXXXXXXXXXXXKFMADLNLKSDSVLTEIKESIKIWLNYGVRGFLFTNLGMYAENGTKPDRKCKNDSISSPYSTIDVQMLLKEIRKTMDEVAKSTDKSRLLIVDAGDVGLEVGKADPLLQYLGKKENLADMIISREFLKYRGWETNCGSKQSSISNYLSTVPSD----KRKMVGLTSATLFSPRTNDLMKIVSPFLLEGNSILYYGSEINMPCDGM 1297
            +F GL+KEEL K A  P WV+ R  L +LFW+ W  ML  A++I+V + +C + P   +W +   Y V D  AF   D    GD  G+   LDY+      G ++L P+ K Q   E+ ++      + ++P +GS E F   ++ A+K+ I ++L +  N L  +S F   L  + D V T++K+++  WL  GV GF   ++G                      +  +  + L E R     + KS  + RLLI           ++  L Q L   E+  D++++  +L   G   +  + +  ++ YL+   S          GL ++  F P     +  +  F L G  +  YG EI +    +
Sbjct:   60 KFTGLSKEELLKVAGSPGWVRTRWALLLLFWLGWIGMLAGAVVIIVRAPRCRELPVQRWWHKGALYRVGDLQAFQARDS---GDLAGLKGHLDYLSTLKVKG-LVLGPIHKNQ---EDDVAG--TNLQEINPAVGSKEEFDSFLQSAKKKSIRVILDLTPNYLGQNSWF---LPTQVDLVATKVKDALNFWLQAGVDGFQVRDVG----------------------NLTNAALHLAEWRN----ITKSFSEDRLLIAGT--------ESSDLHQILSLLESTKDLLLTSSYLSASG--VSGENMKFLVTQYLNATDSHWCSWSLSQAGLLTS--FVPAQLLRLYQLLLFTLPGTPVFSYGDEIGLQAAAL 380          
BLAST of slc3a-1 vs. UniProt/SwissProt
Match: sp|P10852|4F2_MOUSE (4F2 cell-surface antigen heavy chain OS=Mus musculus OX=10090 GN=Slc3a2 PE=1 SV=1)

HSP 1 Score: 96.6709 bits (239), Expect = 9.472e-20
Identity = 83/250 (33.20%), Postives = 133/250 (53.20%), Query Frame = 2
Query:   83 DVEMNDVQ--KPLMKDSDIENIPE----VEFKSIKQDAEIVKKDDEFRGLTKEELEKFAKDPFWVKLRLILFILFWIVWATMLVAAILIVVFSKKCPKRPKLEFWQQKTGYWV-DPYAFVDTDQNLVGDFKGIMTKLDYIQKKVGAGYIILNPVFKGQYIKENQISEFVEIFRNVDPKLGSIESFKELVKDARKRGIEIXXXXXXXXXXXXXKFMADLNLKSDSVLTEIKESIKIWLNYGVRGFLFTNLG 811
            DVE+N+++  K  M  +D     E    V+ K  + + E   K   F GL+KEEL K A  P WV+ R  L +LFW+ W  ML  A++I+V + +C + P   +W +   Y + D  AFV  D    G   G+ + L+Y+      G ++L P+ K Q  + N+        + ++P LGS E FK+L++ A+K+ I I+L +  N    ++ F   L  ++D V T++KE++  WL  GV GF F ++G
Sbjct:   11 DVELNELEPEKQPMNAADGAAAGEKNGLVKIKVAEDETEAGVK---FTGLSKEELLKVAGSPGWVRTRWALLLLFWLGWLGMLAGAVVIIVRAPRCRELPVQRWWHKGALYRIGDLQAFVGRD---AGGIAGLKSHLEYLSTLKVKG-LVLGPIHKNQKDEINETD-----LKQINPTLGSQEDFKDLLQSAKKKSIHIILDLTPNYQGQNAWF---LPAQADIVATKMKEALSSWLQDGVDGFQFRDVG 245          
BLAST of slc3a-1 vs. UniProt/SwissProt
Match: sp|Q794F9|4F2_RAT (4F2 cell-surface antigen heavy chain OS=Rattus norvegicus OX=10116 GN=Slc3a2 PE=1 SV=1)

HSP 1 Score: 92.8189 bits (229), Expect = 1.739e-18
Identity = 81/253 (32.02%), Postives = 132/253 (52.17%), Query Frame = 2
Query:   83 DVEMNDVQ--KPLMKDSDIENIPE----VEFKSIKQDAEIVKKDDEFRGLTKEELEKFAKDPFWVKLRLILFILFWIVWATMLVAAILIVVFSKKCPKRPKLEFWQQKTGYWV-DPYAFVDTDQNLVGDFKGIMTKLDYIQKKVGAGYIILNPVFKGQYIKENQISEFVEIFRNVDPKLGSIESFKELVKDARKRGIEIXXXXXXXXXXXXXKFMADLNLKSDSVLTEIKESIKIWLNYGVRGFLFTNLGMYA 820
            DVE+N+++  K  M  +D     E    V+ K  + +AE   K   F GL+KEEL K A  P WV+ R  L +LFW+ W  ML  A++I+V + +C + P   +W +   Y + D  AFV  +   +   K  +  L  ++ K     ++L P+ K Q  + N+        + +DP LGS E FK+L++ A+K+ I I+L +  N    ++ F+     ++D V T++KE++  WL  GV GF   ++G  A
Sbjct:   11 DVELNELEPEKQPMNAADGAAAGEKNGLVKIKVAEDEAEAGVK---FTGLSKEELLKVAGSPGWVRTRWALLLLFWLGWLGMLAGAVVIIVRAPRCRELPVQRWWHKGALYRIGDLQAFVGPEARGIAGLKNHLEYLSTLKVK----GLVLGPIHKNQKDEVNETD-----LKQIDPDLGSQEDFKDLLQSAKKKSIHIILDLTPNYKGQNAWFLPP---QADIVATKMKEALSSWLQDGVDGFQVRDVGKLA 248          
BLAST of slc3a-1 vs. UniProt/SwissProt
Match: sp|P08195|4F2_HUMAN (4F2 cell-surface antigen heavy chain OS=Homo sapiens OX=9606 GN=SLC3A2 PE=1 SV=3)

HSP 1 Score: 84.7297 bits (208), Expect = 9.927e-16
Identity = 99/370 (26.76%), Postives = 159/370 (42.97%), Query Frame = 2
Query:  200 EFRGLTKEELEKFAKDPFWVKLRLILFILFWIVWATMLVAAILIVVFSKKCPKRPKLEFWQQKTGYWV-DPYAFVDTDQNLVGDFKGIMTKLDYIQKKVGAGYIILNPVFKGQYIKENQISEFVEIFRNVDPKLGSIESFKELVKDARKRGIEIXXXXXXXXXXXXXKFMADLNLKSDSVLTEIKESIKIWLNYGVRGFLFTNLGMYAENGTKPDRKCKNDSISSPYSTIDVQMLLKEIRKTMDEVAKSTDKSRLLIVDAGDVGLEVGKADPLLQYLGKKENLADMIISREFLKYRGWETNCGSKQSSISNYLSTVP--------SDKRKMVGLTSATLFSPRTNDLMKIVSPFLLEGNSILYYGSEINM 1282
            +F GL+KEEL K A  P WV+ R  L +LFW+ W  ML  A++I+V + +C + P  ++W     Y + D  AF     +  G+  G+  +LDY+      G ++L P+ K Q     Q          +DP  GS E F  L++ A+K+ I ++L +  N    +S F    + + D+V T++K++++ WL  GV GF   ++    EN                    D    L E +     + K   + RLLI       L+        Q L   E+  D++++  +L   G  +     +S ++ YL+           S  R +     A L   R   LM     F L G  +  YG EI +
Sbjct:  160 KFTGLSKEELLKVAGSPGWVRTRWALLLLFWLGWLGMLAGAVVIIVRAPRCRELPAQKWWHTGALYRIGDLQAF---QGHGAGNLAGLKGRLDYLSSLKVKG-LVLGPIHKNQKDDVAQTD-----LLQIDPNFGSKEDFDSLLQSAKKKSIRVILDLTPNYRGENSWF----STQVDTVATKVKDALEFWLQAGVDGFQVRDI----EN------------------LKDASSFLAEWQN----ITKGFSEDRLLIAGTNSSDLQ--------QILSLLESNKDLLLTSSYLSDSG--STGEHTKSLVTQYLNATGNRWCSWSLSQARLLTSFLPAQLL--RLYQLML----FTLPGTPVFSYGDEIGL 474          
BLAST of slc3a-1 vs. UniProt/SwissProt
Match: sp|Q07837|SLC31_HUMAN (Neutral and basic amino acid transport protein rBAT OS=Homo sapiens OX=9606 GN=SLC3A1 PE=1 SV=2)

HSP 1 Score: 67.781 bits (164), Expect = 2.003e-10
Identity = 48/155 (30.97%), Postives = 81/155 (52.26%), Query Frame = 2
Query:  203 FRGLTKEELEKFAKDPFWVKLRLILFILFWIVWATMLVAAILIVVFSKKCPKRPKLEFWQQKTGYWVDPYAFVDTDQNLVGDFKGIMTKLDYIQKKVGAGYIILNPVFKGQYIKENQISEF---VEIFRNVDPKLGSIESFKELVKDARKRGIEI 658
            + G+ KE L +F+      + R+   ILFW+  A++LV     +      PK   L++WQ+   Y + P +F D++++  GD KGI  KLDYI        + +  V+   + K + + +F   VE FR VDP  G++E F+ LV     +G+++
Sbjct:   65 YAGMPKEVLFQFSGQ---ARYRIPREILFWLTVASVLVLIAATIAIIALSPK--CLDWWQEGPMYQIYPRSFKDSNKDGNGDLKGIQDKLDYITA------LNIKTVWITSFYKSS-LKDFRYGVEDFREVDPIFGTMEDFENLVAAIHDKGLKL 207          
BLAST of slc3a-1 vs. TrEMBL
Match: A0A0H3YIT3 (Slc3a-1 OS=Schmidtea mediterranea OX=79327 GN=slc3a-1 PE=2 SV=1)

