TNF receptor-associated factor

Overview
NameTNF receptor-associated factor
Smed IDSMED30015808
Length (bp)9536
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of TNF receptor-associated factor (SMED30015808) t-SNE clustered cells

Violin plots show distribution of expression levels for TNF receptor-associated factor (SMED30015808) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of TNF receptor-associated factor (SMED30015808) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for TNF receptor-associated factor (SMED30015808) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30015808

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 13

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
muscle cellSMED30015808SMESG000006455.1 dd_Smed_v4_11785_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
epidermal cellSMED30015808SMESG000006455.1 dd_Smed_v4_11785_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
medial muscle cellSMED30015808SMESG000006455.1 dd_Smed_v4_11785_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
protonephridiaSMED30015808SMESG000001468.1 dd_Smed_v4_5675_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
neuronSMED30015808SMESG000001468.1 dd_Smed_v4_5675_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
neuronSMED30015808SMESG000001468.1 dd_Smed_v4_5675_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult colorimetric in situ hybridization evidence
parenchymal cellSMED30015808SMESG000001468.1 dd_Smed_v4_5675_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
epidermal cellSMED30015808SMESG000001468.1 dd_Smed_v4_5675_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
neuronSMED30015808SMESG000066529.1 SMESG000053822.1 SMESG000029555.1 SMESG000010523.1 SMESG000023758.1 SMESG000074160.1 SMESG000019863.1 SMESG000001468.1 dd_Smed_v6_5675_0dd_Smed_v6PMID:29674432
Plass et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
cholinergic neuronSMED30015808SMESG000066529.1 SMESG000053822.1 SMESG000029555.1 SMESG000010523.1 SMESG000023758.1 SMESG000074160.1 SMESG000019863.1 SMESG000001468.1 dd_Smed_v6_5675_0dd_Smed_v6PMID:29674432
Plass et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
GABAergic neuronSMED30015808SMESG000066529.1 SMESG000053822.1 SMESG000029555.1 SMESG000010523.1 SMESG000023758.1 SMESG000074160.1 SMESG000019863.1 SMESG000001468.1 dd_Smed_v6_5675_0dd_Smed_v6PMID:29674432
Plass et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
parenchymal cellSMED30015808SMESG000066529.1 SMESG000053822.1 SMESG000029555.1 SMESG000010523.1 SMESG000023758.1 SMESG000074160.1 SMESG000019863.1 SMESG000001468.1 dd_Smed_v6_5675_0dd_Smed_v6PMID:29674432
Plass et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
glial cellSMED30015808SMESG000066529.1 SMESG000053822.1 SMESG000029555.1 SMESG000010523.1 SMESG000023758.1 SMESG000074160.1 SMESG000019863.1 SMESG000001468.1 dd_Smed_v6_5675_0dd_Smed_v6PMID:29674432
Plass et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of TNF receptor-associated factor vs. Ensembl Human
Match: TRAF3 (TNF receptor associated factor 3 [Source:HGNC Symbol;Acc:HGNC:12033])

HSP 1 Score: 114.39 bits (285), Expect = 2.624e-25
Identity = 55/143 (38.46%), Postives = 81/143 (56.64%), Query Frame = 3
Query: 4314 WKIGGWAEKVKSAEEEKIIGITSHQFYTEIGGYRMKLRVYPNGDGVGKGKYLSVYFLLARGRYDGKLEWPFNRKVTISIAKPGKWEERHSEKLGVDPRSMISQKPKSTENVAGGVPQFLLKKYV-TPQFVKDDTIYITIEVET 4739
            WKI  +  + + A   K + + S  FYT   GY+M  RVY NGDG+GKG +LS++F++ RG YD  L WPF +KVT+ +   G       +    DP S   +KP    N+A G P F+ +  +    ++KDDTI+I + V+T
Sbjct:  337 WKIRDYKRRKQEAVMGKTLSLYSQPFYTGYFGYKMCARVYLNGDGMGKGTHLSLFFVIMRGEYDALLPWPFKQKVTLMLMDQGSSRRHLGDAFKPDPNSSSFKKPTGEMNIASGCPVFVAQTVLENGTYIKDDTIFIKVIVDT 479          
BLAST of TNF receptor-associated factor vs. Ensembl Human
Match: TRAF3 (TNF receptor associated factor 3 [Source:HGNC Symbol;Acc:HGNC:12033])

HSP 1 Score: 114.775 bits (286), Expect = 4.042e-25
Identity = 55/143 (38.46%), Postives = 81/143 (56.64%), Query Frame = 3
Query: 4314 WKIGGWAEKVKSAEEEKIIGITSHQFYTEIGGYRMKLRVYPNGDGVGKGKYLSVYFLLARGRYDGKLEWPFNRKVTISIAKPGKWEERHSEKLGVDPRSMISQKPKSTENVAGGVPQFLLKKYV-TPQFVKDDTIYITIEVET 4739
            WKI  +  + + A   K + + S  FYT   GY+M  RVY NGDG+GKG +LS++F++ RG YD  L WPF +KVT+ +   G       +    DP S   +KP    N+A G P F+ +  +    ++KDDTI+I + V+T
Sbjct:  395 WKIRDYKRRKQEAVMGKTLSLYSQPFYTGYFGYKMCARVYLNGDGMGKGTHLSLFFVIMRGEYDALLPWPFKQKVTLMLMDQGSSRRHLGDAFKPDPNSSSFKKPTGEMNIASGCPVFVAQTVLENGTYIKDDTIFIKVIVDT 537          
BLAST of TNF receptor-associated factor vs. Ensembl Human
Match: TRAF3 (TNF receptor associated factor 3 [Source:HGNC Symbol;Acc:HGNC:12033])

HSP 1 Score: 114.775 bits (286), Expect = 4.042e-25
Identity = 55/143 (38.46%), Postives = 81/143 (56.64%), Query Frame = 3
Query: 4314 WKIGGWAEKVKSAEEEKIIGITSHQFYTEIGGYRMKLRVYPNGDGVGKGKYLSVYFLLARGRYDGKLEWPFNRKVTISIAKPGKWEERHSEKLGVDPRSMISQKPKSTENVAGGVPQFLLKKYV-TPQFVKDDTIYITIEVET 4739
            WKI  +  + + A   K + + S  FYT   GY+M  RVY NGDG+GKG +LS++F++ RG YD  L WPF +KVT+ +   G       +    DP S   +KP    N+A G P F+ +  +    ++KDDTI+I + V+T
Sbjct:  395 WKIRDYKRRKQEAVMGKTLSLYSQPFYTGYFGYKMCARVYLNGDGMGKGTHLSLFFVIMRGEYDALLPWPFKQKVTLMLMDQGSSRRHLGDAFKPDPNSSSFKKPTGEMNIASGCPVFVAQTVLENGTYIKDDTIFIKVIVDT 537          
BLAST of TNF receptor-associated factor vs. Ensembl Human
Match: TRAF3 (TNF receptor associated factor 3 [Source:HGNC Symbol;Acc:HGNC:12033])

HSP 1 Score: 114.39 bits (285), Expect = 5.535e-25
Identity = 55/143 (38.46%), Postives = 81/143 (56.64%), Query Frame = 3
Query: 4314 WKIGGWAEKVKSAEEEKIIGITSHQFYTEIGGYRMKLRVYPNGDGVGKGKYLSVYFLLARGRYDGKLEWPFNRKVTISIAKPGKWEERHSEKLGVDPRSMISQKPKSTENVAGGVPQFLLKKYV-TPQFVKDDTIYITIEVET 4739
            WKI  +  + + A   K + + S  FYT   GY+M  RVY NGDG+GKG +LS++F++ RG YD  L WPF +KVT+ +   G       +    DP S   +KP    N+A G P F+ +  +    ++KDDTI+I + V+T
Sbjct:  420 WKIRDYKRRKQEAVMGKTLSLYSQPFYTGYFGYKMCARVYLNGDGMGKGTHLSLFFVIMRGEYDALLPWPFKQKVTLMLMDQGSSRRHLGDAFKPDPNSSSFKKPTGEMNIASGCPVFVAQTVLENGTYIKDDTIFIKVIVDT 562          
BLAST of TNF receptor-associated factor vs. Ensembl Human
Match: TRAF3 (TNF receptor associated factor 3 [Source:HGNC Symbol;Acc:HGNC:12033])

HSP 1 Score: 114.39 bits (285), Expect = 5.535e-25
Identity = 55/143 (38.46%), Postives = 81/143 (56.64%), Query Frame = 3
Query: 4314 WKIGGWAEKVKSAEEEKIIGITSHQFYTEIGGYRMKLRVYPNGDGVGKGKYLSVYFLLARGRYDGKLEWPFNRKVTISIAKPGKWEERHSEKLGVDPRSMISQKPKSTENVAGGVPQFLLKKYV-TPQFVKDDTIYITIEVET 4739
            WKI  +  + + A   K + + S  FYT   GY+M  RVY NGDG+GKG +LS++F++ RG YD  L WPF +KVT+ +   G       +    DP S   +KP    N+A G P F+ +  +    ++KDDTI+I + V+T
Sbjct:  420 WKIRDYKRRKQEAVMGKTLSLYSQPFYTGYFGYKMCARVYLNGDGMGKGTHLSLFFVIMRGEYDALLPWPFKQKVTLMLMDQGSSRRHLGDAFKPDPNSSSFKKPTGEMNIASGCPVFVAQTVLENGTYIKDDTIFIKVIVDT 562          
BLAST of TNF receptor-associated factor vs. Ensembl Celegans
Match: trf-1 (TNF Receptor Associated Factor (TRAF) homolog; TRF-1 [Source:UniProtKB/TrEMBL;Acc:G5EG80])

HSP 1 Score: 83.1889 bits (204), Expect = 1.185e-15
Identity = 50/169 (29.59%), Postives = 83/169 (49.11%), Query Frame = 3
Query: 4314 WKIGGWAEKVKSAEEEKIIGITSHQFYTEIGGYRMKLRVYPNGDGVGKGKYLSVYFLLARGRYDGKLEWPFNRKVTISIAKPG-KWEERHSEKLGVDPRSMISQ-----KPKSTENVAGGVPQFLLKKYVTPQFVKDDTIYITIEVETEREMKIRIQQEQARPRISVLE 4802
            WKI    ++   A+      I S  F +   GY+M       GDG   GK +S+Y LL +G +D  LEWPF+R + IS+     + E+R +    +DPR + +      +P+   N A G   F     +   +VKDD IY+ I+V+    + ++++   A+ R  +L+
Sbjct:  267 WKIDKLQQRTNEAKSGADTTIFSVPFMSHRFGYKMMACACLFGDGSSAGKSISLYVLLLKGEFDPTLEWPFHRAIKISLLDQNPRPEDRVNITYVIDPRKLKANEKFLARPRGERNAAFGSQSF-CSLAILQNYVKDDKIYVQIDVDRCETLPVQLKSRDAKERKQMLD 434          
BLAST of TNF receptor-associated factor vs. Ensembl Celegans
Match: trf-2 (TNF Receptor Associated Factor (TRAF) homolog [Source:UniProtKB/TrEMBL;Acc:Q9N586])

HSP 1 Score: 63.929 bits (154), Expect = 7.327e-10
Identity = 46/139 (33.09%), Postives = 68/139 (48.92%), Query Frame = 3
Query: 4341 VKSAEEEKIIGITSHQFYTEIGGYRMKLRVYPNGDGVGKGKYLSVYFLLARGRYDGKLEWPFNRKVTISIAKPGKWEERHSEKLGVDPRSMIS---QKPKSTENVAGGVPQFLLKKYVTPQFVKDDTIYITIEVETERE 4748
            VK+ + +    I S  FY+   GY+M     P GDG+   +Y SV+  L +G +D  LEWPF   VT SI    K +E  ++ + V+    I    ++P+   N   G   FL    VT +F  D  I+I I+V   +E
Sbjct:  172 VKATKNKSHRSIYSQPFYSHGYGYKMMAVAAPYGDGLAFREYFSVFVCLMKGEWDDILEWPFRCDVTFSILSDDK-KELLTKTIYVNEMPEIQEFLERPEGLRNGTFGFQNFLPLAKVT-EFAADGDIFIQIKVLLSKE 308          
BLAST of TNF receptor-associated factor vs. Ensembl Fly
Match: Traf4 (gene:FBgn0026319 transcript:FBtr0334401)

HSP 1 Score: 78.1814 bits (191), Expect = 5.700e-14
Identity = 42/152 (27.63%), Postives = 83/152 (54.61%), Query Frame = 3
Query: 4314 WKIGGWAEKVKSAEEEKIIGITSHQFYTEIGGYRMKLRVYPNGDGVGKGKYLSVYFLLARGRYDGKLEWPFNRKVTISIAKPGKWEERH--SEKLGVDPRSMISQKPKSTENVAG-GVPQFLLKKYVTPQ-FVKDDTIYITIEVETEREMKI 4757
            WKI  W+ K+  A  +  + + S  FYT   GY+++  ++ NG+G G+  ++SVY  +  G YD  L+WPF+  +T ++ + G    +   +E    DP     Q+P +  +  G G P+F+  + +  + F+K DT+++ ++V+  + + +
Sbjct:  326 WKITDWSAKMAEARGKDGLELVSPPFYTSQYGYKLQASMFLNGNGPGENTHVSVYIKVLPGEYDALLKWPFSHSITFTLFEQGAQSGQGGVAESFVPDPTWENFQRPSNEPDQLGFGFPRFISHELLHSRPFIKGDTVFLRVKVDPSKIVAV 477          
BLAST of TNF receptor-associated factor vs. Ensembl Fly
Match: Traf4 (gene:FBgn0026319 transcript:FBtr0077429)

HSP 1 Score: 77.7962 bits (190), Expect = 6.936e-14
Identity = 42/152 (27.63%), Postives = 83/152 (54.61%), Query Frame = 3
Query: 4314 WKIGGWAEKVKSAEEEKIIGITSHQFYTEIGGYRMKLRVYPNGDGVGKGKYLSVYFLLARGRYDGKLEWPFNRKVTISIAKPGKWEERH--SEKLGVDPRSMISQKPKSTENVAG-GVPQFLLKKYVTPQ-FVKDDTIYITIEVETEREMKI 4757
            WKI  W+ K+  A  +  + + S  FYT   GY+++  ++ NG+G G+  ++SVY  +  G YD  L+WPF+  +T ++ + G    +   +E    DP     Q+P +  +  G G P+F+  + +  + F+K DT+++ ++V+  + + +
Sbjct:  335 WKITDWSAKMAEARGKDGLELVSPPFYTSQYGYKLQASMFLNGNGPGENTHVSVYIKVLPGEYDALLKWPFSHSITFTLFEQGAQSGQGGVAESFVPDPTWENFQRPSNEPDQLGFGFPRFISHELLHSRPFIKGDTVFLRVKVDPSKIVAV 486          
BLAST of TNF receptor-associated factor vs. Ensembl Zebrafish
Match: traf3 (TNF receptor-associated factor 3 [Source:ZFIN;Acc:ZDB-GENE-040801-257])

HSP 1 Score: 116.701 bits (291), Expect = 7.197e-26
Identity = 54/143 (37.76%), Postives = 83/143 (58.04%), Query Frame = 3
Query: 4314 WKIGGWAEKVKSAEEEKIIGITSHQFYTEIGGYRMKLRVYPNGDGVGKGKYLSVYFLLARGRYDGKLEWPFNRKVTISIAKPGKWEERHSEKLGVDPRSMISQKPKSTENVAGGVPQFLLKKYV-TPQFVKDDTIYITIEVET 4739
            WKI  +  + + A   K + + S  FYT   GY+M  RVY NGDG+GKG +LS++F++ RG YD  L+WPF +KVT+ +   G   +   +    DP S   ++P    N+A G P F+ +  +    ++KDDTI+I + V+T
Sbjct:  425 WKIRDYKRRKQEAVVSKTLSLYSQPFYTGYFGYKMCARVYLNGDGMGKGTHLSLFFVVMRGEYDALLQWPFKQKVTLMLMDQGPARKHLGDAFKPDPSSSSFRRPTGEMNIASGCPLFVAQTVLENGTYIKDDTIFIKVTVDT 567          
BLAST of TNF receptor-associated factor vs. Ensembl Zebrafish
Match: BX901915.1 (pep chromosome:GRCz11:CHR_ALT_CTG5_1_18:28764891:28768979:-1 gene:ENSDARG00000109857.1 transcript:ENSDART00000191629.1 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:BX901915.1)

HSP 1 Score: 103.605 bits (257), Expect = 2.627e-23
Identity = 54/145 (37.24%), Postives = 81/145 (55.86%), Query Frame = 3
Query: 4308 YTWKIGGWAEKVKSAEEEKIIGITSHQFYTEIGGYRMKLRVYPNGDGVGKGKYLSVYFLLARGRYDGKLEWPFNRKVTISIAKPGKWEERHSEKLGVDPRSMISQKPKSTENVAGGVPQF--LLKKYVTPQFVKDDTIYITIEVE 4736
            + WKI  +++K + A   +   + S  FYT   GY+M LR+Y NGDG G+G +LS++F++ RG  D  L+WPFN+KVT+ +       E   +    D  S   Q+P S  N+A G P F  L K      +++DDTI+I   V+
Sbjct:  128 FVWKISDFSKKRQDAVAGRAPAMFSPAFYTSKYGYKMCLRIYLNGDGTGRGTHLSLFFVVMRGHSDALLKWPFNQKVTLMLLDQNN-REHIIDAFRPDISSSSFQRPVSDMNIASGCPLFCPLSKLDSKNSYIRDDTIFIKAIVD 271          
BLAST of TNF receptor-associated factor vs. Ensembl Zebrafish
Match: AL844899.1 (pep chromosome:GRCz11:CHR_ALT_CTG5_2_4:28756846:28760787:-1 gene:ENSDARG00000111038.1 transcript:ENSDART00000183806.1 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:AL844899.1)

HSP 1 Score: 103.605 bits (257), Expect = 2.627e-23
Identity = 54/145 (37.24%), Postives = 81/145 (55.86%), Query Frame = 3
Query: 4308 YTWKIGGWAEKVKSAEEEKIIGITSHQFYTEIGGYRMKLRVYPNGDGVGKGKYLSVYFLLARGRYDGKLEWPFNRKVTISIAKPGKWEERHSEKLGVDPRSMISQKPKSTENVAGGVPQF--LLKKYVTPQFVKDDTIYITIEVE 4736
            + WKI  +++K + A   +   + S  FYT   GY+M LR+Y NGDG G+G +LS++F++ RG  D  L+WPFN+KVT+ +       E   +    D  S   Q+P S  N+A G P F  L K      +++DDTI+I   V+
Sbjct:  128 FVWKISDFSKKRQDAVAGRAPAMFSPAFYTSKYGYKMCLRIYLNGDGTGRGTHLSLFFVVMRGHSDALLKWPFNQKVTLMLLDQNN-REHIIDAFRPDISSSSFQRPVSDMNIASGCPLFCPLSKLDSKNSYIRDDTIFIKAIVD 271          
BLAST of TNF receptor-associated factor vs. Ensembl Zebrafish
Match: unm_sa808 (un-named sa808 [Source:ZFIN;Acc:ZDB-GENE-120727-21])

HSP 1 Score: 98.5969 bits (244), Expect = 1.444e-21
Identity = 53/145 (36.55%), Postives = 80/145 (55.17%), Query Frame = 3
Query: 4308 YTWKIGGWAEKVKSAEEEKIIGITSHQFYTEIGGYRMKLRVYPNGDGVGKGKYLSVYFLLARGRYDGKLEWPFNRKVTISIAKPGKWEERHSEKLGVDPRSMISQKPKSTENVAGGVPQF--LLKKYVTPQFVKDDTIYITIEVE 4736
            + W+I  + +K + A   +   + S  FYT   GY+M LR+Y NGDG G+G +LS++F++ RG  D  L+WPFN+KVT+ +       E   +    D  S   Q+P S  N+A G P F  L K      +++DDTI+I   V+
Sbjct:  134 FIWRISDFTKKRQDAIAGRAPAMFSPAFYTSKYGYKMCLRIYLNGDGTGRGTHLSLFFVVMRGMSDALLKWPFNQKVTLMLLDQSN-REHIIDAFRPDITSSSFQRPVSEMNIASGCPLFCPLAKLEGKNSYIRDDTIFIKAIVD 277          
BLAST of TNF receptor-associated factor vs. Ensembl Zebrafish
Match: traf1 (TNF receptor-associated factor 1 [Source:ZFIN;Acc:ZDB-GENE-071120-4])

HSP 1 Score: 102.834 bits (255), Expect = 1.615e-21
Identity = 56/148 (37.84%), Postives = 82/148 (55.41%), Query Frame = 3
Query: 4308 YTWKIGGWAEKVKSAEEEKIIGITSHQFYTEIGGYRMKLRVYPNGDGVGKGKYLSVYFLLARGRYDGKLEWPFNRKVTISIAKPGKWEERHSEKLGVDPRSMISQKPKSTENVAGGVPQFL-LKKYVTPQ--FVKDDTIYITIEVETE 4742
            + W++   ++K + A   + I   S  FYT   G+++ LR+Y NGDG GKG ++S++F++ +G YD  L WPF  KVT  +    +  E   +    D  SM   +P S  NVA G P F  LKK  +P+  + KDDTIYI   V+T 
Sbjct:  404 FYWRVCDVSQKQREAANSQKISQYSPAFYTARYGFKVCLRLYLNGDGAGKGSHISLFFVIMKGEYDPILSWPFKHKVTFFLLDQNQ-REHVIDAFRPDLSSMSFHQPVSDMNVASGCPLFFPLKKLRSPKHAYCKDDTIYIKCVVDTS 550          
BLAST of TNF receptor-associated factor vs. Ensembl Xenopus
Match: ssh2 (slingshot protein phosphatase 2 [Source:Xenbase;Acc:XB-GENE-993093])

HSP 1 Score: 113.235 bits (282), Expect = 1.153e-24
Identity = 54/143 (37.76%), Postives = 81/143 (56.64%), Query Frame = 3
Query: 4314 WKIGGWAEKVKSAEEEKIIGITSHQFYTEIGGYRMKLRVYPNGDGVGKGKYLSVYFLLARGRYDGKLEWPFNRKVTISIAKPGKWEERHSEKLGVDPRSMISQKPKSTENVAGGVPQFLLKKYV-TPQFVKDDTIYITIEVET 4739
            WKI  +  + + A   K + + S  FYT   GY+M  RVY NGDG+GKG +LS++F++ RG YD  L WPF +KV++ +   G       +    DP S   +KP    N+A G P F+ +  +    ++KDDTI+I + V+T
Sbjct:  388 WKIRDYKRRKQEAVMGKTLSLYSQPFYTGYFGYKMCARVYLNGDGMGKGTHLSLFFVIMRGEYDALLPWPFKQKVSLMLMDQGPSRRHLGDAFKPDPNSSSFKKPTGEMNIASGCPVFVAQTVLENGTYIKDDTIFIKVIVDT 530          
BLAST of TNF receptor-associated factor vs. Ensembl Xenopus
Match: slc12a1 (solute carrier family 12 member 1 [Source:Xenbase;Acc:XB-GENE-479925])

HSP 1 Score: 112.464 bits (280), Expect = 1.198e-24
Identity = 69/199 (34.67%), Postives = 103/199 (51.76%), Query Frame = 3
Query: 4191 TLELYEDEPYENL------PEKMLNEMEWQPEEDEEINDRARLAPYT-------WKIGGWAEKVKSAEEEKIIGITSHQFYTEIGGYRMKLRVYPNGDGVGKGKYLSVYFLLARGRYDGKLEWPFNRKVTISIAKPGKWEERHSEKLGVDPRSMISQKPKSTENVAGGVPQFL----LKKYVTPQFVKDDTIYITIEVE 4736
            TLE Y+D   +NL       + +L+  + Q   +EE   R RL   T       WKI  +  K + A E + + I S  FYT   GYR+  R Y NGDG GKG +LS+YF++ +G +D  L WPF +KVT+ +      +   ++    DP S   ++P S  N+A G P+F     L+      ++KDDT++I I V+
Sbjct:  287 TLEAYKDR-IDNLDGQFKKHDVLLSNHKMQMTSNEE---RFRLVEGTSYNGKLIWKITDYERKKREAMEGRAVSIFSQHFYTSWCGYRLCARAYLNGDGSGKGSFLSLYFVVMKGEFDSILLWPFKQKVTLMLLDQSGKKNHITDVFRADPNSSSFKRPDSEMNIASGCPRFASHAQLENPKNGCYIKDDTLFIKIVVD 481          
BLAST of TNF receptor-associated factor vs. Ensembl Xenopus
Match: slc12a1 (solute carrier family 12 member 1 [Source:Xenbase;Acc:XB-GENE-479925])

