O-acyltransferase

Overview
NameO-acyltransferase
Smed IDSMED30015783
Length (bp)1566
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of O-acyltransferase (SMED30015783) t-SNE clustered cells

Violin plots show distribution of expression levels for O-acyltransferase (SMED30015783) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of O-acyltransferase (SMED30015783) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for O-acyltransferase (SMED30015783) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30015783

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 6

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
gutSMED30015783h1SMcG0008202 Contig1658GPL15192PMID:23079596
Forsthoefel et al., 2012
whole organism asexual adult colorimetric in situ hybridization evidence
intestinal phagocyteSMED30015783h1SMcG0008202 Contig1658GPL15192PMID:23079596
Forsthoefel et al., 2012
FACS sorted cell population asexual adult cDNA to DNA expression microarray evidence
gutSMED30015783 dd_Smed_v4_2567_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
cephalic gangliaSMED30015783 dd_Smed_v4_2567_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
neoblastSMED30015783 dd_Smed_v4_2567_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
parenchymal cellSMED30015783 dd_Smed_v4_2567_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of O-acyltransferase vs. Ensembl Human
Match: SOAT1 (sterol O-acyltransferase 1 [Source:HGNC Symbol;Acc:HGNC:11177])

HSP 1 Score: 288.5 bits (737), Expect = 3.784e-91
Identity = 163/463 (35.21%), Postives = 259/463 (55.94%), Query Frame = 3
Query:  138 IDASSSDHSNGDSKVLVRE-RVYVDRDSLLTEMFRIPHFNSLLNMFLSFVILMMMKTVCNDWLKEGFFKHYHHFQWVSNEFAGIQXXXXXX-XXXXXXXXXXXXXXKFWIIMRLKWKLKALLDVFSVFIYLLI-IGCAIVLPVRIVMNHYVPPCSSAFIVYEQIRILMKIHAYVRTVIPKLHHLFKQSNQHDILQKSINEVVCWKKFLYFLIIPTLVYRDSYPMRKSVNFKSVISSFLEFILCIIFMYYIFINLMRPIFHDFNPSFMTLEEIIPKFFQAILPTILMMLSVFFCFLHSWLNAFAELTKFGDRQFYKDWWNATSLSDYFRTWNALIYDWLYTYIYRDFSLLMLRITNNKMISKSFGMISVLLISALVHEYVLAFCFRFFYPVLLTVFFFSGTVLYF-VKANRASRIPNIMLWTGLYIGNSIFTTLYSSEWYARKNCKRTNEGFLDFIVPRSLFCE 1514
            ++   ++H   D +    + ++++ R SLL E+  + H  ++ +MF++ +IL ++ T+  D++ EG  +    F  +S  F     V+ T  +       + + L + W     K     +  +F  F++++  IG     P  +V+ + +PP S   I++EQIR +MK H++VR  +P++ +  K+       + S   +    ++LYFL  PTL+YRDSYP   +V +  V   F +   C  ++YYIF  L  P+F +      +   ++   F +ILP +L++   FF FLH WLNAFAE+ +FGDR FYKDWWN+TS S+Y+RTWN +++DWLY Y Y+DF    L   + +   KS  M++V  +SA+VHEY LA C  FFYPVL  +F F G    F V  +R   I N+++WT L++GN +    YS EWYAR++C   N  FLD++ PRS  C 
Sbjct:   35 LEGEKNNHRAKDLRAPPEQGKIFIARRSLLDELLEVDHIRTIYHMFIALLILFILSTLVVDYIDEG--RLVLEFSLLSYAFGKFPTVVWTWWIMFLSTFSVPYFLFQHWATGYSKSSHPLIRSLFHGFLFMIFQIGVLGFGPTYVVLAYTLPPASRFIIIFEQIRFVMKAHSFVRENVPRVLNSAKE-------KSSTVPIPTVNQYLYFLFAPTLIYRDSYPRNPTVRWGYVAMKFAQVFGCFFYVYYIFERLCAPLFRNIKQEPFSARVLVLCVFNSILPGVLILFLTFFAFLHCWLNAFAEMLRFGDRMFYKDWWNSTSYSNYYRTWNVVVHDWLYYYAYKDF----LWFFSKRF--KSAAMLAVFAVSAVVHEYALAVCLSFFYPVLFVLFMFFGMAFNFIVNDSRKKPIWNVLMWTSLFLGNGVLLCFYSQEWYARQHCPLKNPTFLDYVRPRSWTCR 482          
BLAST of O-acyltransferase vs. Ensembl Human
Match: SOAT1 (sterol O-acyltransferase 1 [Source:HGNC Symbol;Acc:HGNC:11177])

HSP 1 Score: 288.5 bits (737), Expect = 4.413e-91
Identity = 163/463 (35.21%), Postives = 259/463 (55.94%), Query Frame = 3
Query:  138 IDASSSDHSNGDSKVLVRE-RVYVDRDSLLTEMFRIPHFNSLLNMFLSFVILMMMKTVCNDWLKEGFFKHYHHFQWVSNEFAGIQXXXXXX-XXXXXXXXXXXXXXKFWIIMRLKWKLKALLDVFSVFIYLLI-IGCAIVLPVRIVMNHYVPPCSSAFIVYEQIRILMKIHAYVRTVIPKLHHLFKQSNQHDILQKSINEVVCWKKFLYFLIIPTLVYRDSYPMRKSVNFKSVISSFLEFILCIIFMYYIFINLMRPIFHDFNPSFMTLEEIIPKFFQAILPTILMMLSVFFCFLHSWLNAFAELTKFGDRQFYKDWWNATSLSDYFRTWNALIYDWLYTYIYRDFSLLMLRITNNKMISKSFGMISVLLISALVHEYVLAFCFRFFYPVLLTVFFFSGTVLYF-VKANRASRIPNIMLWTGLYIGNSIFTTLYSSEWYARKNCKRTNEGFLDFIVPRSLFCE 1514
            ++   ++H   D +    + ++++ R SLL E+  + H  ++ +MF++ +IL ++ T+  D++ EG  +    F  +S  F     V+ T  +       + + L + W     K     +  +F  F++++  IG     P  +V+ + +PP S   I++EQIR +MK H++VR  +P++ +  K+       + S   +    ++LYFL  PTL+YRDSYP   +V +  V   F +   C  ++YYIF  L  P+F +      +   ++   F +ILP +L++   FF FLH WLNAFAE+ +FGDR FYKDWWN+TS S+Y+RTWN +++DWLY Y Y+DF    L   + +   KS  M++V  +SA+VHEY LA C  FFYPVL  +F F G    F V  +R   I N+++WT L++GN +    YS EWYAR++C   N  FLD++ PRS  C 
Sbjct:   42 LEGEKNNHRAKDLRAPPEQGKIFIARRSLLDELLEVDHIRTIYHMFIALLILFILSTLVVDYIDEG--RLVLEFSLLSYAFGKFPTVVWTWWIMFLSTFSVPYFLFQHWATGYSKSSHPLIRSLFHGFLFMIFQIGVLGFGPTYVVLAYTLPPASRFIIIFEQIRFVMKAHSFVRENVPRVLNSAKE-------KSSTVPIPTVNQYLYFLFAPTLIYRDSYPRNPTVRWGYVAMKFAQVFGCFFYVYYIFERLCAPLFRNIKQEPFSARVLVLCVFNSILPGVLILFLTFFAFLHCWLNAFAEMLRFGDRMFYKDWWNSTSYSNYYRTWNVVVHDWLYYYAYKDF----LWFFSKRF--KSAAMLAVFAVSAVVHEYALAVCLSFFYPVLFVLFMFFGMAFNFIVNDSRKKPIWNVLMWTSLFLGNGVLLCFYSQEWYARQHCPLKNPTFLDYVRPRSWTCR 489          
BLAST of O-acyltransferase vs. Ensembl Human
Match: SOAT1 (sterol O-acyltransferase 1 [Source:HGNC Symbol;Acc:HGNC:11177])