HSP 1 Score: 1165.98 bits (3015), Expect = 0.000e+0
Identity = 583/583 (100.00%), Postives = 583/583 (100.00%), Query Frame = 2
Query:   74 MANDVEMNDVQKPLMKDSDIENIPEVEFKSIKQDAEIVKKDDEFRGLTKEELEKFAKDPFWVKLRLILFILFWIVWATMLVAAILIVVFSKKCPKRPKLEFWQQKTGYWVDPYAFVDTDQNLVGDFKGIMTKLDYIQKKVGAGYIILNPVFKGQYIKENQISEFVEIFRNVDPKLGSIESFKELVKDARKRGIEIXXXXXXXXXXXXXKFMADLNLKSDSVLTEIKESIKIWLNYGVRGFLFTNLGMYAENGTKPDRKCKNDSISSPYSTIDVQMLLKEIRKTMDEVAKSTDKSRLLIVDAGDVGLEVGKADPLLQYLGKKENLADMIISREFLKYRGWETNCGSKQSSISNYLSTVPSDKRKMVGLTSATLFSPRTNDLMKIVSPFLLEGNSILYYGSEINMPCDGMDLSGSTLYPVNSKSPNNCNHMIMPWDNNGDEFSGGKLNQSQYLSQYKDTVQSLTATGTGENILKLHGRLIKIRNEPSLLWGKTKLIQSQKTSNYSHNIFTRQADGFPIIVVALLIDSTAEKPGKVFSFKSICEKFTPILVYPSNENLEENKEVDTKNVFLKTVTTGSVHVFKCAE 1822
            MANDVEMNDVQKPLMKDSDIENIPEVEFKSIKQDAEIVKKDDEFRGLTKEELEKFAKDPFWVKLRLILFILFWIVWATMLVAAILIVVFSKKCPKRPKLEFWQQKTGYWVDPYAFVDTDQNLVGDFKGIMTKLDYIQKKVGAGYIILNPVFKGQYIKENQISEFVEIFRNVDPKLGSIESFKELVKDARKRGIEIVLSVDLNSLSNSSKFMADLNLKSDSVLTEIKESIKIWLNYGVRGFLFTNLGMYAENGTKPDRKCKNDSISSPYSTIDVQMLLKEIRKTMDEVAKSTDKSRLLIVDAGDVGLEVGKADPLLQYLGKKENLADMIISREFLKYRGWETNCGSKQSSISNYLSTVPSDKRKMVGLTSATLFSPRTNDLMKIVSPFLLEGNSILYYGSEINMPCDGMDLSGSTLYPVNSKSPNNCNHMIMPWDNNGDEFSGGKLNQSQYLSQYKDTVQSLTATGTGENILKLHGRLIKIRNEPSLLWGKTKLIQSQKTSNYSHNIFTRQADGFPIIVVALLIDSTAEKPGKVFSFKSICEKFTPILVYPSNENLEENKEVDTKNVFLKTVTTGSVHVFKCAE
Sbjct:    1 MANDVEMNDVQKPLMKDSDIENIPEVEFKSIKQDAEIVKKDDEFRGLTKEELEKFAKDPFWVKLRLILFILFWIVWATMLVAAILIVVFSKKCPKRPKLEFWQQKTGYWVDPYAFVDTDQNLVGDFKGIMTKLDYIQKKVGAGYIILNPVFKGQYIKENQISEFVEIFRNVDPKLGSIESFKELVKDARKRGIEIVLSVDLNSLSNSSKFMADLNLKSDSVLTEIKESIKIWLNYGVRGFLFTNLGMYAENGTKPDRKCKNDSISSPYSTIDVQMLLKEIRKTMDEVAKSTDKSRLLIVDAGDVGLEVGKADPLLQYLGKKENLADMIISREFLKYRGWETNCGSKQSSISNYLSTVPSDKRKMVGLTSATLFSPRTNDLMKIVSPFLLEGNSILYYGSEINMPCDGMDLSGSTLYPVNSKSPNNCNHMIMPWDNNGDEFSGGKLNQSQYLSQYKDTVQSLTATGTGENILKLHGRLIKIRNEPSLLWGKTKLIQSQKTSNYSHNIFTRQADGFPIIVVALLIDSTAEKPGKVFSFKSICEKFTPILVYPSNENLEENKEVDTKNVFLKTVTTGSVHVFKCAE 583          
BLAST of slc3a-1 vs. TrEMBL
Match: C1LL83 (Alpha-glucosidase OS=Schistosoma japonicum OX=6182 PE=2 SV=1)

HSP 1 Score: 355.525 bits (911), Expect = 2.560e-110
Identity = 214/611 (35.02%), Postives = 338/611 (55.32%), Query Frame = 2
Query:  185 VKKDDEFRGLTKEELEKF-AKDPFWVKLRLILFILFWIVWATMLVAAILIVVFSKKCPKRPKLEFWQQKTGYWVDPYAFVDTDQNLVGDFKGIMTKLDYIQKKVGAGYIILNPVFKGQYIKENQISEFVEIFRNVDPKLGSIESFKELVKDARKRGIEIXXXXXXXXXXXXXKF--------------------------------------MADLNLKSDSVLTEIKESIKIWLNYGVRGFLFTNLGMYAENGTK---PDRKCKNDSISSPYSTIDVQM-----LLKEIRKTMDEVAKSTDKSRLLIVDAGDVGLEVGKADPL-LQYLGKKEN-LADMIISREFLKYRGWET---NCGSKQSSISNYLSTVPSDKRKMVGLTSATLFSPRTNDLMKIVSPFLLEGNSILYYGSEINMPCDGMDLSGSTLYPVNSKSPNN--------CNHMIMPWDNNGDEFSGGKLNQS---QYLSQY--KDTVQSLTATGTGENILKLHGRLIKIRNEPSLLWGKTKLIQSQK-TSNYSHNIFTRQADGFPIIVVALLIDSTAEKPGKVFSFKSICEKFTPILVYPSNENLEENKEVDTKNVFLKTVTTGSVHVFKCA 1819
            V + D +  LT+E+L +  +K+PFW +LR  LFILFW+VW  +L+AAILI+VF+ KCP RP L FW+  TGYWV+P+A+ D+  + +GD KG+  +LDYI+  +GAG+I+L+ +F GQY  + +    V+ + NVDP LG++E FK LV+   K GI ++L++D NS+S    +                                        DLNL+    L  I +  K WLN G+ G L  N+  Y ENGT+   P  K       S Y T  + +     ++++IRK +DE+++S+ K +LL VDAG+ G  VGK++ + +Q+LG K++  A +++SR+F+K+RGW+    +    +++I  Y     SD+  M  LT+ +    R +DL+ + +  LL G  +LYYGSE+N   + ++ +G   YP + K+            + + MPWD  G  FS    N +   +YL ++  ++TV+S T++G G     L   LI IR   SLLWG  +L++S   T      IF R+A+GFP  ++ L  +         F+F S+C    P ++YP+N+N   ++EV ++ V+L +     V+VFKCA
Sbjct:   33 VGQKDTYCLLTREDLMQLDSKEPFWYRLRWGLFILFWVVWVGLLLAAILIIVFTPKCPPRPVLPFWRSTTGYWVNPFAYEDSSNDKIGDLKGLAKRLDYIKGTIGAGFIVLSSIFSGQYTNDLKTLGLVDDYFNVDPALGTMEDFKNLVRSCHKNGIYLILTMDFNSVSAKHPWTEFTYLLEPYSSKKVSRLGGDARTVIQGVSYYSVFGSHFVDLNLRETGALDRIADVAKFWLNEGIDGILLDNVAFYIENGTESGAPITKELGSQWFSKYPTSQIYISESVEVVRKIRKVVDEMSESSGKPKLLAVDAGNTGYGVGKSEDISMQFLGTKDSPAAHVVVSRQFVKHRGWKAPPIDPEEIKNNIFTYDMLSVSDRNSM-ALTTVSTSDSRQSDLVALAATVLLPGTCLLYYGSELNEGTENVNFTGD-FYPFDEKTIFTGSKETDVLLSQLAMPWDQAGVGFSPALTNSTSFTEYLKRFGLRETVESATSSGRGATPFSLVQDLIAIRRNESLLWGDFRLLKSSLITEELKFQIFERKAEGFPAFIIVLRNEPNVAS--GTFNFSSVCSNIIPKIIYPANKNFPIDQEVSSQRVYLHSSGEPMVYVFKCA 639          
BLAST of slc3a-1 vs. TrEMBL
Match: C1LL84 (Alpha-glucosidase OS=Schistosoma japonicum OX=6182 PE=2 SV=1)

HSP 1 Score: 355.525 bits (911), Expect = 2.940e-110
Identity = 214/611 (35.02%), Postives = 337/611 (55.16%), Query Frame = 2
Query:  185 VKKDDEFRGLTKEELEKF-AKDPFWVKLRLILFILFWIVWATMLVAAILIVVFSKKCPKRPKLEFWQQKTGYWVDPYAFVDTDQNLVGDFKGIMTKLDYIQKKVGAGYIILNPVFKGQYIKENQISEFVEIFRNVDPKLGSIESFKELVKDARKRGIEIXXXXXXXXXXXXXKF--------------------------------------MADLNLKSDSVLTEIKESIKIWLNYGVRGFLFTNLGMYAENGTK---PDRKCKNDSISSPYSTIDVQM-----LLKEIRKTMDEVAKSTDKSRLLIVDAGDVGLEVGKADPL-LQYLGKKEN-LADMIISREFLKYRGWET---NCGSKQSSISNYLSTVPSDKRKMVGLTSATLFSPRTNDLMKIVSPFLLEGNSILYYGSEINMPCDGMDLSGSTLYPVNSKSPNN--------CNHMIMPWDNNGDEFSGGKLNQS---QYLSQY--KDTVQSLTATGTGENILKLHGRLIKIRNEPSLLWGKTKLIQSQK-TSNYSHNIFTRQADGFPIIVVALLIDSTAEKPGKVFSFKSICEKFTPILVYPSNENLEENKEVDTKNVFLKTVTTGSVHVFKCA 1819
            V + D +  LT+E+L +  +K+PFW +LR  LFILFW+VW  +L+AAILI+VF+ KCP RP L FW+  TGYWV+P+A+ D+  + +GD KG+  +LDYI+  +GAG+I+L+ +F GQY  + +    V+ + NVDP LG++E FK LV+   K GI ++L++D NS+S    +                                        DLNL+    L  I +  K WLN G+ G L  N+  Y ENGT+   P  K       S Y T  + +     ++++IRK +DE+++S+ K +LL VDAG+ G  VGK++ + +Q+LG K++  A +++SR+F+K+RGW+    +    +++I  Y     SD+  M  LT+ +    R +DL+ + +  LL G  +LYYGSE+N   + ++ +G   YP + K+            + + MPWD  G  FS    N +   +YL ++  ++TV+S T++G G     L   LI IR   SLLWG  +L++S   T      IF R+A+GFP  ++ L  +         F F S+C    P ++YP+N+N   ++EV ++ V+L +     V+VFKCA
Sbjct:   33 VGQKDTYCLLTREDLMQLDSKEPFWYRLRWGLFILFWVVWVGLLLAAILIIVFTPKCPPRPVLPFWRSTTGYWVNPFAYEDSSNDKIGDLKGLAKRLDYIKGTIGAGFIVLSSIFSGQYTNDLKTLGLVDDYFNVDPALGTMEDFKNLVRSCHKNGIYLILTMDFNSVSAKHPWTEFTYLLEPYSSKKVSRLGGDARTVIQGVSYYSVFGSHFVDLNLRETGALDRIADVAKFWLNEGIDGILLDNVAFYIENGTESGAPITKELGSQWFSKYPTSQIYISESVEVVRKIRKVVDEMSESSGKPKLLAVDAGNTGYGVGKSEDISMQFLGTKDSPAAHVVVSRQFVKHRGWKAPPIDPEEIKNNIFTYDMLSVSDRNSM-ALTTVSTSDSRQSDLVALAATVLLPGTCLLYYGSELNEGTENVNFTGD-FYPFDEKTIFTGSKETDVLLSQLAMPWDQAGVGFSPALTNSTSFTEYLKRFGLRETVESATSSGRGATPFSLVQDLIAIRRNESLLWGDFRLLKSSLITEELKFQIFERKAEGFPAFIIVLRNEPNVAS--GTFDFSSVCSNIIPKIIYPANKNFPIDQEVSSQRVYLHSSGEPMVYVFKCA 639          
BLAST of slc3a-1 vs. TrEMBL
Match: B9P3Q9 (Permease 1 heavy chain OS=Schistosoma japonicum OX=6182 PE=2 SV=1)