HSP 1 Score: 112.849 bits (281), Expect = 1.317e-24
Identity = 69/199 (34.67%), Postives = 103/199 (51.76%), Query Frame = 3
Query: 4191 TLELYEDEPYENL------PEKMLNEMEWQPEEDEEINDRARLAPYT-------WKIGGWAEKVKSAEEEKIIGITSHQFYTEIGGYRMKLRVYPNGDGVGKGKYLSVYFLLARGRYDGKLEWPFNRKVTISIAKPGKWEERHSEKLGVDPRSMISQKPKSTENVAGGVPQFL----LKKYVTPQFVKDDTIYITIEVE 4736
            TLE Y+D   +NL       + +L+  + Q   +EE   R RL   T       WKI  +  K + A E + + I S  FYT   GYR+  R Y NGDG GKG +LS+YF++ +G +D  L WPF +KVT+ +      +   ++    DP S   ++P S  N+A G P+F     L+      ++KDDT++I I V+
Sbjct:  337 TLEAYKDR-IDNLDGQFKKHDVLLSNHKMQMTSNEE---RFRLVEGTSYNGKLIWKITDYERKKREAMEGRAVSIFSQHFYTSWCGYRLCARAYLNGDGSGKGSFLSLYFVVMKGEFDSILLWPFKQKVTLMLLDQSGKKNHITDVFRADPNSSSFKRPDSEMNIASGCPRFASHAQLENPKNGCYIKDDTLFIKIVVD 531          
BLAST of TNF receptor-associated factor vs. Ensembl Xenopus
Match: slc12a1 (solute carrier family 12 member 1 [Source:Xenbase;Acc:XB-GENE-479925])

HSP 1 Score: 112.849 bits (281), Expect = 1.352e-24
Identity = 69/199 (34.67%), Postives = 103/199 (51.76%), Query Frame = 3
Query: 4191 TLELYEDEPYENL------PEKMLNEMEWQPEEDEEINDRARLAPYT-------WKIGGWAEKVKSAEEEKIIGITSHQFYTEIGGYRMKLRVYPNGDGVGKGKYLSVYFLLARGRYDGKLEWPFNRKVTISIAKPGKWEERHSEKLGVDPRSMISQKPKSTENVAGGVPQFL----LKKYVTPQFVKDDTIYITIEVE 4736
            TLE Y+D   +NL       + +L+  + Q   +EE   R RL   T       WKI  +  K + A E + + I S  FYT   GYR+  R Y NGDG GKG +LS+YF++ +G +D  L WPF +KVT+ +      +   ++    DP S   ++P S  N+A G P+F     L+      ++KDDT++I I V+
Sbjct:  338 TLEAYKDR-IDNLDGQFKKHDVLLSNHKMQMTSNEE---RFRLVEGTSYNGKLIWKITDYERKKREAMEGRAVSIFSQHFYTSWCGYRLCARAYLNGDGSGKGSFLSLYFVVMKGEFDSILLWPFKQKVTLMLLDQSGKKNHITDVFRADPNSSSFKRPDSEMNIASGCPRFASHAQLENPKNGCYIKDDTLFIKIVVD 532          
BLAST of TNF receptor-associated factor vs. Ensembl Xenopus
Match: ssh2 (slingshot protein phosphatase 2 [Source:Xenbase;Acc:XB-GENE-993093])

HSP 1 Score: 113.235 bits (282), Expect = 1.420e-24
Identity = 54/143 (37.76%), Postives = 81/143 (56.64%), Query Frame = 3
Query: 4314 WKIGGWAEKVKSAEEEKIIGITSHQFYTEIGGYRMKLRVYPNGDGVGKGKYLSVYFLLARGRYDGKLEWPFNRKVTISIAKPGKWEERHSEKLGVDPRSMISQKPKSTENVAGGVPQFLLKKYV-TPQFVKDDTIYITIEVET 4739
            WKI  +  + + A   K + + S  FYT   GY+M  RVY NGDG+GKG +LS++F++ RG YD  L WPF +KV++ +   G       +    DP S   +KP    N+A G P F+ +  +    ++KDDTI+I + V+T
Sbjct:  413 WKIRDYKRRKQEAVMGKTLSLYSQPFYTGYFGYKMCARVYLNGDGMGKGTHLSLFFVIMRGEYDALLPWPFKQKVSLMLMDQGPSRRHLGDAFKPDPNSSSFKKPTGEMNIASGCPVFVAQTVLENGTYIKDDTIFIKVIVDT 555          
BLAST of TNF receptor-associated factor vs. Ensembl Mouse
Match: Traf3 (TNF receptor-associated factor 3 [Source:MGI Symbol;Acc:MGI:108041])

HSP 1 Score: 114.39 bits (285), Expect = 3.035e-25
Identity = 55/143 (38.46%), Postives = 81/143 (56.64%), Query Frame = 3
Query: 4314 WKIGGWAEKVKSAEEEKIIGITSHQFYTEIGGYRMKLRVYPNGDGVGKGKYLSVYFLLARGRYDGKLEWPFNRKVTISIAKPGKWEERHSEKLGVDPRSMISQKPKSTENVAGGVPQFLLKKYV-TPQFVKDDTIYITIEVET 4739
            WKI  +  + + A   K + + S  FYT   GY+M  RVY NGDG+GKG +LS++F++ RG YD  L WPF +KVT+ +   G       +    DP S   +KP    N+A G P F+ +  +    ++KDDTI+I + V+T
Sbjct:  394 WKIRDYKRRKQEAVMGKTLSLYSQPFYTGYFGYKMCARVYLNGDGMGKGTHLSLFFVIMRGEYDALLPWPFKQKVTLMLMDQGSSRRHLGDAFKPDPNSSSFKKPTGEMNIASGCPVFVAQTVLENGTYIKDDTIFIKVIVDT 536          
BLAST of TNF receptor-associated factor vs. Ensembl Mouse
Match: Traf3 (TNF receptor-associated factor 3 [Source:MGI Symbol;Acc:MGI:108041])

HSP 1 Score: 114.39 bits (285), Expect = 3.035e-25
Identity = 55/143 (38.46%), Postives = 81/143 (56.64%), Query Frame = 3
Query: 4314 WKIGGWAEKVKSAEEEKIIGITSHQFYTEIGGYRMKLRVYPNGDGVGKGKYLSVYFLLARGRYDGKLEWPFNRKVTISIAKPGKWEERHSEKLGVDPRSMISQKPKSTENVAGGVPQFLLKKYV-TPQFVKDDTIYITIEVET 4739
            WKI  +  + + A   K + + S  FYT   GY+M  RVY NGDG+GKG +LS++F++ RG YD  L WPF +KVT+ +   G       +    DP S   +KP    N+A G P F+ +  +    ++KDDTI+I + V+T
Sbjct:  394 WKIRDYKRRKQEAVMGKTLSLYSQPFYTGYFGYKMCARVYLNGDGMGKGTHLSLFFVIMRGEYDALLPWPFKQKVTLMLMDQGSSRRHLGDAFKPDPNSSSFKKPTGEMNIASGCPVFVAQTVLENGTYIKDDTIFIKVIVDT 536          
BLAST of TNF receptor-associated factor vs. Ensembl Mouse
Match: Traf3 (TNF receptor-associated factor 3 [Source:MGI Symbol;Acc:MGI:108041])

HSP 1 Score: 114.39 bits (285), Expect = 3.908e-25
Identity = 55/143 (38.46%), Postives = 81/143 (56.64%), Query Frame = 3
Query: 4314 WKIGGWAEKVKSAEEEKIIGITSHQFYTEIGGYRMKLRVYPNGDGVGKGKYLSVYFLLARGRYDGKLEWPFNRKVTISIAKPGKWEERHSEKLGVDPRSMISQKPKSTENVAGGVPQFLLKKYV-TPQFVKDDTIYITIEVET 4739
            WKI  +  + + A   K + + S  FYT   GY+M  RVY NGDG+GKG +LS++F++ RG YD  L WPF +KVT+ +   G       +    DP S   +KP    N+A G P F+ +  +    ++KDDTI+I + V+T
Sbjct:  419 WKIRDYKRRKQEAVMGKTLSLYSQPFYTGYFGYKMCARVYLNGDGMGKGTHLSLFFVIMRGEYDALLPWPFKQKVTLMLMDQGSSRRHLGDAFKPDPNSSSFKKPTGEMNIASGCPVFVAQTVLENGTYIKDDTIFIKVIVDT 561          
BLAST of TNF receptor-associated factor vs. Ensembl Mouse
Match: Traf5 (TNF receptor-associated factor 5 [Source:MGI Symbol;Acc:MGI:107548])

HSP 1 Score: 107.457 bits (267), Expect = 7.554e-25
Identity = 55/183 (30.05%), Postives = 94/183 (51.37%), Query Frame = 3
Query: 4197 ELYEDEPYENLPEKMLNEMEWQPEEDEEINDRARLAPYTWKIGGWAEKVKSAEEEKIIGITSHQFYTEIGGYRMKLRVYPNGDGVGKGKYLSVYFLLARGRYDGKLEWPFNRKVTISIAKPGKWEERHSEKLGVDPRSMISQKPKSTENVAGGVPQFLLKKYVTPQ---FVKDDTIYITIEVE 4736
            E  + + + N+ +  LN+ E   E  +++          WK+  +  K + A E   + + S  FYT   GYR+  R Y NGDG GKG +LS+YF++ RG +D  L+WPF ++VT+ +      +    E    DP S   ++P    N+A G P+F+    +      ++KDDT+++ + V+
Sbjct:   64 ETSKHDAHINIHKAQLNKNE---ERFKQLEGACYSGKLIWKVTDYRVKKREAVEGHTVSVFSQPFYTSRCGYRLCARAYLNGDGSGKGTHLSLYFVVMRGEFDSLLQWPFRQRVTLMLLDQSGKKNHIVETFKADPNSSSFKRPDGEMNIASGCPRFVSHSTLENSKNTYIKDDTLFLKVAVD 243          
BLAST of TNF receptor-associated factor vs. Ensembl Mouse
Match: Traf5 (TNF receptor-associated factor 5 [Source:MGI Symbol;Acc:MGI:107548])

HSP 1 Score: 107.457 bits (267), Expect = 7.554e-25
Identity = 55/183 (30.05%), Postives = 94/183 (51.37%), Query Frame = 3
Query: 4197 ELYEDEPYENLPEKMLNEMEWQPEEDEEINDRARLAPYTWKIGGWAEKVKSAEEEKIIGITSHQFYTEIGGYRMKLRVYPNGDGVGKGKYLSVYFLLARGRYDGKLEWPFNRKVTISIAKPGKWEERHSEKLGVDPRSMISQKPKSTENVAGGVPQFLLKKYVTPQ---FVKDDTIYITIEVE 4736
            E  + + + N+ +  LN+ E   E  +++          WK+  +  K + A E   + + S  FYT   GYR+  R Y NGDG GKG +LS+YF++ RG +D  L+WPF ++VT+ +      +    E    DP S   ++P    N+A G P+F+    +      ++KDDT+++ + V+
Sbjct:   64 ETSKHDAHINIHKAQLNKNE---ERFKQLEGACYSGKLIWKVTDYRVKKREAVEGHTVSVFSQPFYTSRCGYRLCARAYLNGDGSGKGTHLSLYFVVMRGEFDSLLQWPFRQRVTLMLLDQSGKKNHIVETFKADPNSSSFKRPDGEMNIASGCPRFVSHSTLENSKNTYIKDDTLFLKVAVD 243          
BLAST of TNF receptor-associated factor vs. UniProt/SwissProt
Match: sp|Q13114|TRAF3_HUMAN (TNF receptor-associated factor 3 OS=Homo sapiens OX=9606 GN=TRAF3 PE=1 SV=2)

HSP 1 Score: 114.39 bits (285), Expect = 2.658e-24
Identity = 55/143 (38.46%), Postives = 81/143 (56.64%), Query Frame = 3
Query: 4314 WKIGGWAEKVKSAEEEKIIGITSHQFYTEIGGYRMKLRVYPNGDGVGKGKYLSVYFLLARGRYDGKLEWPFNRKVTISIAKPGKWEERHSEKLGVDPRSMISQKPKSTENVAGGVPQFLLKKYV-TPQFVKDDTIYITIEVET 4739
            WKI  +  + + A   K + + S  FYT   GY+M  RVY NGDG+GKG +LS++F++ RG YD  L WPF +KVT+ +   G       +    DP S   +KP    N+A G P F+ +  +    ++KDDTI+I + V+T
Sbjct:  420 WKIRDYKRRKQEAVMGKTLSLYSQPFYTGYFGYKMCARVYLNGDGMGKGTHLSLFFVIMRGEYDALLPWPFKQKVTLMLMDQGSSRRHLGDAFKPDPNSSSFKKPTGEMNIASGCPVFVAQTVLENGTYIKDDTIFIKVIVDT 562          
BLAST of TNF receptor-associated factor vs. UniProt/SwissProt
Match: sp|Q60803|TRAF3_MOUSE (TNF receptor-associated factor 3 OS=Mus musculus OX=10090 GN=Traf3 PE=1 SV=2)

HSP 1 Score: 114.39 bits (285), Expect = 2.734e-24
Identity = 55/143 (38.46%), Postives = 81/143 (56.64%), Query Frame = 3
Query: 4314 WKIGGWAEKVKSAEEEKIIGITSHQFYTEIGGYRMKLRVYPNGDGVGKGKYLSVYFLLARGRYDGKLEWPFNRKVTISIAKPGKWEERHSEKLGVDPRSMISQKPKSTENVAGGVPQFLLKKYV-TPQFVKDDTIYITIEVET 4739
            WKI  +  + + A   K + + S  FYT   GY+M  RVY NGDG+GKG +LS++F++ RG YD  L WPF +KVT+ +   G       +    DP S   +KP    N+A G P F+ +  +    ++KDDTI+I + V+T
Sbjct:  419 WKIRDYKRRKQEAVMGKTLSLYSQPFYTGYFGYKMCARVYLNGDGMGKGTHLSLFFVIMRGEYDALLPWPFKQKVTLMLMDQGSSRRHLGDAFKPDPNSSSFKKPTGEMNIASGCPVFVAQTVLENGTYIKDDTIFIKVIVDT 561          
BLAST of TNF receptor-associated factor vs. UniProt/SwissProt
Match: sp|P70191|TRAF5_MOUSE (TNF receptor-associated factor 5 OS=Mus musculus OX=10090 GN=Traf5 PE=1 SV=1)

HSP 1 Score: 108.997 bits (271), Expect = 1.568e-22
Identity = 49/144 (34.03%), Postives = 79/144 (54.86%), Query Frame = 3
Query: 4314 WKIGGWAEKVKSAEEEKIIGITSHQFYTEIGGYRMKLRVYPNGDGVGKGKYLSVYFLLARGRYDGKLEWPFNRKVTISIAKPGKWEERHSEKLGVDPRSMISQKPKSTENVAGGVPQFLLKKYVTPQ---FVKDDTIYITIEVE 4736
            WK+  +  K + A E   + + S  FYT   GYR+  R Y NGDG GKG +LS+YF++ RG +D  L+WPF ++VT+ +      +    E    DP S   ++P    N+A G P+F+    +      ++KDDT+++ + V+
Sbjct:  408 WKVTDYRVKKREAVEGHTVSVFSQPFYTSRCGYRLCARAYLNGDGSGKGTHLSLYFVVMRGEFDSLLQWPFRQRVTLMLLDQSGKKNHIVETFKADPNSSSFKRPDGEMNIASGCPRFVSHSTLENSKNTYIKDDTLFLKVAVD 551          
BLAST of TNF receptor-associated factor vs. UniProt/SwissProt
Match: sp|O00463|TRAF5_HUMAN (TNF receptor-associated factor 5 OS=Homo sapiens OX=9606 GN=TRAF5 PE=1 SV=2)

HSP 1 Score: 105.531 bits (262), Expect = 1.786e-21
Identity = 50/145 (34.48%), Postives = 82/145 (56.55%), Query Frame = 3
Query: 4314 WKIGGWAEKVKSAEEEKIIGITSHQFYTEIGGYRMKLRVYPNGDGVGKGKYLSVYFLLARGRYDGKLEWPFNRKVTISIA-KPGKWEERHSEKLGVDPRSMISQKPKSTENVAGGVPQFLLKKYV---TPQFVKDDTIYITIEVE 4736
            WK+  +  K + A +   + I S  FYT   GYR+  R Y NGDG G+G +LS+YF++ RG +D  L+WPF ++VT+ +  + GK  +   E    DP S   ++P    N+A G P+F+    +      ++KDDT+++ + V+
Sbjct:  408 WKVTDYKMKKREAVDGHTVSIFSQSFYTSRCGYRLCARAYLNGDGSGRGSHLSLYFVVMRGEFDSLLQWPFRQRVTLMLLDQSGK--KNIMETFKPDPNSSSFKRPDGEMNIASGCPRFVAHSVLENAKNAYIKDDTLFLKVAVD 550          
BLAST of TNF receptor-associated factor vs. UniProt/SwissProt
Match: sp|P39428|TRAF1_MOUSE (TNF receptor-associated factor 1 OS=Mus musculus OX=10090 GN=Traf1 PE=1 SV=2)

HSP 1 Score: 100.523 bits (249), Expect = 2.206e-20
Identity = 53/147 (36.05%), Postives = 79/147 (53.74%), Query Frame = 3
Query: 4308 YTWKIGGWAEKVKSAEEEKIIGITSHQFYTEIGGYRMKLRVYPNGDGVGKGKYLSVYFLLARGRYDGKLEWPFNRKVTISIAKPGKWEERHSEKLGVDPRSMISQKPKSTENVAGGVPQFL-LKKYVTPQ--FVKDDTIYITIEVET 4739
            + WKI    ++   +   + + + S  FYT   GY++ LR+Y NGDG GK  +LS++ ++ RG YD  L WPF  KVT  +       E   +    D  S   Q+P+S  NVA G P F  L K  +P+  +VKDDT+++   V+T
Sbjct:  262 FLWKITNVTKRCHESVCGRTVSLFSPAFYTAKYGYKLCLRLYLNGDGSGKKTHLSLFIVIMRGEYDALLPWPFRNKVTFMLLDQNN-REHAIDAFRPDLSSASFQRPQSETNVASGCPLFFPLSKLQSPKHAYVKDDTMFLKCIVDT 407          
BLAST of TNF receptor-associated factor vs. TrEMBL
Match: A0A355ABF2 (Uncharacterized protein OS=Flavobacteriaceae bacterium OX=1871037 GN=DDZ39_05755 PE=4 SV=1)

HSP 1 Score: 239.195 bits (609), Expect = 2.111e-97
Identity = 135/421 (32.07%), Postives = 227/421 (53.92%), Query Frame = 3
Query: 6420 KGMNAIITTILIWMMCVKGVEPFVVYDCDNIKIGDKYSLKETEECKAANPGRLQTTATAVSYNVYQEVDFIKTEIRECTVTRKIVAFHCRNHSQSXXXXXXXXXXXXXXXRSECEKGFNTGVIRIAGRIQVAAEDGKIKTTRVYAAGRIKAGDGSCEGGEYTLLNQLVRGVVVIESYQVKLEKFQSYFDPNTQAIKKYPQCVATHGSCTTRMSTIVYHADTRACRLTLLKSAIFDEVQGQVHSET----ETNTQKRAMEELRRIGQIRNPTITTIIGSETTPTGVNSTDSAIGMRFIKGRMVSKCDEMIISINYKEIFLS*ITISNVKAKIDPKDVKLYLYMNNKMDFLYHRGLASTEKIYYDLIKNDCILNREILKTKLAMAITNPDNAIPLLPLQEGYFGRIIGEVMYTYKCEKTIARL 7670
            K  N +I  +L++ +  KG +    YDCDN K+G ++SL + EEC  A P + +     + Y++YQE   I +  +ECTVTR+     C +HS S II+  +    + +    CE  F    IR+A ++ + A+ G +    +   G I A DG+CEGGEY    + ++  +VIE+YQ+ ++K +  FDP+T  +     C A    C    ++I+Y    + C L  LK+  FD ++G++        + N++ + +    +            I S  TP  + +  ++  +R ++   V KC + +   NY  I +S + +     KI  K++ L +Y NNK D+LYH  L   E +Y ++I NDC LNREIL+TK+A+ +TNP+ A P++PL +G F R++GEV+ T+KC++   ++
Sbjct:  371 KVFNFVILMLLLFSL-PKG-KAIKAYDCDNAKLGTQFSLLDAEECPEAYPNQFEKRFNRI-YHIYQERGLIYSAAKECTVTRRRSIRWCGHHSHSAIIKQPSMIEYLNIGHRNCEDAFRLKEIRLADKLILKAKPGILIQEDIIKVGSI-AFDGTCEGGEYWYQGKKIKQALVIETYQITIKKSEVAFDPDTNEMMSRSYCSAKSNFCFDGKTSIIYDIRKQECNLVFLKTVNFDVIRGKIFDNNLFIDKLNSRPKKIYRTEKT-----------INSHITPVVLIANKTSDAIRLVRKDQVVKCGQSVYLTNYDRIVVSTVRVKEAIIKISKKEINLAVYFNNKADYLYHHQLRQIEDLYREMIINDCKLNREILRTKMALIVTNPNIAAPVIPLGKGVFSRVLGEVLQTFKCKQVEVKI 776          

HSP 2 Score: 150.984 bits (380), Expect = 2.111e-97
Identity = 87/234 (37.18%), Postives = 139/234 (59.40%), Query Frame = 2
Query: 7661 RKVTGKLKIPSD-----KCINKGKIRFAQPVTRMINPAKFIPNMFSCSNVYGPLFETRDRSWLQFPTRVIVAPPRVFGLTELASEAEFKPV-DISRSGIYQTKDLERAREHLLFPTQRQTILSNIVTITRGNNY**KPNYELLLSPNHFQHATANMMKAMWGRFLIFGQMMAXXXXXXXXXXXXXXXXTQMLACFDIYKRERKINWKMTLGFLPFLAKTMV---LHGHSKDIHK 8335
            ++V  K+ I SD       I K K  + +PVTR++ P         CS ++ P ++  D +W+  P+   +APP+ F LT L +  +F  + D+ +SG+Y  K +E AR++LL+P  R  IL+ IV  + G+    +PNYELLLSPNHF+ A  N+MK +WGRFLIFGQ +AG++GI  ++  ++  + Q+ + +++YK     +WK+ LG +P LA+  +   LH    D+ K
Sbjct:  770 KQVEVKINISSDCTHELPVIYKNKFMYLEPVTRLLLPDVIKVKKIKCSPLFSPAYKLSDNTWIVTPSLTPIAPPKRFQLTNLRNAVKFSRLKDLMKSGLYDKKAMEDARKYLLYPQVRDRILTEIVETSLGDGN--RPNYELLLSPNHFEKAAKNVMKKVWGRFLIFGQAIAGLMGIYYVVIFLKTFIEQVTSTYELYKI-MGFSWKLILGIIPCLARPFISKKLHDKINDVEK 1000          
BLAST of TNF receptor-associated factor vs. TrEMBL
Match: F1AGB6 (Uncharacterized protein (Fragment) OS=Schmidtea mediterranea OX=79327 PE=2 SV=1)

HSP 1 Score: 244.588 bits (623), Expect = 9.921e-71
Identity = 124/142 (87.32%), Postives = 134/142 (94.37%), Query Frame = 3
Query: 2493 QEMKEPELKLQKDEQEASTSQEKERISEPIITKNRIQRILLQKIETRIRKEKPTWSKTQIENKIKEIWFQIKGPTKIMKEEEQPHINMLRRIPDDQTDEDESEISSLGGEIFQSCEENKPYKDESKSELEEMETSVPREDET 2918
            QEM+EP L+LQ+DEQE STSQEKE+ISEPIITKNRIQRILLQKIETRIRKEKPTWS+ QIEN+IKEIWFQ KG TK MK+EEQPHINMLR+IPDDQTDEDESEISSLGGEIFQSCEENKP KDESKSE+EEMET+V REDET
Sbjct:    1 QEMEEPRLELQRDEQEVSTSQEKEKISEPIITKNRIQRILLQKIETRIRKEKPTWSEEQIENRIKEIWFQTKGSTKRMKKEEQPHINMLRQIPDDQTDEDESEISSLGGEIFQSCEENKPNKDESKSEVEEMETNVSREDET 142          
BLAST of TNF receptor-associated factor vs. TrEMBL
Match: D5JG59 (TNF receptor-associated factor-2-like protein A OS=Dugesia japonica OX=6161 GN=TRAF-2A PE=2 SV=1)