HSP 1 Score: 288.115 bits (736), Expect = 3.674e-90
Identity = 163/463 (35.21%), Postives = 259/463 (55.94%), Query Frame = 3
Query:  138 IDASSSDHSNGDSKVLVRE-RVYVDRDSLLTEMFRIPHFNSLLNMFLSFVILMMMKTVCNDWLKEGFFKHYHHFQWVSNEFAGIQXXXXXX-XXXXXXXXXXXXXXKFWIIMRLKWKLKALLDVFSVFIYLLI-IGCAIVLPVRIVMNHYVPPCSSAFIVYEQIRILMKIHAYVRTVIPKLHHLFKQSNQHDILQKSINEVVCWKKFLYFLIIPTLVYRDSYPMRKSVNFKSVISSFLEFILCIIFMYYIFINLMRPIFHDFNPSFMTLEEIIPKFFQAILPTILMMLSVFFCFLHSWLNAFAELTKFGDRQFYKDWWNATSLSDYFRTWNALIYDWLYTYIYRDFSLLMLRITNNKMISKSFGMISVLLISALVHEYVLAFCFRFFYPVLLTVFFFSGTVLYF-VKANRASRIPNIMLWTGLYIGNSIFTTLYSSEWYARKNCKRTNEGFLDFIVPRSLFCE 1514
            ++   ++H   D +    + ++++ R SLL E+  + H  ++ +MF++ +IL ++ T+  D++ EG  +    F  +S  F     V+ T  +       + + L + W     K     +  +F  F++++  IG     P  +V+ + +PP S   I++EQIR +MK H++VR  +P++ +  K+       + S   +    ++LYFL  PTL+YRDSYP   +V +  V   F +   C  ++YYIF  L  P+F +      +   ++   F +ILP +L++   FF FLH WLNAFAE+ +FGDR FYKDWWN+TS S+Y+RTWN +++DWLY Y Y+DF    L   + +   KS  M++V  +SA+VHEY LA C  FFYPVL  +F F G    F V  +R   I N+++WT L++GN +    YS EWYAR++C   N  FLD++ PRS  C 
Sbjct:  100 LEGEKNNHRAKDLRAPPEQGKIFIARRSLLDELLEVDHIRTIYHMFIALLILFILSTLVVDYIDEG--RLVLEFSLLSYAFGKFPTVVWTWWIMFLSTFSVPYFLFQHWATGYSKSSHPLIRSLFHGFLFMIFQIGVLGFGPTYVVLAYTLPPASRFIIIFEQIRFVMKAHSFVRENVPRVLNSAKE-------KSSTVPIPTVNQYLYFLFAPTLIYRDSYPRNPTVRWGYVAMKFAQVFGCFFYVYYIFERLCAPLFRNIKQEPFSARVLVLCVFNSILPGVLILFLTFFAFLHCWLNAFAEMLRFGDRMFYKDWWNSTSYSNYYRTWNVVVHDWLYYYAYKDF----LWFFSKRF--KSAAMLAVFAVSAVVHEYALAVCLSFFYPVLFVLFMFFGMAFNFIVNDSRKKPIWNVLMWTSLFLGNGVLLCFYSQEWYARQHCPLKNPTFLDYVRPRSWTCR 547          
BLAST of O-acyltransferase vs. Ensembl Human
Match: SOAT2 (sterol O-acyltransferase 2 [Source:HGNC Symbol;Acc:HGNC:11178])

HSP 1 Score: 267.7 bits (683), Expect = 1.231e-82
Identity = 147/452 (32.52%), Postives = 248/452 (54.87%), Query Frame = 3
Query:  162 SNGDSKVLVRERVYVDRDSLLTEMFRIPHFNSLLNMFLSFVILMMMKTVCNDWLKEGFFKHYHHFQWVSNEFAGIQXXXXX-XXXXXXXXXXXXXXXKFWIIMRLKWKLKALLDVFSVFIYLLIIGCAIVLPVRIVMNHYVPPCSSAFIVYEQIRILMKIHAYVRTVIPKLHHLFKQSNQHDILQKSINEVVCWKKFLYFLIIPTLVYRDSYPMRKSVNFKSVISSFLEFILCIIFMYYIFINLMRPIFHDFNPSFMTLEEIIPKFFQAILPTILMMLSVFFCFLHSWLNAFAELTKFGDRQFYKDWWNATSLSDYFRTWNALIYDWLYTYIYRDFSLLMLRITNNKMISKSFGMISVLLISALVHEYVLAFCFRFFYPVLLTVFFFSGTVLYF-VKANRASRIPNIMLWTGLYIGNSIFTTLYSSEWYARKNCKRTNEGFLDFIVPRSLFC 1511
            S      L +++V++ R SLL E+  + HF ++ +MF++ + + ++ T+  D++ EG  +    F  +   F  + + L+T +      ++  +  ++ W   R  W     L    +  + +++ CA  LPV + + H +PP S   +V+EQ+R LMK ++++R  +P      +      I   S +       +LYFL  PTL+YR++YP    V +  V  +F + + C+++  +I   L  P+F + +    +   ++     A LP I M+L +FF FLH WLNAFAE+ +FGDR FY+DWWN+TS S+Y+RTWN +++DWLY+Y+Y+D     LR+   +  ++   M+ V L+SA+ HEY+  F   FFYPV+L +F   G +L F +   R     N+++WT L++G  I  +LY  EWYAR++C      F   + PRS  C
Sbjct:   91 SRTQEPSLGKQKVFIIRKSLLDELMEVQHFRTIYHMFIAGLCVFIISTLAIDFIDEG--RLLLEFDLLIFSFGQLPLALVTWVPMFLSTLLAPYQALRLWA--RGTWTQATGLGCALLAAHAVVL-CA--LPVHVAVEHQLPPASRCVLVFEQVRFLMKSYSFLREAVPGT---LRARRGEGIQAPSFS------SYLYFLFCPTLIYRETYPRTPYVRWNYVAKNFAQALGCVLYACFILGRLCVPVFANMSREPFSTRALVLSILHATLPGIFMLLLIFFAFLHCWLNAFAEMLRFGDRMFYRDWWNSTSFSNYYRTWNVVVHDWLYSYVYQD----GLRLLGAR--ARGVAMLGVFLVSAVAHEYIFCFVLGFFYPVMLILFLVIGGMLNFMMHDQRTGPAWNVLMWTMLFLGQGIQVSLYCQEWYARRHCPLPQATFWGLVTPRSWSC 520          
BLAST of O-acyltransferase vs. Ensembl Human
Match: DGAT1 (diacylglycerol O-acyltransferase 1 [Source:HGNC Symbol;Acc:HGNC:2843])

HSP 1 Score: 104.375 bits (259), Expect = 3.279e-23
Identity = 68/244 (27.87%), Postives = 114/244 (46.72%), Query Frame = 3
Query:  717 SINEVVCWKKFLYFLIIPTLVYRDSYPMRKSVNFKSVISSFLEFILCIIFMYYIFINLMRPIFHDFNPSF--MTLEEIIPKFFQAILPTILMMLSVFFCFLHSWLNAFAELTKFGDRQFYKDWWNATSLSDYFRTWNALIYDWLYTYIYRDFSLLMLRITNNKMISKSFGMISVLLISALVHEYVLAFCFRFFYPVLLTVFFFSGTVLYFVKANRASRIPNIMLWTGLYIGNSIFTTLYSSEWY 1442
            S  + + ++   YFL  PTL Y  ++P    +  + ++   LE +        +    M P   +    F  M    II +  +  +P  L+ L  F+   HS LNA AEL +FGDR+FY+DWWN+ S++ +++ WN  ++ W   + Y+     MLR  ++K ++++     V L SA  HEY+++   R F     T       + +FV         N  +W  L IG  I   +Y  ++Y
Sbjct:  242 SYPDNLTYRDLYYFLFAPTLCYELNFPRSPRIRKRFLLRRILEMLFFTQLQVGLIQQWMVPTIQNSMKPFKDMDYSRIIERLLKLAVPNHLIWLIFFYWLFHSCLNAVAELMQFGDREFYRDWWNSESVTYFWQNWNIPVHKWCIRHFYKP----MLRRGSSKWMART----GVFLASAFFHEYLVSVPLRMFRLWAFTGMMAQIPLAWFVGRFFQGNYGNAAVWLSLIIGQPIAVLMYVHDYY 477          
BLAST of O-acyltransferase vs. Ensembl Celegans
Match: mboa-1 (O-acyltransferase [Source:UniProtKB/TrEMBL;Acc:Q17498])

HSP 1 Score: 197.593 bits (501), Expect = 4.989e-57
Identity = 130/478 (27.20%), Postives = 221/478 (46.23%), Query Frame = 3
Query:  105 SKRRNNRESTKIDASSSDHSNGDSKVLVRERVYVDRDSLLTEMFRIPHFNSLLNMFLSFVILMMMKTVCNDWLKEGFFKHYHHFQWVSNEFAGIQXXXXXXXXXXXXXXXXXXXXKFWIIMRLKWKLKALLDVFSVFIYLLIIGCAIVLPVRIVMNHYVPPCSSAFIVYEQIRILMKIHAYVRTVIPKLHHLFKQSNQHDILQKSINEVV-CW---KKFLYFLIIPTLVYRDSYPMRKSVNFKSVISSFLEFILCIIFMYYIFINLMRPIFHDFNPSFMTLEEIIPKFFQAILPTILMMLSVFFCFLHSWLNAFAELTKFGDRQFYKDWWNATSLSDYFRTWNALIYDWLYTYIYRDFSLLMLRITNNKMISKSFGMISVLLISALVHEYVLAFCFRFFYPVLLTVFFFSGTVLYFVK---ANRASRIPNIMLWTGLYIGNSIFTTLYSSEWYARKN-CKRTNEGFLDFIVPRSLFCE 1514
            +K   N  +  +       S    K   +E+ +V R+SLLT  FR  H   + N F +  +L  ++ + +D L       +HH   +   F      +     +++  I  +   + W  +  K       ++  V  Y+  +      P++ +    +    S  I  E  RI MK+H+++R             N    +++ I   +  W   ++FLY+   P+ +YRDSYP  +  + K+    FLE +  I F+   F   + P  H  + + ++   I    F  I+P I+ M S+F+  LH WLN F+E+ +F DRQFY +WW+++++++Y+R WN +++DWLY Y++RD     L   N     +    ++V  +SA+ HEY     FR FYPV+  ++F  G   + V     NR++   N  LW  L IG  +F   Y  EWYAR+  C   +   +D + PR   C 
Sbjct:    8 AKGEENNNNVILKEHHEQVSVKHKKREFKEKTFVVRESLLTSEFRNGHMKIIYNCFTAAFLLFFLRAMIDDILVHKM--PFHHTWLIWWNFQNFIPTMAVWTGMFLSTIGVYYAYEHWSTIPSK-NTDLASNLPFVTAYVTYLAAFFYFPLKFLYESDLKCACSFIITCETTRIAMKVHSFIR------------ENWDRAMKRKIGGTIDAWPTMEQFLYYQFCPSFIYRDSYPRTEKRDMKAAGLYFLECLAVIEFVNLTFTQWVFPWLHVQDYTSLSFSTIALSLFTGIIPGIICMTSLFYGLLHCWLNCFSEMMQFADRQFYLNWWHSSNMAEYYRNWNLVVHDWLYAYVFRD-----LAAYNPGRKGQRAAQMAVFFLSAVFHEYWFGVAFRCFYPVMFVLYFIFGGTFFAVSRLITNRSAW--NTALWFNLLIGTGMFIAFYGQEWYARRGHCAPYSNAVVDLLFPRHWNCH 463          
BLAST of O-acyltransferase vs. Ensembl Celegans
Match: mboa-2 (O-acyltransferase [Source:UniProtKB/TrEMBL;Acc:F1LIN4])