HSP 1 Score: 355.525 bits (911), Expect = 3.004e-110
Identity = 214/611 (35.02%), Postives = 337/611 (55.16%), Query Frame = 2
Query:  185 VKKDDEFRGLTKEELEKF-AKDPFWVKLRLILFILFWIVWATMLVAAILIVVFSKKCPKRPKLEFWQQKTGYWVDPYAFVDTDQNLVGDFKGIMTKLDYIQKKVGAGYIILNPVFKGQYIKENQISEFVEIFRNVDPKLGSIESFKELVKDARKRGIEIXXXXXXXXXXXXXKF--------------------------------------MADLNLKSDSVLTEIKESIKIWLNYGVRGFLFTNLGMYAENGTK---PDRKCKNDSISSPYSTIDVQM-----LLKEIRKTMDEVAKSTDKSRLLIVDAGDVGLEVGKADPL-LQYLGKKEN-LADMIISREFLKYRGWET---NCGSKQSSISNYLSTVPSDKRKMVGLTSATLFSPRTNDLMKIVSPFLLEGNSILYYGSEINMPCDGMDLSGSTLYPVNSKSPNN--------CNHMIMPWDNNGDEFSGGKLNQS---QYLSQY--KDTVQSLTATGTGENILKLHGRLIKIRNEPSLLWGKTKLIQSQK-TSNYSHNIFTRQADGFPIIVVALLIDSTAEKPGKVFSFKSICEKFTPILVYPSNENLEENKEVDTKNVFLKTVTTGSVHVFKCA 1819
            V + D +  LT+E+L +  +K+PFW +LR  LFILFW+VW  +L+AAILI+VF+ KCP RP L FW+  TGYWV+P+A+ D+  + +GD KG+  +LDYI+  +GAG+I+L+ +F GQY  + +    V+ + NVDP LG++E FK LV+   K GI ++L++D NS+S    +                                        DLNL+    L  I +  K WLN G+ G L  N+  Y ENGT+   P  K       S Y T  + +     ++++IRK +DE+++S+ K +LL VDAG+ G  VGK++ + +Q+LG K++  A +++SR+F+K+RGW+    +    +++I  Y     SD+  M  LT+ +    R +DL+ + +  LL G  +LYYGSE+N   + ++ +G   YP + K+            + + MPWD  G  FS    N +   +YL ++  ++TV+S T++G G     L   LI IR   SLLWG  +L++S   T      IF R+A+GFP  ++ L  +         F F S+C    P ++YP+N+N   ++EV ++ V+L +     V+VFKCA
Sbjct:   33 VGQKDTYCLLTREDLMQLDSKEPFWYRLRWGLFILFWVVWVGLLLAAILIIVFTPKCPPRPVLPFWRSTTGYWVNPFAYEDSSNDKIGDLKGLAKRLDYIKGTIGAGFIVLSSIFSGQYTNDLKTLGLVDDYFNVDPALGTMEDFKNLVRSCHKNGIYLILTMDFNSVSAKHPWTEFTYLLEPYSSKKVSRLGGDARTVIQGVSYYSVFGSHFVDLNLRETGALDRIADVAKFWLNEGIDGILLDNVAFYIENGTESGAPITKELGSQWFSKYPTSQIYISESVEVVRKIRKVVDEMSESSGKPKLLAVDAGNTGYGVGKSEDISMQFLGTKDSPAAHVVVSRQFVKHRGWKAPPIDPEEIKNNIFTYDMLSVSDRNSM-ALTTVSTSDSRQSDLVALAATVLLPGTCLLYYGSELNEGTENVNFTGD-FYPFDEKTIFTGSKETDVLLSQLAMPWDQAGVGFSPALTNSTSFTEYLKRFGLRETVESATSSGRGATPFSLVQDLIAIRRNESLLWGDFRLLKSSLITEGLKFQIFERKAEGFPAFIIVLRNEPNVAS--GTFDFSSVCSNIIPKIIYPANKNFPIDQEVSSQRVYLHSSGEPMVYVFKCA 639          
BLAST of slc3a-1 vs. TrEMBL
Match: A0A183R858 (Aamy domain-containing protein OS=Schistosoma rodhaini OX=6188 PE=4 SV=1)

HSP 1 Score: 354.755 bits (909), Expect = 5.608e-110
Identity = 212/612 (34.64%), Postives = 331/612 (54.08%), Query Frame = 2
Query:  191 KDDEFRGLTKEELEKF-AKDPFWVKLRLILFILFWIVWATMLVAAILIVVFSKKCPKRPKLEFWQQKTGYWVDPYAFVDTDQNLVGDFKGIMTKLDYIQKKVGAGYIILNPVFKGQYIKENQISEFVEIFRNVDPKLGSIESFKELVKDARKRGIEIXXXXXXXXXXXXXKF---------------------------------------MADLNLKSDSVLTEIKESIKIWLNYGVRGFLFTNLGMYAENGTKP--------DRKCKNDSISSPYSTIDVQMLLKEIRKTMDEVAKSTDKSRLLIVDAGDVGLEVG-KADPLLQYLGKKEN-LADMIISREFLKYRGWE---TNCGSKQSSISNYLSTVPSDKRKMVGLTSATLFSPRTNDLMKIVSPFLLEGNSILYYGSEINMPCDGMDLSGSTLYPVNSKSPNN--------CNHMIMPWDNNGDEFS---GGKLNQSQYLSQYK--DTVQSLTATGTGENILKLHGRLIKIRNEPSLLWGKTKLIQSQK-TSNYSHNIFTRQADGFPIIVVALLIDSTAEKPGKV---FSFKSICEKFTPILVYPSNENLEENKEVDTKNVFLKTVTTGSVHVFKC 1816
            + D +R LT+E+L +  +++P W++LR  LFILFWIVW  +L+AA+LI+VF+ KCP RP L FW+  TGYWV+P+A+ D+  + +GD +G++ KL+YI+  +GAG+I+L  +F GQY  + +    V+ F N+DP  G++E FK  V+   K GI +VL++D NS+S    +                                         DLNL+    L  I +  + WLN G+ G L  N+  Y EN  KP          K  N+  SS     +   +++ IRK ++EV++S+ K +LL VDAG+ G  +  K D  +QYLG +++  A +++SR+F+K RGW+   TN     + I  Y      D+  M  LT+A+   PR +DL+ + S FLL G S+LYYGSE+N     ++ +G   YP + K+            + + MPWD +G  FS       + ++YL  +K  +TV+S T++G G     L   L+ IR   SLLWG  ++++S + T      +F R+A+GFP  +V L      +KP  V   F F S+C    P ++YP N+N   ++ V ++ V+LK+     ++VFKC
Sbjct:   35 QKDTYRLLTREDLMQLDSREPLWLRLRWGLFILFWIVWIGLLLAAVLIIVFTPKCPPRPVLPFWRSSTGYWVNPFAYADSTNDKIGDLRGLVEKLEYIKSTIGAGFIVLTSIFSGQYTNDQKTLGLVDDFYNIDPAAGTMEDFKYFVRSCHKHGIHVVLTMDFNSVSAKHSWTDLTSMLEPYPSGGRISRLGGDAKTVIQGTEYYSVFGSQFVDLNLRESVTLDHISDVARFWLNEGIDGILLDNVAFYVENSAKPTALITKELGSKWFNEYPSSQIYLNESVDVVRRIRKVVNEVSESSGKPKLLAVDAGNTGYGISEKEDLSMQYLGTEDSPAAHVVVSRQFVKQRGWKAPPTNPSVTNNDIFTYDMLSVYDRNSM-ALTAASTTDPRQSDLVALASTFLLPGTSLLYYGSELNEETSNINFTGE-FYPFDEKTVFTGSKETDVLLSQLAMPWDQSGAGFSPILSNVTSFTEYLKAFKINETVESATSSGRGITSFSLVQDLVAIRKNESLLWGNFRMLKSSRITEELDFEMFERKAEGFPAFIVVL-----RKKPNAVSGTFDFSSVCSSIIPKIIYPPNKNFPIDQPVSSQRVYLKSDGQPMIYVFKC 639          
BLAST of slc3a-1 vs. Ensembl Cavefish
Match: slc3a2a (4F2 cell-surface antigen heavy chain-like [Source:NCBI gene;Acc:103045737])