HSP 1 Score: 128.257 bits (321), Expect = 1.081e-27
Identity = 62/150 (41.33%), Postives = 86/150 (57.33%), Query Frame = 3
Query: 4296 RLAPYTWKIGGWAEKVKSAEEEKIIGITSHQFYTEIGGYRMKLRVYPNGDGVGKGKYLSVYFLLARGRYDGKLEWPFNRKVTISIAKPGKWEERHSEKLGVDPRSMISQKPKSTENVAGGVPQFLLKKYVTPQ--FVKDDTIYITIEVET 4739
            R A + WK   +  +   AE    + +TS  FYT   GY+M LRVYP GDGVGKG +LSV+F + +G +D  L WPF +KVT+SI       + HS+    D RS   QKP    N+A G P+F+L   +     + K+DTI++ I V+T
Sbjct:  201 RNASFIWKFTDFEVRRVDAESGGRVSVTSDAFYTSEFGYKMCLRVYPAGDGVGKGTHLSVFFAIMKGEFDDLLSWPFKQKVTLSILDQESGSKPHSDTFKPDARSACYQKPTDECNIASGFPKFILLSLIMNNSIYCKNDTIFLKIAVDT 350          
BLAST of TNF receptor-associated factor vs. TrEMBL
Match: A0A2T7NN15 (Uncharacterized protein OS=Pomacea canaliculata OX=400727 GN=C0Q70_18362 PE=4 SV=1)

HSP 1 Score: 128.257 bits (321), Expect = 2.864e-26
Identity = 65/146 (44.52%), Postives = 90/146 (61.64%), Query Frame = 3
Query: 4314 WKIGGWAEKVKSAEEEKIIGITSHQFYTEIGGYRMKLRVYPNGDGVGKGKYLSVYFLLARGRYDGKLEWPFNRKVTISIAKPGKWEERHSEKLGVDPRSMISQKPKSTENVAGGVPQFL-LKKYVTPQF--VKDDTIYITIEVETE 4742
            WKI  +  K + A   K+  I S  FYT + GY+M  R+YPNGDG+GKG +LS++F+L RG YD  L WPF +KVT+ +    K+ E   +    DP S   ++P +  N+A G P FL L K V PQF  +KD+T++I I VET+
Sbjct:  400 WKISDFDRKRRDAISGKVTSIYSPAFYTGVVGYKMCARIYPNGDGMGKGTHLSLFFVLMRGHYDSLLPWPFQQKVTLMLID-QKYREHVVDAFRPDPTSSSFKRPTTEMNIASGCPVFLPLSKLVNPQFGYLKDNTMFIKIFVETD 544          
BLAST of TNF receptor-associated factor vs. TrEMBL
Match: H2YYB2 (MATH domain-containing protein OS=Ciona savignyi OX=51511 PE=4 SV=1)

HSP 1 Score: 117.857 bits (294), Expect = 3.422e-26
Identity = 57/144 (39.58%), Postives = 84/144 (58.33%), Query Frame = 3
Query: 4311 TWKIGGWAEKVKSAEEEKIIGITSHQFYTEIGGYRMKLRVYPNGDGVGKGKYLSVYFLLARGRYDGKLEWPFNRKVTISIAKPGKWEERHSEKLGVDPRSMISQKPKSTENVAGGVPQFLLKKYVT-PQFVKDDTIYITIEVET 4739
            TW I  +    + AE  +++ I S  FYT   GY+M  R+YPNGDG+GKG ++S++F++ +G YD  L WPF +KVT+ +   G      S+    DP S   ++P S  N+A G P F+    +    +VK+DTIYI I V+T
Sbjct:    9 TWIIQNYQRHKREAESGRVLSIYSQPFYTSRYGYKMCARIYPNGDGMGKGTHMSLFFVVMKGEYDALLPWPFRQKVTLMLLDQGVDRRHLSDTFRPDPTSSSFKQPTSDMNIASGCPLFVAHSVIKGSSYVKEDTIYIRIHVDT 152          
BLAST of TNF receptor-associated factor vs. Ensembl Cavefish
Match: ENSAMXT00000035169.1 (pep primary_assembly:Astyanax_mexicanus-2.0:9:3354744:3362219:1 gene:ENSAMXG00000029095.1 transcript:ENSAMXT00000035169.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 110.923 bits (276), Expect = 3.192e-27
Identity = 54/143 (37.76%), Postives = 81/143 (56.64%), Query Frame = 3
Query: 4314 WKIGGWAEKVKSAEEEKIIGITSHQFYTEIGGYRMKLRVYPNGDGVGKGKYLSVYFLLARGRYDGKLEWPFNRKVTISIAKPGKWEERHSEKLGVDPRSMISQKPKSTENVAGGVPQFLLKKYV-TPQFVKDDTIYITIEVET 4739
            WKI  +  +   A   K + + S  FYT   GY+M  RVY NGDG+GKG +LS++F++ RG YD  L WPF +KVT+ +   G   +   +    DP S   ++P    N+A G P F+ +  +    ++KDDTI+I + V+T
Sbjct:    8 WKIRDYKRRKAEAVASKTLSLYSQPFYTGYFGYKMCARVYLNGDGMGKGTHLSLFFVVMRGEYDALLPWPFKQKVTLMLMDQGPARKHLGDAFKPDPNSSSFRRPTGEMNIASGCPLFVAQTVLENGTYIKDDTIFIKVTVDT 150          
BLAST of TNF receptor-associated factor vs. Ensembl Cavefish
Match: traf2a (TNF receptor-associated factor 2-like [Source:NCBI gene;Acc:103036375])

HSP 1 Score: 102.834 bits (255), Expect = 6.218e-22
Identity = 54/145 (37.24%), Postives = 81/145 (55.86%), Query Frame = 3
Query: 4308 YTWKIGGWAEKVKSAEEEKIIGITSHQFYTEIGGYRMKLRVYPNGDGVGKGKYLSVYFLLARGRYDGKLEWPFNRKVTISIAKPGKWEERHSEKLGVDPRSMISQKPKSTENVAGGVPQF--LLKKYVTPQFVKDDTIYITIEVE 4736
            + WKI  +++K + A   +   + S  FYT   GY+M LR+Y NGDG G+G +LS++F++ RG  D  L+WPFN+KVT+ +       E   +    D  S   Q+P S  N+A G P F  L K      +++DDTI+I   V+
Sbjct:  312 FVWKISDFSKKRQDAVAGRAPAMFSPAFYTSKYGYKMCLRIYLNGDGTGRGTHLSLFFVVMRGHSDALLKWPFNQKVTLMLLDQNN-REHIIDAFRPDISSSSFQRPVSDMNIASGCPLFCPLSKLDSKNSYIRDDTIFIKAIVD 455          
BLAST of TNF receptor-associated factor vs. Ensembl Cavefish
Match: traf2a (TNF receptor-associated factor 2-like [Source:NCBI gene;Acc:103036375])

HSP 1 Score: 102.834 bits (255), Expect = 1.716e-21
Identity = 54/145 (37.24%), Postives = 81/145 (55.86%), Query Frame = 3
Query: 4308 YTWKIGGWAEKVKSAEEEKIIGITSHQFYTEIGGYRMKLRVYPNGDGVGKGKYLSVYFLLARGRYDGKLEWPFNRKVTISIAKPGKWEERHSEKLGVDPRSMISQKPKSTENVAGGVPQF--LLKKYVTPQFVKDDTIYITIEVE 4736
            + WKI  +++K + A   +   + S  FYT   GY+M LR+Y NGDG G+G +LS++F++ RG  D  L+WPFN+KVT+ +       E   +    D  S   Q+P S  N+A G P F  L K      +++DDTI+I   V+
Sbjct:  425 FVWKISDFSKKRQDAVAGRAPAMFSPAFYTSKYGYKMCLRIYLNGDGTGRGTHLSLFFVVMRGHSDALLKWPFNQKVTLMLLDQNN-REHIIDAFRPDISSSSFQRPVSDMNIASGCPLFCPLSKLDSKNSYIRDDTIFIKAIVD 568          
BLAST of TNF receptor-associated factor vs. Ensembl Cavefish
Match: traf2b (TNF receptor associated factor 2 [Source:NCBI gene;Acc:103028261])

HSP 1 Score: 102.064 bits (253), Expect = 2.336e-21
Identity = 52/145 (35.86%), Postives = 82/145 (56.55%), Query Frame = 3
Query: 4308 YTWKIGGWAEKVKSAEEEKIIGITSHQFYTEIGGYRMKLRVYPNGDGVGKGKYLSVYFLLARGRYDGKLEWPFNRKVTISIAKPGKWEERHSEKLGVDPRSMISQKPKSTENVAGGVPQF--LLKKYVTPQFVKDDTIYITIEVE 4736
            + WKI  ++ + + A   +   + S  FY+   GY+M LR+Y NGDG G+G +LS++F++ RG+YD  L+WPF++KVT+ +       E   +    D  S   Q+P S  N+A G P F  L K      +++DDTI+I   V+
Sbjct:  384 FVWKISDFSRRRQDALAGRAPAMFSPAFYSSKYGYKMCLRLYLNGDGTGRGSHLSLFFVVMRGKYDALLKWPFSQKVTLMLLDQNN-REHIIDAFRPDISSTSFQRPISEMNIASGCPLFCPLAKLAGKSSYLRDDTIFIKAIVD 527          
BLAST of TNF receptor-associated factor vs. Ensembl Cavefish
Match: traf1 (TNF receptor-associated factor 1-like [Source:NCBI gene;Acc:103045252])

HSP 1 Score: 98.5969 bits (244), Expect = 2.442e-20
Identity = 54/146 (36.99%), Postives = 83/146 (56.85%), Query Frame = 3
Query: 4308 YTWKIGGWAEKVKSAEEEKIIGITSHQFYTEIGGYRMKLRVYPNGDGVGKGKYLSVYFLLARGRYDGKLEWPFNRKVTISIAKPGKWEERHSEKLGVDPRSMISQKPKSTENVAGGVPQFL-LKKYVTPQ--FVKDDTIYITIEVE 4736
            + W+I   ++K+K A   +     S  FYT   G+++ +R+Y  GDGVGKG ++S++F++ +G YD  L WPF +KVT  +    +  E   +    D RS   Q+P S  NVA G P F  L K  +P+  +VKDDT++I   V+
Sbjct:  371 FLWRICDVSQKLKEAATGQKSSQYSPAFYTSRYGFKVCMRLYMYGDGVGKGTHISLFFVIMKGDYDPLLSWPFKQKVTFFLIDQNQ-REHVVDAFRPDLRSASFQRPVSEMNVASGCPLFFPLSKLRSPKHAYVKDDTLFIKCVVD 515          
BLAST of TNF receptor-associated factor vs. Ensembl Sea Lamprey
Match: ENSPMAT00000000074.1 (pep scaffold:Pmarinus_7.0:GL482142:165593:173010:-1 gene:ENSPMAG00000000066.1 transcript:ENSPMAT00000000074.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 116.701 bits (291), Expect = 5.340e-27
Identity = 59/167 (35.33%), Postives = 95/167 (56.89%), Query Frame = 3
Query: 4242 LNEMEWQPEEDEEINDRARLAPYTWKIGGWAEKVKSAEEEKIIGITSHQFYTEIGGYRMKLRVYPNGDGVGKGKYLSVYFLLARGRYDGKLEWPFNRKVTISIAKPGKWEERHSEKLGVDPRSMISQKPKSTENVAGGVPQFLLKKYV-TPQFVKDDTIYITIEVET 4739
            L EM+ + +  E  +   +L    WKI  +A + + A   + + + S  FYT   GYRM  R Y NGDGVG+G +LS++F++ RG YD  L WPF ++VT+++   G    + S+    DP S   ++P S  N+A G P F+    + +  +++DDTI+I + V+T
Sbjct:  308 LAEMDLRFQVLETASYNGKL---VWKIRDYARRKQDAVSGRTLSLYSQPFYTSPFGYRMCARAYLNGDGVGRGTHLSLFFVVMRGEYDALLPWPFRQRVTLTLLDQGAARRQLSDTFKPDPASSSFRRPTSDMNIASGCPLFVSHVALESASYLQDDTIFIKVVVDT 471          
BLAST of TNF receptor-associated factor vs. Ensembl Sea Lamprey
Match: ENSPMAT00000002130.1 (pep scaffold:Pmarinus_7.0:GL484662:8457:12718:-1 gene:ENSPMAG00000001936.1 transcript:ENSPMAT00000002130.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 115.161 bits (287), Expect = 8.684e-27
Identity = 53/142 (37.32%), Postives = 81/142 (57.04%), Query Frame = 3
Query: 4314 WKIGGWAEKVKSAEEEKIIGITSHQFYTEIGGYRMKLRVYPNGDGVGKGKYLSVYFLLARGRYDGKLEWPFNRKVTISIAKPGKWEERHSEKLGVDPRSMISQKPKSTENVAGGVPQFLLKKYV-TPQFVKDDTIYITIEVE 4736
            WKI  +A + + A   + + + S  FYT   GY+M  R Y NGDGVG+G +LS++F++ RG YD  LEWPF R+VT+S+   G      S+    DP S   ++P    NVA G P F+    +    ++ DDT+++ + V+
Sbjct:  272 WKIRDYARRKQEAASGRTLSLYSQPFYTSPFGYKMCARAYLNGDGVGRGTHLSLFFVVMRGEYDALLEWPFRRRVTLSLLDQGAARRHLSDTFTPDPASGSFRRPDGDMNVASGCPLFVSHVALEGSSYLVDDTVFVRVVVD 413          
BLAST of TNF receptor-associated factor vs. Ensembl Sea Lamprey
Match: traf6 (TNF receptor-associated factor 6 [Source:NCBI gene;Acc:554561])

HSP 1 Score: 60.8474 bits (146), Expect = 4.207e-9
Identity = 44/170 (25.88%), Postives = 75/170 (44.12%), Query Frame = 3
Query: 4308 YTWKI--------GGWAEKVKS--AEEEKIIGITSHQFYTEIGGYRMKLRV-------YPNGDG------VGKGKYLSVYFLLARGRYDGKLEWPFNRKVTISIAKPGKWEERH-SEKLGVDPRSMISQKPKSTENVAG-GVPQFL-LKKYVTPQFVKDDTIYITIEVET 4739
            +TW++        GG A    S     +    + S  FYT + GYR+ LR+        P G         G+  +L+++  L +G YD +L WPF  ++ IS+    + +  H +E +  DP+    Q+P    N  G G   F+ +       +++DD + +  EV T
Sbjct:  395 FTWRVERFSRLLPGGLASGFASDGMHPDAPAVMHSSGFYTGVPGYRLCLRLQVLSGREVPAGAASPSVLLAGRQPHLALFVHLLQGDYDHRLPWPFKGRIRISVVDQCERDSVHVTEMMDADPQLSAFQRPSVHRNPKGFGYMNFMDINTLHHRSYLRDDCLVVRCEVVT 564          
BLAST of TNF receptor-associated factor vs. Ensembl Sea Lamprey
Match: ENSPMAT00000003739.1 (pep scaffold:Pmarinus_7.0:GL499243:411:1384:-1 gene:ENSPMAG00000003418.1 transcript:ENSPMAT00000003739.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 46.9802 bits (110), Expect = 6.841e-6
Identity = 25/74 (33.78%), Postives = 31/74 (41.89%), Query Frame = 3
Query: 1455 RNKPNANEQCSTCQKMGHRSENCFRNY-------NCQICGKRGHTERICQQ----LNSKACYNCGQQGHIARRC 1643
            R  P   + C  C K GH +  C           +C  CGK+GH  R C           CY CGQ+GH+ R C
Sbjct:   55 RECPLPQDTCYNCGKGGHIARECPEGRQDRGGGPSCYTCGKQGHLARECSSGGGGPGDNKCYGCGQRGHMQRDC 128          

HSP 2 Score: 46.595 bits (109), Expect = 8.619e-6
Identity = 24/64 (37.50%), Postives = 31/64 (48.44%), Query Frame = 3
Query: 1482 CSTCQKMGHRSENC-FRNYNCQICGKRGHTERICQQLNSK-----ACYNCGQQGHIARRCNIRG 1655
            C  C + GH +  C      C  CGK GH  R C +         +CY CG+QGH+AR C+  G
Sbjct:   44 CYRCGEGGHIARECPLPQDTCYNCGKGGHIARECPEGRQDRGGGPSCYTCGKQGHLARECSSGG 107          
BLAST of TNF receptor-associated factor vs. Ensembl Nematostella
Match: EDO49464 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RG36])

HSP 1 Score: 107.842 bits (268), Expect = 1.238e-23
Identity = 55/145 (37.93%), Postives = 80/145 (55.17%), Query Frame = 3
Query: 4308 YTWKIGGWAEKVKSAEEEKIIGITSHQFYTEIGGYRMKLRVYPNGDGVGKGKYLSVYFLLARGRYDGKLEWPFNRKVTISIAKPGKWEERHSEKLGVDPRSMISQKPKSTENVAGGVPQFLLKKYV-TPQFVKDDTIYITIEVET 4739
            Y WKI  +  + +     K   I S  FY    GY+   RVYPNGDG+GKG +LS++F+L RG +D  L WPF +KVT  +    +  +   +    DP S   ++P S  N+A G P F+    + T  +V+DDT++I I V+T
Sbjct:  380 YIWKIDEYTRRYQEGVSGKTPSIYSPPFYVGRYGYKACARVYPNGDGMGKGSHLSLFFVLMRGEFDALLPWPFRQKVTFKLLDQDRVHDI-GDTFRPDPTSSSFKRPTSNMNIASGCPLFISHTNLQTRAYVRDDTMFIKIAVDT 523          
BLAST of TNF receptor-associated factor vs. Ensembl Nematostella
Match: EDO38873 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SBN4])

HSP 1 Score: 100.138 bits (248), Expect = 2.123e-21
Identity = 48/142 (33.80%), Postives = 79/142 (55.63%), Query Frame = 3
Query: 4314 WKIGGWAEKVKSAEEEKIIGITSHQFYTEIGGYRMKLRVYPNGDGVGKGKYLSVYFLLARGRYDGKLEWPFNRKVTISIAKPGKWEERHSEKLGVDPRSMISQKPKSTENVAGGVPQFLLKKYVTPQ-FVKDDTIYITIEVE 4736
            WKI   A K   A   ++    S  F+T   GY+M  R+Y NGDG+G+  ++S++F++ RG +D  L WPF +KVT+ +      E    +    DP S   Q+P++  N+A G P F   + +T   +++DDT+++ I V+
Sbjct:  337 WKITNVANKRSEATSGRVTSFYSPCFFTGPHGYKMCARIYLNGDGMGRNHHVSLFFVIMRGEFDALLRWPFRQKVTLMLLDQDNVEHV-IDAFRPDPSSSSFQRPRAEMNIASGCPLFCSHEQLTQHAYIRDDTMFLKIIVD 477          
BLAST of TNF receptor-associated factor vs. Ensembl Nematostella
Match: EDO35237 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SM27])

HSP 1 Score: 97.4413 bits (241), Expect = 2.363e-20
Identity = 47/144 (32.64%), Postives = 75/144 (52.08%), Query Frame = 3
Query: 4308 YTWKIGGWAEKVKSAEEEKIIGITSHQFYTEIGGYRMKLRVYPNGDGVGKGKYLSVYFLLARGRYDGKLEWPFNRKVTISIAKPGKWEERHSEKLGVDPRSMISQKPKSTENVAGGVPQFLLKKYV-TPQFVKDDTIYITIEVE 4736
            + WKI  + E+   A+      I S  FYT   GY++  R++PNGDG  +  YLS++  L RG YD  L WPF   +TI++          SE    DP S+  Q+P    NVA G P+F  +  + T  ++ ++ +++ + V+
Sbjct:  382 FLWKIDKFTERYAEAKSGNATSIYSSPFYTHRFGYKLCARLFPNGDGSARDNYLSIFIALMRGEYDSILPWPFQETITITLIDQDNGMNI-SETFDPDPCSISFQRPTRNINVASGCPRFCSQTVLRTRGYMNENCVFVKVVVD 524          
BLAST of TNF receptor-associated factor vs. Ensembl Nematostella
Match: EDO41243 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S4Z7])

HSP 1 Score: 85.5001 bits (210), Expect = 1.186e-16
Identity = 46/148 (31.08%), Postives = 80/148 (54.05%), Query Frame = 3
Query: 4308 YTWKIGGWAEKVKSAEEEKIIGITSHQFYTEIGGYRMKLRVYPNGDGVGKGKYLSVYFLLARGRYDGKLEWPFNR--KVTISIAKPGKWEERHSEKLGV-DPRSMISQKPKSTENVAGGVPQFLL-KKYVTPQFVKDDTIYITIEVET 4739
            + W+I  +A+ ++ A+    + + S  F+TE  GY+++  +YPNG   GK  ++S +  + RG YDG L WPF R  K+T+   K    + R+ EK  + +P      +PK+  N   G   F+  +K  T  +V D T+++ +EV +
Sbjct:  320 FVWRIPDFADSLRQAKLGLKVRLDSEPFFTEKNGYKLRATLYPNGTMSGKNTHISAFVSINRGEYDGILAWPFTRVIKITLLDQKENVLQRRNVEKTIIPNPSLENFHRPKTVSNNGRGSATFVSHEKLWTENYVVDGTLFMQVEVSS 467          
BLAST of TNF receptor-associated factor vs. Ensembl Nematostella
Match: EDO49545 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RGK7])

HSP 1 Score: 84.3445 bits (207), Expect = 1.461e-16
Identity = 51/153 (33.33%), Postives = 82/153 (53.59%), Query Frame = 3
Query: 4308 YTWKIGGWAEK----VKSAEEEKIIGITSHQFYTEIGGYRMKLRVYPNGDGVGKGKYLSVYFLLARGRYDGKLEWPFNRKVTISIAKPGKWEERHSEKLGVDPRSM-----ISQKPKSTENVAGGVPQFLLKKYV-TPQFVKDDTIYITIEVE 4736
            + WKI  +  +    V S EE   + I S  FYT   GY+++L+ Y NG   GKG +LS+Y ++ +G YD  LEWPF +K+T  +    + ++ H   L    RS+     +  +P   EN+  G P F+  + + + ++VKDD ++I   VE
Sbjct:  255 FLWKISNYKHQYDQAVASPEE---LAIFSPPFYTSQYGYKLRLKAYLNGRDRGKGTHLSLYIIIMKGDYDALLEWPFKQKITFYLIDQSE-KQNHRTHLLSPNRSLPNIKVVFNRPTVKENLGIGNPCFVPNEVLESGEYVKDDVMFIKAVVE 403          
BLAST of TNF receptor-associated factor vs. Ensembl Medaka
Match: traf3 (TNF receptor associated factor 3 [Source:NCBI gene;Acc:101161601])

HSP 1 Score: 115.161 bits (287), Expect = 5.837e-26
Identity = 54/144 (37.50%), Postives = 84/144 (58.33%), Query Frame = 3
Query: 4314 WKIGGWAEKVKSAEEEKIIGITSHQFYTEIGGYRMKLRVYPNGDGVGKGKYLSVYFLLARGRYDGKLEWPFNRKVTISIAKPGKWEERHSEKLGVDPRSMISQKPKSTENVAGGVPQFLLKKYV-TPQFVKDDTIYITIEVETE 4742
            WKI  +  + + A   K + + S  FYT   GY+M  RVY NGDG+GKG +LS++F++ RG YD  L WPF +KVT+ +   G   +   +    DP S   ++P +  N+A G P F+ +  + +  ++KDDTI+I + V+T 
Sbjct:  302 WKIRDYKRRKQDAVAGKTLSLYSQPFYTGYFGYKMCARVYLNGDGMGKGTHLSLFFVVMRGEYDALLPWPFKQKVTLMLMDQGPSRKHLGDAFKPDPSSSSFRRPVAEMNIASGCPLFVSQSVLESGTYIKDDTIFIKVTVDTS 445          
BLAST of TNF receptor-associated factor vs. Ensembl Medaka
Match: unm_sa808 (TNF receptor-associated factor 2 [Source:NCBI gene;Acc:101155367])

HSP 1 Score: 101.679 bits (252), Expect = 4.292e-21
Identity = 54/145 (37.24%), Postives = 81/145 (55.86%), Query Frame = 3
Query: 4308 YTWKIGGWAEKVKSAEEEKIIGITSHQFYTEIGGYRMKLRVYPNGDGVGKGKYLSVYFLLARGRYDGKLEWPFNRKVTISIAKPGKWEERHSEKLGVDPRSMISQKPKSTENVAGGVPQF--LLKKYVTPQFVKDDTIYITIEVE 4736
            + W+I  +A+K + A   +   + S  FYT   GY+M LR+Y NGDG G+G +LS++F++ RG  D  L+WPFN+KVT+ +       E   +    D  S   Q+P S  N+A G P F  L K      +++DDTI+I   V+
Sbjct:  449 FIWRISDFAKKRQDAVAGRAPAMFSPAFYTSKYGYKMCLRIYLNGDGTGRGTHLSLFFVVMRGLSDALLKWPFNQKVTLMLLDQSN-REHIIDAFRPDVTSSSFQRPVSEMNIASGCPLFCPLSKLDAKNSYIRDDTIFIKAIVD 592          
BLAST of TNF receptor-associated factor vs. Ensembl Medaka
Match: ENSORLT00000020861.2 (TNF receptor-associated factor 2 [Source:NCBI gene;Acc:101167626])