HSP 1 Score: 87.8113 bits (216), Expect = 7.415e-19
Identity = 69/241 (28.63%), Postives = 117/241 (48.55%), Query Frame = 3
Query:  753 YFLIIPTLVYRDSYP----MRKSVNFKSVIS-SFLEFILCIIFMYYIFI---NLMRPIFHDFNPSFMTLEEIIPKFFQAILPTILMMLSVFFCFLHSWLNAFAELTKFGDRQFYKDWWNATSLSDYFRTWNALIYDWLYTYIYRDFSLLMLRITNNKMISKSFGMISVLLISALVHEYVLAFCFRFFYPVLLTVFFFSGTVLYFV---KANRASRIPNIMLWTGLYIGNSIFTTLYSSEWY 1442
            YF+  PTL Y   +P    +RK    K  +   FL F++  +   ++     N M+P+      S M     + +  +  +P  L+ L  F+ F HS+LN  AEL +F DR+FY+D+WNA ++  ++++WN  ++ +   +IY      M+R  NN   SK      V  +SA  HEY+++   + F   L + +   G +   +   K  R  R  NI++W  L +G  +   +Y  +WY
Sbjct:   76 YFMAAPTLCYEFKFPRLLRIRKHFLIKRTVELIFLSFLIAALVQQWVVPTVRNSMKPL------SEMEYSRCLERLLKLAIPNHLIWLLFFYTFFHSFLNLIAELLRFADREFYRDFWNAETIGYFWKSWNIPVHRFAVRHIYSP----MMR--NN--FSKMSAFFVVFFVSAFFHEYLVSVPLKIFR--LWSYYGMMGQIPLSIITDKVVRGGRTGNIIVWLSLIVGQPLAILMYGHDWY 300          
BLAST of O-acyltransferase vs. Ensembl Celegans
Match: mboa-2 (O-acyltransferase [Source:UniProtKB/TrEMBL;Acc:F1LIN4])

HSP 1 Score: 87.8113 bits (216), Expect = 7.415e-19
Identity = 69/241 (28.63%), Postives = 117/241 (48.55%), Query Frame = 3
Query:  753 YFLIIPTLVYRDSYP----MRKSVNFKSVIS-SFLEFILCIIFMYYIFI---NLMRPIFHDFNPSFMTLEEIIPKFFQAILPTILMMLSVFFCFLHSWLNAFAELTKFGDRQFYKDWWNATSLSDYFRTWNALIYDWLYTYIYRDFSLLMLRITNNKMISKSFGMISVLLISALVHEYVLAFCFRFFYPVLLTVFFFSGTVLYFV---KANRASRIPNIMLWTGLYIGNSIFTTLYSSEWY 1442
            YF+  PTL Y   +P    +RK    K  +   FL F++  +   ++     N M+P+      S M     + +  +  +P  L+ L  F+ F HS+LN  AEL +F DR+FY+D+WNA ++  ++++WN  ++ +   +IY      M+R  NN   SK      V  +SA  HEY+++   + F   L + +   G +   +   K  R  R  NI++W  L +G  +   +Y  +WY
Sbjct:   76 YFMAAPTLCYEFKFPRLLRIRKHFLIKRTVELIFLSFLIAALVQQWVVPTVRNSMKPL------SEMEYSRCLERLLKLAIPNHLIWLLFFYTFFHSFLNLIAELLRFADREFYRDFWNAETIGYFWKSWNIPVHRFAVRHIYSP----MMR--NN--FSKMSAFFVVFFVSAFFHEYLVSVPLKIFR--LWSYYGMMGQIPLSIITDKVVRGGRTGNIIVWLSLIVGQPLAILMYGHDWY 300          
BLAST of O-acyltransferase vs. Ensembl Celegans
Match: mboa-2 (O-acyltransferase [Source:UniProtKB/TrEMBL;Acc:F1LIN4])

HSP 1 Score: 87.4261 bits (215), Expect = 4.018e-18
Identity = 69/241 (28.63%), Postives = 117/241 (48.55%), Query Frame = 3
Query:  753 YFLIIPTLVYRDSYP----MRKSVNFKSVIS-SFLEFILCIIFMYYIFI---NLMRPIFHDFNPSFMTLEEIIPKFFQAILPTILMMLSVFFCFLHSWLNAFAELTKFGDRQFYKDWWNATSLSDYFRTWNALIYDWLYTYIYRDFSLLMLRITNNKMISKSFGMISVLLISALVHEYVLAFCFRFFYPVLLTVFFFSGTVLYFV---KANRASRIPNIMLWTGLYIGNSIFTTLYSSEWY 1442
            YF+  PTL Y   +P    +RK    K  +   FL F++  +   ++     N M+P+      S M     + +  +  +P  L+ L  F+ F HS+LN  AEL +F DR+FY+D+WNA ++  ++++WN  ++ +   +IY      M+R  NN   SK      V  +SA  HEY+++   + F   L + +   G +   +   K  R  R  NI++W  L +G  +   +Y  +WY
Sbjct:  258 YFMAAPTLCYEFKFPRLLRIRKHFLIKRTVELIFLSFLIAALVQQWVVPTVRNSMKPL------SEMEYSRCLERLLKLAIPNHLIWLLFFYTFFHSFLNLIAELLRFADREFYRDFWNAETIGYFWKSWNIPVHRFAVRHIYSP----MMR--NN--FSKMSAFFVVFFVSAFFHEYLVSVPLKIFR--LWSYYGMMGQIPLSIITDKVVRGGRTGNIIVWLSLIVGQPLAILMYGHDWY 482          
BLAST of O-acyltransferase vs. Ensembl Celegans
Match: mboa-2 (O-acyltransferase [Source:UniProtKB/TrEMBL;Acc:F1LIN4])

HSP 1 Score: 87.4261 bits (215), Expect = 4.018e-18
Identity = 69/241 (28.63%), Postives = 117/241 (48.55%), Query Frame = 3
Query:  753 YFLIIPTLVYRDSYP----MRKSVNFKSVIS-SFLEFILCIIFMYYIFI---NLMRPIFHDFNPSFMTLEEIIPKFFQAILPTILMMLSVFFCFLHSWLNAFAELTKFGDRQFYKDWWNATSLSDYFRTWNALIYDWLYTYIYRDFSLLMLRITNNKMISKSFGMISVLLISALVHEYVLAFCFRFFYPVLLTVFFFSGTVLYFV---KANRASRIPNIMLWTGLYIGNSIFTTLYSSEWY 1442
            YF+  PTL Y   +P    +RK    K  +   FL F++  +   ++     N M+P+      S M     + +  +  +P  L+ L  F+ F HS+LN  AEL +F DR+FY+D+WNA ++  ++++WN  ++ +   +IY      M+R  NN   SK      V  +SA  HEY+++   + F   L + +   G +   +   K  R  R  NI++W  L +G  +   +Y  +WY
Sbjct:  258 YFMAAPTLCYEFKFPRLLRIRKHFLIKRTVELIFLSFLIAALVQQWVVPTVRNSMKPL------SEMEYSRCLERLLKLAIPNHLIWLLFFYTFFHSFLNLIAELLRFADREFYRDFWNAETIGYFWKSWNIPVHRFAVRHIYSP----MMR--NN--FSKMSAFFVVFFVSAFFHEYLVSVPLKIFR--LWSYYGMMGQIPLSIITDKVVRGGRTGNIIVWLSLIVGQPLAILMYGHDWY 482          
BLAST of O-acyltransferase vs. Ensembl Fly
Match: CG8112 (gene:FBgn0037612 transcript:FBtr0305337)