HSP 1 Score: 92.0485 bits (227), Expect = 3.674e-19
Identity = 66/216 (30.56%), Postives = 111/216 (51.39%), Query Frame = 2
Query:  164 IKQDAEIVKKDDEFRGLTKEELEKFAKDPFWVKLRLILFILFWIVWATMLVAAILIVVFSKKCPKRPKLEFWQQKTGYWV-DPYAFVDTDQNLVGDFKGIMTKLDYIQKKVGAGYIILNPVFKGQYIKENQISEFVEIFRNVDPKLGSIESFKELVKDARKRGIEIXXXXXXXXXXXXXKFMADLNLKSDSVLTEIKESIKIWLNYGVRGFLFTNL 808
            + +D E+     +F GL+KEEL + A    WV+ RLIL +LFW+ W  ML  A++I+V + +C   P++ +W +   Y + D  AF +         KG+  KLD + +    G II  P+ + Q      ++     F  ++P +GS      L++ A K+GI IVL +  N     + F    N++  +V ++ K++   WL+ GV G L ++L
Sbjct:   40 VPEDTEV-----KFTGLSKEELLRVAGTTGWVRTRLILLVLFWLGWVGMLAGAVVIIVQAPRCKPIPEMHWWNEGPLYQIADVNAFAENK-----GLKGVEEKLDNLNQLKVKGLII-GPIHRVQADHPKTLN-----FTTIEPVVGSENDLNSLLEKAHKKGISIVLDLTPNYKGAEAWFN---NIQ--AVASQFKDACAYWLHKGVDGVLVSDL 234          
BLAST of slc3a-1 vs. Ensembl Cavefish
Match: si:dkey-202g17.3 (4F2 cell-surface antigen heavy chain-like [Source:NCBI gene;Acc:103026381])

HSP 1 Score: 87.8113 bits (216), Expect = 6.911e-18
Identity = 56/208 (26.92%), Postives = 103/208 (49.52%), Query Frame = 2
Query:  203 FRGLTKEELEKFAKDPFWVKLRLILFILFWIVWATMLVAAILIVVFSKKCPKRPKLEFWQQKTGYWVDPYAFVDTDQNLVGDFKGIMTKLDYIQKKVGAGYIILNPVFKGQYIKENQISEFVEIFRNVDPKLGSIESFKELVKDARKRGIEIXXXXXXXXXXXXXKFMADLNLKSDSVLTE-----------IKESIKIWLNYGVRGF 793
            ++ +T+E+LE  A  P W + R  L +LFW+ W  ML AAI+++V S + P    L +WQ K  Y + P  F+D +         +  +L Y+Q  +G G +IL    +G ++ ++  +   E     + +LG++  F +L+ D+ + G+ ++L             + DL+L S+   +            +++S++ WL  GV GF
Sbjct:   44 WKPMTREQLEAAAGGPGWKRFRSRLVLLFWVAWLAMLGAAIVVIVQSPR-PVATPLHWWQNKLFYRLQPVLFLDVNNTESSAISKVSDRLLYLQ-SLGVGVMIL----EGMFMNKSSPTNLTE----NNQQLGTLPQFHQLITDSNRAGVRVILD------------LCDLDLSSEPQFSNETVILAGGSGYVQDSLRYWLERGVSGF 229          
BLAST of slc3a-1 vs. Ensembl Cavefish
Match: slc3a2b (4F2 cell-surface antigen heavy chain-like [Source:NCBI gene;Acc:103024422])

HSP 1 Score: 83.1889 bits (204), Expect = 2.616e-16
Identity = 57/207 (27.54%), Postives = 97/207 (46.86%), Query Frame = 2
Query:  188 KKDDEFRGLTKEELEKFAKDPFWVKLRLILFILFWIVWATMLVAAILIVVFSKKCPKRPKLEFWQQKTGYWVDPYAFVDTDQNLVGDFKGIMTKLDYIQKKVGAGYIILNPVFKGQYIKENQISEFVEIFRNVDPKLGSIESFKELVKDARKRGIEIXXXXXXXXXXXXXKFMADLNLKSDSVLTEIKESIKIWLNYGVRGFLFTNL 808
            +K+ +F GL+KEEL + A  P W+K+R  L I FW+ W  ML  AI+I+V + +C   P++ +W +   Y +        + N+      +  KLDY  K    G +I  P+      K   ++        +    G++E   +L+ DA K+ + +VL +  N   ++  F    N  S  V  ++  +   WL+ GV G L   +
Sbjct:   52 EKEAKFTGLSKEELLRVAGTPGWIKVRWALLISFWLGWIGMLAGAIVIIVQAPRCKPLPEMNWWDEGPLYQIGDIMSFTGESNIA----SLAKKLDYANKLKVKGLVI-GPIHASSPDKPEDLN-----LEEISSTAGNMEQLSKLLDDAHKKSMSVVLDLTPNYSGSNLWF----NSNSTHVADKVTSATNYWLSKGVDGILLHGI 244          
BLAST of slc3a-1 vs. Ensembl Cavefish
Match: slc3a1 (solute carrier family 3 member 1 [Source:NCBI gene;Acc:103025210])

HSP 1 Score: 68.1662 bits (165), Expect = 1.653e-11
Identity = 52/175 (29.71%), Postives = 81/175 (46.29%), Query Frame = 2
Query:  143 PEVEFKSIKQDAEIVKKDDEFRGLTKEELEKFAKDPFWVKLRLILFILFWIVWATMLVAAILIVVFSKKCPKRPKLEFWQQKTGYWVDPYAFVDTDQNLVGDFKGIMTKLDYIQKKVGAGYIILNPVFKGQYIKENQISEF---VEIFRNVDPKLGSIESFKELVKDARKRGIEI 658
            P V  +S     E   +   + G+ KE L  ++      + R+   ILFW+  A  L    L V      P  P L +WQ    Y V P +F D+D + VGD +GI  KL + Q      Y+ +  V+   + K + +++F   VE FR VDP  G++E F  L+      G+++
Sbjct:   40 PAVSAESCAAGEESYTQLRPYAGMPKEVLLLYSSQ---ARYRVPREILFWLTVACTLALVALTVTVIVLSP--PCLSWWQTTPVYQVYPRSFKDSDGDGVGDLRGIKEKLSHFQ------YLNIKAVWISPFYK-SPMADFGYDVEDFRRVDPLFGTMEDFDNLLASMHSMGLKL 202          
BLAST of slc3a-1 vs. Ensembl Sea Lamprey
Match: slc3a1 (solute carrier family 3 member 1 [Source:ZFIN;Acc:ZDB-GENE-090313-225])

HSP 1 Score: 55.0694 bits (131), Expect = 3.951e-8
Identity = 40/152 (26.32%), Postives = 74/152 (48.68%), Query Frame = 2
Query:  179 EIVKKDDEFRGLTKEELEKFAKDPFWVKLRLILFILFWIVWATMLVAAILIVVFSKKCPKRPKLEFWQQKTGYWVDPYAFVDTDQNLVGDFKGIMTKLDYIQKKVGAGYIILNPVFKGQYIKENQISEFVEI--FRNVDPKLGSIESFKELV 628
            E+ ++   + G+ KE L +++      + R+   ++FW++    +V     V      P+   L++WQ    Y + P +F D D N VGD KGI  KLD+++      Y+ +  V    +    Q+ +  ++  F  VDP LGS+   ++L+
Sbjct:   16 EVPREKGPYAGMPKEVLLQYSNKK---RYRVTRDVIFWLIVVATVVLVAATVAVIALSPR--CLDWWQASPVYQIYPRSFRDADGNGVGDLKGIKEKLDHLK------YLNIKAVLISSFYTSPQVEQGQDVSDFLGVDPLLGSMNDVEDLI 156          
BLAST of slc3a-1 vs. Ensembl Yeast
Match: IMA5 (Alpha-glucosidase; specificity for isomaltose, maltose, and palatinose, but not alpha-methylglucoside; most distant member of the IMA isomaltase family, but with similar catalytic properties as Ima1p and Ima2p; not required for isomaltose utilization, but Ima5p overexpression allows the ima1 null mutant to grow on isomaltose; can cleave alpha-1,3 linkage of nigerose and turanose and alpha-1,5 linkage of leucrose and is very sensitive to temperature in vitro [Source:SGD;Acc:S000003752])

HSP 1 Score: 50.0618 bits (118), Expect = 7.647e-7
Identity = 27/95 (28.42%), Postives = 54/95 (56.84%), Query Frame = 2
Query:  374 FWQQKTGYWVDPYAFVDTDQNLVGDFKGIMTKLDYIQKKVGAGYIILNPVFKGQYIKENQISEFVEIFRNVDPKLGSIESFKELVKDARKRGIEI 658
            +W++ T Y + P +F D++ +  GD  GI +KLDY+ K++G   I + P +      +  +   +  +  V P+ G+ E   +++++A KRGI++
Sbjct:    9 WWKEATVYQIYPASFKDSNNDGWGDLAGITSKLDYV-KELGVDAIWVCPFYDS---PQEDMGYDIANYEKVWPRYGTNEDCFQMIEEAHKRGIKV 99          
BLAST of slc3a-1 vs. Ensembl Nematostella
Match: EDO37034 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SGS7])

HSP 1 Score: 57.3806 bits (137), Expect = 1.170e-8
Identity = 30/101 (29.70%), Postives = 58/101 (57.43%), Query Frame = 2
Query:  359 RPKLEFWQQKTGYWVDPYAFVDTDQNLVGDFKGIMTKLDYIQKKVGAGYIILNPVFKGQYIKEN-QISEFVEIFRNVDPKLGSIESFKELVKDARKRGIEI 658
            R +  +W+    Y + P +F D++ +  GD  GI ++LDY+   +G   I L+P+FK   +     +S+F++    V+P  G++E F+ L++D   RG+++
Sbjct:   13 RSEQRWWKNSVIYHIYPRSFQDSNGDGNGDLSGIRSRLDYLD-YLGVKIIYLSPIFKSPMVDNGYDVSDFMD----VNPMFGTMEDFESLLQDIHSRGMKL 108          
BLAST of slc3a-1 vs. Ensembl Medaka
Match: slc3a2a (solute carrier family 3 member 2 [Source:NCBI gene;Acc:101170465])