HSP 1 Score: 100.523 bits (249), Expect = 9.949e-21
Identity = 53/145 (36.55%), Postives = 80/145 (55.17%), Query Frame = 3
Query: 4308 YTWKIGGWAEKVKSAEEEKIIGITSHQFYTEIGGYRMKLRVYPNGDGVGKGKYLSVYFLLARGRYDGKLEWPFNRKVTISIAKPGKWEERHSEKLGVDPRSMISQKPKSTENVAGGVPQF--LLKKYVTPQFVKDDTIYITIEVE 4736
            + WKI  + +K + A   +   + S  FYT   GY+M LR+Y NGDG G+G +LS++F++ RG  D  L+WPFN+KVT+ +       E   +    D  S   Q+P S  N+A G P F  L K      +++D+TI+I   V+
Sbjct:  422 FIWKISDFTKKRQDAMAGRAPAMFSPAFYTSKYGYKMCLRIYLNGDGTGRGTHLSLFFVVMRGHSDALLKWPFNQKVTLMLLDQNN-REHIIDAFRPDISSSSFQRPVSDMNIASGCPLFCPLSKLDSKNSYIRDETIFIKAIVD 565          
BLAST of TNF receptor-associated factor vs. Ensembl Medaka
Match: traf2b (TNF receptor associated factor 2 [Source:NCBI gene;Acc:101159764])

HSP 1 Score: 98.9821 bits (245), Expect = 2.231e-20
Identity = 64/203 (31.53%), Postives = 102/203 (50.25%), Query Frame = 3
Query: 4182 NEITLELY------EDEPYENLPEKM------LNEMEWQPEEDEEINDRARLAPY----TWKIGGWAEKVKSAEEEKIIGITSHQFYTEIGGYRMKLRVYPNGDGVGKGKYLSVYFLLARGRYDGKLEWPFNRKVTISIAKPGKWEERHSEKLGVDPRSMISQKPKSTENVAGGVPQF--LLKKYVTPQFVKDDTIYITIEVE 4736
            + +TLE +      + E  ENL  K+      L   + Q  E E++    +   Y     WKI  ++ + + A   +   + S  FY+   GY+M LR+Y NGDG G+G +LS++F++ R +YD  L+WPF++KVT+ +       E   +    D  S   Q+P S  N+A G P F  L K      +++DDTI+I   V+
Sbjct:  311 SSLTLEAFSHQHRLDQEKIENLSNKIRQLERSLTVKDLQLSEAEQMVRELQYCTYDGIFVWKITDFSHRRQEAVSGRAPAMFSPAFYSSKYGYKMCLRLYLNGDGTGRGTHLSLFFVVMRSKYDALLKWPFSQKVTLMLLDQNN-REHIIDAFRPDITSTSFQRPVSEMNIASGCPLFCPLAKLAGKSPYLRDDTIFIKAIVD 512          
BLAST of TNF receptor-associated factor vs. Ensembl Medaka
Match: traf2b (TNF receptor associated factor 2 [Source:NCBI gene;Acc:101159764])

HSP 1 Score: 98.5969 bits (244), Expect = 3.072e-20
Identity = 64/203 (31.53%), Postives = 102/203 (50.25%), Query Frame = 3
Query: 4182 NEITLELY------EDEPYENLPEKM------LNEMEWQPEEDEEINDRARLAPY----TWKIGGWAEKVKSAEEEKIIGITSHQFYTEIGGYRMKLRVYPNGDGVGKGKYLSVYFLLARGRYDGKLEWPFNRKVTISIAKPGKWEERHSEKLGVDPRSMISQKPKSTENVAGGVPQF--LLKKYVTPQFVKDDTIYITIEVE 4736
            + +TLE +      + E  ENL  K+      L   + Q  E E++    +   Y     WKI  ++ + + A   +   + S  FY+   GY+M LR+Y NGDG G+G +LS++F++ R +YD  L+WPF++KVT+ +       E   +    D  S   Q+P S  N+A G P F  L K      +++DDTI+I   V+
Sbjct:  318 SSLTLEAFSHQHRLDQEKIENLSNKIRQLERSLTVKDLQLSEAEQMVRELQYCTYDGIFVWKITDFSHRRQEAVSGRAPAMFSPAFYSSKYGYKMCLRLYLNGDGTGRGTHLSLFFVVMRSKYDALLKWPFSQKVTLMLLDQNN-REHIIDAFRPDITSTSFQRPVSEMNIASGCPLFCPLAKLAGKSPYLRDDTIFIKAIVD 519          
BLAST of TNF receptor-associated factor vs. Planmine SMEST
Match: SMESG000072336.1 (SMESG000072336.1)

HSP 1 Score: 2580.82 bits (6688), Expect = 0.000e+0
Identity = 1394/1902 (73.29%), Postives = 1587/1902 (83.44%), Query Frame = 3
Query:  402 SRQITVNIDSISNHTRSKSQENREKSLLKTEEKRKVRYSRSVNTRVXXXXXXXXXXXXXXXXFEFNSSEENELRNIENQLTTIESVNEEDL----DNNPNMTTLINS-SIPDANTMSNNNNVMVGEFREKFRGEPFDGSLNKLDTFIKEFEVYKNICHWTDQKVKERLPLYLKGSAQDVFVEEARDVTKLTTWTEIKEFLIKIFGIEKKGNRKILDFLHRKQRRDESNAVYACELKKLCKEAFGETDLPEDKMVDVFIRGIKREDIRANLGCLAPETLDKAVAIANRCEAHLGLGYQVAVLATE--PTTSTVXXXXXXXXXXXXXXXFIPRAQQMFKPPATRNPEDRGNNQVSYNNNFRNKPNANEQCSTCQKMGHRSENCFRNYNCQICGKRGHTERICQQLNSKACYNCGQQGHIARRCNIRGESXXXXXXXXXXXXXXXXVIQEIDMLRETLQRMPMELKEMMQQMPTNIQQQRINVMRSNEEIQELRTRXXXXXXXXXXXXXXXXEAQEIQQRWENRKQTPKRINMMRMEIPDEIHTAEQCVENEGGGNMITDNEKTVELNTMEKIEAIKEFTXXXXXXXXXXXXTIIEKPNEPETQEIKRAEMMITEDQNKETLVYEIDELENEIMTQKTESTLEKIKQEEAVEQEEDQSKEKEAILKQEKAELRKKALILKIDGALKHLEQEQALDQKIEVMAKKVLSQEMKEPE-LKLQKDEQEASTSQEKE--RISEPIITKNRIQRILLQKIETRIRKEKPTWSKTQIENKIKEIWFQIKGPTKIMKEEEQPHINMLRRIPDDQTDEDESEISSLGGEIFQSCEENKPYKDESKSELEEMETSVPREDETEILKEINEIVEEVDRNQMFLNLRDTTAYSRIMKLIAKGYQQDNGTFTASWKDMIKKYQENLKEYDREEYQVIIDFPEIPRQIIATRGESTNELYDWVVKKLGPSYKNKPLYYQGRKIKRDIHLADALIWPKGINVVTLNKNETEETTAEIWQKIQILYTKEIKPGLEKERQKIMRQNQIKMTEQAIDQARKYINRLSLTRPISMKIFVEAVRDTDIMRFDNERTDELIAKYGEHQRDMRGDEPIKIRIKLPNDEIKEISVDPDCQMHELYRRINREIIQPIIESSDDGMVEDVAIMYHKRQISPRERTPIYELGIWEDGQTINIIAMDEPERKNTTKREQQIQEFQEEMKRKMDQILTIYQLWRQDAKLSTKLQPIDDSRCRSTPWKKVYDEKTKEWKWEMERTEPKWRKYVPGEAPEDAANEITLELYEDEPYENLPEKMLNEMEWQPEEDEEINDRARLAPYTWKIGGWAEKVKSAEEEKIIGITSHQFYTEIGGYRMKLRVYPNGDGVGKGKYLSVYFLLARGRYDGKLEWPFNRKVTISIAKPGKWEERHSEKLGVDPRSMISQKPKSTENVAGGVPQFLLKKYVTPQ---FVKDDTIYITIEVETEREMKIRIQQEQARPRISVLEKRIPGTRYLPTDIDDSVEEGLTRLTETQKCRELAAILRTGAKNQRRTVTDLAKWIIDSCNRVENLRNIVKEIEEYRRMYAWYPEQFREIIRKWKHTEWAAETIEKYSLKIMTPDFEPIEREFYITAKVSEVKKRIPYEPPFHLQYEGRSLDDDLEIGVTQMQLGLINILTVAKIAGRELNKREIKTKTPIGRQESLNTPEVPPAADEVIVITTGDEEILNDLNDIVDEETTRRIPESRDLFMTENEDDLITDEPDELVCGQRQPVEIIEPDTXXXXXXXXXXXXSSTGDEWDNWINERGATTSKETADEQPKRKETGTAMEKKSRGRPKIDKPAPERKTKEQMQMDQLTTKLNKLSQVTXXXXXXXXXXXXXXXWINRLITDMLGLANPEIKRNLKLNNIGAEAKQLWAAIKPIINKIMDNK 6068
            +++ITV I++   +TRS++++  E+SLL+ EE+ K    RSVNT +ST   TGTG+++G  DFE++SS+E+ + N EN +   E  +EE++    DNN NM T  NS +IP AN      N M+GEFREKFRGEPFDG+LNKLDTFIKEFEVYK ICHW      ER      GS Q     E + V +       K    K   IEKKGNRK+LDFLHRKQRRDESNAVYACELKKLCKEAFG+ D+PEDKMVDVF+RGIKREDIRANLGCLAPETLDKAV IANRCEAHLGLGYQVAV+ATE    T+  N NN +NN NPAMNQFIPRAQQMFK P TRNPE+ GNNQVSYNNNFRN  N NE C+TCQ+ GHR+E C+RN+NCQ CG+RGHTERIC+Q +++ACYNCGQ+GH+ARRCNI+      +  NN TRNPQINVIQEIDMLRETLQRMPMEL+EMMQQ+P N QQQRINVMRSNEE  E RT+EYQ+QQQAEWQRLQTEEAQEIQQRWENRKQTP+RINMMRME P E HTAEQC                       KIEAIKEF EEEKQ+RRQ KE  IEKP E E+QEIK+ E  I E+QN+++L+YE++ L  E + QK ++ LE+ +QEEA+EQE+DQ ++KE  LKQEK +L KK LI K+D  LK +EQEQ L+QKIE++A+K LS+E KE + L+LQ++EQEAST +EKE   +SEPIITKNRIQR+LLQ+IE RIRKE+P W++ QI NK+KEIW Q KG T   +E+E+PHINMLR+I D+QTDEDESEISSLGGEIFQSCEENKP KDESKSE+E ME +VPREDE EI++E+NEIVEEV +N+MF+NL+DTT YSRIMKLIA+GYQQDNG  TASWK  IK YQENLKEYD +EYQV+ID PEIPRQIIATRGE+TNELY+W+ +KLG SYKN+PLYY+G+KIKRD+HLADALIWP GINVVT + NE EET A+I QKI+                                           T PISMK+FVE VRDTDIMRFDNERTDELIAKYGEHQRDMRGDEPIKIRIKLPNDEIKEISVDPDCQ+HEL+RRIN+EIIQPIIESSDDGMVEDV IMYHKRQI PRERTPIYELGIWE+GQTINIIAMDEPERKNTTK+EQQI+EFQEEMKRKMD+ILT+YQ+WRQD KLSTKLQP+DDS CR+TPWKKVYDE  KEWKW+  RTEPKWRKY+PGEAPE+ ANE+TLELYED PYENLPE ++NEMEWQPEEDEEINDRARLAPYTWKI GWAEKVKSAEE KI  +TSHQFYTEIGGYRMKLR+YPNGDGV KGKYLSV+FLLARGRYDGKLEWPFNRK  ISIAKPG WEERHSEKLGV+PRS +SQKP++TENVAGG+PQFLLKK++T +   FVK+D IYITIEVETE+EMK+RIQ+E+ARPRI+VLEKRIPG+RYLPTD+DDSVEE LTRLTETQKCRELA ILRTGAKNQRRTVTDLAKWII+SCNR+ENLRN VKEIEEYRR+Y W+PEQFREIIRKWKH EWAAETIEKYSLKIMTPDFEPIE++FYITAKVSEVKKRIPYE PFHLQ+EGRSLDDD+EIGVT +QLG +N+LTV KIAGRELNKREIKTKTP+GRQESLNTPEVPPA DEV ++TTGDEEILNDLNDIV+EE TR+IPESRDLF TENE D+ TD+ D  VC Q+QP E +EPDTEEE +K+ERRR++STGDEWDNWI +RGATTS++T +EQPKR+ETGT MEKK RGRPK DKPA E+K+KEQMQMDQLTTKLNKLSQVTKQLQ KL GQEQGAKWINRLI DMLGLANPEIKRNLKLNNIG EAKQLWAAIKPII KIMD K
Sbjct:  700 NQRITVIIENKKYNTRSQTKKKEEESLLEEEERIKAISDRSVNTAISTVTVTGTGSENGPDDFEYSSSQESRIINTENIVEISEPGSEEEITKSRDNNLNMITDSNSNTIPTANP-----NAMIGEFREKFRGEPFDGNLNKLDTFIKEFEVYKTICHW------ERTGRIRGGSKQ---CNEIKHVDR------DKRIFNKDIRIEKKGNRKMLDFLHRKQRRDESNAVYACELKKLCKEAFGDKDIPEDKMVDVFVRGIKREDIRANLGCLAPETLDKAVEIANRCEAHLGLGYQVAVMATEQTTPTTNANTNNSSNNANPAMNQFIPRAQQMFKSPPTRNPENGGNNQVSYNNNFRNNSNTNETCTTCQRTGHRTEECYRNHNCQRCGRRGHTERICRQSDNRACYNCGQKGHLARRCNIK-RGPNQQGTNNQTRNPQINVIQEIDMLRETLQRMPMELREMMQQIPANTQQQRINVMRSNEETYEQRTKEYQQQQQAEWQRLQTEEAQEIQQRWENRKQTPRRINMMRMETPGETHTAEQC-----------------------KIEAIKEFAEEEKQKRRQQKEVKIEKPEEIESQEIKQEE--IPEEQNEKSLMYEVESLAREAVIQKLDNALERREQEEALEQEKDQLRKKEENLKQEKDQLNKKELIQKLDEGLKRIEQEQVLEQKIELLAEKALSRERKEEQRLELQRNEQEASTLKEKEGKMVSEPIITKNRIQRVLLQRIEARIRKEEPNWNEEQIGNKLKEIWLQTKGQTSKPEEKEKPHINMLRQIQDEQTDEDESEISSLGGEIFQSCEENKPNKDESKSEIEGMEINVPREDEIEIIREVNEIVEEVGKNEMFINLKDTTTYSRIMKLIARGYQQDNGIVTASWKTRIKGYQENLKEYDEKEYQVVIDHPEIPRQIIATRGENTNELYEWITEKLGTSYKNRPLYYKGKKIKRDVHLADALIWPDGINVVTFDNNEIEETIADICQKIK-------------------------------------------TMPISMKMFVEDVRDTDIMRFDNERTDELIAKYGEHQRDMRGDEPIKIRIKLPNDEIKEISVDPDCQIHELFRRINQEIIQPIIESSDDGMVEDVVIMYHKRQIGPRERTPIYELGIWENGQTINIIAMDEPERKNTTKKEQQIREFQEEMKRKMDRILTMYQVWRQDPKLSTKLQPVDDSCCRATPWKKVYDESKKEWKWKTVRTEPKWRKYIPGEAPEEVANEVTLELYEDGPYENLPEDIINEMEWQPEEDEEINDRARLAPYTWKISGWAEKVKSAEEGKITSLTSHQFYTEIGGYRMKLRIYPNGDGVAKGKYLSVFFLLARGRYDGKLEWPFNRKTVISIAKPGHWEERHSEKLGVEPRSAVSQKPRTTENVAGGMPQFLLKKFITGETSPFVKNDAIYITIEVETEKEMKLRIQREEARPRINVLEKRIPGSRYLPTDMDDSVEEELTRLTETQKCRELATILRTGAKNQRRTVTDLAKWIIESCNRIENLRNTVKEIEEYRRIYVWHPEQFREIIRKWKHAEWAAETIEKYSLKIMTPDFEPIEKDFYITAKVSEVKKRIPYELPFHLQHEGRSLDDDIEIGVTPLQLGRVNVLTVTKIAGRELNKREIKTKTPVGRQESLNTPEVPPATDEVTIVTTGDEEILNDLNDIVNEEATRKIPESRDLFTTENEIDITTDDLDGFVCAQKQPAETVEPDTEEEERKEERRRQNSTGDEWDNWIKDRGATTSRDTTNEQPKRRETGTVMEKKPRGRPKSDKPAAEKKSKEQMQMDQLTTKLNKLSQVTKQLQRKLTGQEQGAKWINRLIADMLGLANPEIKRNLKLNNIGTEAKQLWAAIKPIITKIMDIK 2512          

HSP 2 Score: 893.649 bits (2308), Expect = 0.000e+0
Identity = 461/528 (87.31%), Postives = 482/528 (91.29%), Query Frame = 2
Query: 7685 IPSDKCIN------KGKIRFAQPVTRMINPAKFIPNMFSCSNVYGPLFETRDRSWLQFPTRVIVAPPRVFGLTELASEAEFKPVDISRSGIYQTKDLERAREHLLFPTQRQTILSNIVTITRGNNY**KPNYELLLSPNHFQHATANMMKAMWGRFLIFGQMMAXXXXXXXXXXXXXXXXTQMLACFDIYKRERKINWKMTLGFLPFLAKTMVLHGHSKDIHKIKRLVGILTRMNGTDEEVGRNFKAIMKMEAERTRIKRQKTSNWKRWIDFKXXXXXXXXXXX-QRGTQKLTQGKLQQWENQKTKLNEHYNHPPPAYECLKK*TKPVEQNTPIPRPTTLRNIYPTLYEPNLAELVSRTSRRSKSVDQEVETRTIAMLQTLAGPTLTIPIDINEFEIKAMIDTGANISEIKMYKIQGRLWPCIEETNMDVITCSKESVSVIGKIWSTIEYKNVKINTYLAVIRKLSADCIIGTDLMPERLKEIIIELGSMELRDRTGRICTLKFEARCSENIVVPGRTQMICYVKVDE 9247
            IP DKCIN      KGKIRFAQPVTRMINP KF+PNMFSCSNVYGPLFET D SWLQFPTRVIVAPP+VFGLTELASEAEFKPVDISRSGIYQTKDLERAREHLLFP QRQ ILSNIVTIT GNNY  KPNYELLLSP+HFQHAT NMMKAMWGRFLIFGQMMAGILGIILIIQIVRVILTQMLACFDIYKRERKINWKM +GFLPFLAKTMVLHGHSKDIHKIKRLVGILTRM GTDEEVGR FKAIM++EAERTRIKRQKTSNW+RW+DFKNDSSDNS ND+ Q GTQ LTQGK QQWENQK KLNE YNHPPP YECLKK T PVE+N P+P+PTTLR+IYPT YEPN AEL+ RTSRRSKSVDQ+VETRTIAMLQT AGPTLTIPIDIN  EIKAMIDTGANIS IKM KI G+LWPCIEETNMDVITCSKESVSVIGKIWS IEYKNVKI+TYLAVIRKLSADCIIGTDLMPE LKEIII+LGSMELRD+TGRIC LK E RCSE I+VPGRTQMICYVK+ E
Sbjct: 2977 IPRDKCINELEIVYKGKIRFAQPVTRMINPTKFVPNMFSCSNVYGPLFETGDGSWLQFPTRVIVAPPKVFGLTELASEAEFKPVDISRSGIYQTKDLERAREHLLFPAQRQAILSNIVTITGGNNYGEKPNYELLLSPDHFQHATKNMMKAMWGRFLIFGQMMAGILGIILIIQIVRVILTQMLACFDIYKRERKINWKMAIGFLPFLAKTMVLHGHSKDIHKIKRLVGILTRMKGTDEEVGRKFKAIMRLEAERTRIKRQKTSNWRRWLDFKNDSSDNSDNDDNQGGTQMLTQGKTQQWENQKMKLNEQYNHPPPVYECLKKSTIPVERNIPMPKPTTLRSIYPTPYEPNWAELIPRTSRRSKSVDQDVETRTIAMLQTPAGPTLTIPIDINGIEIKAMIDTGANISAIKMDKIPGKLWPCIEETNMDVITCSKESVSVIGKIWSIIEYKNVKISTYLAVIRKLSADCIIGTDLMPELLKEIIIDLGSMELRDKTGRICALKSEVRCSEKIIVPGRTQMICYVKIRE 3504          

HSP 3 Score: 782.326 bits (2019), Expect = 0.000e+0
Identity = 389/431 (90.26%), Postives = 405/431 (93.97%), Query Frame = 3
Query: 6399 SDPKTARKGMNAIITTILIWMMCVKGVEPFVVYDCDNIKIGDKYSLKETEECKAANPGRLQTTATAVSYNVYQEVDFIKTEIRECTVTRKIVAFHCRNHSQSXXXXXXXXXXXXXXXRSECEKGFNTGVIRIAGRIQVAAEDGKIKTTRVYAAGRIKAGDGSCEGGEYTLLNQLVRGVVVIESYQVKLEKFQSYFDPNTQAIKKYPQCVATHGSCTTRMSTIVYHADTRACRLTLLKSAIFDEVQGQVHSETETNTQKRAMEELRRIGQIRNPTITTIIGSETTPTGVNSTDSAIGMRFIKGRMVSKCDEMIISINYKEIFLS*ITISNVKAKIDPKDVKLYLYMNNKMDFLYHRGLASTEKIYYDLIKNDCILNREILKTKLAMAITNPDNAIPLLPLQEGYFGRIIGEVMYTYKCEKTIARLPENSRSP 7691
            SDP+TARKGMNAIITTILIWMMC+KGVEPFVVYDCDN+KIGDKYSLKETEECKAANPGRLQ TA AVSYNVYQEVDFIKTEIRECTVTRKIVAFHC +HS STIIE GTETTVVTVTRSECE+GFNTG+IRIAGRIQVAAEDGKIKTTRVYAAGRI AGDGSCEGGEYTLLNQLV+GVVVIESYQVKLEK+Q YFDP+TQA+KKYPQC+AT  SCTT MSTIVY+ADTRACRLTLLKSAIFDEVQGQV+SETETNTQK AMEELRR G+I  PTITT IGSE TPT V STDS IGMRFIKGRMVSKCDEM+IS NYK IFLS  TISN KAKIDPKDVKLYLYMNNKMDFLYHRGLASTEKIYYDLIKNDCILNREILKTKLAMAITNPDNAIPLLPLQEGYFGRI+GEVMYTYKCEKTIARLPENS  P
Sbjct: 2548 SDPRTARKGMNAIITTILIWMMCIKGVEPFVVYDCDNVKIGDKYSLKETEECKAANPGRLQRTAVAVSYNVYQEVDFIKTEIRECTVTRKIVAFHCGHHSHSTIIEAGTETTVVTVTRSECEEGFNTGIIRIAGRIQVAAEDGKIKTTRVYAAGRITAGDGSCEGGEYTLLNQLVKGVVVIESYQVKLEKYQGYFDPDTQAMKKYPQCLATDRSCTTGMSTIVYNADTRACRLTLLKSAIFDEVQGQVYSETETNTQKNAMEELRRTGKIGKPTITTNIGSEATPTVVISTDSTIGMRFIKGRMVSKCDEMVISTNYKGIFLSRSTISNAKAKIDPKDVKLYLYMNNKMDFLYHRGLASTEKIYYDLIKNDCILNREILKTKLAMAITNPDNAIPLLPLQEGYFGRIVGEVMYTYKCEKTIARLPENSTIP 2978          
BLAST of TNF receptor-associated factor vs. Planmine SMEST
Match: SMESG000000671.1 (SMESG000000671.1)