HSP 1 Score: 189.889 bits (481), Expect = 2.394e-53
Identity = 145/494 (29.35%), Postives = 246/494 (49.80%), Query Frame = 3
Query:  117 NNRESTKIDASSSDHSNG-----------DSKVLVR-------ERVYVDRDSLLTEMFRIPHFNSLLNMFLSFVILMMMKTVCNDWLKEGFFKHYHHFQWVSNEFAG----IQXXXXXXXXXXXXXXXXXXXXKFWIIMRLKWKLKALLDVF-SVFIYLLIIGCAIV---LPVRIVMNHYVPPCSSAFIVYEQIRILMKIHAYVRTVIPKLHHLFKQSNQHDILQKSINE--VVCWKKFLYFLIIPTLVYRDSYPMRKSVNFKSVISSFLEFILCIIFMY-YIFINLMRPIFHDFNPSFMTLEEIIPKFFQAILPTILMMLSVFFCFLHSWLNAFAELTKFGDRQFYKDWWNATSLSDYFRTWNALIYDWLYTYIYRDFSLLMLRITNNKMISKSFGMISVLLISALVHEYVLAFCFRFFYPVLLTVFFFSGTVLYFVKANRASRIPNIMLWTGLYIGNSIFTTLYSSEWYARKNCKRTNEGFLDFIVPRSLFC 1511
            +NR +++  A  SD +NG            S+   R       E+V+V R+S LT + ++ H  ++ ++F   +++ ++  +C D+  +G       F      F G    +  V+   L  ++ V+  +   + W ++R K K  + L  F S    +L I   +V   +   + +   +P  S+  ++ E  R+LMK+HA+VR    ++ +   +    +  ++      V     + YFL  PTL+YRDSYP    + +K  ++  LE ++ I F+Y +I    +   F  +    M   ++I K F  +LP+ ++ L  F+  LHSWLN  +EL +FGDR FYKDWW + +   Y+R WN +++DWLY Y+Y+D    + R       SK    ++V +ISA+VHE VL F  + F+PV+   F   G  L F+  +    + NI LW  L +GN+   +LY+ E YA KNC  +NE +   ++P    C
Sbjct:   77 HNRVTSQAPADVSDSTNGHANGTHPRPPIQSETSARKQRRQLPEKVFVARESYLTALLQVEHMRTIYHIFYIILVMFLLNVICYDYFVDG------RFDLGLGTFRGGLRRLHWVMGVWLLEHVFVLALYFAFRGWALVRHKLKPHSSLQRFWSHSCLILYISSQLVFCFVSTSLCLKFNLPFVSACILLLESTRLLMKMHAFVRYNAERVLNGKAKKEDAEEEKEGSERPFVPPLSCYTYFLFAPTLIYRDSYPRTSHIRWKFALNRLLE-VVAIAFLYAFIHERHIHEHFGQYGLEPMGPSQLILKLFGMMLPSAVIFLCGFYLILHSWLNFTSELLRFGDRMFYKDWWTSHTYDGYYRNWNVVVHDWLYEYVYKDMYTHVFR------GSKVAASLAVFMISAVVHEQVLGFALQMFFPVMFFFFGVVGVALVFLMRSAPKVMGNIFLWFSLILGNATLISLYAMEHYALKNCNLSNESWTYRLLPAVWRC 557          
BLAST of O-acyltransferase vs. Ensembl Fly
Match: mdy (gene:FBgn0004797 transcript:FBtr0080916)

HSP 1 Score: 90.8929 bits (224), Expect = 5.393e-19
Identity = 63/240 (26.25%), Postives = 110/240 (45.83%), Query Frame = 3
Query:  738 WKKFLYFLIIPTLVYRDSYPMRKSVNFKSVISSFLEFILCIIFMYYIFINLMRP-IFHDFNP-SFMTLEEIIPKFFQAILPTILMMLSVFFCFLHSWLNAFAELTKFGDRQFYKDWWNATSLSDYFRTWNALIYDWLYTYIYRDFSLLMLRITNNKMISKSFGMISVLLISALVHEYVLAFCFRFFYPVLLTVFFFSG--------TVLYFVKANRASRIPNIMLWTGLYIGNSIFTTLY 1427
            +K  LYFL  PTL Y  ++P    V  + ++   LE ++ +  +  +F   + P + +   P S M +     +  +  LP  L  L  F+   HS+LNA  EL  F DR FY DWWNA ++  ++RTWN  ++ W   ++Y       + +      S+    I V L SA+ HEY+++   + +      ++ F G         +   ++     R+ NI++W  + +G  +    Y
Sbjct:  319 YKDLLYFLCAPTLCYELNFPRTSRVRKRFLLKRLLEVVIGVNVVMALFQQWIIPSVRNSLIPFSNMDVALATERLLKLALPNHLCWLCFFYLMFHSFLNAVGELLNFADRNFYCDWWNANNIDTFWRTWNMPVHRWCVRHLY-------IPVVQMGYSSRQASTI-VFLFSAVFHEYLVSVPLQIY-----KIWAFMGMMGQIPLSAISKSIEKKLGPRMGNIIVWASIILGQPLCIMAY 545          
BLAST of O-acyltransferase vs. Ensembl Fly
Match: mdy (gene:FBgn0004797 transcript:FBtr0080915)

HSP 1 Score: 90.8929 bits (224), Expect = 5.393e-19
Identity = 63/240 (26.25%), Postives = 110/240 (45.83%), Query Frame = 3
Query:  738 WKKFLYFLIIPTLVYRDSYPMRKSVNFKSVISSFLEFILCIIFMYYIFINLMRP-IFHDFNP-SFMTLEEIIPKFFQAILPTILMMLSVFFCFLHSWLNAFAELTKFGDRQFYKDWWNATSLSDYFRTWNALIYDWLYTYIYRDFSLLMLRITNNKMISKSFGMISVLLISALVHEYVLAFCFRFFYPVLLTVFFFSG--------TVLYFVKANRASRIPNIMLWTGLYIGNSIFTTLY 1427
            +K  LYFL  PTL Y  ++P    V  + ++   LE ++ +  +  +F   + P + +   P S M +     +  +  LP  L  L  F+   HS+LNA  EL  F DR FY DWWNA ++  ++RTWN  ++ W   ++Y       + +      S+    I V L SA+ HEY+++   + +      ++ F G         +   ++     R+ NI++W  + +G  +    Y
Sbjct:  319 YKDLLYFLCAPTLCYELNFPRTSRVRKRFLLKRLLEVVIGVNVVMALFQQWIIPSVRNSLIPFSNMDVALATERLLKLALPNHLCWLCFFYLMFHSFLNAVGELLNFADRNFYCDWWNANNIDTFWRTWNMPVHRWCVRHLY-------IPVVQMGYSSRQASTI-VFLFSAVFHEYLVSVPLQIY-----KIWAFMGMMGQIPLSAISKSIEKKLGPRMGNIIVWASIILGQPLCIMAY 545          
BLAST of O-acyltransferase vs. Ensembl Fly
Match: mdy (gene:FBgn0004797 transcript:FBtr0080917)

HSP 1 Score: 90.8929 bits (224), Expect = 5.393e-19
Identity = 63/240 (26.25%), Postives = 110/240 (45.83%), Query Frame = 3
Query:  738 WKKFLYFLIIPTLVYRDSYPMRKSVNFKSVISSFLEFILCIIFMYYIFINLMRP-IFHDFNP-SFMTLEEIIPKFFQAILPTILMMLSVFFCFLHSWLNAFAELTKFGDRQFYKDWWNATSLSDYFRTWNALIYDWLYTYIYRDFSLLMLRITNNKMISKSFGMISVLLISALVHEYVLAFCFRFFYPVLLTVFFFSG--------TVLYFVKANRASRIPNIMLWTGLYIGNSIFTTLY 1427
            +K  LYFL  PTL Y  ++P    V  + ++   LE ++ +  +  +F   + P + +   P S M +     +  +  LP  L  L  F+   HS+LNA  EL  F DR FY DWWNA ++  ++RTWN  ++ W   ++Y       + +      S+    I V L SA+ HEY+++   + +      ++ F G         +   ++     R+ NI++W  + +G  +    Y
Sbjct:  319 YKDLLYFLCAPTLCYELNFPRTSRVRKRFLLKRLLEVVIGVNVVMALFQQWIIPSVRNSLIPFSNMDVALATERLLKLALPNHLCWLCFFYLMFHSFLNAVGELLNFADRNFYCDWWNANNIDTFWRTWNMPVHRWCVRHLY-------IPVVQMGYSSRQASTI-VFLFSAVFHEYLVSVPLQIY-----KIWAFMGMMGQIPLSAISKSIEKKLGPRMGNIIVWASIILGQPLCIMAY 545          
BLAST of O-acyltransferase vs. Ensembl Fly
Match: mdy (gene:FBgn0004797 transcript:FBtr0347182)

HSP 1 Score: 90.8929 bits (224), Expect = 5.393e-19
Identity = 63/240 (26.25%), Postives = 110/240 (45.83%), Query Frame = 3
Query:  738 WKKFLYFLIIPTLVYRDSYPMRKSVNFKSVISSFLEFILCIIFMYYIFINLMRP-IFHDFNP-SFMTLEEIIPKFFQAILPTILMMLSVFFCFLHSWLNAFAELTKFGDRQFYKDWWNATSLSDYFRTWNALIYDWLYTYIYRDFSLLMLRITNNKMISKSFGMISVLLISALVHEYVLAFCFRFFYPVLLTVFFFSG--------TVLYFVKANRASRIPNIMLWTGLYIGNSIFTTLY 1427
            +K  LYFL  PTL Y  ++P    V  + ++   LE ++ +  +  +F   + P + +   P S M +     +  +  LP  L  L  F+   HS+LNA  EL  F DR FY DWWNA ++  ++RTWN  ++ W   ++Y       + +      S+    I V L SA+ HEY+++   + +      ++ F G         +   ++     R+ NI++W  + +G  +    Y
Sbjct:  319 YKDLLYFLCAPTLCYELNFPRTSRVRKRFLLKRLLEVVIGVNVVMALFQQWIIPSVRNSLIPFSNMDVALATERLLKLALPNHLCWLCFFYLMFHSFLNAVGELLNFADRNFYCDWWNANNIDTFWRTWNMPVHRWCVRHLY-------IPVVQMGYSSRQASTI-VFLFSAVFHEYLVSVPLQIY-----KIWAFMGMMGQIPLSAISKSIEKKLGPRMGNIIVWASIILGQPLCIMAY 545          
BLAST of O-acyltransferase vs. Ensembl Zebrafish
Match: soat1 (sterol O-acyltransferase 1 [Source:ZFIN;Acc:ZDB-GENE-081105-177])