HSP 1 Score: 89.7373 bits (221), Expect = 1.705e-18
Identity = 63/210 (30.00%), Postives = 109/210 (51.90%), Query Frame = 2
Query:  185 VKKDD-EFRGLTKEELEKFAKDPFWVKLRLILFILFWIVWATMLVAAILIVVFSKKCPKRPKLEFWQQKTGYWVDPYAFVDTDQNLVGDFKGIMTKLDYI-QKKVGAGYIILNPVFKGQYIKENQISEFVEIFRNVDPKLGSIESFKELVKDARKRGIEIXXXXXXXXXXXXXKFMADLNLKSDSVLTEIKESIKIWLNYGVRGFLFTNL 808
            V +DD  F GL+KEEL + A  P WV+ R +L +LFW+ W  ML  AI+I+V + +C   P++ +W +   Y +D     D D    G  +G+  KLD + Q KV    ++L P+     ++E++ +        + P  GS++  + ++  A K+G+ +VL +  N   ++  F  D     D ++ ++K + + WLN GV      +L
Sbjct:   43 VPEDDVTFTGLSKEELLRVAGTPGWVRTRWVLLVLFWLGWVGMLAGAIVIIVQAPRCKPIPEMNWWNEGPLYQID-----DLDA-FSGGMEGLEEKLDGMTQLKVKG--LVLGPLHS---VQEDEPATLE--LDKISPIFGSLKQLEAVLAKAHKKGMSVVLDLTPNYKGSAPWFQND-----DEIVEKVKSAAEYWLNLGVDAIKLRDL 234          
BLAST of slc3a-1 vs. Ensembl Medaka
Match: ENSORLT00000013036.2 (4F2 cell-surface antigen heavy chain [Source:NCBI gene;Acc:101167257])

HSP 1 Score: 85.5001 bits (210), Expect = 4.537e-17
Identity = 72/290 (24.83%), Postives = 134/290 (46.21%), Query Frame = 2
Query:  149 VEFKSIKQDAEIVKKDDEFRGLTKEELEKFAKDPFWVKLRLILFILFWIVWATMLVAAILIVVFSKKCPKRPKLEFWQQKTGYWV-DPYAFVDTDQNLVGDFKGIMTKLDYIQKKVGAGYIILNPVFKGQYIKENQISEFVEIFRNVDPKLGSIESFKELVKDARKRGIEIXXXXXXXXXXXXXKFMADLNLKSDSVLTEIKESIKIWLNYGVRGF--------------LFTNLGMYAENGTK--PDRKC--------KNDSISSPYSTIDVQMLLKEIRKTMDEVAKS 943
            V+ K +++D E  K    F GL KEEL + A  P WV+ R  L ++FWI W  MLV A+LI++ +  C + P  ++W +     + +  AF +T      D KG+  K+  +      G +I  P+          +      F  + P+ G++E F  L++ A ++G+ +VL +  N   +S  + +  ++   +V   +K ++  WL+ GV G               L+T++    +NGT   P+++           +++S   S+  V +LL  +    D+  ++
Sbjct:   65 VKLKVLEEDEEQTK----FTGLNKEELLRVAGSPGWVRTRWALLLVFWIGWLGMLVGAVLIILRAPVCRELPPTDWWNEGPLLQIKNLQAFSETR-----DLKGLEQKVSTLSGLKLKGLVI-GPIHAAPADDPMNLE-----FEEISPEFGNLEQFNSLLQTAHRKGVFVVLDLTPNYRGSSGPWFSSASVT--NVAERLKSALVFWLSEGVDGIQLPGVEDLARMVPSLWTDIRAIVQNGTDKYPNKRVLIGVTEASSAETVSDLLSSTGVDLLLSGVLSASDQTERA 337          
BLAST of slc3a-1 vs. Ensembl Medaka
Match: slc3a1 (solute carrier family 3 member 1 [Source:NCBI gene;Acc:101157723])

HSP 1 Score: 69.707 bits (169), Expect = 5.144e-12
Identity = 47/166 (28.31%), Postives = 87/166 (52.41%), Query Frame = 2
Query:  173 DAEIVKKDDEFRGLTKEELEKFAKDPFWVKLRLILFILFWI-VWATMLVAAILIVVFSKKCPKRPKLEFWQQKTGYWVDPYAFVDTDQNLVGDFKGIMTKLDYIQKKVGAGYIILNPVFKGQYIKENQISEF---VEIFRNVDPKLGSIESFKELVKDARKRGIEI 658
            D  +  + + + G+ KE L  ++      + R+   +LFW+ V  T+ + A+ + + +      P L +WQ    Y V P +F D+D + VGD +GI  KLD+    +    I ++P ++      + + +F   VE FR+VDP  G++E F+EL+ +  K G+++
Sbjct:   51 DDSVYAQVEPYAGMPKEVLLLYSSQ---ARYRVPREVLFWLTVCCTLALVAVTVAIIALS---PPCLGWWQISPVYQVYPRSFKDSDGDGVGDLRGIKEKLDHFH-SLNIKSIWISPFYR------SPMKDFGYDVEDFRDVDPLFGTMEDFEELLAEMHKNGLKL 203          
BLAST of slc3a-1 vs. Ensembl Medaka
Match: si:dkey-202g17.3 (4F2 cell-surface antigen heavy chain [Source:NCBI gene;Acc:101159121])

HSP 1 Score: 55.0694 bits (131), Expect = 1.518e-7
Identity = 49/214 (22.90%), Postives = 96/214 (44.86%), Query Frame = 2
Query:  164 IKQDAEIVKKDDEFRGLTKEELEKFAKDPFWVKLRLILFILFWIVWATMLVAAILIVVFSKKCPKRPKLEFWQQKTGYWVDPYAFVDTDQNLVGDFKGIMTKLDYIQKKVGAGYIILNPVFKGQYIKENQISEFVEIFRNVDPKLGSIESFKELVKDARKRGIEIXXXXXXXXXXXXXKFMADLNLKSDSVLTEIKESIKIWLNYGVRGFLFTN 805
            ++ D E V+    +R L+K++LE  A  P W K+R  L +  W+    M   A+ I+V S + P    L +WQ+   Y +    +++T          +  +L ++ + +G G +IL  VF     K   IS   +    +          + L+ ++ K  +++V+ +    L          ++ S+   T ++++++ WL  GV GFL  +
Sbjct:   31 LEPDPEPVQ---HWRPLSKQQLEAAAGGPGWRKVRHYLVLTVWLACIVMFSVAVGIIVLSPR-PSATCLRWWQKSLFYQLQADLYMETQAQGPQGATEVSEQLAHL-RSLGIGALILEGVFH----KGMSISNLTDAPTQI----------QLLLMESNKANLKVVMDLCEADLLELYAAAGHSDMPSNHS-TPVQDALRFWLGQGVAGFLICD 224          
BLAST of slc3a-1 vs. Planmine SMEST
Match: SMESG000019184.1 (SMESG000019184.1)

HSP 1 Score: 1057.36 bits (2733), Expect = 0.000e+0
Identity = 539/583 (92.45%), Postives = 541/583 (92.80%), Query Frame = 2
Query:   74 MANDVEMNDVQKPLMKDSDIENIPEVEFKSIKQDAEIVKKDDEFRGLTKEELEKFAKDPFWVKLRLILFILFWIVWATMLVAAILIVVFSKKCPKRPKLEFWQQKTGYWVDPYAFVDTDQNLVGDFKGIMTKLDYIQKKVGAGYIILNPVFKGQYIKENQISEFVEIFRNVDPKLGSIESFKELVKDARKRGIEIXXXXXXXXXXXXXKFMADLNLKSDSVLTEIKESIKIWLNYGVRGFLFTNLGMYAENGTKPDRKCKNDSISSPYSTIDVQMLLKEIRKTMDEVAKSTDKSRLLIVDAGDVGLEVGKADPLLQYLGKKENLADMIISREFLKYRGWETNCGSKQSSISNYLSTVPSDKRKMVGLTSATLFSPRTNDLMKIVSPFLLEGNSILYYGSEINMPCDGMDLSGSTLYPVNSKSPNNCNHMIMPWDNNGDEFSGGKLNQSQYLSQYKDTVQSLTATGTGENILKLHGRLIKIRNEPSLLWGKTKLIQSQKTSNYSHNIFTRQADGFPIIVVALLIDSTAEKPGKVFSFKSICEKFTPILVYPSNENLEENKEVDTKNVFLKTVTTGSVHVFKCAE 1822
            M+NDVEMNDVQKPLMKDSDIENIPEVEFKSIKQDAEIVKKDDEFRGLTKEELEKFAKDPFWVKLRLILFILFWIVWATMLVAAILIVVFSKKCPKRPKLEFWQQKTGYWVDPYAFVDTDQNLVGDFKGIMTKLDYIQKKVGAGYIILNPVFKGQYIKENQISEFVEIFRNVDPKLGSIESFKELVKDARKRGIEIVLSVDLNSLSNSSKFMADLNLKSDSVLTEIKESIKIWLNYGVRGFLFTNLGMYAENGTKPDRKCKNDSISSPYSTIDVQMLLKEIRKTMDEVAKSTDKSRLLIVDAGDVGLEVGKADPLLQYLGKKENLADMIISREFLKYRGWET CGSKQSSISNYLSTVPSDKRKMVGLTSATLFSPRTNDLMKIVSPFLLEGNSILYYGSE+NMPCDGMDLSGSTLYPVNSK PNNCNHMIMPWDNNGDEFSGGKLNQSQYLSQYKDTVQ                                       TSNYSHNIFTRQADGFPIIVVALLID TAEKPGKVFSFKSICEKFTPILVYPSNENLEENKEVDTKNVFLKTVTTGSVHVFKCAE
Sbjct:    1 MSNDVEMNDVQKPLMKDSDIENIPEVEFKSIKQDAEIVKKDDEFRGLTKEELEKFAKDPFWVKLRLILFILFWIVWATMLVAAILIVVFSKKCPKRPKLEFWQQKTGYWVDPYAFVDTDQNLVGDFKGIMTKLDYIQKKVGAGYIILNPVFKGQYIKENQISEFVEIFRNVDPKLGSIESFKELVKDARKRGIEIVLSVDLNSLSNSSKFMADLNLKSDSVLTEIKESIKIWLNYGVRGFLFTNLGMYAENGTKPDRKCKNDSISSPYSTIDVQMLLKEIRKTMDEVAKSTDKSRLLIVDAGDVGLEVGKADPLLQYLGKKENLADMIISREFLKYRGWETKCGSKQSSISNYLSTVPSDKRKMVGLTSATLFSPRTNDLMKIVSPFLLEGNSILYYGSEVNMPCDGMDLSGSTLYPVNSKLPNNCNHMIMPWDNNGDEFSGGKLNQSQYLSQYKDTVQ---------------------------------------TSNYSHNIFTRQADGFPIIVVALLIDLTAEKPGKVFSFKSICEKFTPILVYPSNENLEENKEVDTKNVFLKTVTTGSVHVFKCAE 544          
BLAST of slc3a-1 vs. Planmine SMEST
Match: SMESG000019192.1 (SMESG000019192.1)