HSP 1 Score: 2572.73 bits (6667), Expect = 0.000e+0
Identity = 1311/1567 (83.66%), Postives = 1375/1567 (87.75%), Query Frame = 3
Query: 2709 GPTKIMKEEEQPHINMLRRIPDDQTDEDESEISSLGGEIFQSCEENKPYKDESKSELEEMETSVPREDETEILKEINEIVEEVDRNQMFLNLRDTTAYSRIMKLIAKGYQQDNGTFTASWKDMIKKYQENLKEYDREEYQVIIDFPEIPRQIIATRGESTNELYDWVVKKLGPSYKNKPLYYQGRKIKRDIHLADALIWPKGINVVTLNKNETEETTAEIWQKIQILYTKEIKPGLEKERQKIMRQNQIKMTEQAIDQARKYINRLSLTRPISMKIFVEAVRDTDIMRFDNERTDELIAKYGEHQRDMRGDEPIKIRIKLPNDEIKEISVDPDCQMHELYRRINREIIQPIIESSDDGMVEDVAIMYHKRQISPRERTPIYELGIWEDGQTINIIAMDEPERKNTTKREQQIQEFQEEMKRKMDQILTIYQLWRQDAKLSTKLQPIDDSRCRSTPWKKVYDEKTKEWKWEMERTEPKWRKYVPGEAPEDAANEITLELYEDEPYENLPEKMLNEMEWQPEEDEEINDRARLAPYTWKIGGWAEKVKSAEEEKIIGITSHQFYTEIGGYRMKLRVYPNGDGVGKGKYLSVYFLLARGRYDGKLEWPFNRKVTISIAKPGKWEERHSEKLGVDPRSMISQKPKSTENVAGGVPQFLLKKYVTPQFVKDDTIYITIEVETEREMKIRIQQEQARPRISVLEKRIPGTRYLPTDIDDSVEEGLTRLTETQKCRELAAILRTGAKNQRRTVTDLAKWIIDSCNRVENLRNIVKEIEEYRRMYAWYPEQFREIIRKWKHTEWAAETIEKYSLKIMTPDFEPIEREFYITAKVSEVKKRIPYEPPFHLQYEGRSLDDDLEIGVTQMQLGLINILTVAKIAGRELNKREIKTKTPIGRQESLNTPEVPPAADEVIVITTGDEEILNDLNDIVDEETTRRIPESRDLFMTENEDDLITDEPDELVCGQRQPVEIIEPDTXXXXXXXXXXXXSSTGDEWDNWINERGATTSKETADEQPKRKETGTAMEKKSRGRPKIDKPAPERKTKEQMQMDQLTTKLNKLSQVTXXXXXXXXXXXXXXXWINRLITDMLGLANPEIKRNLKLNNIGAEAKQLWAAIKPIINKIMDNKVRTTTKDPEELLLIINHLTKRSDDPNRYLVGMAYLMYNTIVIYRKRTPRYNPNGYEFAITDIIRKVIEPFILTQGGWQAFINLVSKDDQTEIMQTKLKELLTEFETTINASDPKTARKGMNAIITTILIWMMCVKGVEPFVVYDCDNIKIGDKYSLKETEECKAANPGRLQTTATAVSYNVYQEVDFIKTEIRECTVTRKIVAFHCRNHSQSXXXXXXXXXXXXXXXRSECEKGFNTGVIRIAGRIQVAAEDGKIKTTRVYAAGRIKAGDGSCEGGEYTLLNQLVRGVVVIESYQVKLEKFQSYFDPNTQAIKKYPQCVATHGSCTTRMSTIVYHADTRACRLTLLKSAIFDEVQGQVHSETETNTQKRAMEELRRIGQIRNPTITTIIGSETTPTGVNSTDSAIGMRFIKGRMVSKCDEMIISINYKEIFLS*ITISNVKAKIDPK 7409
            GPTKIMK+EEQPHINMLR+IPDDQTDEDESEISSLGGEIFQSCEENKP K+E KSE+EEMET+V REDE EILKEINEIVEEVDRNQMFLNL+DTT YSRIMKLIAKGYQQDNGTFTASWKDMIKKYQENLKEYDR EYQVIID PEIPRQIIATRGESTNELYDWVVKKLGPSYKN+PLY+QGRKIKRDIHLADALIWP GINV+TLNK+ETEETTAEIWQKIQILY KEIKPGLEKERQKIMRQNQIKMTEQ+IDQARKYINRLSLTRPISMK+FVEAVRDT IMRFDNERTDELIAKYGEHQRDM+GDEPIKI+IKLPNDE KEI VDPDCQMHELYRRIN EIIQPIIESSDDGMVEDVAIMYHKRQISPRERTPIYELGIWEDGQTINIIAMDEPE KNTTK+E+QIQEFQEEMKRK++QILTIYQ+WRQDAKLSTKLQPI DSRCRSTPWK+VYDEK KEWKW+MERTEPK RKYVPGEAPEDAANEITLELYEDEPYE+LP++M+NE+EWQPEEDEEINDRARLAPYTWKIGGWAEKVKSAEEEKIIGITSHQFYTEIGGYRMKLRVYPN +GV KGKYL VYFLLARGRYD KLEWPFNRK+ ISIAKPGKWE RHSEKLGVDPRSMI QKPKSTENVAGGVPQFLLKK+VT QFVKDDTIYITIEVET++EMK                                            KCRELAAILRTGAKNQRR VTDLAKWIIDSCNR+ENLRNIVKEIEEYRR+YAWYPEQFREIIRKWKH EWAAETIEKYSLKIMTPDFEPIER+FYITAKVSEVKKRIPYE PFHLQYEGRSL+DDLEIGVT MQ GLINILTVAKIAGRELNKREIKTKTPIGRQESLNTPEVPPAADEVIVITTGDEEILNDLNDIVDEETTRRIPESRDLFMTENE+D+ITDE DEL   +  P                           DNWINERGATTS +TADEQ KRKETGTAMEKKSRGRPK +KPAPERKTKEQ+QMDQLTTKLNKLSQVTKQLQGKLKGQEQGAKWINRLI DMLGLANPEIKRNLKLNNIG EAKQL AAIKPIINKIMDNKVRTTTKDPEELLLIINHLTKRSDDPNRYLVGMAYLMYNT+ IYRKRTPRYNPNGYEFAITDIIRK                        TE+MQTKLKELLTEFETTINASDPKTARKGMNAIITTILIWMMC+KGVEPFVVYDCDNIKIGDKYSLKE EECKAANPGRLQTTATAVSYNVYQEVDFIKTEI+E +VTR IVAFHC +HS STIIE GTETTVV+VTR ECE+GF +G I+IAGRIQVAAE+GKIKT+RVYAAGRI AGDG+CE GEYTLLNQLV+G+V   +               TQA+KKYPQC+AT  SC T MSTIVYHADTR CRLTLLKSAIFDEVQGQVHSETETNTQK AM+ELRR G+I  PTITT IGSE TPT V STD+ IGMRFIKGRMVSKCDEM+ S NYK IFLS   I N KA   P+
Sbjct:  490 GPTKIMKKEEQPHINMLRQIPDDQTDEDESEISSLGGEIFQSCEENKPNKEEPKSEIEEMETNVRREDEIEILKEINEIVEEVDRNQMFLNLKDTTMYSRIMKLIAKGYQQDNGTFTASWKDMIKKYQENLKEYDRAEYQVIIDLPEIPRQIIATRGESTNELYDWVVKKLGPSYKNRPLYHQGRKIKRDIHLADALIWPNGINVITLNKSETEETTAEIWQKIQILYIKEIKPGLEKERQKIMRQNQIKMTEQSIDQARKYINRLSLTRPISMKMFVEAVRDTYIMRFDNERTDELIAKYGEHQRDMKGDEPIKIKIKLPNDETKEILVDPDCQMHELYRRINLEIIQPIIESSDDGMVEDVAIMYHKRQISPRERTPIYELGIWEDGQTINIIAMDEPEWKNTTKKERQIQEFQEEMKRKINQILTIYQVWRQDAKLSTKLQPISDSRCRSTPWKRVYDEKAKEWKWKMERTEPKCRKYVPGEAPEDAANEITLELYEDEPYEDLPDEMINEIEWQPEEDEEINDRARLAPYTWKIGGWAEKVKSAEEEKIIGITSHQFYTEIGGYRMKLRVYPNREGVAKGKYLLVYFLLARGRYDEKLEWPFNRKIIISIAKPGKWEGRHSEKLGVDPRSMICQKPKSTENVAGGVPQFLLKKHVTSQFVKDDTIYITIEVETKQEMKT---------------------------------------NRNAKCRELAAILRTGAKNQRRAVTDLAKWIIDSCNRIENLRNIVKEIEEYRRVYAWYPEQFREIIRKWKHIEWAAETIEKYSLKIMTPDFEPIERDFYITAKVSEVKKRIPYELPFHLQYEGRSLEDDLEIGVTPMQFGLINILTVAKIAGRELNKREIKTKTPIGRQESLNTPEVPPAADEVIVITTGDEEILNDLNDIVDEETTRRIPESRDLFMTENENDIITDELDELKEREETP--------------------KLNRRRMDNWINERGATTSGDTADEQLKRKETGTAMEKKSRGRPKTNKPAPERKTKEQVQMDQLTTKLNKLSQVTKQLQGKLKGQEQGAKWINRLIADMLGLANPEIKRNLKLNNIGTEAKQLCAAIKPIINKIMDNKVRTTTKDPEELLLIINHLTKRSDDPNRYLVGMAYLMYNTMAIYRKRTPRYNPNGYEFAITDIIRK------------------------TEMMQTKLKELLTEFETTINASDPKTARKGMNAIITTILIWMMCIKGVEPFVVYDCDNIKIGDKYSLKEAEECKAANPGRLQTTATAVSYNVYQEVDFIKTEIKEYSVTRIIVAFHCGHHSHSTIIEAGTETTVVSVTRRECEEGFTSGRIQIAGRIQVAAEEGKIKTSRVYAAGRITAGDGTCEEGEYTLLNQLVKGIVDTLT--------------RTQAMKKYPQCLATDRSCNTGMSTIVYHADTRTCRLTLLKSAIFDEVQGQVHSETETNTQKSAMDELRRTGRIGKPTITTTIGSEVTPTVVISTDTTIGMRFIKGRMVSKCDEMVSSTNYKGIFLSRTKIPNTKAANRPQ 1959          

HSP 2 Score: 666.381 bits (1718), Expect = 0.000e+0
Identity = 356/471 (75.58%), Postives = 400/471 (84.93%), Query Frame = 2
Query: 7886 ELASEAEFKPVDISRSGIYQTKDLERAREH---------LLFPTQRQTILSNIVTITRGNNY**KPNYELLLSPNHFQHATANMMKAMWGRFLIFGQMMAXXXXXXXXXXXXXXXXTQMLACFDIYKRERKINWKMTLGFLPFLAKTMVLHGHSKDIHKIKRLVGILTRMNGTDEEVGRNFKAIMKMEAERTRIKRQKTSNWKRWIDFKXXXXXXXXXXX-QRGTQKLTQGKLQQWENQKTKLNEHYNHPPPAYECLKK*TKPVEQNTP------IPRPTTLRNIYPTLYEPNLAELVSRTSRRSKSVDQEVETRTIAMLQTLAGPTLTIPIDINEFEIKAMIDTGANISEIKMYKIQGRLWPCIEETNMDVITCSKESVSVIGKIWSTIEYKNVKINTYLAVIRKLSADCIIGTDLMPERLKEIIIELGSMELRDRTGRICTLKFEARCSENIVVPGRTQMICYVKVDEE 9250
            E+ S   +K + +SR+ I  TK   R + +          + P+ +Q ILSNIVTIT GNNY  KPNYELLLSP+HFQHATANMMKAMWGRFLIFG MMAGILGIILIIQIVRVILTQMLACFDIYKRERKINWKM +GFLPFLAKTMVLHGHSKDIHKIKRLVGILT+MNG DEEVGR FKAIM++E+++TRIKRQKT+NWKRW++ K+D+SDNS N+  Q G Q LTQ +L+QWEN+KT+ +EHYNHPPP YECLKK TK VE+NTP      IPRPTTLRNIYP  +EPN A+L+ RTS+RS+SVDQ+ +TRTIAMLQTLAGPTLTIPI+IN  EIKAMIDTGANIS IKM KI GRLWPCIEE NMDVITC+KESV+VIGKIWS IEYKNVKINTYLAVIR+LSADCIIGTDLMPE LKEIII+LGSMELRD+TGRIC LK E RC E IVV GRTQMICYVKV+EE
Sbjct: 1932 EMVSSTNYKGIFLSRTKIPNTKAANRPQRYERSGTSQRTFIIPSAKQAILSNIVTITGGNNYGEKPNYELLLSPDHFQHATANMMKAMWGRFLIFGPMMAGILGIILIIQIVRVILTQMLACFDIYKRERKINWKMAIGFLPFLAKTMVLHGHSKDIHKIKRLVGILTKMNGIDEEVGRKFKAIMRLESKKTRIKRQKTNNWKRWMNIKDDNSDNSDNNENQGGPQILTQEQLKQWENRKTRHSEHYNHPPPVYECLKKATKSVERNTPVERHVPIPRPTTLRNIYPAPHEPNWADLMPRTSQRSRSVDQDPKTRTIAMLQTLAGPTLTIPIEINGVEIKAMIDTGANISAIKMDKIPGRLWPCIEEANMDVITCTKESVAVIGKIWSIIEYKNVKINTYLAVIRRLSADCIIGTDLMPELLKEIIIDLGSMELRDKTGRICMLKSEVRCLEKIVVSGRTQMICYVKVNEE 2402          

HSP 3 Score: 42.743 bits (99), Expect = 0.000e+0
Identity = 18/19 (94.74%), Postives = 19/19 (100.00%), Query Frame = 1
Query: 9247 GEMIFEPNHKFEKKRELPL 9303
            GEM+FEPNHKFEKKRELPL
Sbjct: 2405 GEMVFEPNHKFEKKRELPL 2423          

HSP 4 Score: 296.204 bits (757), Expect = 1.416e-79
Identity = 208/366 (56.83%), Postives = 229/366 (62.57%), Query Frame = 3
Query:  399 SSRQITVNIDSISNHTRSKSQENREKSLLKTEEKRKVRYSRSVNTRVXXXXXXXXXXXXXXXXFEFNSSEENELRNIENQLTTIESVNEE-DLDNNPNMTTLINS---SIPDANTMSNNNNVMVGEFREKFRGEPFDGSLNKLDTFIKEFEVYKNICHWTDQKVKERLPLYLKGSAQDVFVEEARDVTKLTTWTEIKEFLIKIFGIEKKGNRKILDFLHRKQRRDESNAVYACELKKLCKEAFGETDLPEDKMVDVFIRGIKREDIRANLGCLAPETLDKAVAIANRCEAHLGLGYQVAVLATEPTTSTVXXXXXXXXXXXXXXXFIPRAQQMFKPPATRNPEDRGNNQVSYNNNFRNKPNANEQC 1484
            +S++ITVNIDSISNHTRSKS+ENREKSLLK EEK++V  SRSVNT  STTA TGTGTDSGLTDFEFNSSEENE+ N ENQL  IES +EE + DNNPNMTT INS   SIPD NTM NNNN  VGEFREKFRGEPFDGSL+KLDTFIKEFEVYK ICHWTDQK                  +EA                   FG       K++D   R+ +R++  A   C    L  E         DK V +                            ANRCEAHLGLGYQ+AVL TEPTT T+   NQNNN NPAMNQFIPRAQQMFKPPATRNPEDRGNNQ+        KP   EQC
Sbjct:  124 ASKRITVNIDSISNHTRSKSKENREKSLLKAEEKKRVLNSRSVNTGTSTTAVTGTGTDSGLTDFEFNSSEENEILNTENQLAIIESGSEEENQDNNPNMTTSINSNTPSIPDPNTMPNNNNATVGEFREKFRGEPFDGSLSKLDTFIKEFEVYKTICHWTDQK---------------KLCKEA-------------------FGDADLPEDKMVDVFIREIKREDIRANLGC----LAPETL-------DKAVAI----------------------------ANRCEAHLGLGYQIAVLTTEPTTPTI---NQNNNTNPAMNQFIPRAQQMFKPPATRNPEDRGNNQM--------KPTPAEQC 405          

HSP 5 Score: 119.013 bits (297), Expect = 5.760e-26
Identity = 80/119 (67.23%), Postives = 95/119 (79.83%), Query Frame = 3
Query: 2004 AEQCVENEGGGNMITDNEKTVELNTMEKIEAIKEFTXXXXXXXXXXXXTIIEKPNEPETQEIKRAEMMITEDQNKETLVYEIDELENE-----IMTQKTESTLEKIKQEEAVEQEEDQS 2345
            AEQCVENEGGG+MITD EKT +LNTMEKIEAIKEFTEEE+QRRRQLKE   EKP+EPE QEIK+AEMMITEDQNKETL YE+DELE E     IM ++ +  +  ++Q    + +ED+S
Sbjct:  402 AEQCVENEGGGDMITD-EKTTKLNTMEKIEAIKEFTEEERQRRRQLKEMTTEKPDEPEAQEIKQAEMMITEDQNKETLTYEMDELEKEIGPTKIMKKEEQPHINMLRQIPDDQTDEDES 519          
BLAST of TNF receptor-associated factor vs. Planmine SMEST
Match: SMESG000000671.1 (SMESG000000671.1)

HSP 1 Score: 2570.81 bits (6662), Expect = 0.000e+0
Identity = 1311/1567 (83.66%), Postives = 1375/1567 (87.75%), Query Frame = 3
Query: 2709 GPTKIMKEEEQPHINMLRRIPDDQTDEDESEISSLGGEIFQSCEENKPYKDESKSELEEMETSVPREDETEILKEINEIVEEVDRNQMFLNLRDTTAYSRIMKLIAKGYQQDNGTFTASWKDMIKKYQENLKEYDREEYQVIIDFPEIPRQIIATRGESTNELYDWVVKKLGPSYKNKPLYYQGRKIKRDIHLADALIWPKGINVVTLNKNETEETTAEIWQKIQILYTKEIKPGLEKERQKIMRQNQIKMTEQAIDQARKYINRLSLTRPISMKIFVEAVRDTDIMRFDNERTDELIAKYGEHQRDMRGDEPIKIRIKLPNDEIKEISVDPDCQMHELYRRINREIIQPIIESSDDGMVEDVAIMYHKRQISPRERTPIYELGIWEDGQTINIIAMDEPERKNTTKREQQIQEFQEEMKRKMDQILTIYQLWRQDAKLSTKLQPIDDSRCRSTPWKKVYDEKTKEWKWEMERTEPKWRKYVPGEAPEDAANEITLELYEDEPYENLPEKMLNEMEWQPEEDEEINDRARLAPYTWKIGGWAEKVKSAEEEKIIGITSHQFYTEIGGYRMKLRVYPNGDGVGKGKYLSVYFLLARGRYDGKLEWPFNRKVTISIAKPGKWEERHSEKLGVDPRSMISQKPKSTENVAGGVPQFLLKKYVTPQFVKDDTIYITIEVETEREMKIRIQQEQARPRISVLEKRIPGTRYLPTDIDDSVEEGLTRLTETQKCRELAAILRTGAKNQRRTVTDLAKWIIDSCNRVENLRNIVKEIEEYRRMYAWYPEQFREIIRKWKHTEWAAETIEKYSLKIMTPDFEPIEREFYITAKVSEVKKRIPYEPPFHLQYEGRSLDDDLEIGVTQMQLGLINILTVAKIAGRELNKREIKTKTPIGRQESLNTPEVPPAADEVIVITTGDEEILNDLNDIVDEETTRRIPESRDLFMTENEDDLITDEPDELVCGQRQPVEIIEPDTXXXXXXXXXXXXSSTGDEWDNWINERGATTSKETADEQPKRKETGTAMEKKSRGRPKIDKPAPERKTKEQMQMDQLTTKLNKLSQVTXXXXXXXXXXXXXXXWINRLITDMLGLANPEIKRNLKLNNIGAEAKQLWAAIKPIINKIMDNKVRTTTKDPEELLLIINHLTKRSDDPNRYLVGMAYLMYNTIVIYRKRTPRYNPNGYEFAITDIIRKVIEPFILTQGGWQAFINLVSKDDQTEIMQTKLKELLTEFETTINASDPKTARKGMNAIITTILIWMMCVKGVEPFVVYDCDNIKIGDKYSLKETEECKAANPGRLQTTATAVSYNVYQEVDFIKTEIRECTVTRKIVAFHCRNHSQSXXXXXXXXXXXXXXXRSECEKGFNTGVIRIAGRIQVAAEDGKIKTTRVYAAGRIKAGDGSCEGGEYTLLNQLVRGVVVIESYQVKLEKFQSYFDPNTQAIKKYPQCVATHGSCTTRMSTIVYHADTRACRLTLLKSAIFDEVQGQVHSETETNTQKRAMEELRRIGQIRNPTITTIIGSETTPTGVNSTDSAIGMRFIKGRMVSKCDEMIISINYKEIFLS*ITISNVKAKIDPK 7409
            GPTKIMK+EEQPHINMLR+IPDDQTDEDESEISSLGGEIFQSCEENKP K+E KSE+EEMET+V REDE EILKEINEIVEEVDRNQMFLNL+DTT YSRIMKLIAKGYQQDNGTFTASWKDMIKKYQENLKEYDR EYQVIID PEIPRQIIATRGESTNELYDWVVKKLGPSYKN+PLY+QGRKIKRDIHLADALIWP GINV+TLNK+ETEETTAEIWQKIQILY KEIKPGLEKERQKIMRQNQIKMTEQ+IDQARKYINRLSLTRPISMK+FVEAVRDT IMRFDNERTDELIAKYGEHQRDM+GDEPIKI+IKLPNDE KEI VDPDCQMHELYRRIN EIIQPIIESSDDGMVEDVAIMYHKRQISPRERTPIYELGIWEDGQTINIIAMDEPE KNTTK+E+QIQEFQEEMKRK++QILTIYQ+WRQDAKLSTKLQPI DSRCRSTPWK+VYDEK KEWKW+MERTEPK RKYVPGEAPEDAANEITLELYEDEPYE+LP++M+NE+EWQPEEDEEINDRARLAPYTWKIGGWAEKVKSAEEEKIIGITSHQFYTEIGGYRMKLRVYPN +GV KGKYL VYFLLARGRYD KLEWPFNRK+ ISIAKPGKWE RHSEKLGVDPRSMI QKPKSTENVAGGVPQFLLKK+VT QFVKDDTIYITIEVET++EMK                                            KCRELAAILRTGAKNQRR VTDLAKWIIDSCNR+ENLRNIVKEIEEYRR+YAWYPEQFREIIRKWKH EWAAETIEKYSLKIMTPDFEPIER+FYITAKVSEVKKRIPYE PFHLQYEGRSL+DDLEIGVT MQ GLINILTVAKIAGRELNKREIKTKTPIGRQESLNTPEVPPAADEVIVITTGDEEILNDLNDIVDEETTRRIPESRDLFMTENE+D+ITDE DEL   +  P                           DNWINERGATTS +TADEQ KRKETGTAMEKKSRGRPK +KPAPERKTKEQ+QMDQLTTKLNKLSQVTKQLQGKLKGQEQGAKWINRLI DMLGLANPEIKRNLKLNNIG EAKQL AAIKPIINKIMDNKVRTTTKDPEELLLIINHLTKRSDDPNRYLVGMAYLMYNT+ IYRKRTPRYNPNGYEFAITDIIRK                        TE+MQTKLKELLTEFETTINASDPKTARKGMNAIITTILIWMMC+KGVEPFVVYDCDNIKIGDKYSLKE EECKAANPGRLQTTATAVSYNVYQEVDFIKTEI+E +VTR IVAFHC +HS STIIE GTETTVV+VTR ECE+GF +G I+IAGRIQVAAE+GKIKT+RVYAAGRI AGDG+CE GEYTLLNQLV+G+V   +               TQA+KKYPQC+AT  SC T MSTIVYHADTR CRLTLLKSAIFDEVQGQVHSETETNTQK AM+ELRR G+I  PTITT IGSE TPT V STD+ IGMRFIKGRMVSKCDEM+ S NYK IFLS   I N KA   P+
Sbjct:  525 GPTKIMKKEEQPHINMLRQIPDDQTDEDESEISSLGGEIFQSCEENKPNKEEPKSEIEEMETNVRREDEIEILKEINEIVEEVDRNQMFLNLKDTTMYSRIMKLIAKGYQQDNGTFTASWKDMIKKYQENLKEYDRAEYQVIIDLPEIPRQIIATRGESTNELYDWVVKKLGPSYKNRPLYHQGRKIKRDIHLADALIWPNGINVITLNKSETEETTAEIWQKIQILYIKEIKPGLEKERQKIMRQNQIKMTEQSIDQARKYINRLSLTRPISMKMFVEAVRDTYIMRFDNERTDELIAKYGEHQRDMKGDEPIKIKIKLPNDETKEILVDPDCQMHELYRRINLEIIQPIIESSDDGMVEDVAIMYHKRQISPRERTPIYELGIWEDGQTINIIAMDEPEWKNTTKKERQIQEFQEEMKRKINQILTIYQVWRQDAKLSTKLQPISDSRCRSTPWKRVYDEKAKEWKWKMERTEPKCRKYVPGEAPEDAANEITLELYEDEPYEDLPDEMINEIEWQPEEDEEINDRARLAPYTWKIGGWAEKVKSAEEEKIIGITSHQFYTEIGGYRMKLRVYPNREGVAKGKYLLVYFLLARGRYDEKLEWPFNRKIIISIAKPGKWEGRHSEKLGVDPRSMICQKPKSTENVAGGVPQFLLKKHVTSQFVKDDTIYITIEVETKQEMKT---------------------------------------NRNAKCRELAAILRTGAKNQRRAVTDLAKWIIDSCNRIENLRNIVKEIEEYRRVYAWYPEQFREIIRKWKHIEWAAETIEKYSLKIMTPDFEPIERDFYITAKVSEVKKRIPYELPFHLQYEGRSLEDDLEIGVTPMQFGLINILTVAKIAGRELNKREIKTKTPIGRQESLNTPEVPPAADEVIVITTGDEEILNDLNDIVDEETTRRIPESRDLFMTENENDIITDELDELKEREETP--------------------KLNRRRMDNWINERGATTSGDTADEQLKRKETGTAMEKKSRGRPKTNKPAPERKTKEQVQMDQLTTKLNKLSQVTKQLQGKLKGQEQGAKWINRLIADMLGLANPEIKRNLKLNNIGTEAKQLCAAIKPIINKIMDNKVRTTTKDPEELLLIINHLTKRSDDPNRYLVGMAYLMYNTMAIYRKRTPRYNPNGYEFAITDIIRK------------------------TEMMQTKLKELLTEFETTINASDPKTARKGMNAIITTILIWMMCIKGVEPFVVYDCDNIKIGDKYSLKEAEECKAANPGRLQTTATAVSYNVYQEVDFIKTEIKEYSVTRIIVAFHCGHHSHSTIIEAGTETTVVSVTRRECEEGFTSGRIQIAGRIQVAAEEGKIKTSRVYAAGRITAGDGTCEEGEYTLLNQLVKGIVDTLT--------------RTQAMKKYPQCLATDRSCNTGMSTIVYHADTRTCRLTLLKSAIFDEVQGQVHSETETNTQKSAMDELRRTGRIGKPTITTTIGSEVTPTVVISTDTTIGMRFIKGRMVSKCDEMVSSTNYKGIFLSRTKIPNTKAANRPQ 1994          