HSP 1 Score: 268.855 bits (686), Expect = 6.953e-83
Identity = 157/468 (33.55%), Postives = 266/468 (56.84%), Query Frame = 3
Query:  117 NNRESTKIDASSSDHSNGDSKVLVRERVYVDRDSLLTEMFRIPHFNSLLNMFLSFVILMMMKTVCNDWLKEGFFKHYHHFQWVSNEFAGIQXXXXX-XXXXXXXXXXXXXXXKFWIIMRLKWKLKALLDVFSVFIYLLIIGCAIV-LPVRIVMNHYVPPCSSAFIVYEQIRILMKIHAYVRTVIPKLHHLFKQSNQHDILQKSINEVVCWKKFLYFLIIPTLVYRDSYPMRKSVNFKSVISSFLEFILCIIFMYYIFINLMRPIFHDFNPSFMTLEEIIPKFFQAILPTILMMLSVFFCFLHSWLNAFAELTKFGDRQFYKDWWNATSLSDYFRTWNALIYDWLYTYIYRDFSLLMLRITNNKMISKSFGMISVLLISALVHEYVLAFCFRFFYPVLLTVFFFSGTVLYFV-KANRASRIPNIMLWTGLYIGNSIFTTLYSSEWYARKNCKRTNEGFLDFIVPRSLFC 1511
            +++E +K+   ++  S G SK       +V R SLL ++F + H  ++ +MF++ +IL +  T+  D++ EG  +    F  +   F    +V++T +      +++ ++L+  W  +    + + L  V +  I L+  G  +  LP  +V+ + +PP S   ++ EQ+R++MK H+++R  +P++  L       D  + ++  V  + +++YFL  PTL+Y+D+YP    + +  V + F + +  + + YYIF+ L  P F + +        ++   F +ILP +L++   FF FLH WLNAFAE+ +FGDR FYKDWWN+TS ++Y+RTWN +++DWLY Y+YRDF    L +T  +   ++  M+ V  +SA+VHEYVLA CF FFYPV+  +F   G V  FV    R   I N+++WT L++G  +   LYS EWYA++ C       +D + PRS  C
Sbjct:   99 SDKEKSKL--RNAQPSQGQSKQ------FVIRRSLLDDLFEVNHIRTIYHMFIALLILFIFSTLVVDFIDEG--RLVLEFDLLVYAFGQFPLVVVTWMCMFLSTLVVPYVLLVVWAGIYSSSQHRLLWTVLAGSILLIYQGLGLGFLPTYVVLKNGLPPASCFILILEQVRLMMKSHSFIRENVPRVRSL-------DRNKSNLVAVPQFTQYIYFLFAPTLIYKDNYPRNPCIRWGYVATKFSQVLGSLFYAYYIFVRLCIPQFRNISMQLFDPRAMVLCVFNSILPGVLVLFLAFFAFLHCWLNAFAEMLRFGDRMFYKDWWNSTSYANYYRTWNVVVHDWLYYYVYRDF----LWMTQKRF--RAVAMLVVFTVSAVVHEYVLAICFGFFYPVMFCLFMCFGMVFNFVLHDRRKGPIWNVIMWTSLFLGQGVMICLYSQEWYAQRYCPIEEPSLIDLLKPRSWTC 543          
BLAST of O-acyltransferase vs. Ensembl Zebrafish
Match: soat1 (sterol O-acyltransferase 1 [Source:ZFIN;Acc:ZDB-GENE-081105-177])

HSP 1 Score: 268.855 bits (686), Expect = 6.953e-83
Identity = 157/468 (33.55%), Postives = 266/468 (56.84%), Query Frame = 3
Query:  117 NNRESTKIDASSSDHSNGDSKVLVRERVYVDRDSLLTEMFRIPHFNSLLNMFLSFVILMMMKTVCNDWLKEGFFKHYHHFQWVSNEFAGIQXXXXX-XXXXXXXXXXXXXXXKFWIIMRLKWKLKALLDVFSVFIYLLIIGCAIV-LPVRIVMNHYVPPCSSAFIVYEQIRILMKIHAYVRTVIPKLHHLFKQSNQHDILQKSINEVVCWKKFLYFLIIPTLVYRDSYPMRKSVNFKSVISSFLEFILCIIFMYYIFINLMRPIFHDFNPSFMTLEEIIPKFFQAILPTILMMLSVFFCFLHSWLNAFAELTKFGDRQFYKDWWNATSLSDYFRTWNALIYDWLYTYIYRDFSLLMLRITNNKMISKSFGMISVLLISALVHEYVLAFCFRFFYPVLLTVFFFSGTVLYFV-KANRASRIPNIMLWTGLYIGNSIFTTLYSSEWYARKNCKRTNEGFLDFIVPRSLFC 1511
            +++E +K+   ++  S G SK       +V R SLL ++F + H  ++ +MF++ +IL +  T+  D++ EG  +    F  +   F    +V++T +      +++ ++L+  W  +    + + L  V +  I L+  G  +  LP  +V+ + +PP S   ++ EQ+R++MK H+++R  +P++  L       D  + ++  V  + +++YFL  PTL+Y+D+YP    + +  V + F + +  + + YYIF+ L  P F + +        ++   F +ILP +L++   FF FLH WLNAFAE+ +FGDR FYKDWWN+TS ++Y+RTWN +++DWLY Y+YRDF    L +T  +   ++  M+ V  +SA+VHEYVLA CF FFYPV+  +F   G V  FV    R   I N+++WT L++G  +   LYS EWYA++ C       +D + PRS  C
Sbjct:   99 SDKEKSKL--RNAQPSQGQSKQ------FVIRRSLLDDLFEVNHIRTIYHMFIALLILFIFSTLVVDFIDEG--RLVLEFDLLVYAFGQFPLVVVTWMCMFLSTLVVPYVLLVVWAGIYSSSQHRLLWTVLAGSILLIYQGLGLGFLPTYVVLKNGLPPASCFILILEQVRLMMKSHSFIRENVPRVRSL-------DRNKSNLVAVPQFTQYIYFLFAPTLIYKDNYPRNPCIRWGYVATKFSQVLGSLFYAYYIFVRLCIPQFRNISMQLFDPRAMVLCVFNSILPGVLVLFLAFFAFLHCWLNAFAEMLRFGDRMFYKDWWNSTSYANYYRTWNVVVHDWLYYYVYRDF----LWMTQKRF--RAVAMLVVFTVSAVVHEYVLAICFGFFYPVMFCLFMCFGMVFNFVLHDRRKGPIWNVIMWTSLFLGQGVMICLYSQEWYAQRYCPIEEPSLIDLLKPRSWTC 543          
BLAST of O-acyltransferase vs. Ensembl Zebrafish
Match: soat2 (sterol O-acyltransferase 2 [Source:ZFIN;Acc:ZDB-GENE-061013-742])

HSP 1 Score: 236.498 bits (602), Expect = 1.581e-70
Identity = 125/328 (38.11%), Postives = 186/328 (56.71%), Query Frame = 3
Query:  546 VLPVRIVMNHYVPPCSSAFIVYEQIRILMKIHAYVRTVIPKLHHLFKQSNQHDILQKSINEVVCW----KKFLYFLIIPTLVYRDSYPMRKSVNFKSVISSFLEFILCIIFMYYIFINLMRPIFHDFNPSFMTLEEIIPKFFQAILPTILMMLSVFFCFLHSWLNAFAELTKFGDRQFYKDWWNATSLSDYFRTWNALIYDWLYTYIYRDFSLLMLRITNNKMISKSFGMISVLLISALVHEYVLAFCFRFFYPVLLTVFFFSGTVLYFV-KANRASRIPNIMLWTGLYIGNSIFTTLYSSEWYARKNCKRTNEGFLDFIVPRSLFCE 1514
            + PV +V+++ +PP S   I+ EQIR +MK ++++R           +S    +          W      +LYFL  PTL+YR+ YP   ++ ++ V  +FL+ +  + ++Y+I   L  P+F + +    +   +I   F A  P +LM++  F+ FLH WLNAFAE+ +F DR FYKDWWN+TS ++Y+RTWN +++DWLY Y YRDF    L ++  K+  +S   +SV  +SALVHEY     F FFYPV+   F   G V  F     R S + NI++WT L+IG  +   LY  EWYA+ +C RT  GF D + PRS  C 
Sbjct:  257 IFPVYVVLHYQLPPASRFIIILEQIRFVMKSYSFIR-----------ESTAAALKNTPQKGERLWFPALSSYLYFLFCPTLIYREVYPRNPNIRWRFVGMNFLKVLASLFYLYFILERLCIPVFRNKSGLQFSTRTLILTLFHAAFPGMLMLMLGFYAFLHCWLNAFAEMLRFADRMFYKDWWNSTSFANYYRTWNIVVHDWLYYYAYRDF----LWLSGYKL--RSVATLSVFAVSALVHEYAFTMGFGFFYPVMFCTFAGIGVVFNFAMNDKRKSPVWNIIMWTCLFIGQGVHVCLYCLEWYAQIHCPRTGAGFWDLVTPRSWTCS 567          
BLAST of O-acyltransferase vs. Ensembl Zebrafish
Match: soat2 (sterol O-acyltransferase 2 [Source:ZFIN;Acc:ZDB-GENE-061013-742])