HSP 1 Score: 1051.97 bits (2719), Expect = 0.000e+0
Identity = 539/583 (92.45%), Postives = 545/583 (93.48%), Query Frame = 2
Query:   74 MANDVEMNDVQKPLMKDSDIENIPEVEFKSIKQDAEIVKKDDEFRGLTKEELEKFAKDPFWVKLRLILFILFWIVWATMLVAAILIVVFSKKCPKRPKLEFWQQKTGYWVDPYAFVDTDQNLVGDFKGIMTKLDYIQKKVGAGYIILNPVFKGQYIKENQISEFVEIFRNVDPKLGSIESFKELVKDARKRGIEIXXXXXXXXXXXXXKFMADLNLKSDSVLTEIKESIKIWLNYGVRGFLFTNLGMYAENGTKPDRKCKNDSISSPYSTIDVQMLLKEIRKTMDEVAKSTDKSRLLIVDAGDVGLEVGKADPLLQYLGKKENLADMIISREFLKYRGWETNCGSKQSSISNYLSTVPSDKRKMVGLTSATLFSPRTNDLMKIVSPFLLEGNSILYYGSEINMPCDGMDLSGSTLYPVNSKSPNNCNHMIMPWDNNGDEFSGGKLNQSQYLSQYKDTVQSLTATGTGENILKLHGRLIKIRNEPSLLWGKTKLIQSQKTSNYSHNIFTRQADGFPIIVVALLIDSTAEKPGKVFSFKSICEKFTPILVYPSNENLEENKEVDTKNVFLKTVTTGSVHVFKCAE 1822
            M+NDVEMNDVQKPLMKDSDIENIPEVEFKSIKQDAEIVKKDDEFRGLTKEELEKFAKDPFWVKLRLILFILFWIVWATMLVAAILIVVF K C +                              F+ IMTKLDYIQKKVGAGYIILNPVFKGQYIKENQISEFVEIFRNVDPKLGSIESFKELVKDARKRGIEIVLSVDLNSLSNSSKFMADLNLKSDSVLTEIKESIKIWLNYGVRGFLFTNLGMYAENGTKPDRKCKNDSISSPYSTIDVQMLLKEIRKTMDEVAKSTDKSRLLIVDAG+VGLEVGKADPLLQYLGKKENLADMIISREFLKYRGWET CG+KQSSISNYLSTVPSDKRKMVGLTS TLFSPRTNDLMKIVSPFLLEGNSILYYGSE+NMPCDGMDLSGSTLYPVNSK PNNCNHMIMPWDNNGDEFSGGKLNQSQYLSQYKDTVQSLTATGTGENILKLHGRLIKIRNEPSLLWGKTKLIQSQKTSNYSHNIFTRQADGFPIIVVALLID TAEKPGKVFSFKSICEKFTPILVYPSNENLEENKEVDTKNVFLKTVTTGSVHVFKCAE
Sbjct:    1 MSNDVEMNDVQKPLMKDSDIENIPEVEFKSIKQDAEIVKKDDEFRGLTKEELEKFAKDPFWVKLRLILFILFWIVWATMLVAAILIVVF-KSCRR------------------------------FQRIMTKLDYIQKKVGAGYIILNPVFKGQYIKENQISEFVEIFRNVDPKLGSIESFKELVKDARKRGIEIVLSVDLNSLSNSSKFMADLNLKSDSVLTEIKESIKIWLNYGVRGFLFTNLGMYAENGTKPDRKCKNDSISSPYSTIDVQMLLKEIRKTMDEVAKSTDKSRLLIVDAGNVGLEVGKADPLLQYLGKKENLADMIISREFLKYRGWETECGNKQSSISNYLSTVPSDKRKMVGLTSTTLFSPRTNDLMKIVSPFLLEGNSILYYGSEVNMPCDGMDLSGSTLYPVNSKLPNNCNHMIMPWDNNGDEFSGGKLNQSQYLSQYKDTVQSLTATGTGENILKLHGRLIKIRNEPSLLWGKTKLIQSQKTSNYSHNIFTRQADGFPIIVVALLIDLTAEKPGKVFSFKSICEKFTPILVYPSNENLEENKEVDTKNVFLKTVTTGSVHVFKCAE 552          
BLAST of slc3a-1 vs. Planmine SMEST
Match: SMESG000019184.1 (SMESG000019184.1)

HSP 1 Score: 1046.19 bits (2704), Expect = 0.000e+0
Identity = 534/577 (92.55%), Postives = 535/577 (92.72%), Query Frame = 2
Query:   92 MNDVQKPLMKDSDIENIPEVEFKSIKQDAEIVKKDDEFRGLTKEELEKFAKDPFWVKLRLILFILFWIVWATMLVAAILIVVFSKKCPKRPKLEFWQQKTGYWVDPYAFVDTDQNLVGDFKGIMTKLDYIQKKVGAGYIILNPVFKGQYIKENQISEFVEIFRNVDPKLGSIESFKELVKDARKRGIEIXXXXXXXXXXXXXKFMADLNLKSDSVLTEIKESIKIWLNYGVRGFLFTNLGMYAENGTKPDRKCKNDSISSPYSTIDVQMLLKEIRKTMDEVAKSTDKSRLLIVDAGDVGLEVGKADPLLQYLGKKENLADMIISREFLKYRGWETNCGSKQSSISNYLSTVPSDKRKMVGLTSATLFSPRTNDLMKIVSPFLLEGNSILYYGSEINMPCDGMDLSGSTLYPVNSKSPNNCNHMIMPWDNNGDEFSGGKLNQSQYLSQYKDTVQSLTATGTGENILKLHGRLIKIRNEPSLLWGKTKLIQSQKTSNYSHNIFTRQADGFPIIVVALLIDSTAEKPGKVFSFKSICEKFTPILVYPSNENLEENKEVDTKNVFLKTVTTGSVHVFKCAE 1822
            MNDVQKPLMKDSDIENIPEVEFKSIKQDAEIVKKDDEFRGLTKEELEKFAKDPFWVKLRLILFILFWIVWATMLVAAILIVVFSKKCPKRPKLEFWQQKTGYWVDPYAFVDTDQNLVGDFKGIMTKLDYIQKKVGAGYIILNPVFKGQYIKENQISEFVEIFRNVDPKLGSIESFKELVKDARKRGIEIVLSVDLNSLSNSSKFMADLNLKSDSVLTEIKESIKIWLNYGVRGFLFTNLGMYAENGTKPDRKCKNDSISSPYSTIDVQMLLKEIRKTMDEVAKSTDKSRLLIVDAGDVGLEVGKADPLLQYLGKKENLADMIISREFLKYRGWET CGSKQSSISNYLSTVPSDKRKMVGLTSATLFSPRTNDLMKIVSPFLLEGNSILYYGSE+NMPCDGMDLSGSTLYPVNSK PNNCNHMIMPWDNNGDEFSGGKLNQSQYLSQYKDTVQ                                       TSNYSHNIFTRQADGFPIIVVALLID TAEKPGKVFSFKSICEKFTPILVYPSNENLEENKEVDTKNVFLKTVTTGSVHVFKCAE
Sbjct:    1 MNDVQKPLMKDSDIENIPEVEFKSIKQDAEIVKKDDEFRGLTKEELEKFAKDPFWVKLRLILFILFWIVWATMLVAAILIVVFSKKCPKRPKLEFWQQKTGYWVDPYAFVDTDQNLVGDFKGIMTKLDYIQKKVGAGYIILNPVFKGQYIKENQISEFVEIFRNVDPKLGSIESFKELVKDARKRGIEIVLSVDLNSLSNSSKFMADLNLKSDSVLTEIKESIKIWLNYGVRGFLFTNLGMYAENGTKPDRKCKNDSISSPYSTIDVQMLLKEIRKTMDEVAKSTDKSRLLIVDAGDVGLEVGKADPLLQYLGKKENLADMIISREFLKYRGWETKCGSKQSSISNYLSTVPSDKRKMVGLTSATLFSPRTNDLMKIVSPFLLEGNSILYYGSEVNMPCDGMDLSGSTLYPVNSKLPNNCNHMIMPWDNNGDEFSGGKLNQSQYLSQYKDTVQ---------------------------------------TSNYSHNIFTRQADGFPIIVVALLIDLTAEKPGKVFSFKSICEKFTPILVYPSNENLEENKEVDTKNVFLKTVTTGSVHVFKCAE 538          
BLAST of slc3a-1 vs. Planmine SMEST
Match: SMESG000019192.1 (SMESG000019192.1)