HSP 2 Score: 665.996 bits (1717), Expect = 0.000e+0
Identity = 356/471 (75.58%), Postives = 400/471 (84.93%), Query Frame = 2
Query: 7886 ELASEAEFKPVDISRSGIYQTKDLERAREH---------LLFPTQRQTILSNIVTITRGNNY**KPNYELLLSPNHFQHATANMMKAMWGRFLIFGQMMAXXXXXXXXXXXXXXXXTQMLACFDIYKRERKINWKMTLGFLPFLAKTMVLHGHSKDIHKIKRLVGILTRMNGTDEEVGRNFKAIMKMEAERTRIKRQKTSNWKRWIDFKXXXXXXXXXXX-QRGTQKLTQGKLQQWENQKTKLNEHYNHPPPAYECLKK*TKPVEQNTP------IPRPTTLRNIYPTLYEPNLAELVSRTSRRSKSVDQEVETRTIAMLQTLAGPTLTIPIDINEFEIKAMIDTGANISEIKMYKIQGRLWPCIEETNMDVITCSKESVSVIGKIWSTIEYKNVKINTYLAVIRKLSADCIIGTDLMPERLKEIIIELGSMELRDRTGRICTLKFEARCSENIVVPGRTQMICYVKVDEE 9250
            E+ S   +K + +SR+ I  TK   R + +          + P+ +Q ILSNIVTIT GNNY  KPNYELLLSP+HFQHATANMMKAMWGRFLIFG MMAGILGIILIIQIVRVILTQMLACFDIYKRERKINWKM +GFLPFLAKTMVLHGHSKDIHKIKRLVGILT+MNG DEEVGR FKAIM++E+++TRIKRQKT+NWKRW++ K+D+SDNS N+  Q G Q LTQ +L+QWEN+KT+ +EHYNHPPP YECLKK TK VE+NTP      IPRPTTLRNIYP  +EPN A+L+ RTS+RS+SVDQ+ +TRTIAMLQTLAGPTLTIPI+IN  EIKAMIDTGANIS IKM KI GRLWPCIEE NMDVITC+KESV+VIGKIWS IEYKNVKINTYLAVIR+LSADCIIGTDLMPE LKEIII+LGSMELRD+TGRIC LK E RC E IVV GRTQMICYVKV+EE
Sbjct: 1967 EMVSSTNYKGIFLSRTKIPNTKAANRPQRYERSGTSQRTFIIPSAKQAILSNIVTITGGNNYGEKPNYELLLSPDHFQHATANMMKAMWGRFLIFGPMMAGILGIILIIQIVRVILTQMLACFDIYKRERKINWKMAIGFLPFLAKTMVLHGHSKDIHKIKRLVGILTKMNGIDEEVGRKFKAIMRLESKKTRIKRQKTNNWKRWMNIKDDNSDNSDNNENQGGPQILTQEQLKQWENRKTRHSEHYNHPPPVYECLKKATKSVERNTPVERHVPIPRPTTLRNIYPAPHEPNWADLMPRTSQRSRSVDQDPKTRTIAMLQTLAGPTLTIPIEINGVEIKAMIDTGANISAIKMDKIPGRLWPCIEEANMDVITCTKESVAVIGKIWSIIEYKNVKINTYLAVIRRLSADCIIGTDLMPELLKEIIIDLGSMELRDKTGRICMLKSEVRCLEKIVVSGRTQMICYVKVNEE 2437          

HSP 3 Score: 42.743 bits (99), Expect = 0.000e+0
Identity = 18/19 (94.74%), Postives = 19/19 (100.00%), Query Frame = 1
Query: 9247 GEMIFEPNHKFEKKRELPL 9303
            GEM+FEPNHKFEKKRELPL
Sbjct: 2440 GEMVFEPNHKFEKKRELPL 2458          

HSP 4 Score: 465.307 bits (1196), Expect = 4.484e-131
Identity = 273/367 (74.39%), Postives = 289/367 (78.75%), Query Frame = 3
Query:  396 QSSRQITVNIDSISNHTRSKSQENREKSLLKTEEKRKVRYSRSVNTRVXXXXXXXXXXXXXXXXFEFNSSEENELRNIENQLTTIESVNEE-DLDNNPNMTTLINS---SIPDANTMSNNNNVMVGEFREKFRGEPFDGSLNKLDTFIKEFEVYKNICHWTDQKVKERLPLYLKGSAQDVFVEEARDVTKLTTWTEIKEFLIKIFGIEKKGNRKILDFLHRKQRRDESNAVYACELKKLCKEAFGETDLPEDKMVDVFIRGIKREDIRANLGCLAPETLDKAVAIANRCEAHLGLGYQVAVLATEPTTSTVXXXXXXXXXXXXXXXFIPRAQQMFKPPATRNPEDRGNNQVSYNNNFRNKPNANEQC 1484
            ++S++ITVNIDSISNHTRSKS+ENREKSLLK EEK++V  SRSVNT  STTA TGTGTDSGLTDFEFNSSEENE+ N ENQL  IES +EE + DNNPNMTT INS   SIPD NTM NNNN  VGEFREKFRGEPFDGSL+KLDTFIKEFEVYK ICHWTDQKVKERLPLYLKGSAQDVFVEEARD TKLTTWT+IKEFL                                    KLCKEAFG+ DLPEDKMVDVFIR IKREDIRANLGCLAPETLDKAVAIANRCEAHLGLGYQ+AVL TEPTT T+   NQNNN NPAMNQFIPRAQQMFKPPATRNPEDRGNNQ+        KP   EQC
Sbjct:  121 RASKRITVNIDSISNHTRSKSKENREKSLLKAEEKKRVLNSRSVNTGTSTTAVTGTGTDSGLTDFEFNSSEENEILNTENQLAIIESGSEEENQDNNPNMTTSINSNTPSIPDPNTMPNNNNATVGEFREKFRGEPFDGSLSKLDTFIKEFEVYKTICHWTDQKVKERLPLYLKGSAQDVFVEEARDPTKLTTWTDIKEFL------------------------------------KLCKEAFGDADLPEDKMVDVFIREIKREDIRANLGCLAPETLDKAVAIANRCEAHLGLGYQIAVLTTEPTTPTI---NQNNNTNPAMNQFIPRAQQMFKPPATRNPEDRGNNQM--------KPTPAEQC 440          

HSP 5 Score: 119.013 bits (297), Expect = 6.435e-26
Identity = 80/119 (67.23%), Postives = 95/119 (79.83%), Query Frame = 3
Query: 2004 AEQCVENEGGGNMITDNEKTVELNTMEKIEAIKEFTXXXXXXXXXXXXTIIEKPNEPETQEIKRAEMMITEDQNKETLVYEIDELENE-----IMTQKTESTLEKIKQEEAVEQEEDQS 2345
            AEQCVENEGGG+MITD EKT +LNTMEKIEAIKEFTEEE+QRRRQLKE   EKP+EPE QEIK+AEMMITEDQNKETL YE+DELE E     IM ++ +  +  ++Q    + +ED+S
Sbjct:  437 AEQCVENEGGGDMITD-EKTTKLNTMEKIEAIKEFTEEERQRRRQLKEMTTEKPDEPEAQEIKQAEMMITEDQNKETLTYEMDELEKEIGPTKIMKKEEQPHINMLRQIPDDQTDEDES 554          
BLAST of TNF receptor-associated factor vs. Planmine SMEST
Match: SMESG000010523.1 (SMESG000010523.1)

HSP 1 Score: 2457.17 bits (6367), Expect = 0.000e+0
Identity = 1261/1430 (88.18%), Postives = 1307/1430 (91.40%), Query Frame = 3
Query: 3402 IKPGLEKERQKIMRQNQIKMTEQAIDQARKYINRLSLTRPISMKIFVEAVRDTDIMRFDNERTDELIAKYGEHQRDMRGDEPIKIRIKLPNDEIKEISVDPDCQMHELYRRINREIIQPIIESSDDGMVEDVAIMYHKRQISPRERTPIYELGIWEDGQTINIIAMDEPERKNTTKREQQIQEFQEEMKRKMDQILTIYQLWRQDAKLSTKLQPIDDSRCRSTPWKKVYDEKTKEWKWEMERTEPKWRKYVPGEAPEDAANEITLELYEDEPYENLPEKMLNEMEWQPEEDEEINDRARLAPYTWKIGGWAEKVKSAEEEKIIGITSHQFYTEIGGYRMKLRVYPNGDGVGKGKYLSVYFLLARGRYDGKLEWPFNRKVTISIAKPGKWEERHSEKLGVDPRSMISQKPKSTENVAGGVPQFLLKKYVTPQFVKDDTIYITIEVETEREMKIRIQQEQARPRISVLEKRIPGTRYLPTDIDDSVEEGLTRLTETQKCRELAAILRTGAKNQRRTVTDLAKWIIDSCNRVENLRNIVKEIEEYRRMYAWYPEQFREIIRKWKHTEWAAETIEKYSLKIMTPDFEPIEREFYITAKVSEVKKRIPYEPPFHLQYEGRSLDDDLEIGVTQMQLGLINILTVAKIAGRELNKREIKTKTPIGRQESLNTPEVPPAADEVIVITTGDEEILNDLNDIVDEETTRRIPESRDLFMTENEDDLITDEPDELVCGQRQPVEIIEPDTXXXXXXXXXXXXSSTGDEWDNWINERGATTSKETADEQPKRKETGTAMEKKSRGRPKIDKPAPERKTKEQMQMDQLTTKLNKLSQVTXXXXXXXXXXXXXXXWINRLITDMLGLANPEIKRNLKLNNIGAEAKQLWAAIKPIINKIMDNKVRTTTKDPEELLLIINHLTKRSDDPNRYLVGMAYLMYNTIVIYRKRTPRYNPNGYEFAITDIIRKVIEPFILTQGGWQAFINLVSKDDQTEIMQTKLKELLTEFETTINASDPKTARKGMNAIITTILIWMMCVKGVEPFVVYDCDNIKIGDKYSLKETEECKAANPGRLQTTATAVSYNVYQEVDFIKTEIRECTVTRKIVAFHCRNHSQSXXXXXXXXXXXXXXXRSECEKGFNTGVIRIAGRIQVAAEDGKIKTTRVYAAGRIKAGDGSCEGGEYTLLNQLVRGVVVIESYQVKLEKFQSYFDPNTQAIKKYPQCVATHGSCTTRMSTIVYHADTRACRLTLLKSAIFDEVQGQVHSETETNTQKRAMEELRRIGQIRNPTITTIIGSETTPTGVNSTDSAIGMRFIKGRMVSKCDEMIISINYKEIFLS*ITISNVKAKIDPKDVKLYLYMNNKMDFLYHRGLASTEKIYYDLIKNDCILNREILKTKLAMAITNPDNAIPLLPLQEGYFGRIIGEVMYTYKCEKTIARLPENSRSP 7691
            IKPGLEKERQKIMRQNQIKMTEQAIDQARKYINRLSLTRPISMKIFVEAVRDTDIMRFDNERTDELIAKYGEHQRDMRGDEPIKIRIKLPNDEIKEI VDPDCQMHELYRRINREIIQPIIE+SDDGMVEDVAIMYHKRQISPRERTPIYELGIWEDGQTINIIAMDEPERKNTTKREQQIQEFQEEMKRKMDQILTIYQLWRQDAKLSTKLQPIDDSRCRSTPWKKVYDEKTKEWKW+MER+EPKWRKY+PGEAPEDAANEITLELYEDEPYENLPE+M+NEME QPEEDEEINDRARLAPYTWKIGGWAEKVKSAEEEKIIGITSHQFYTEIGGYRMKLRVYPNGDGVGKGKYLSVYFLLARGRYDGKLEWPFNRKVTISIAKPGKWEERHSEKLG+DP SMISQKPKSTENVAGGVPQFLLKKYVTPQFVKDDTIYITIEVETEREMK RIQQEQARPRISVLEKRIPGT+YLPTDIDD VEEGLTRLTETQKCRELAAILRTGAKNQRRTVT+LA WIIDSC+R+ENLRNIVKEIEEYRRMYAWYPEQFREIIRKWKHTEWAAETIEKY+LKIM PDFEPIEREFYITAKVSEVKKRIPYEPPFHLQY+GRSLDDDLEIGVTQMQLGLIN+LTVAKIAGRELNKREI+TKTPIGRQESLNTPEVPPA DEVIVITTGDEEILNDLNDIVDEETTRRIPESRDLFMTE+E+DLIT+EPDELVCGQRQPVEIIEPDTEEENK KERRRRSSTGDEWDNWINERGATTSKET    P                             E+ QMDQLTTKLNKLSQVTKQLQGKLKGQEQGAKWINRLITDMLGLANPEIKRNLKLNNIGAEAKQLWAAIKPIINKIMDNKVRTTT+DPEELLLIINHLTKRSDDPNRYLVGMAYLMYNTIVIYRKRTPRYNPNGYEFAITDIIRKVIEPFILTQGGWQAFI LVSKDDQTE+MQ KLKELLTEFETTINASDPKTARKGMN IITTILIWMMC                IGDKYSLKETEECKAANPGRLQTTATAVSYNVYQEVDFIKTEI+EC+VTRKIVAFHC +HS ST IE GTETTVV+VTRSECE+GF TG I IAGR+ VAAE+GKIKTTRVYAAGRI AGDG+C+GGEYTLLNQLV+GVVVIESYQVKLEK+Q YFDP+TQA+KKYPQC+AT  SC T MSTI               SAIFDEVQGQVH ETETNTQK A++E+RR G+I  PTITT IGSE TPT V STD+ IGMRFIKGRMVSKCDEM                   K KIDPKDVKLYLY+NNKMDFLYH+GLASTEKIYYDL+KNDCILNREILKTKLAMAITNPDNAIPLLPLQEGYFGRI+GEV+YTYKCEKTIA+LPENS  P
Sbjct:   21 IKPGLEKERQKIMRQNQIKMTEQAIDQARKYINRLSLTRPISMKIFVEAVRDTDIMRFDNERTDELIAKYGEHQRDMRGDEPIKIRIKLPNDEIKEILVDPDCQMHELYRRINREIIQPIIENSDDGMVEDVAIMYHKRQISPRERTPIYELGIWEDGQTINIIAMDEPERKNTTKREQQIQEFQEEMKRKMDQILTIYQLWRQDAKLSTKLQPIDDSRCRSTPWKKVYDEKTKEWKWKMERSEPKWRKYIPGEAPEDAANEITLELYEDEPYENLPEEMINEMEGQPEEDEEINDRARLAPYTWKIGGWAEKVKSAEEEKIIGITSHQFYTEIGGYRMKLRVYPNGDGVGKGKYLSVYFLLARGRYDGKLEWPFNRKVTISIAKPGKWEERHSEKLGMDPGSMISQKPKSTENVAGGVPQFLLKKYVTPQFVKDDTIYITIEVETEREMKSRIQQEQARPRISVLEKRIPGTKYLPTDIDDPVEEGLTRLTETQKCRELAAILRTGAKNQRRTVTELANWIIDSCSRIENLRNIVKEIEEYRRMYAWYPEQFREIIRKWKHTEWAAETIEKYTLKIMMPDFEPIEREFYITAKVSEVKKRIPYEPPFHLQYQGRSLDDDLEIGVTQMQLGLINVLTVAKIAGRELNKREIRTKTPIGRQESLNTPEVPPATDEVIVITTGDEEILNDLNDIVDEETTRRIPESRDLFMTEDENDLITEEPDELVCGQRQPVEIIEPDTEEENKMKERRRRSSTGDEWDNWINERGATTSKETTANNP----------------------------NEKKQMDQLTTKLNKLSQVTKQLQGKLKGQEQGAKWINRLITDMLGLANPEIKRNLKLNNIGAEAKQLWAAIKPIINKIMDNKVRTTTRDPEELLLIINHLTKRSDDPNRYLVGMAYLMYNTIVIYRKRTPRYNPNGYEFAITDIIRKVIEPFILTQGGWQAFIKLVSKDDQTEMMQAKLKELLTEFETTINASDPKTARKGMNTIITTILIWMMC----------------IGDKYSLKETEECKAANPGRLQTTATAVSYNVYQEVDFIKTEIKECSVTRKIVAFHCGHHSHSTSIEAGTETTVVSVTRSECEEGFTTGRISIAGRVNVAAEEGKIKTTRVYAAGRITAGDGTCQGGEYTLLNQLVKGVVVIESYQVKLEKYQGYFDPDTQAMKKYPQCLATDRSCNTGMSTI---------------SAIFDEVQGQVHRETETNTQKSALDEIRRTGRIGKPTITTTIGSEVTPTVVISTDTTIGMRFIKGRMVSKCDEM--------------QYQTQKRKIDPKDVKLYLYINNKMDFLYHKGLASTEKIYYDLVKNDCILNREILKTKLAMAITNPDNAIPLLPLQEGYFGRIVGEVIYTYKCEKTIAKLPENSTIP 1377          

HSP 2 Score: 316.62 bits (810), Expect = 2.807e-92
Identity = 156/182 (85.71%), Postives = 167/182 (91.76%), Query Frame = 2
Query: 8705 YEPNLAELVSRTSRRSKSVDQEVETRTIAMLQTLAGPTLTIPIDINEFEIKAMIDTGANISEIKMYKIQGRLWPCIEETNMDVITCSKESVSVIGKIWSTIEYKNVKINTYLAVIRKLSADCIIGTDLMPERLKEIIIELGSMELRDRTGRICTLKFEARCSENIVVPGRTQMICYVKVDEE 9250
            YEPN A+LV RTS+RS+SVDQ+ ETRTIAMLQTLAGPTLT+PI+IN  EIKAMIDTGANIS IKM KI G+LWPCIEE NMDVITCSKESV+VIGKIWS IEYKNVKINTYLAVIRKLSADCIIGTDLMPE LKEIII+LGSMELRD+TGRIC LK E RCSE IVVPGRTQMICYVKV+EE
Sbjct: 1555 YEPNWADLVPRTSQRSRSVDQDPETRTIAMLQTLAGPTLTVPIEINGVEIKAMIDTGANISAIKMDKIPGKLWPCIEEANMDVITCSKESVAVIGKIWSIIEYKNVKINTYLAVIRKLSADCIIGTDLMPELLKEIIIDLGSMELRDKTGRICMLKSEVRCSEKIVVPGRTQMICYVKVNEE 1736          

HSP 3 Score: 45.4394 bits (106), Expect = 2.807e-92
Identity = 18/19 (94.74%), Postives = 19/19 (100.00%), Query Frame = 1
Query: 9247 GEMIFEPNHKFEKKRELPL 9303
            GEMIFEPNHKFEKK+ELPL
Sbjct: 1739 GEMIFEPNHKFEKKKELPL 1757          

HSP 4 Score: 221.476 bits (563), Expect = 8.972e-65
Identity = 105/121 (86.78%), Postives = 109/121 (90.08%), Query Frame = 2
Query: 7685 IPSDKCIN------KGKIRFAQPVTRMINPAKFIPNMFSCSNVYGPLFETRDRSWLQFPTRVIVAPPRVFGLTELASEAEFKPVDISRSGIYQTKDLERAREHLLFPTQRQTILSNIVTIT 8029
            IP DKCIN      KGKIRFAQPVTRMINP KF+PNMFSCSNVYGPLFE RD SWLQFPTRVIVAPP++FGLTELASEAEFKPVDIS+SGIYQTKDLERAREHLLFP QRQ ILSNIVTIT
Sbjct: 1376 IPRDKCINELEIMHKGKIRFAQPVTRMINPEKFVPNMFSCSNVYGPLFEIRDGSWLQFPTRVIVAPPKIFGLTELASEAEFKPVDISQSGIYQTKDLERAREHLLFPAQRQAILSNIVTIT 1496          

HSP 5 Score: 48.9062 bits (115), Expect = 8.972e-65
Identity = 23/35 (65.71%), Postives = 28/35 (80.00%), Query Frame = 1
Query: 8086 FSTCNRKYDESHVGKIFNIRTNDGRNSRDHTHHPN 8190
            FST   KYDESHVGKI N+RT+DGRN  ++T+H N
Sbjct: 1516 FSTRYSKYDESHVGKILNLRTDDGRNFGNNTYHSN 1550          

HSP 6 Score: 104.375 bits (259), Expect = 1.761e-21
Identity = 54/73 (73.97%), Postives = 59/73 (80.82%), Query Frame = 2
Query: 9317 VYQRQQ*NTNQYHQCELMTSITNNAQAQWTNTHMVLTESVNRGLHQAARIEDQQRTILQLQRMNEQLNNQVRW 9535
            +YQ Q        QCELMT ITNNAQ QWTNTH+VLTESVNRGL QA R+E+QQRTILQLQRMNEQL +QVRW
Sbjct: 3642 IYQDQGIEATWRRQCELMTLITNNAQTQWTNTHLVLTESVNRGLQQALRLEEQQRTILQLQRMNEQLADQVRW 3714          

HSP 7 Score: 92.4337 bits (228), Expect = 6.443e-18
Identity = 50/158 (31.65%), Postives = 91/158 (57.59%), Query Frame = 3
Query: 4266 EEDEEINDRARLAPYTWKIGGWAEKVKSAEEEKIIGITSHQFYTEIGGYRMKLRVYPNGDGVGKGKYLSVYFLLARGRYDGKLEWPFNRKVTISIAKPGKWEERHSEKLGVDPRSMISQKPKSTENVAGGVPQFLLKKYVTPQ-FVKDDTIYITIEVE 4736
            E +  I  +   AP+ WKI  +AEK++ A++     + S   Y+   GY++ +R+YPNGDG   G ++SV+  + RG YD  L WPF + + +++   G+ + R+  + G +P+     +P +  N A G P+F  ++ +  + F+++D +YI +EVE
Sbjct: 4077 ETNNSITRKHPTAPFIWKITEFAEKLQRAKDGTQRILDSPPIYSWENGYKLGIRLYPNGDGNATGTHISVFIRVGRGDYDELLTWPFKQNMILTMK--GQEDYRNPIRTGNEPQ---MGRPTTDWNTAIGTPRFYPQQRLRGEGFLREDNLYIKLEVE 4229          
BLAST of TNF receptor-associated factor vs. Planmine SMEST
Match: SMESG000010523.1 (SMESG000010523.1)