HSP 1 Score: 171.785 bits (434), Expect = 6.444e-48
Identity = 110/368 (29.89%), Postives = 188/368 (51.09%), Query Frame = 3
Query:  117 NNRESTKIDASSSDHSNGDSKVLVRERVYVDRDSLLTEMFRIPHFNSLLNMFLSFVILMMMKTVCNDW-------LKEGFFKHYHHFQWVSNEFAGIQXXXXX-XXXXXXXXXXXXXXXKFWIIMRLKWKLKALLDVFSVFIYLLIIGCAI------VLPVRIVMNHYVPPCSSAFIVYEQIRILMKIHAYVRTVIPKLHHLFKQSNQHDILQKSINEVVCW----KKFLYFLIIPTLVYRDSYPMRKSVNFKSVISSFLEFILCIIFMYYIFINLMRPIFHDFNPSFMTLEEIIPKFFQAILPTILMMLSVFFCFLHSWLNAFAELTKFGDRQFYKDWWNATSLSDYFRTWNALIYDWLYTYIYRDF 1166
             +  +  +  + +  S+GD   L + +V+V R SLL E+F I H  ++ +MF++ + L  M T+  D+       L  G F +          F  + +V+    L     ++  + +++ W  +      +  + V +      II CA       + PV +V+++ +PP S   I+ EQIR +MK ++++R           +S    +          W      +LYFL  PTL+YR+ YP   ++ ++ V  +FL+ +  + ++Y+I   L  P+F + +    +   +I   F A  P +LM++  F+ FLH WLNAFAE+ +F DR FYKDWWN+TS ++Y+RTWN +++DWLY Y YRDF
Sbjct:   48 THSHTNMLTHTDNKTSSGDRHKLDQGKVFVARCSLLDELFEISHIRTIYHMFIAALFLFFMSTLAVDYIDQGRLVLDLGLFYY---------AFGQLHVVICCWTLMFSYTLLGPYHVLRVWAGLYHNGHHRTCVCVITA-----IILCAAQMSMLGIFPVYVVLHYQLPPASRFIIILEQIRFVMKSYSFIR-----------ESTAAALKNTPQKGERLWFPALSSYLYFLFCPTLIYREVYPRNPNIRWRFVGMNFLKVLASLFYLYFILERLCIPVFRNKSGLQFSTRTLILTLFHAAFPGMLMLMLGFYAFLHCWLNAFAEMLRFADRMFYKDWWNSTSFANYYRTWNIVVHDWLYYYAYRDF 390          
BLAST of O-acyltransferase vs. Ensembl Zebrafish
Match: dgat1b (diacylglycerol O-acyltransferase 1b [Source:ZFIN;Acc:ZDB-GENE-040718-158])

HSP 1 Score: 93.9745 bits (232), Expect = 6.088e-20
Identity = 62/236 (26.27%), Postives = 113/236 (47.88%), Query Frame = 3
Query:  753 YFLIIPTLVYRDSYPMRKSVNFKSVISSFLEFILCIIFMYYIFINLMRPIFHDFNPSFMTLE--EIIPKFFQAILPTILMMLSVFFCFLHSWLNAFAELTKFGDRQFYKDWWNATSLSDYFRTWNALIYDWLYTYIYRDFSLLMLRITNNKMISKSFGMISVLLISALVHEYVLAFCFRFF----YPVLLTVFFFSGTVLYFVKANRASRIPNIMLWTGLYIGNSIFTTLYSSEWY 1442
            YF+  PTL Y  ++P  +S+    ++    E +L    +  +    M PI          ++   +  +  +  +P  L+ L  F+ F HS +N  AEL +FGDR+FY+DWWN+ +++ +++ WN  ++ W   + Y+     +LR    K++S+S    +V   SA  HEY+++   R F    +  ++     +  V  F++ N      N  +W  L IG  I   +Y  ++Y
Sbjct:  270 YFVFAPTLCYELNFPRSESIRMGFLLRRLFEMLLLTQLLVGLTQQWMVPIIRSSMKPLQEMDYTRMTERLLRLAVPNHLLWLIFFYSFFHSSMNFMAELLRFGDREFYRDWWNSETITYFWQNWNIPVHKWCLRHFYKP----LLRRGAGKLLSQS----AVFFASAFFHEYLVSVPLRMFRLWAFMGMMAQIPLAWLVSRFLRGNYG----NAAVWLSLIIGQPIAVLMYVHDYY 493          
BLAST of O-acyltransferase vs. Ensembl Xenopus
Match: ythdc1 (YTH domain containing 1 [Source:Xenbase;Acc:XB-GENE-1004178])

HSP 1 Score: 274.633 bits (701), Expect = 5.592e-85
Identity = 135/324 (41.67%), Postives = 200/324 (61.73%), Query Frame = 3
Query:  549 LPVRIVMNHYVPPCSSAFIVYEQIRILMKIHAYVRTVIPKLHHLFKQSNQHDILQKSINEVVCWKKFLYFLIIPTLVYRDSYPMRKSVNFKSVISSFLEFILCIIFMYYIFINLMRPIFHDFNPSFMTLEEIIPKFFQAILPTILMMLSVFFCFLHSWLNAFAELTKFGDRQFYKDWWNATSLSDYFRTWNALIYDWLYTYIYRDFSLLMLRITNNKMISKSFGMISVLLISALVHEYVLAFCFRFFYPVLLTVFFFSGTVLYFV-KANRASRIPNIMLWTGLYIGNSIFTTLYSSEWYARKNCKRTNEGFLDFIVPRSLFCEI 1517
            +P  IV++H +PP S   I+ EQ+R++MK H++VR  +P++    K+       + SI  V    ++LYFL  PTL+YRDSYP   S+ +  V + F + + C+ + YY+F+ L  P+F + +    +L  ++   F +ILP +L++   FF FLH WLNAFAE+ +F DR FYKDWWN+TS ++Y+RTWN +++DWLY Y YRDF    L I   +   KS  M+ V  +SA+VHEY L  CF FFYPVL  +F   G +  F+    R   I N+++WT L++G  +   LYS EWYA+++C   N  F+DF+ PRS  C +
Sbjct:  237 MPTYIVLHHDLPPASRFIIILEQVRLIMKSHSFVRENVPRIFAFTKE-------KSSIVPVPQVTQYLYFLFAPTLIYRDSYPRNPSIRWGYVATKFAQVLGCLFYAYYVFVRLCIPLFRNISQEQFSLRVLVLCIFNSILPGVLVLFLAFFAFLHCWLNAFAEMLRFADRMFYKDWWNSTSFANYYRTWNVVVHDWLYYYAYRDF----LWIFGRRF--KSAAMLCVFTVSAVVHEYALGICFGFFYPVLFILFMCFGMLFNFILHDRRKGPIWNVIMWTSLFLGQGVLICLYSQEWYAQRHCPINNPAFIDFLKPRSWTCRL 547          
BLAST of O-acyltransferase vs. Ensembl Xenopus
Match: ythdc1 (YTH domain containing 1 [Source:Xenbase;Acc:XB-GENE-1004178])

HSP 1 Score: 274.248 bits (700), Expect = 6.726e-85
Identity = 134/324 (41.36%), Postives = 199/324 (61.42%), Query Frame = 3
Query:  549 LPVRIVMNHYVPPCSSAFIVYEQIRILMKIHAYVRTVIPKLHHLFKQSNQHDILQKSINEVVCWKKFLYFLIIPTLVYRDSYPMRKSVNFKSVISSFLEFILCIIFMYYIFINLMRPIFHDFNPSFMTLEEIIPKFFQAILPTILMMLSVFFCFLHSWLNAFAELTKFGDRQFYKDWWNATSLSDYFRTWNALIYDWLYTYIYRDFSLLMLRITNNKMISKSFGMISVLLISALVHEYVLAFCFRFFYPVLLTVFFFSGTVLYFV-KANRASRIPNIMLWTGLYIGNSIFTTLYSSEWYARKNCKRTNEGFLDFIVPRSLFCEI 1517
            +P  IV++H +PP S   I+ EQ+R++MK H++VR  +P++    K+       + SI  V    ++LYFL  PTL+YRDSYP   S+ +  V + F + + C+ + YY+F+ L  P+F + +    +L  ++   F +ILP +L++   FF FLH WLNAFAE+ +F DR FYKDWWN+TS ++Y+RTWN +++DWLY Y YRDF  +  R        KS  M+ V  +SA+VHEY L  CF FFYPVL  +F   G +  F+    R   I N+++WT L++G  +   LYS EWYA+++C   N  F+DF+ PRS  C +
Sbjct:  238 MPTYIVLHHDLPPASRFIIILEQVRLIMKSHSFVRENVPRIFAFTKE-------KSSIVPVPQVTQYLYFLFAPTLIYRDSYPRNPSIRWGYVATKFAQVLGCLFYAYYVFVRLCIPLFRNISQEQFSLRVLVLCIFNSILPGVLVLFLAFFAFLHCWLNAFAEMLRFADRMFYKDWWNSTSFANYYRTWNVVVHDWLYYYAYRDFLWIFGRRF------KSAAMLCVFTVSAVVHEYALGICFGFFYPVLFILFMCFGMLFNFILHDRRKGPIWNVIMWTSLFLGQGVLICLYSQEWYAQRHCPINNPAFIDFLKPRSWTCRL 548          
BLAST of O-acyltransferase vs. Ensembl Xenopus
Match: ythdc1 (YTH domain containing 1 [Source:Xenbase;Acc:XB-GENE-1004178])