HSP 1 Score: 1041.57 bits (2692), Expect = 0.000e+0
Identity = 534/577 (92.55%), Postives = 539/577 (93.41%), Query Frame = 2
Query:   92 MNDVQKPLMKDSDIENIPEVEFKSIKQDAEIVKKDDEFRGLTKEELEKFAKDPFWVKLRLILFILFWIVWATMLVAAILIVVFSKKCPKRPKLEFWQQKTGYWVDPYAFVDTDQNLVGDFKGIMTKLDYIQKKVGAGYIILNPVFKGQYIKENQISEFVEIFRNVDPKLGSIESFKELVKDARKRGIEIXXXXXXXXXXXXXKFMADLNLKSDSVLTEIKESIKIWLNYGVRGFLFTNLGMYAENGTKPDRKCKNDSISSPYSTIDVQMLLKEIRKTMDEVAKSTDKSRLLIVDAGDVGLEVGKADPLLQYLGKKENLADMIISREFLKYRGWETNCGSKQSSISNYLSTVPSDKRKMVGLTSATLFSPRTNDLMKIVSPFLLEGNSILYYGSEINMPCDGMDLSGSTLYPVNSKSPNNCNHMIMPWDNNGDEFSGGKLNQSQYLSQYKDTVQSLTATGTGENILKLHGRLIKIRNEPSLLWGKTKLIQSQKTSNYSHNIFTRQADGFPIIVVALLIDSTAEKPGKVFSFKSICEKFTPILVYPSNENLEENKEVDTKNVFLKTVTTGSVHVFKCAE 1822
            MNDVQKPLMKDSDIENIPEVEFKSIKQDAEIVKKDDEFRGLTKEELEKFAKDPFWVKLRLILFILFWIVWATMLVAAILIVVF K C +                              F+ IMTKLDYIQKKVGAGYIILNPVFKGQYIKENQISEFVEIFRNVDPKLGSIESFKELVKDARKRGIEIVLSVDLNSLSNSSKFMADLNLKSDSVLTEIKESIKIWLNYGVRGFLFTNLGMYAENGTKPDRKCKNDSISSPYSTIDVQMLLKEIRKTMDEVAKSTDKSRLLIVDAG+VGLEVGKADPLLQYLGKKENLADMIISREFLKYRGWET CG+KQSSISNYLSTVPSDKRKMVGLTS TLFSPRTNDLMKIVSPFLLEGNSILYYGSE+NMPCDGMDLSGSTLYPVNSK PNNCNHMIMPWDNNGDEFSGGKLNQSQYLSQYKDTVQSLTATGTGENILKLHGRLIKIRNEPSLLWGKTKLIQSQKTSNYSHNIFTRQADGFPIIVVALLID TAEKPGKVFSFKSICEKFTPILVYPSNENLEENKEVDTKNVFLKTVTTGSVHVFKCAE
Sbjct:    1 MNDVQKPLMKDSDIENIPEVEFKSIKQDAEIVKKDDEFRGLTKEELEKFAKDPFWVKLRLILFILFWIVWATMLVAAILIVVF-KSCRR------------------------------FQRIMTKLDYIQKKVGAGYIILNPVFKGQYIKENQISEFVEIFRNVDPKLGSIESFKELVKDARKRGIEIVLSVDLNSLSNSSKFMADLNLKSDSVLTEIKESIKIWLNYGVRGFLFTNLGMYAENGTKPDRKCKNDSISSPYSTIDVQMLLKEIRKTMDEVAKSTDKSRLLIVDAGNVGLEVGKADPLLQYLGKKENLADMIISREFLKYRGWETECGNKQSSISNYLSTVPSDKRKMVGLTSTTLFSPRTNDLMKIVSPFLLEGNSILYYGSEVNMPCDGMDLSGSTLYPVNSKLPNNCNHMIMPWDNNGDEFSGGKLNQSQYLSQYKDTVQSLTATGTGENILKLHGRLIKIRNEPSLLWGKTKLIQSQKTSNYSHNIFTRQADGFPIIVVALLIDLTAEKPGKVFSFKSICEKFTPILVYPSNENLEENKEVDTKNVFLKTVTTGSVHVFKCAE 546          
BLAST of slc3a-1 vs. Planmine SMEST
Match: SMESG000019192.1 (SMESG000019192.1)

HSP 1 Score: 1033.86 bits (2672), Expect = 0.000e+0
Identity = 534/587 (90.97%), Postives = 539/587 (91.82%), Query Frame = 2
Query:   92 MNDVQKPLMKDSDIENIPEVEFKSIKQDAEIVKKDDEFRGLTKEELEKFAKDPFWVKLRLILFILFWIVWATMLVAAILIVVFSKKCPKRPKLEFWQQKTGYWVDPYAFVDTDQNLVGDFKGIMTKLDYIQKKVGAGYIILNPVFKGQYIKENQISEFVEIFRNVDPKLGSIESFKELVKDARKRGIEIXXXXXXXXXXXXXKFMADLNLKSDSVLTEIKESIKIWLNYGVRGFLFTNLGMYAENGTKPDRKCKNDSISSPYSTIDVQMLLKEIRKTMDEVAKSTDKSRLLIVDAGDVGLEVGKADPLLQYLGKKENLADMIISREFLKYRGWETNCGSKQSSISNYLSTVPSDKRKMVGLTSATLFSPRTNDLMKIVSPFLLEGNSILYYGSEINMPCDGMDLSGSTLYPVNSKSPNNCNHMIMPWDNNGDEFSGGKLNQSQYLSQYKDTVQSLTATGTGENILKLHGRLIKIRNEPSLLWGKTKLIQSQK----------TSNYSHNIFTRQADGFPIIVVALLIDSTAEKPGKVFSFKSICEKFTPILVYPSNENLEENKEVDTKNVFLKTVTTGSVHVFKCAE 1822
            MNDVQKPLMKDSDIENIPEVEFKSIKQDAEIVKKDDEFRGLTKEELEKFAKDPFWVKLRLILFILFWIVWATMLVAAILIVVF K C +                              F+ IMTKLDYIQKKVGAGYIILNPVFKGQYIKENQISEFVEIFRNVDPKLGSIESFKELVKDARKRGIEIVLSVDLNSLSNSSKFMADLNLKSDSVLTEIKESIKIWLNYGVRGFLFTNLGMYAENGTKPDRKCKNDSISSPYSTIDVQMLLKEIRKTMDEVAKSTDKSRLLIVDAG+VGLEVGKADPLLQYLGKKENLADMIISREFLKYRGWET CG+KQSSISNYLSTVPSDKRKMVGLTS TLFSPRTNDLMKIVSPFLLEGNSILYYGSE+NMPCDGMDLSGSTLYPVNSK PNNCNHMIMPWDNNGDEFSGGKLNQSQYLSQYKDTVQSLTATGTGENILKLHGRLIKIRNEPSLLWGKTKLIQSQK          TSNYSHNIFTRQADGFPIIVVALLID TAEKPGKVFSFKSICEKFTPILVYPSNENLEENKEVDTKNVFLKTVTTGSVHVFKCAE
Sbjct:    1 MNDVQKPLMKDSDIENIPEVEFKSIKQDAEIVKKDDEFRGLTKEELEKFAKDPFWVKLRLILFILFWIVWATMLVAAILIVVF-KSCRR------------------------------FQRIMTKLDYIQKKVGAGYIILNPVFKGQYIKENQISEFVEIFRNVDPKLGSIESFKELVKDARKRGIEIVLSVDLNSLSNSSKFMADLNLKSDSVLTEIKESIKIWLNYGVRGFLFTNLGMYAENGTKPDRKCKNDSISSPYSTIDVQMLLKEIRKTMDEVAKSTDKSRLLIVDAGNVGLEVGKADPLLQYLGKKENLADMIISREFLKYRGWETECGNKQSSISNYLSTVPSDKRKMVGLTSTTLFSPRTNDLMKIVSPFLLEGNSILYYGSEVNMPCDGMDLSGSTLYPVNSKLPNNCNHMIMPWDNNGDEFSGGKLNQSQYLSQYKDTVQSLTATGTGENILKLHGRLIKIRNEPSLLWGKTKLIQSQKYNILESKNEITSNYSHNIFTRQADGFPIIVVALLIDLTAEKPGKVFSFKSICEKFTPILVYPSNENLEENKEVDTKNVFLKTVTTGSVHVFKCAE 556          
The following BLAST results are available for this feature:
BLAST of slc3a-1 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
SLC3A21.976e-1626.76solute carrier family 3 member 2 [Source:HGNC Symb... [more]
SLC3A22.067e-1626.76solute carrier family 3 member 2 [Source:HGNC Symb... [more]
SLC3A22.182e-1626.76solute carrier family 3 member 2 [Source:HGNC Symb... [more]
SLC3A22.287e-1626.70solute carrier family 3 member 2 [Source:HGNC Symb... [more]
SLC3A22.408e-1626.70solute carrier family 3 member 2 [Source:HGNC Symb... [more]
back to top
BLAST of slc3a-1 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 3
Match NameE-valueIdentityDescription
atgp-14.092e-2840.94Amino acid Transporter GlycoProtein subunit [Sour... [more]
atgp-21.586e-1632.67Amino acid Transporter GlycoProtein subunit [Sour... [more]
atgp-21.595e-1632.67Amino acid Transporter GlycoProtein subunit [Sour... [more]
back to top
BLAST of slc3a-1 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
CD98hc8.481e-1449.18gene:FBgn0037533 transcript:FBtr0081824[more]
CD98hc8.481e-1449.18gene:FBgn0037533 transcript:FBtr0331342[more]
CD98hc8.481e-1449.18gene:FBgn0037533 transcript:FBtr0332157[more]
CD98hc8.515e-1449.18gene:FBgn0037533 transcript:FBtr0331344[more]
Mal-A61.163e-830.30gene:FBgn0050360 transcript:FBtr0346647[more]
back to top
BLAST of slc3a-1 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
si:dkey-202g17.31.829e-2027.90si:dkey-202g17.3 [Source:ZFIN;Acc:ZDB-GENE-131127-... [more]
slc3a2a1.143e-1929.75solute carrier family 3 member 2a [Source:ZFIN;Acc... [more]
slc3a2a2.044e-1929.75solute carrier family 3 member 2a [Source:ZFIN;Acc... [more]
slc3a2b6.059e-1730.61solute carrier family 3 member 2b [Source:ZFIN;Acc... [more]
zgc:1584236.715e-1627.23zgc:158423 [Source:ZFIN;Acc:ZDB-GENE-061215-58][more]
back to top
BLAST of slc3a-1 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 1
Match NameE-valueIdentityDescription
SLC3A21.851e-2334.11solute carrier family 3 (amino acid transporter he... [more]
back to top
BLAST of slc3a-1 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 4
Match NameE-valueIdentityDescription
Slc3a21.184e-2033.20solute carrier family 3 (activators of dibasic and... [more]
Slc3a21.354e-2033.20solute carrier family 3 (activators of dibasic and... [more]
Slc3a24.365e-1732.20solute carrier family 3 (activators of dibasic and... [more]
Slc3a13.345e-1130.32solute carrier family 3, member 1 [Source:MGI Symb... [more]
back to top
BLAST of slc3a-1 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q7YQK3|4F2_RABIT6.821e-2426.684F2 cell-surface antigen heavy chain OS=Oryctolagu... [more]
sp|P10852|4F2_MOUSE9.472e-2033.204F2 cell-surface antigen heavy chain OS=Mus muscul... [more]
sp|Q794F9|4F2_RAT1.739e-1832.024F2 cell-surface antigen heavy chain OS=Rattus nor... [more]
sp|P08195|4F2_HUMAN9.927e-1626.764F2 cell-surface antigen heavy chain OS=Homo sapie... [more]
sp|Q07837|SLC31_HUMAN2.003e-1030.97Neutral and basic amino acid transport protein rBA... [more]
back to top
BLAST of slc3a-1 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A0H3YIT30.000e+0100.00Slc3a-1 OS=Schmidtea mediterranea OX=79327 GN=slc3... [more]
C1LL832.560e-11035.02Alpha-glucosidase OS=Schistosoma japonicum OX=6182... [more]
C1LL842.940e-11035.02Alpha-glucosidase OS=Schistosoma japonicum OX=6182... [more]
B9P3Q93.004e-11035.02Permease 1 heavy chain OS=Schistosoma japonicum OX... [more]
A0A183R8585.608e-11034.64Aamy domain-containing protein OS=Schistosoma rodh... [more]
back to top
BLAST of slc3a-1 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 4
Match NameE-valueIdentityDescription
slc3a2a3.674e-1930.564F2 cell-surface antigen heavy chain-like [Source:... [more]
si:dkey-202g17.36.911e-1826.924F2 cell-surface antigen heavy chain-like [Source:... [more]
slc3a2b2.616e-1627.544F2 cell-surface antigen heavy chain-like [Source:... [more]
slc3a11.653e-1129.71solute carrier family 3 member 1 [Source:NCBI gene... [more]
back to top
BLAST of slc3a-1 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 1
Match NameE-valueIdentityDescription
slc3a13.951e-826.32solute carrier family 3 member 1 [Source:ZFIN;Acc:... [more]
back to top
BLAST of slc3a-1 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 1
Match NameE-valueIdentityDescription
IMA57.647e-728.42Alpha-glucosidase; specificity for isomaltose, mal... [more]
back to top
BLAST of slc3a-1 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 1
Match NameE-valueIdentityDescription
EDO370341.170e-829.70Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of slc3a-1 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 4
Match NameE-valueIdentityDescription
slc3a2a1.705e-1830.00solute carrier family 3 member 2 [Source:NCBI gene... [more]
ENSORLT00000013036.24.537e-1724.834F2 cell-surface antigen heavy chain [Source:NCBI ... [more]
slc3a15.144e-1228.31solute carrier family 3 member 1 [Source:NCBI gene... [more]
si:dkey-202g17.31.518e-722.904F2 cell-surface antigen heavy chain [Source:NCBI ... [more]
back to top
BLAST of slc3a-1 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000019184.10.000e+092.45SMESG000019184.1[more]
SMESG000019192.10.000e+092.45SMESG000019192.1[more]
SMESG000019184.10.000e+092.55SMESG000019184.1[more]
SMESG000019192.10.000e+092.55SMESG000019192.1[more]
SMESG000019192.10.000e+090.97SMESG000019192.1[more]
back to top
Cross References
External references for this transcript
DatabaseAccession
SmedGD GBrowseSMED30015813
GenBankAKN21406.1
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30015813 ID=SMED30015813|Name=slc3a-1|organism=Schmidtea mediterranea sexual|type=transcript|length=1961bp
TAAGATTTTAATTTATTTTTAAGGCAATATTTTATTTTATCACACTTGAG
CTACAGTAAATTTTTGTGGAAAAATGGCAAATGACGTAGAAATGAACGAC
GTCCAGAAACCTTTAATGAAAGATTCTGATATAGAAAATATTCCTGAGGT
AGAATTTAAATCTATCAAACAAGATGCTGAAATTGTTAAAAAAGATGACG
AATTTCGAGGATTAACTAAAGAAGAATTGGAAAAATTTGCTAAAGATCCG
TTTTGGGTGAAACTAAGATTGATATTATTTATACTATTTTGGATTGTTTG
GGCTACAATGTTAGTGGCAGCTATACTAATTGTTGTATTTAGTAAGAAAT
GTCCAAAGAGACCAAAATTAGAATTCTGGCAGCAAAAAACAGGCTACTGG
GTTGATCCTTATGCATTTGTTGATACTGATCAGAATCTTGTCGGAGATTT
CAAAGGAATTATGACAAAATTGGACTATATCCAAAAGAAAGTAGGAGCTG
GCTACATAATTTTAAATCCCGTCTTTAAAGGCCAATACATTAAAGAAAAC
CAAATAAGTGAATTCGTCGAAATTTTTCGAAATGTCGATCCAAAATTAGG
AAGTATAGAATCATTTAAAGAATTAGTGAAAGATGCACGCAAAAGAGGAA
TCGAGATTGTTCTCAGTGTCGATTTAAATTCACTTTCTAATTCTTCTAAA
TTCATGGCTGATTTGAATCTCAAAAGTGATTCTGTTTTAACAGAAATTAA
AGAATCGATAAAAATATGGTTAAATTACGGTGTTAGGGGATTTTTGTTCA
CTAATTTGGGAATGTATGCAGAAAATGGCACGAAACCTGATCGTAAATGC
AAAAACGATTCGATTTCAAGCCCATATTCAACAATTGATGTGCAAATGTT
GTTGAAAGAAATCCGTAAAACCATGGATGAAGTTGCCAAAAGCACTGACA
AATCACGATTGTTAATAGTTGATGCTGGGGATGTTGGACTTGAAGTTGGC
AAAGCTGATCCATTACTTCAGTATTTGGGTAAAAAGGAAAATTTGGCTGA
TATGATTATTAGCAGGGAATTTCTAAAATACCGAGGATGGGAAACAAATT
GCGGCAGTAAACAATCTTCTATAAGCAATTATTTGTCGACAGTTCCTTCG
GATAAACGTAAAATGGTCGGTCTAACCTCTGCTACTTTATTCAGTCCTAG
AACTAATGATTTAATGAAAATTGTATCACCATTTTTACTTGAAGGGAATT
CAATTCTGTATTATGGATCGGAGATCAATATGCCCTGTGATGGAATGGAC
CTTTCTGGCTCCACTCTTTATCCTGTTAATTCAAAATCACCGAATAACTG
CAATCATATGATAATGCCTTGGGATAATAATGGTGATGAGTTTTCTGGTG
GGAAATTGAACCAATCTCAATACTTATCCCAATACAAAGATACCGTACAA
AGTCTCACTGCAACTGGAACTGGTGAAAATATTCTCAAACTACATGGAAG
ATTAATTAAAATACGCAATGAACCAAGTTTGTTATGGGGAAAAACAAAAC
TGATCCAAAGTCAAAAGACTTCAAATTATTCACACAATATTTTCACTCGA
CAAGCCGACGGGTTTCCTATAATTGTGGTTGCACTTTTGATTGATTCAAC
TGCTGAAAAACCTGGAAAAGTTTTTTCGTTTAAATCGATTTGTGAAAAAT
TTACGCCGATTTTGGTTTATCCGTCAAATGAAAATTTAGAAGAAAATAAA
GAAGTTGATACTAAAAACGTTTTCCTAAAAACCGTAACAACCGGCTCGGT
TCACGTTTTTAAATGCGCTGAATAACTTGTTGGATTTTATTAATAAAATA
GGATTTTAGTGATTTATGTGACTTTTGTATTCGTCAAATTTTTATTTGTT
TATTATTTGTCGAAATCATTTTTTTCTATTTAATAATATATAATTAATCG
CATCGAAAAAA
back to top