HSP 1 Score: 2445.23 bits (6336), Expect = 0.000e+0
Identity = 1256/1430 (87.83%), Postives = 1302/1430 (91.05%), Query Frame = 3
Query: 3402 IKPGLEKERQKIMRQNQIKMTEQAIDQARKYINRLSLTRPISMKIFVEAVRDTDIMRFDNERTDELIAKYGEHQRDMRGDEPIKIRIKLPNDEIKEISVDPDCQMHELYRRINREIIQPIIESSDDGMVEDVAIMYHKRQISPRERTPIYELGIWEDGQTINIIAMDEPERKNTTKREQQIQEFQEEMKRKMDQILTIYQLWRQDAKLSTKLQPIDDSRCRSTPWKKVYDEKTKEWKWEMERTEPKWRKYVPGEAPEDAANEITLELYEDEPYENLPEKMLNEMEWQPEEDEEINDRARLAPYTWKIGGWAEKVKSAEEEKIIGITSHQFYTEIGGYRMKLRVYPNGDGVGKGKYLSVYFLLARGRYDGKLEWPFNRKVTISIAKPGKWEERHSEKLGVDPRSMISQKPKSTENVAGGVPQFLLKKYVTPQFVKDDTIYITIEVETEREMKIRIQQEQARPRISVLEKRIPGTRYLPTDIDDSVEEGLTRLTETQKCRELAAILRTGAKNQRRTVTDLAKWIIDSCNRVENLRNIVKEIEEYRRMYAWYPEQFREIIRKWKHTEWAAETIEKYSLKIMTPDFEPIEREFYITAKVSEVKKRIPYEPPFHLQYEGRSLDDDLEIGVTQMQLGLINILTVAKIAGRELNKREIKTKTPIGRQESLNTPEVPPAADEVIVITTGDEEILNDLNDIVDEETTRRIPESRDLFMTENEDDLITDEPDELVCGQRQPVEIIEPDTXXXXXXXXXXXXSSTGDEWDNWINERGATTSKETADEQPKRKETGTAMEKKSRGRPKIDKPAPERKTKEQMQMDQLTTKLNKLSQVTXXXXXXXXXXXXXXXWINRLITDMLGLANPEIKRNLKLNNIGAEAKQLWAAIKPIINKIMDNKVRTTTKDPEELLLIINHLTKRSDDPNRYLVGMAYLMYNTIVIYRKRTPRYNPNGYEFAITDIIRKVIEPFILTQGGWQAFINLVSKDDQTEIMQTKLKELLTEFETTINASDPKTARKGMNAIITTILIWMMCVKGVEPFVVYDCDNIKIGDKYSLKETEECKAANPGRLQTTATAVSYNVYQEVDFIKTEIRECTVTRKIVAFHCRNHSQSXXXXXXXXXXXXXXXRSECEKGFNTGVIRIAGRIQVAAEDGKIKTTRVYAAGRIKAGDGSCEGGEYTLLNQLVRGVVVIESYQVKLEKFQSYFDPNTQAIKKYPQCVATHGSCTTRMSTIVYHADTRACRLTLLKSAIFDEVQGQVHSETETNTQKRAMEELRRIGQIRNPTITTIIGSETTPTGVNSTDSAIGMRFIKGRMVSKCDEMIISINYKEIFLS*ITISNVKAKIDPKDVKLYLYMNNKMDFLYHRGLASTEKIYYDLIKNDCILNREILKTKLAMAITNPDNAIPLLPLQEGYFGRIIGEVMYTYKCEKTIARLPENSRSP 7691
            IKPGLEKERQKIMRQNQIKMTEQAIDQARKYINRLSLTRPISMKIFVEAVRDTDIMRFDNERTDELIAKYGEHQRDMRGDEPIKIRIKLPNDEIKEI VDPDCQMHELYRRINREIIQPIIE+SDDGMVEDVAIMYHKRQISPRERTPIYELGIWEDGQTINIIAMDEPERKNTTKREQQIQEFQEEMKRKMDQILTIYQLWRQDAKLSTKLQPIDDSRCRSTPWKKVYDEKTKEWKW+MER+EPKWRKY+PGEAPEDAANEITLELYEDEPYENLPE+M+NEME QPEEDEEINDRARLAPYTWKIGGWAEKVKSAEEEKIIGITSHQFYTEIGGYRMKLRVYPNGDGVGKGKYLSVYFLLARGRYDGKLEWPFNRKVTISIAKPGKWEERHSEKLG+DP SMISQKPKSTENVAGGVPQFLLKKYVTPQFVKDDTIYITIEVETEREMK RIQQEQARPRISVLEKRIPGT+YLPTDIDD VEEGLTRLTETQKCRELAAILRTGAKNQRRTVT+LA WIIDSC+R+ENLRNIVKEIEEYRRMYAWYPEQFREIIRKWKHTEWAAETIEKY+LKIM PDFEPIEREFYITAKVSEVKKRIPYEPPFHLQY+GRSLDDDLEIGVTQMQLGLIN+LTVAKIAGRELNKREI+TKTPIGRQESLNTPEVPPA DEVIVITTGDEEILNDLNDIVDEETTRRIPESRDLFMTE+E+DLIT+EPDELVCGQRQPVEIIEPDTEEENK KERRRRSSTGDEWDNWINERGATTSKET    P                             E+ QMDQLTTKLNKLSQVTKQLQGKLKGQEQGAKWINRLITDMLGLANPEIKRNLKLNNIGAEAKQLWAAIKPIINKIMDNKVRTTT+DPEELLLIINHLTKRSDDPNRYLVGMAYLMYNTIVIYRKRTPRYNPNGYEFAITDIIRKVIEPFILTQGGWQAFI LVSKDDQTE+MQ KLKELLTEFETTINASDPKTARKGMN IITTILIWMMCVKG                     ETEECKAANPGRLQTTATAVSYNVYQEVDFIKTEI+EC+VTRKIVAFHC +HS ST IE GTETTVV+VTRSECE+GF TG I IAGR+ VAAE+GKIKTTRVYAAGRI AGDG+C+GGEYTLLNQLV+GVVVIESYQVKLEK+Q YFDP+TQA+KKYPQC+AT  SC T MSTI               SAIFDEVQGQVH ETETNTQK A++E+RR G+I  PTITT IGSE TPT V STD+ IGMRFIKGRMVSKCDEM                   K KIDPKDVKLYLY+NNKMDFLYH+GLASTEKIYYDL+KNDCILNREILKTKLAMAITNPDNAIPLLPLQEGYFGRI+GEV+YTYKCEKTIA+LPENS  P
Sbjct:   21 IKPGLEKERQKIMRQNQIKMTEQAIDQARKYINRLSLTRPISMKIFVEAVRDTDIMRFDNERTDELIAKYGEHQRDMRGDEPIKIRIKLPNDEIKEILVDPDCQMHELYRRINREIIQPIIENSDDGMVEDVAIMYHKRQISPRERTPIYELGIWEDGQTINIIAMDEPERKNTTKREQQIQEFQEEMKRKMDQILTIYQLWRQDAKLSTKLQPIDDSRCRSTPWKKVYDEKTKEWKWKMERSEPKWRKYIPGEAPEDAANEITLELYEDEPYENLPEEMINEMEGQPEEDEEINDRARLAPYTWKIGGWAEKVKSAEEEKIIGITSHQFYTEIGGYRMKLRVYPNGDGVGKGKYLSVYFLLARGRYDGKLEWPFNRKVTISIAKPGKWEERHSEKLGMDPGSMISQKPKSTENVAGGVPQFLLKKYVTPQFVKDDTIYITIEVETEREMKSRIQQEQARPRISVLEKRIPGTKYLPTDIDDPVEEGLTRLTETQKCRELAAILRTGAKNQRRTVTELANWIIDSCSRIENLRNIVKEIEEYRRMYAWYPEQFREIIRKWKHTEWAAETIEKYTLKIMMPDFEPIEREFYITAKVSEVKKRIPYEPPFHLQYQGRSLDDDLEIGVTQMQLGLINVLTVAKIAGRELNKREIRTKTPIGRQESLNTPEVPPATDEVIVITTGDEEILNDLNDIVDEETTRRIPESRDLFMTEDENDLITEEPDELVCGQRQPVEIIEPDTEEENKMKERRRRSSTGDEWDNWINERGATTSKETTANNP----------------------------NEKKQMDQLTTKLNKLSQVTKQLQGKLKGQEQGAKWINRLITDMLGLANPEIKRNLKLNNIGAEAKQLWAAIKPIINKIMDNKVRTTTRDPEELLLIINHLTKRSDDPNRYLVGMAYLMYNTIVIYRKRTPRYNPNGYEFAITDIIRKVIEPFILTQGGWQAFIKLVSKDDQTEMMQAKLKELLTEFETTINASDPKTARKGMNTIITTILIWMMCVKG---------------------ETEECKAANPGRLQTTATAVSYNVYQEVDFIKTEIKECSVTRKIVAFHCGHHSHSTSIEAGTETTVVSVTRSECEEGFTTGRISIAGRVNVAAEEGKIKTTRVYAAGRITAGDGTCQGGEYTLLNQLVKGVVVIESYQVKLEKYQGYFDPDTQAMKKYPQCLATDRSCNTGMSTI---------------SAIFDEVQGQVHRETETNTQKSALDEIRRTGRIGKPTITTTIGSEVTPTVVISTDTTIGMRFIKGRMVSKCDEM--------------QYQTQKRKIDPKDVKLYLYINNKMDFLYHKGLASTEKIYYDLVKNDCILNREILKTKLAMAITNPDNAIPLLPLQEGYFGRIVGEVIYTYKCEKTIAKLPENSTIP 1372          

HSP 2 Score: 316.235 bits (809), Expect = 3.232e-92
Identity = 156/182 (85.71%), Postives = 167/182 (91.76%), Query Frame = 2
Query: 8705 YEPNLAELVSRTSRRSKSVDQEVETRTIAMLQTLAGPTLTIPIDINEFEIKAMIDTGANISEIKMYKIQGRLWPCIEETNMDVITCSKESVSVIGKIWSTIEYKNVKINTYLAVIRKLSADCIIGTDLMPERLKEIIIELGSMELRDRTGRICTLKFEARCSENIVVPGRTQMICYVKVDEE 9250
            YEPN A+LV RTS+RS+SVDQ+ ETRTIAMLQTLAGPTLT+PI+IN  EIKAMIDTGANIS IKM KI G+LWPCIEE NMDVITCSKESV+VIGKIWS IEYKNVKINTYLAVIRKLSADCIIGTDLMPE LKEIII+LGSMELRD+TGRIC LK E RCSE IVVPGRTQMICYVKV+EE
Sbjct: 1550 YEPNWADLVPRTSQRSRSVDQDPETRTIAMLQTLAGPTLTVPIEINGVEIKAMIDTGANISAIKMDKIPGKLWPCIEEANMDVITCSKESVAVIGKIWSIIEYKNVKINTYLAVIRKLSADCIIGTDLMPELLKEIIIDLGSMELRDKTGRICMLKSEVRCSEKIVVPGRTQMICYVKVNEE 1731          

HSP 3 Score: 45.4394 bits (106), Expect = 3.232e-92
Identity = 18/19 (94.74%), Postives = 19/19 (100.00%), Query Frame = 1
Query: 9247 GEMIFEPNHKFEKKRELPL 9303
            GEMIFEPNHKFEKK+ELPL
Sbjct: 1734 GEMIFEPNHKFEKKKELPL 1752          

HSP 4 Score: 221.476 bits (563), Expect = 9.508e-65
Identity = 105/121 (86.78%), Postives = 109/121 (90.08%), Query Frame = 2
Query: 7685 IPSDKCIN------KGKIRFAQPVTRMINPAKFIPNMFSCSNVYGPLFETRDRSWLQFPTRVIVAPPRVFGLTELASEAEFKPVDISRSGIYQTKDLERAREHLLFPTQRQTILSNIVTIT 8029
            IP DKCIN      KGKIRFAQPVTRMINP KF+PNMFSCSNVYGPLFE RD SWLQFPTRVIVAPP++FGLTELASEAEFKPVDIS+SGIYQTKDLERAREHLLFP QRQ ILSNIVTIT
Sbjct: 1371 IPRDKCINELEIMHKGKIRFAQPVTRMINPEKFVPNMFSCSNVYGPLFEIRDGSWLQFPTRVIVAPPKIFGLTELASEAEFKPVDISQSGIYQTKDLERAREHLLFPAQRQAILSNIVTIT 1491          

HSP 5 Score: 48.521 bits (114), Expect = 9.508e-65
Identity = 23/35 (65.71%), Postives = 28/35 (80.00%), Query Frame = 1
Query: 8086 FSTCNRKYDESHVGKIFNIRTNDGRNSRDHTHHPN 8190
            FST   KYDESHVGKI N+RT+DGRN  ++T+H N
Sbjct: 1511 FSTRYSKYDESHVGKILNLRTDDGRNFGNNTYHSN 1545          

HSP 6 Score: 104.375 bits (259), Expect = 1.746e-21
Identity = 54/73 (73.97%), Postives = 59/73 (80.82%), Query Frame = 2
Query: 9317 VYQRQQ*NTNQYHQCELMTSITNNAQAQWTNTHMVLTESVNRGLHQAARIEDQQRTILQLQRMNEQLNNQVRW 9535
            +YQ Q        QCELMT ITNNAQ QWTNTH+VLTESVNRGL QA R+E+QQRTILQLQRMNEQL +QVRW
Sbjct: 3637 IYQDQGIEATWRRQCELMTLITNNAQTQWTNTHLVLTESVNRGLQQALRLEEQQRTILQLQRMNEQLADQVRW 3709          