HSP 1 Score: 264.618 bits (675), Expect = 1.871e-82
Identity = 152/457 (33.26%), Postives = 249/457 (54.49%), Query Frame = 3
Query:  114 RNNRESTKIDASSSDHSNGDSKVLVRERVYVDRDSLLTEMFRIPHFNSLLNMFLSFVILMMMKTVCNDWLKEGFFKHYHHFQWVSNEFAGIQXXXXXXXXXXXXXXXXXXXXKFWIIMRLKWKLKALLDVFSVFIYLLIIGCAIV----LPVRIVMNHYVPPCSSAFIVYEQIRILMKIHAYVRTVIPKLHHLFKQSNQHDILQKSINEVVCWKKFLYFLIIPTLVYRDSYPMRKSVNFKSVISSFLEFILCIIFMYYIFINLMRPIFHDFNPSFMTLEEIIPKFFQAILPTILMMLSVFFCFLHSWLNAFAELTKFGDRQFYKDWWNATSLSDYFRTWNALIYDWLYTYIYRDFSLLMLRITNNKMISKSFGMISVLLISALVHEYVLAFCFRFFYPVLLTVFFFSGTVLYFV-KANRASRIPNIMLWTGLYIGNSIFTTLYSSEWYARKNCKRTN 1469
            R  + + K       H     +  +R ++      L +E+F + H  ++ +MF++ +IL ++ T+  D++ EG  +    F  +   F   +  ++    L + +    +    +      ++      + SVF  LL +   ++    +P  IV++H +PP S   I+ EQ+R++MK H++VR  +P++    K+       + SI  V    ++LYFL  PTL+YRDSYP   S+ +  V + F + + C+ + YY+F+ L  P+F + +    +L  ++   F +ILP +L++   FF FLH WLNAFAE+ +F DR FYKDWWN+TS ++Y+RTWN +++DWLY Y YRDF    L I   +   KS  M+ V  +SA+VHEY L  CF FFYPVL  +F   G +  F+    R   I N+++WT L++G  +   LYS EWYA+++C   N
Sbjct:    5 REPQSNVKRLGEQHKHHKSSWRCQIRCQMADTVSFLHSELFEVNHIRTIYHMFIALLILFILSTLVVDFIDEG--RLVLEFDLLVYAFG--KFPIVISTWLCMFLSTFLIPYGLFSAWARGYRASFHRSIRSVFFGLLFMTFQMLGLGFMPTYIVLHHDLPPASRFIIILEQVRLIMKSHSFVRENVPRIFAFTKE-------KSSIVPVPQVTQYLYFLFAPTLIYRDSYPRNPSIRWGYVATKFAQVLGCLFYAYYVFVRLCIPLFRNISQEQFSLRVLVLCIFNSILPGVLVLFLAFFAFLHCWLNAFAEMLRFADRMFYKDWWNSTSFANYYRTWNVVVHDWLYYYAYRDF----LWIFGRRF--KSAAMLCVFTVSAVVHEYALGICFGFFYPVLFILFMCFGMLFNFILHDRRKGPIWNVIMWTSLFLGQGVLICLYSQEWYAQRHCPINN 444          
BLAST of O-acyltransferase vs. Ensembl Xenopus
Match: ythdc1 (YTH domain containing 1 [Source:Xenbase;Acc:XB-GENE-1004178])

HSP 1 Score: 260.766 bits (665), Expect = 8.801e-81
Identity = 148/422 (35.07%), Postives = 239/422 (56.64%), Query Frame = 3
Query:  219 LLTEMFRIPHFNSLLNMFLSFVILMMMKTVCNDWLKEGFFKHYHHFQWVSNEFAGIQXXXXXXXXXXXXXXXXXXXXKFWIIMRLKWKLKALLDVFSVFIYLLIIGCAIV----LPVRIVMNHYVPPCSSAFIVYEQIRILMKIHAYVRTVIPKLHHLFKQSNQHDILQKSINEVVCWKKFLYFLIIPTLVYRDSYPMRKSVNFKSVISSFLEFILCIIFMYYIFINLMRPIFHDFNPSFMTLEEIIPKFFQAILPTILMMLSVFFCFLHSWLNAFAELTKFGDRQFYKDWWNATSLSDYFRTWNALIYDWLYTYIYRDFSLLMLRITNNKMISKSFGMISVLLISALVHEYVLAFCFRFFYPVLLTVFFFSGTVLYFV-KANRASRIPNIMLWTGLYIGNSIFTTLYSSEWYARKNCKRTN 1469
            L +E+F + H  ++ +MF++ +IL ++ T+  D++ EG  +    F  +   F   +  ++    L + +    +    +      ++      + SVF  LL +   ++    +P  IV++H +PP S   I+ EQ+R++MK H++VR  +P++    K+       + SI  V    ++LYFL  PTL+YRDSYP   S+ +  V + F + + C+ + YY+F+ L  P+F + +    +L  ++   F +ILP +L++   FF FLH WLNAFAE+ +F DR FYKDWWN+TS ++Y+RTWN +++DWLY Y YRDF    L I   +   KS  M+ V  +SA+VHEY L  CF FFYPVL  +F   G +  F+    R   I N+++WT L++G  +   LYS EWYA+++C   N
Sbjct:   49 LHSELFEVNHIRTIYHMFIALLILFILSTLVVDFIDEG--RLVLEFDLLVYAFG--KFPIVISTWLCMFLSTFLIPYGLFSAWARGYRASFHRSIRSVFFGLLFMTFQMLGLGFMPTYIVLHHDLPPASRFIIILEQVRLIMKSHSFVRENVPRIFAFTKE-------KSSIVPVPQVTQYLYFLFAPTLIYRDSYPRNPSIRWGYVATKFAQVLGCLFYAYYVFVRLCIPLFRNISQEQFSLRVLVLCIFNSILPGVLVLFLAFFAFLHCWLNAFAEMLRFADRMFYKDWWNSTSFANYYRTWNVVVHDWLYYYAYRDF----LWIFGRRF--KSAAMLCVFTVSAVVHEYALGICFGFFYPVLFILFMCFGMLFNFILHDRRKGPIWNVIMWTSLFLGQGVLICLYSQEWYAQRHCPINN 453          
BLAST of O-acyltransferase vs. Ensembl Xenopus
Match: ythdc1 (YTH domain containing 1 [Source:Xenbase;Acc:XB-GENE-1004178])

HSP 1 Score: 259.61 bits (662), Expect = 1.424e-80
Identity = 148/422 (35.07%), Postives = 239/422 (56.64%), Query Frame = 3
Query:  219 LLTEMFRIPHFNSLLNMFLSFVILMMMKTVCNDWLKEGFFKHYHHFQWVSNEFAGIQXXXXXXXXXXXXXXXXXXXXKFWIIMRLKWKLKALLDVFSVFIYLLIIGCAIV----LPVRIVMNHYVPPCSSAFIVYEQIRILMKIHAYVRTVIPKLHHLFKQSNQHDILQKSINEVVCWKKFLYFLIIPTLVYRDSYPMRKSVNFKSVISSFLEFILCIIFMYYIFINLMRPIFHDFNPSFMTLEEIIPKFFQAILPTILMMLSVFFCFLHSWLNAFAELTKFGDRQFYKDWWNATSLSDYFRTWNALIYDWLYTYIYRDFSLLMLRITNNKMISKSFGMISVLLISALVHEYVLAFCFRFFYPVLLTVFFFSGTVLYFV-KANRASRIPNIMLWTGLYIGNSIFTTLYSSEWYARKNCKRTN 1469
            L +E+F + H  ++ +MF++ +IL ++ T+  D++ EG  +    F  +   F   +  ++    L + +    +    +      ++      + SVF  LL +   ++    +P  IV++H +PP S   I+ EQ+R++MK H++VR  +P++    K+       + SI  V    ++LYFL  PTL+YRDSYP   S+ +  V + F + + C+ + YY+F+ L  P+F + +    +L  ++   F +ILP +L++   FF FLH WLNAFAE+ +F DR FYKDWWN+TS ++Y+RTWN +++DWLY Y YRDF    L I   +   KS  M+ V  +SA+VHEY L  CF FFYPVL  +F   G +  F+    R   I N+++WT L++G  +   LYS EWYA+++C   N
Sbjct:   31 LHSELFEVNHIRTIYHMFIALLILFILSTLVVDFIDEG--RLVLEFDLLVYAFG--KFPIVISTWLCMFLSTFLIPYGLFSAWARGYRASFHRSIRSVFFGLLFMTFQMLGLGFMPTYIVLHHDLPPASRFIIILEQVRLIMKSHSFVRENVPRIFAFTKE-------KSSIVPVPQVTQYLYFLFAPTLIYRDSYPRNPSIRWGYVATKFAQVLGCLFYAYYVFVRLCIPLFRNISQEQFSLRVLVLCIFNSILPGVLVLFLAFFAFLHCWLNAFAEMLRFADRMFYKDWWNSTSFANYYRTWNVVVHDWLYYYAYRDF----LWIFGRRF--KSAAMLCVFTVSAVVHEYALGICFGFFYPVLFILFMCFGMLFNFILHDRRKGPIWNVIMWTSLFLGQGVLICLYSQEWYAQRHCPINN 435          
BLAST of O-acyltransferase vs. Ensembl Mouse
Match: Soat1 (sterol O-acyltransferase 1 [Source:MGI Symbol;Acc:MGI:104665])