protein sequence of SMED30015813-orf-1

>SMED30015813-orf-1 ID=SMED30015813-orf-1|Name=SMED30015813-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=584bp
MANDVEMNDVQKPLMKDSDIENIPEVEFKSIKQDAEIVKKDDEFRGLTKE
ELEKFAKDPFWVKLRLILFILFWIVWATMLVAAILIVVFSKKCPKRPKLE
FWQQKTGYWVDPYAFVDTDQNLVGDFKGIMTKLDYIQKKVGAGYIILNPV
FKGQYIKENQISEFVEIFRNVDPKLGSIESFKELVKDARKRGIEIVLSVD
LNSLSNSSKFMADLNLKSDSVLTEIKESIKIWLNYGVRGFLFTNLGMYAE
NGTKPDRKCKNDSISSPYSTIDVQMLLKEIRKTMDEVAKSTDKSRLLIVD
AGDVGLEVGKADPLLQYLGKKENLADMIISREFLKYRGWETNCGSKQSSI
SNYLSTVPSDKRKMVGLTSATLFSPRTNDLMKIVSPFLLEGNSILYYGSE
INMPCDGMDLSGSTLYPVNSKSPNNCNHMIMPWDNNGDEFSGGKLNQSQY
LSQYKDTVQSLTATGTGENILKLHGRLIKIRNEPSLLWGKTKLIQSQKTS
NYSHNIFTRQADGFPIIVVALLIDSTAEKPGKVFSFKSICEKFTPILVYP
SNENLEENKEVDTKNVFLKTVTTGSVHVFKCAE*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: biological process
TermDefinition
GO:0006865amino acid transport
GO:0005975carbohydrate metabolic process
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000019muscle progenitor cell
PLANA:0000034epidermis
PLANA:0000099neuron
PLANA:0000101muscle cell
PLANA:0003116parenchymal cell
PLANA:0007528glial cell
Vocabulary: INTERPRO
TermDefinition
IPR042280SLC3A2
IPR006047Glyco_hydro_13_cat_dom
IPR013781Glyco_hydro_catalytic_dom
IPR031984SLC3A2_N
IPR017853Glycoside_hydrolase_SF
Vocabulary: molecular function
TermDefinition
GO:0003824catalytic activity
Vocabulary: cellular component
TermDefinition
GO:0016020membrane
GO:0016021integral component of membrane
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR006047Glycosyl hydrolase, family 13, catalytic domainSMARTSM00642aamycoord: 112..421
e-value: 7.1E-4
score: -70.7
IPR006047Glycosyl hydrolase, family 13, catalytic domainPFAMPF00128Alpha-amylasecoord: 124..208
e-value: 1.7E-11
score: 44.3
NoneNo IPR availableGENE3DG3DSA:3.20.20.80coord: 91..489
e-value: 7.5E-41
score: 142.5
NoneNo IPR availableTMHMMTMhelixcoord: 66..88
IPR031984Solute carrier family 3 member 2, N-terminal domainPFAMPF16028SLC3A2_Ncoord: 39..107
e-value: 1.3E-27
score: 95.2
IPR0422804F2 cell-surface antigen heavy chainPANTHERPTHR46673FAMILY NOT NAMEDcoord: 21..502
IPR017853Glycoside hydrolase superfamilySUPERFAMILYSSF51445(Trans)glycosidasescoord: 28..486