HSP 7 Score: 92.4337 bits (228), Expect = 6.335e-18
Identity = 50/158 (31.65%), Postives = 91/158 (57.59%), Query Frame = 3
Query: 4266 EEDEEINDRARLAPYTWKIGGWAEKVKSAEEEKIIGITSHQFYTEIGGYRMKLRVYPNGDGVGKGKYLSVYFLLARGRYDGKLEWPFNRKVTISIAKPGKWEERHSEKLGVDPRSMISQKPKSTENVAGGVPQFLLKKYVTPQ-FVKDDTIYITIEVE 4736
            E +  I  +   AP+ WKI  +AEK++ A++     + S   Y+   GY++ +R+YPNGDG   G ++SV+  + RG YD  L WPF + + +++   G+ + R+  + G +P+     +P +  N A G P+F  ++ +  + F+++D +YI +EVE
Sbjct: 4072 ETNNSITRKHPTAPFIWKITEFAEKLQRAKDGTQRILDSPPIYSWENGYKLGIRLYPNGDGNATGTHISVFIRVGRGDYDELLTWPFKQNMILTMK--GQEDYRNPIRTGNEPQ---MGRPTTDWNTAIGTPRFYPQQRLRGEGFLREDNLYIKLEVE 4224          
The following BLAST results are available for this feature:
BLAST of TNF receptor-associated factor vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
TRAF32.624e-2538.46TNF receptor associated factor 3 [Source:HGNC Symb... [more]
TRAF34.042e-2538.46TNF receptor associated factor 3 [Source:HGNC Symb... [more]
TRAF34.042e-2538.46TNF receptor associated factor 3 [Source:HGNC Symb... [more]
TRAF35.535e-2538.46TNF receptor associated factor 3 [Source:HGNC Symb... [more]
TRAF35.535e-2538.46TNF receptor associated factor 3 [Source:HGNC Symb... [more]
back to top
BLAST of TNF receptor-associated factor vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 2
Match NameE-valueIdentityDescription
trf-11.185e-1529.59TNF Receptor Associated Factor (TRAF) homolog; TRF... [more]
trf-27.327e-1033.09TNF Receptor Associated Factor (TRAF) homolog [So... [more]
back to top
BLAST of TNF receptor-associated factor vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 2
Match NameE-valueIdentityDescription
Traf45.700e-1427.63gene:FBgn0026319 transcript:FBtr0334401[more]
Traf46.936e-1427.63gene:FBgn0026319 transcript:FBtr0077429[more]
back to top
BLAST of TNF receptor-associated factor vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
traf37.197e-2637.76TNF receptor-associated factor 3 [Source:ZFIN;Acc:... [more]
BX901915.12.627e-2337.24pep chromosome:GRCz11:CHR_ALT_CTG5_1_18:28764891:2... [more]
AL844899.12.627e-2337.24pep chromosome:GRCz11:CHR_ALT_CTG5_2_4:28756846:28... [more]
unm_sa8081.444e-2136.55un-named sa808 [Source:ZFIN;Acc:ZDB-GENE-120727-21... [more]
traf11.615e-2137.84TNF receptor-associated factor 1 [Source:ZFIN;Acc:... [more]
back to top
BLAST of TNF receptor-associated factor vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ssh21.153e-2437.76slingshot protein phosphatase 2 [Source:Xenbase;Ac... [more]
slc12a11.198e-2434.67solute carrier family 12 member 1 [Source:Xenbase;... [more]
slc12a11.317e-2434.67solute carrier family 12 member 1 [Source:Xenbase;... [more]
slc12a11.352e-2434.67solute carrier family 12 member 1 [Source:Xenbase;... [more]
ssh21.420e-2437.76slingshot protein phosphatase 2 [Source:Xenbase;Ac... [more]
back to top
BLAST of TNF receptor-associated factor vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Traf33.035e-2538.46TNF receptor-associated factor 3 [Source:MGI Symbo... [more]
Traf33.035e-2538.46TNF receptor-associated factor 3 [Source:MGI Symbo... [more]
Traf33.908e-2538.46TNF receptor-associated factor 3 [Source:MGI Symbo... [more]
Traf57.554e-2530.05TNF receptor-associated factor 5 [Source:MGI Symbo... [more]
Traf57.554e-2530.05TNF receptor-associated factor 5 [Source:MGI Symbo... [more]
back to top
BLAST of TNF receptor-associated factor vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q13114|TRAF3_HUMAN2.658e-2438.46TNF receptor-associated factor 3 OS=Homo sapiens O... [more]
sp|Q60803|TRAF3_MOUSE2.734e-2438.46TNF receptor-associated factor 3 OS=Mus musculus O... [more]
sp|P70191|TRAF5_MOUSE1.568e-2234.03TNF receptor-associated factor 5 OS=Mus musculus O... [more]
sp|O00463|TRAF5_HUMAN1.786e-2134.48TNF receptor-associated factor 5 OS=Homo sapiens O... [more]
sp|P39428|TRAF1_MOUSE2.206e-2036.05TNF receptor-associated factor 1 OS=Mus musculus O... [more]
back to top
BLAST of TNF receptor-associated factor vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A355ABF22.111e-9732.07Uncharacterized protein OS=Flavobacteriaceae bacte... [more]
F1AGB69.921e-7187.32Uncharacterized protein (Fragment) OS=Schmidtea me... [more]
D5JG591.081e-2741.33TNF receptor-associated factor-2-like protein A OS... [more]
A0A2T7NN152.864e-2644.52Uncharacterized protein OS=Pomacea canaliculata OX... [more]
H2YYB23.422e-2639.58MATH domain-containing protein OS=Ciona savignyi O... [more]
back to top
BLAST of TNF receptor-associated factor vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ENSAMXT00000035169.13.192e-2737.76pep primary_assembly:Astyanax_mexicanus-2.0:9:3354... [more]
traf2a6.218e-2237.24TNF receptor-associated factor 2-like [Source:NCBI... [more]
traf2a1.716e-2137.24TNF receptor-associated factor 2-like [Source:NCBI... [more]
traf2b2.336e-2135.86TNF receptor associated factor 2 [Source:NCBI gene... [more]
traf12.442e-2036.99TNF receptor-associated factor 1-like [Source:NCBI... [more]
back to top
BLAST of TNF receptor-associated factor vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 4
Match NameE-valueIdentityDescription
ENSPMAT00000000074.15.340e-2735.33pep scaffold:Pmarinus_7.0:GL482142:165593:173010:-... [more]
ENSPMAT00000002130.18.684e-2737.32pep scaffold:Pmarinus_7.0:GL484662:8457:12718:-1 g... [more]
traf64.207e-925.88TNF receptor-associated factor 6 [Source:NCBI gene... [more]
ENSPMAT00000003739.16.841e-633.78pep scaffold:Pmarinus_7.0:GL499243:411:1384:-1 gen... [more]
back to top
BLAST of TNF receptor-associated factor vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of TNF receptor-associated factor vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
EDO494641.238e-2337.93Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO388732.123e-2133.80Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO352372.363e-2032.64Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO412431.186e-1631.08Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO495451.461e-1633.33Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of TNF receptor-associated factor vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
traf35.837e-2637.50TNF receptor associated factor 3 [Source:NCBI gene... [more]
unm_sa8084.292e-2137.24TNF receptor-associated factor 2 [Source:NCBI gene... [more]
ENSORLT00000020861.29.949e-2136.55TNF receptor-associated factor 2 [Source:NCBI gene... [more]
traf2b2.231e-2031.53TNF receptor associated factor 2 [Source:NCBI gene... [more]
traf2b3.072e-2031.53TNF receptor associated factor 2 [Source:NCBI gene... [more]
back to top
BLAST of TNF receptor-associated factor vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000072336.10.000e+073.29SMESG000072336.1[more]
SMESG000000671.11.416e-7983.66SMESG000000671.1[more]
SMESG000000671.14.484e-13183.66SMESG000000671.1[more]
SMESG000010523.12.807e-9288.18SMESG000010523.1[more]
SMESG000010523.13.232e-9287.83SMESG000010523.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30015808 ID=SMED30015808|Name=TNF receptor-associated factor|organism=Schmidtea mediterranea sexual|type=transcript|length=9536bp
TGATACGAGATTAATAGATAATTATTACGAGGTATAGATAATTAAAAATG
GACTTAAAATGAGGGGGGTGAGTCAGATAAAGAAGACCACCACGATAAAC
GCGAACAAGGGATAATAACGTATATAGTATGGTAAATGGAGGAGAAATTA
GTATAGAGTATAGAATATTGGAGTGTTATTTATTTTTAGGAATCATAGTC
CAACAAAGCAGTCCAAGTCAAATTCAAAACAAAACAAGGAGAAAATATTT
CAGGGCAAACTACAAAGCAAGTGATAATAAAAGAAACTTGAATAAACGAG
TAGAAAAGGATTGGTAATAAACGTCAGAGTAGCTACGAGTAATAAGCAAC
CAGAATTTCAAAGCAGCCAAAGCAAGAAAAGAGAAACGAGAAAACCAGTC
AAGCAGACAAATAACCGTAAACATTGATAGCATCAGCAACCACACGAGAA
GCAAAAGCCAAGAGAACAGAGAAAAAAGTTTATTAAAAACAGAAGAAAAG
AGAAAAGTTCGTTACAGCAGAAGTGTCAACACCAGAGTATCAACTACAGC
AGCAACAGGAACCGGCACAGATAGCGGATTGACCGATTTTGAATTTAATA
GCAGCGAAGAGAACGAATTACGTAATATCGAAAACCAGTTGACAACGATA
GAATCAGTAAACGAAGAAGATCTGGACAACAATCCAAACATGACGACTTT
AATAAACTCTTCAATTCCGGATGCAAATACAATGTCGAATAACAATAATG
TGATGGTAGGAGAATTCAGAGAAAAGTTTAGAGGAGAACCGTTTGACGGT
AGTCTCAACAAATTAGATACATTTATAAAGGAATTTGAAGTGTATAAAAA
CATCTGTCACTGGACAGATCAAAAAGTAAAAGAGCGATTACCCTTGTATT
TGAAAGGGAGCGCACAAGATGTATTCGTAGAGGAAGCGAGAGATGTAACG
AAATTGACAACGTGGACAGAGATTAAAGAGTTCTTAATAAAAATATTCGG
AATAGAGAAAAAGGGAAATAGGAAGATATTGGACTTCCTACATCGAAAAC
AAAGACGAGATGAATCAAATGCAGTGTACGCATGCGAATTAAAGAAATTA
TGTAAAGAAGCCTTCGGAGAAACAGATTTGCCCGAAGATAAAATGGTAGA
CGTCTTCATAAGAGGAATTAAAAGGGAAGACATACGAGCTAACCTTGGAT
GTTTGGCACCAGAAACATTAGATAAAGCAGTAGCAATCGCAAATAGATGT
GAAGCCCATCTAGGACTGGGATATCAAGTGGCAGTCTTGGCCACAGAACC
AACAACATCAACAGTCAATGCCAACAACCAAAACAACAATATCAATCCAG
CTATGAATCAATTCATTCCAAGAGCACAGCAGATGTTCAAGCCACCAGCA
ACAAGAAATCCAGAAGATAGAGGTAATAACCAAGTAAGCTATAATAATAA
TTTCAGGAACAAGCCAAACGCAAACGAACAATGCTCCACATGTCAAAAAA
TGGGACATCGATCAGAAAATTGTTTCCGGAATTACAACTGCCAGATATGT
GGAAAACGAGGGCATACTGAGAGAATATGTCAACAACTTAACAGCAAAGC
GTGCTATAATTGTGGTCAACAAGGGCACATCGCAAGGCGATGCAACATAA
GAGGAGAATCAAATCAACCAAGACCAAACAATAACCCTACAAGAAATCCA
CAAATTAACGTGATACAAGAAATAGACATGTTACGGGAAACATTACAACG
AATGCCCATGGAATTAAAAGAGATGATGCAACAAATGCCCACCAATATAC
AACAACAACGAATCAATGTAATGAGAAGCAATGAGGAGATTCAAGAGCTG
CGAACCAGAGAATATCAAGAGCAACAACAAGCTGAATGGCAAAGACTACA
AACAGAGGAAGCCCAGGAAATCCAGCAAAGATGGGAAAATCGAAAACAAA
CCCCGAAAAGAATTAATATGATGAGAATGGAAATTCCAGATGAAATTCAC
ACTGCGGAGCAGTGTGTTGAGAACGAAGGGGGAGGAAATATGATAACTGA
TAACGAGAAAACAGTTGAATTAAATACGATGGAGAAAATAGAGGCCATCA
AAGAATTTACAGAGGAGGAAAAACAAAGACGTCGACAGTTAAAAGAAACG
ATAATAGAGAAACCGAATGAACCAGAAACCCAAGAGATTAAACGAGCAGA
AATGATGATAACGGAGGATCAAAACAAGGAAACATTAGTGTACGAGATAG
ACGAACTCGAAAATGAAATTATGACACAAAAGACAGAGAGTACACTCGAG
AAAATAAAGCAAGAGGAAGCTGTAGAACAAGAGGAGGATCAATCAAAAGA
AAAAGAAGCAATCTTAAAACAAGAAAAAGCAGAACTAAGAAAGAAGGCAC
TAATATTAAAAATAGACGGAGCGTTAAAACATTTAGAACAAGAGCAAGCA
CTAGATCAAAAAATAGAAGTGATGGCAAAGAAAGTGCTATCACAAGAAAT
GAAAGAGCCAGAATTAAAACTGCAAAAAGATGAGCAGGAAGCATCAACGT
CACAAGAAAAAGAAAGGATATCAGAACCAATAATAACAAAAAATCGAATC
CAGAGGATACTGCTACAAAAAATAGAAACAAGAATCAGAAAAGAAAAGCC
CACGTGGAGTAAAACTCAAATCGAGAATAAAATAAAGGAGATATGGTTCC
AAATAAAAGGGCCAACAAAGATAATGAAAGAGGAGGAACAACCACATATT
AATATGCTGAGACGAATACCAGACGATCAAACAGATGAAGATGAAAGCGA
AATAAGTAGTCTGGGCGGAGAAATATTTCAGTCATGCGAGGAAAACAAAC
CATACAAAGACGAATCAAAATCCGAATTAGAGGAAATGGAAACGAGTGTA
CCAAGAGAAGATGAAACCGAGATATTAAAAGAAATTAATGAAATTGTAGA
AGAAGTAGATCGAAACCAAATGTTCCTAAACCTCAGAGATACAACCGCAT
ACAGCAGAATAATGAAACTGATTGCGAAAGGATATCAACAAGATAATGGT
ACATTTACGGCATCATGGAAAGATATGATAAAAAAGTACCAAGAGAATCT
GAAAGAATATGATAGAGAAGAGTATCAGGTAATTATTGATTTTCCAGAGA
TACCAAGACAGATAATAGCAACAAGAGGCGAAAGCACAAACGAGTTGTAC
GATTGGGTAGTGAAAAAGCTAGGACCCAGTTATAAAAATAAACCTTTATA
TTATCAAGGAAGGAAAATAAAGCGAGATATACACCTAGCGGATGCTCTAA
TATGGCCAAAAGGAATAAACGTGGTAACATTAAACAAAAATGAAACCGAG
GAAACGACAGCGGAAATATGGCAGAAAATCCAAATACTGTATACCAAAGA
AATAAAACCTGGATTAGAAAAAGAGAGACAAAAGATAATGAGGCAAAACC
AGATAAAAATGACAGAACAAGCAATAGACCAGGCTAGAAAATATATTAAT
CGATTATCATTAACAAGACCGATCTCAATGAAAATATTTGTAGAAGCTGT
GCGAGACACAGATATTATGAGATTCGATAATGAGAGAACAGATGAGTTGA
TAGCCAAATATGGAGAGCACCAAAGAGATATGAGAGGAGATGAACCAATA
AAGATAAGAATAAAGCTACCAAATGATGAAATAAAAGAAATATCGGTGGA
TCCTGATTGTCAAATGCACGAATTATACCGACGAATAAACAGAGAAATCA
TCCAACCAATAATCGAAAGTAGTGATGACGGTATGGTAGAAGACGTGGCA
ATAATGTACCACAAACGACAAATAAGTCCGCGAGAACGAACCCCGATATA
CGAATTAGGTATATGGGAAGACGGACAAACCATTAATATCATAGCCATGG
ATGAACCAGAGAGAAAAAATACGACAAAAAGGGAACAACAGATCCAAGAA
TTTCAAGAGGAAATGAAAAGAAAGATGGACCAAATATTAACCATCTACCA
GTTATGGAGACAAGATGCGAAGTTGAGTACAAAATTACAACCTATAGATG
ATTCGCGATGCCGATCAACACCATGGAAAAAGGTGTATGATGAAAAGACG
AAAGAATGGAAATGGGAAATGGAGAGAACCGAACCAAAATGGAGAAAATA
TGTACCAGGAGAAGCGCCAGAAGATGCAGCTAACGAAATAACTTTAGAGT
TATATGAAGACGAGCCATACGAAAACTTGCCAGAGAAAATGTTAAACGAA
ATGGAATGGCAACCAGAAGAAGACGAGGAAATAAACGATAGAGCTCGACT
AGCCCCATACACATGGAAAATAGGTGGATGGGCTGAAAAAGTAAAATCGG
CTGAGGAAGAGAAAATCATCGGTATTACAAGTCATCAATTCTATACAGAA
ATCGGAGGATACCGAATGAAATTGAGAGTGTACCCAAACGGAGATGGGGT
AGGAAAAGGAAAATATCTATCAGTGTATTTTCTATTAGCAAGAGGCAGAT
ATGACGGAAAGTTAGAGTGGCCATTTAATCGAAAAGTCACAATTTCAATC
GCTAAACCCGGAAAATGGGAAGAGCGACACAGCGAAAAATTGGGAGTAGA
CCCAAGATCAATGATAAGTCAGAAGCCAAAATCCACTGAAAATGTTGCAG
GAGGAGTACCACAATTTCTGTTGAAAAAATACGTAACACCTCAATTCGTA
AAAGATGATACGATATACATCACGATCGAAGTAGAAACAGAACGAGAAAT
GAAAATACGAATTCAACAAGAACAAGCGAGACCGCGAATCAGTGTACTCG
AAAAACGAATTCCAGGAACAAGATATTTGCCCACAGATATAGACGATTCT
GTGGAAGAGGGACTAACAAGATTAACAGAAACGCAAAAATGCAGAGAATT
AGCAGCAATATTGAGAACCGGAGCAAAGAACCAAAGACGAACTGTAACAG
ATTTAGCAAAATGGATAATCGACTCTTGTAACAGAGTAGAGAACCTGCGA
AATATTGTAAAGGAAATAGAAGAATATCGGAGAATGTACGCGTGGTATCC
AGAGCAATTCCGAGAAATTATCCGAAAATGGAAACATACCGAATGGGCAG
CCGAAACGATAGAGAAGTATAGTTTAAAAATTATGACGCCAGATTTCGAA
CCAATCGAAAGAGAATTTTATATCACTGCCAAAGTGAGTGAAGTGAAAAA
GAGAATACCATATGAACCGCCATTTCATTTACAATACGAAGGACGATCAT
TAGATGACGATCTTGAAATTGGAGTTACGCAAATGCAATTGGGGTTAATA
AATATATTAACAGTAGCAAAGATTGCGGGTAGAGAACTCAATAAAAGAGA
AATTAAAACGAAAACGCCAATAGGGCGACAAGAAAGTCTAAATACGCCAG
AAGTTCCACCTGCAGCAGATGAAGTAATCGTCATCACAACAGGAGATGAA
GAGATACTAAATGATCTTAACGATATAGTGGATGAGGAAACGACCCGGAG
AATACCGGAATCAAGAGATTTGTTCATGACAGAAAACGAAGACGATCTGA
TAACAGATGAACCAGACGAGCTAGTATGTGGTCAAAGACAACCAGTCGAA
ATTATAGAGCCAGATACCGAAGAGGAAAATAAAAAGAAAGAGAGAAGACG
CCGAAGCTCGACAGGAGACGAATGGGATAACTGGATAAATGAACGAGGAG
CTACAACATCCAAAGAAACGGCAGACGAACAACCTAAACGAAAGGAAACA
GGTACAGCAATGGAAAAGAAATCCAGAGGACGACCAAAAATTGATAAACC
AGCTCCAGAAAGGAAAACTAAAGAACAAATGCAGATGGATCAATTAACAA
CGAAATTGAACAAGCTCAGCCAAGTAACGAAGCAGTTACAGGGAAAACTG
AAAGGCCAAGAACAAGGAGCAAAGTGGATCAACAGACTAATAACTGATAT
GCTGGGATTAGCAAATCCAGAAATAAAGAGAAATTTGAAACTTAATAATA
TCGGCGCAGAAGCGAAACAGCTTTGGGCAGCAATAAAACCAATAATAAAT
AAAATCATGGACAACAAAGTGCGAACCACAACCAAAGATCCAGAGGAATT
ACTGTTGATAATAAATCACCTAACGAAACGATCTGATGACCCAAATAGAT
ATTTGGTAGGAATGGCCTACCTGATGTACAATACGATAGTGATATACAGA
AAGCGAACTCCAAGATACAACCCAAACGGATATGAATTCGCAATAACGGA
TATTATCAGGAAAGTAATTGAACCATTCATCCTGACTCAAGGTGGATGGC
AAGCTTTTATAAATTTAGTAAGTAAAGATGATCAAACTGAAATAATGCAA
ACAAAGTTGAAAGAGTTACTAACGGAATTCGAAACGACGATTAATGCAAG
TGATCCAAAAACAGCTAGAAAAGGGATGAACGCAATAATCACTACAATAC
TCATATGGATGATGTGCGTAAAAGGAGTAGAACCGTTTGTAGTATATGAT
TGTGATAACATAAAGATTGGTGATAAATACTCACTAAAAGAAACGGAAGA
GTGCAAAGCAGCAAATCCCGGTAGATTACAGACAACAGCAACAGCAGTAT
CTTATAACGTATATCAAGAAGTAGATTTCATAAAAACGGAAATCCGAGAA
TGCACCGTGACAAGAAAAATCGTAGCGTTCCATTGTCGAAATCACTCACA
ATCAACAATTATAGAAACCGGAACAGAGACGACAGTAGTCACAGTAACAC
GGAGCGAATGTGAAAAAGGATTCAATACCGGAGTTATCAGAATAGCAGGA
CGAATTCAAGTCGCAGCAGAAGATGGAAAAATAAAAACCACCAGAGTATA
CGCCGCAGGAAGAATAAAAGCTGGAGATGGATCATGTGAAGGGGGAGAAT
ACACACTGTTAAACCAGTTAGTGCGAGGTGTAGTAGTGATAGAAAGTTAC
CAAGTGAAGTTGGAAAAATTTCAAAGCTACTTTGACCCCAACACGCAGGC
AATAAAGAAGTATCCACAATGCGTAGCAACACATGGATCATGCACTACGA
GGATGTCAACAATCGTGTATCACGCGGATACTAGAGCTTGTCGACTTACC
TTATTAAAAAGCGCAATATTCGACGAAGTACAAGGACAAGTACACAGTGA
AACCGAAACAAATACCCAGAAGAGAGCTATGGAAGAATTACGAAGAATCG
GACAAATCAGAAACCCAACCATTACCACCATTATCGGATCAGAAACCACA
CCAACAGGAGTAAATTCAACCGACAGTGCAATAGGAATGAGATTCATCAA
AGGACGAATGGTAAGCAAGTGCGACGAAATGATAATCAGCATAAATTACA
AAGAAATATTCCTATCGTGAATAACAATATCAAACGTCAAAGCAAAGATA
GACCCAAAGGATGTAAAGCTGTATCTCTACATGAATAACAAAATGGATTT
CCTATATCACAGAGGCCTAGCATCAACAGAGAAAATATATTACGACCTAA
TAAAAAATGACTGTATCCTGAATAGAGAAATATTAAAAACTAAGTTAGCT
ATGGCTATCACCAACCCCGACAATGCAATTCCATTACTACCACTCCAAGA
AGGATATTTCGGAAGAATCATAGGCGAAGTAATGTATACGTACAAATGCG
AGAAGACAATCGCAAGGTTACCGGAAAACTCAAGATCCCCAGTGACAAGT
GTATAAACAAAGGAAAAATTAGATTCGCTCAACCAGTAACAAGGATGATA
AACCCAGCTAAATTCATACCTAATATGTTCAGCTGCAGCAATGTATACGG
ACCATTATTCGAAACGAGAGATAGAAGCTGGTTACAATTTCCAACTCGGG
TAATAGTAGCCCCACCAAGAGTATTTGGACTCACGGAATTAGCCAGCGAA
GCAGAATTCAAACCAGTGGATATATCACGGAGTGGAATATATCAAACAAA
GGATCTAGAACGCGCTCGAGAACACTTATTATTTCCAACACAAAGACAAA
CAATATTATCAAATATCGTGACTATAACAAGAGGAAATAACTATTGATAA
AAACCAAATTATGAATTATTATTATCACCAAACCATTTTCAACATGCAAC
CGCAAATATGATGAAAGCCATGTGGGGAAGATTTTTAATATTCGGACAAA
TGATGGCAGGAATTCTAGGGATCATACTCATCATCCAAATTGTGAGAGTG
ATTCTAACACAAATGTTGGCATGCTTCGATATATATAAAAGGGAAAGGAA
AATAAACTGGAAAATGACTCTAGGATTTTTGCCTTTTTTAGCAAAGACAA
TGGTCTTACATGGACATTCGAAAGACATCCACAAGATAAAGAGATTAGTA
GGAATTTTGACTAGAATGAATGGTACGGACGAAGAAGTGGGACGAAACTT
TAAGGCAATAATGAAGATGGAAGCCGAGAGAACCAGAATAAAAAGGCAGA
AGACAAGCAACTGGAAACGATGGATAGATTTCAAGAACGATAGCAGCGAT
AACAGCTACAACGACAATCAACGGGGAACGCAGAAGTTAACCCAAGGAAA
ACTCCAACAATGGGAAAACCAGAAGACAAAACTAAACGAACATTACAATC
ATCCACCACCAGCATATGAATGCCTGAAAAAATAAACGAAACCCGTAGAG
CAAAACACACCAATACCAAGACCAACAACACTACGCAACATATACCCAAC
ACTATACGAACCAAATTTGGCAGAATTAGTATCGAGAACCAGCCGAAGAT
CGAAAAGTGTAGATCAAGAGGTAGAAACGCGAACCATAGCCATGCTACAA
ACATTAGCAGGACCAACGTTAACGATACCAATAGACATAAATGAATTCGA
GATAAAGGCAATGATCGATACTGGAGCAAACATTTCGGAAATAAAAATGT
ACAAAATACAAGGGAGATTATGGCCATGTATTGAAGAAACAAATATGGAC
GTAATAACCTGCAGTAAAGAATCAGTGTCAGTCATCGGTAAAATCTGGTC
AACAATAGAATACAAAAATGTAAAAATCAATACCTACCTAGCAGTCATCA
GAAAGTTAAGCGCGGATTGCATAATTGGAACGGATCTTATGCCTGAGCGA
TTAAAAGAAATAATAATCGAACTAGGATCAATGGAATTAAGAGACAGAAC
CGGGAGGATATGTACGTTAAAGTTTGAAGCAAGGTGCTCAGAGAATATAG
TAGTACCAGGACGTACGCAAATGATCTGCTACGTAAAAGTCGATGAGGAG
AAATGATTTTCGAACCAAATCACAAATTTGAGAAAAAGAGAGAACTACCA
CTAGAATCGAAATAGTGTATATCAACGACAACAGTGAAATACCAATCAAT
ATCATCAATGCGAATTGATGACATCGATAACCAACAACGCCCAAGCACAA
TGGACTAACACTCATATGGTACTAACAGAAAGCGTAAATCGAGGTTTACA
CCAAGCAGCCAGAATAGAAGACCAACAACGAACCATACTGCAACTCCAAA
GAATGAATGAACAATTGAATAATCAAGTTAGATGGC
back to top

protein sequence of SMED30015808-orf-1

>SMED30015808-orf-1 ID=SMED30015808-orf-1|Name=SMED30015808-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=155bp
MLQTLAGPTLTIPIDINEFEIKAMIDTGANISEIKMYKIQGRLWPCIEET
NMDVITCSKESVSVIGKIWSTIEYKNVKINTYLAVIRKLSADCIIGTDLM
PERLKEIIIELGSMELRDRTGRICTLKFEARCSENIVVPGRTQMICYVKV
DEEK*
back to top

protein sequence of SMED30015808-orf-2

>SMED30015808-orf-2 ID=SMED30015808-orf-2|Name=SMED30015808-orf-2|organism=Schmidtea mediterranea sexual|type=polypeptide|length=2227bp
MTTLINSSIPDANTMSNNNNVMVGEFREKFRGEPFDGSLNKLDTFIKEFE
VYKNICHWTDQKVKERLPLYLKGSAQDVFVEEARDVTKLTTWTEIKEFLI
KIFGIEKKGNRKILDFLHRKQRRDESNAVYACELKKLCKEAFGETDLPED
KMVDVFIRGIKREDIRANLGCLAPETLDKAVAIANRCEAHLGLGYQVAVL
ATEPTTSTVNANNQNNNINPAMNQFIPRAQQMFKPPATRNPEDRGNNQVS
YNNNFRNKPNANEQCSTCQKMGHRSENCFRNYNCQICGKRGHTERICQQL
NSKACYNCGQQGHIARRCNIRGESNQPRPNNNPTRNPQINVIQEIDMLRE
TLQRMPMELKEMMQQMPTNIQQQRINVMRSNEEIQELRTREYQEQQQAEW
QRLQTEEAQEIQQRWENRKQTPKRINMMRMEIPDEIHTAEQCVENEGGGN
MITDNEKTVELNTMEKIEAIKEFTEEEKQRRRQLKETIIEKPNEPETQEI
KRAEMMITEDQNKETLVYEIDELENEIMTQKTESTLEKIKQEEAVEQEED
QSKEKEAILKQEKAELRKKALILKIDGALKHLEQEQALDQKIEVMAKKVL
SQEMKEPELKLQKDEQEASTSQEKERISEPIITKNRIQRILLQKIETRIR
KEKPTWSKTQIENKIKEIWFQIKGPTKIMKEEEQPHINMLRRIPDDQTDE
DESEISSLGGEIFQSCEENKPYKDESKSELEEMETSVPREDETEILKEIN
EIVEEVDRNQMFLNLRDTTAYSRIMKLIAKGYQQDNGTFTASWKDMIKKY
QENLKEYDREEYQVIIDFPEIPRQIIATRGESTNELYDWVVKKLGPSYKN
KPLYYQGRKIKRDIHLADALIWPKGINVVTLNKNETEETTAEIWQKIQIL
YTKEIKPGLEKERQKIMRQNQIKMTEQAIDQARKYINRLSLTRPISMKIF
VEAVRDTDIMRFDNERTDELIAKYGEHQRDMRGDEPIKIRIKLPNDEIKE
ISVDPDCQMHELYRRINREIIQPIIESSDDGMVEDVAIMYHKRQISPRER
TPIYELGIWEDGQTINIIAMDEPERKNTTKREQQIQEFQEEMKRKMDQIL
TIYQLWRQDAKLSTKLQPIDDSRCRSTPWKKVYDEKTKEWKWEMERTEPK
WRKYVPGEAPEDAANEITLELYEDEPYENLPEKMLNEMEWQPEEDEEIND
RARLAPYTWKIGGWAEKVKSAEEEKIIGITSHQFYTEIGGYRMKLRVYPN
GDGVGKGKYLSVYFLLARGRYDGKLEWPFNRKVTISIAKPGKWEERHSEK
LGVDPRSMISQKPKSTENVAGGVPQFLLKKYVTPQFVKDDTIYITIEVET
EREMKIRIQQEQARPRISVLEKRIPGTRYLPTDIDDSVEEGLTRLTETQK
CRELAAILRTGAKNQRRTVTDLAKWIIDSCNRVENLRNIVKEIEEYRRMY
AWYPEQFREIIRKWKHTEWAAETIEKYSLKIMTPDFEPIEREFYITAKVS
EVKKRIPYEPPFHLQYEGRSLDDDLEIGVTQMQLGLINILTVAKIAGREL
NKREIKTKTPIGRQESLNTPEVPPAADEVIVITTGDEEILNDLNDIVDEE
TTRRIPESRDLFMTENEDDLITDEPDELVCGQRQPVEIIEPDTEEENKKK
ERRRRSSTGDEWDNWINERGATTSKETADEQPKRKETGTAMEKKSRGRPK
IDKPAPERKTKEQMQMDQLTTKLNKLSQVTKQLQGKLKGQEQGAKWINRL
ITDMLGLANPEIKRNLKLNNIGAEAKQLWAAIKPIINKIMDNKVRTTTKD
PEELLLIINHLTKRSDDPNRYLVGMAYLMYNTIVIYRKRTPRYNPNGYEF
AITDIIRKVIEPFILTQGGWQAFINLVSKDDQTEIMQTKLKELLTEFETT
INASDPKTARKGMNAIITTILIWMMCVKGVEPFVVYDCDNIKIGDKYSLK
ETEECKAANPGRLQTTATAVSYNVYQEVDFIKTEIRECTVTRKIVAFHCR
NHSQSTIIETGTETTVVTVTRSECEKGFNTGVIRIAGRIQVAAEDGKIKT
TRVYAAGRIKAGDGSCEGGEYTLLNQLVRGVVVIESYQVKLEKFQSYFDP
NTQAIKKYPQCVATHGSCTTRMSTIVYHADTRACRLTLLKSAIFDEVQGQ
VHSETETNTQKRAMEELRRIGQIRNPTITTIIGSETTPTGVNSTDSAIGM
RFIKGRMVSKCDEMIISINYKEIFLS*
back to top

protein sequence of SMED30015808-orf-3

>SMED30015808-orf-3 ID=SMED30015808-orf-3|Name=SMED30015808-orf-3|organism=Schmidtea mediterranea sexual|type=polypeptide|length=134bp
MREDNRKVTGKLKIPSDKCINKGKIRFAQPVTRMINPAKFIPNMFSCSNV
YGPLFETRDRSWLQFPTRVIVAPPRVFGLTELASEAEFKPVDISRSGIYQ
TKDLERAREHLLFPTQRQTILSNIVTITRGNNY*
back to top

protein sequence of SMED30015808-orf-4

>SMED30015808-orf-4 ID=SMED30015808-orf-4|Name=SMED30015808-orf-4|organism=Schmidtea mediterranea sexual|type=polypeptide|length=176bp
MMKAMWGRFLIFGQMMAGILGIILIIQIVRVILTQMLACFDIYKRERKIN
WKMTLGFLPFLAKTMVLHGHSKDIHKIKRLVGILTRMNGTDEEVGRNFKA
IMKMEAERTRIKRQKTSNWKRWIDFKNDSSDNSYNDNQRGTQKLTQGKLQ
QWENQKTKLNEHYNHPPPAYECLKK*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: biological process
TermDefinition
GO:0001817regulation of cytokine production
GO:0007165signal transduction
GO:0008063Toll signaling pathway
GO:0032088negative regulation of NF-kappaB transcription factor activity
GO:0033209tumor necrosis factor-mediated signaling pathway
GO:0042981regulation of apoptotic process
GO:0045087innate immune response
GO:0050688regulation of defense response to virus
GO:0006508proteolysis
Vocabulary: molecular function
TermDefinition
GO:0005164tumor necrosis factor receptor binding
GO:0004190aspartic-type endopeptidase activity
GO:0003676nucleic acid binding
GO:0008270zinc ion binding
GO:0005515protein binding
GO:0046872metal ion binding
Vocabulary: cellular component
TermDefinition
GO:0005737cytoplasm
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000020protonephridia
PLANA:0000099neuron
PLANA:0000101muscle cell
PLANA:0000463cholinergic neuron
PLANA:0000464GABAergic neuron
PLANA:0002032epidermal cell
PLANA:0002056medial muscle cell
PLANA:0003116parenchymal cell
PLANA:0007528glial cell
Vocabulary: INTERPRO
TermDefinition
IPR019103Peptidase_aspartic_DDI1-type
IPR021109Peptidase_aspartic_dom_sf
IPR001878Znf_CCHC
IPR008974TRAF-like
IPR002083MATH/TRAF_dom