HSP 1 Score: 281.952 bits (720), Expect = 4.106e-88
Identity = 160/463 (34.56%), Postives = 262/463 (56.59%), Query Frame = 3
Query:  138 IDASSSDHSNGDSKVLVRE-RVYVDRDSLLTEMFRIPHFNSLLNMFLSFVILMMMKTVCNDWLKEGFFKHYHHFQWVSNEFAGIQXXXXXX-XXXXXXXXXXXXXXKFWIIMRLKWKLKALLDVFSVFIYLLI-IGCAIVLPVRIVMNHYVPPCSSAFIVYEQIRILMKIHAYVRTVIPKLHHLFKQSNQHDILQKSINEVVCWKKFLYFLIIPTLVYRDSYPMRKSVNFKSVISSFLEFILCIIFMYYIFINLMRPIFHDFNPSFMTLEEIIPKFFQAILPTILMMLSVFFCFLHSWLNAFAELTKFGDRQFYKDWWNATSLSDYFRTWNALIYDWLYTYIYRDFSLLMLRITNNKMISKSFGMISVLLISALVHEYVLAFCFRFFYPVLLTVFFFSGTVLYF-VKANRASRIPNIMLWTGLYIGNSIFTTLYSSEWYARKNCKRTNEGFLDFIVPRSLFCE 1514
            ++    +H   D +    + ++++ R SLL E+F + H  ++ +MF++ +IL ++ T+  D++ EG  +    F  ++  F     V+ T        + + + L + W     K     +  +    ++L+  +G    +P  +V+ + +PP S   ++ EQIR++MK H++VR  IP++ +  K+ +  D L  ++N+      +LYFL  PTL+YRD+YP   +V +  V   FL+   C+ ++YYIF  L  P+F +      +   ++   F +ILP +L++   FF FLH WLNAFAE+ +FGDR FYKDWWN+TS S+Y+RTWN +++DWLY Y+Y+D    +L   + +   KS  M++V  +SA+VHEY LA C  +FYPVL  +F F G    F V  +R   I NIM+W  L++G  +    YS EWYAR++C   N  FLD++ PR+  C 
Sbjct:   90 LEEMKKNHRAKDLRAPPEQGKIFISRQSLLDELFEVDHIRTIYHMFIALLILFVLSTIVVDYIDEG--RLVLEFNLLAYAFGKFPTVIWTWWAMFLSTLSIPYFLFQRWAHGYSKSSHPLIYSLVHGLLFLVFQLGVLGFVPTYVVLAYTLPPASRFILILEQIRLIMKAHSFVRENIPRVLNAAKEKSSKDPL-PTVNQ------YLYFLFAPTLIYRDNYPRTPTVRWGYVAMQFLQVFGCLFYVYYIFERLCAPLFRNIKQEPFSARVLVLCVFNSILPGVLILFLSFFAFLHCWLNAFAEMLRFGDRMFYKDWWNSTSYSNYYRTWNVVVHDWLYYYVYKD----LLWFFSKRF--KSAAMLAVFALSAVVHEYALAICLSYFYPVLFVLFMFFGMAFNFIVNDSRKRPIWNIMVWASLFLGYGLILCFYSQEWYARQHCPLKNPTFLDYVRPRTWTCR 537          
BLAST of O-acyltransferase vs. Ensembl Mouse
Match: Soat1 (sterol O-acyltransferase 1 [Source:MGI Symbol;Acc:MGI:104665])

HSP 1 Score: 281.952 bits (720), Expect = 4.106e-88
Identity = 160/463 (34.56%), Postives = 262/463 (56.59%), Query Frame = 3
Query:  138 IDASSSDHSNGDSKVLVRE-RVYVDRDSLLTEMFRIPHFNSLLNMFLSFVILMMMKTVCNDWLKEGFFKHYHHFQWVSNEFAGIQXXXXXX-XXXXXXXXXXXXXXKFWIIMRLKWKLKALLDVFSVFIYLLI-IGCAIVLPVRIVMNHYVPPCSSAFIVYEQIRILMKIHAYVRTVIPKLHHLFKQSNQHDILQKSINEVVCWKKFLYFLIIPTLVYRDSYPMRKSVNFKSVISSFLEFILCIIFMYYIFINLMRPIFHDFNPSFMTLEEIIPKFFQAILPTILMMLSVFFCFLHSWLNAFAELTKFGDRQFYKDWWNATSLSDYFRTWNALIYDWLYTYIYRDFSLLMLRITNNKMISKSFGMISVLLISALVHEYVLAFCFRFFYPVLLTVFFFSGTVLYF-VKANRASRIPNIMLWTGLYIGNSIFTTLYSSEWYARKNCKRTNEGFLDFIVPRSLFCE 1514
            ++    +H   D +    + ++++ R SLL E+F + H  ++ +MF++ +IL ++ T+  D++ EG  +    F  ++  F     V+ T        + + + L + W     K     +  +    ++L+  +G    +P  +V+ + +PP S   ++ EQIR++MK H++VR  IP++ +  K+ +  D L  ++N+      +LYFL  PTL+YRD+YP   +V +  V   FL+   C+ ++YYIF  L  P+F +      +   ++   F +ILP +L++   FF FLH WLNAFAE+ +FGDR FYKDWWN+TS S+Y+RTWN +++DWLY Y+Y+D    +L   + +   KS  M++V  +SA+VHEY LA C  +FYPVL  +F F G    F V  +R   I NIM+W  L++G  +    YS EWYAR++C   N  FLD++ PR+  C 
Sbjct:   90 LEEMKKNHRAKDLRAPPEQGKIFISRQSLLDELFEVDHIRTIYHMFIALLILFVLSTIVVDYIDEG--RLVLEFNLLAYAFGKFPTVIWTWWAMFLSTLSIPYFLFQRWAHGYSKSSHPLIYSLVHGLLFLVFQLGVLGFVPTYVVLAYTLPPASRFILILEQIRLIMKAHSFVRENIPRVLNAAKEKSSKDPL-PTVNQ------YLYFLFAPTLIYRDNYPRTPTVRWGYVAMQFLQVFGCLFYVYYIFERLCAPLFRNIKQEPFSARVLVLCVFNSILPGVLILFLSFFAFLHCWLNAFAEMLRFGDRMFYKDWWNSTSYSNYYRTWNVVVHDWLYYYVYKD----LLWFFSKRF--KSAAMLAVFALSAVVHEYALAICLSYFYPVLFVLFMFFGMAFNFIVNDSRKRPIWNIMVWASLFLGYGLILCFYSQEWYARQHCPLKNPTFLDYVRPRTWTCR 537          
BLAST of O-acyltransferase vs. Ensembl Mouse
Match: Soat2 (sterol O-acyltransferase 2 [Source:MGI Symbol;Acc:MGI:1332226])

HSP 1 Score: 268.47 bits (685), Expect = 4.932e-83
Identity = 151/469 (32.20%), Postives = 257/469 (54.80%), Query Frame = 3
Query:  123 RESTKIDASSSDHSNGDSKVLVRER-VYVDRDSLLTEMFRIPHFNSLLNMFLSFVILMMMKTVCNDWLKEGFFKHYHHFQWVSNEFAGIQXXXXXXXXXXXXXXXXXXXXKFWIIMRLK----WKLKALLDVFSVFIYLLIIGCAIVLPVRIVMNHYVPPCSSAFIVYEQIRILMKIHAYVRTVIPKLHHLFKQSNQHDILQKSINEVVCWKKFLYFLIIPTLVYRDSYPMRKSVNFKSVISSFLEFILCIIFMYYIFINLMRPIFHDFNPSFMTLEEIIPKFFQAILPTILMMLSVFFCFLHSWLNAFAELTKFGDRQFYKDWWNATSLSDYFRTWNALIYDWLYTYIYRDFSLLMLRITNNKMISKSFGMISVLLISALVHEYVLAFCFRFFYPVLLTVFFFSGTVLYFVKANRASRIP-NIMLWTGLYIGNSIFTTLYSSEWYARKNCKRTNEGFLDFIVPRSLFC 1511
            ++   + +++ D ++   ++   +R V++ R SL+ E+  + HF ++ +MF++ + ++++ T+  D++ EG  +    F  +   F G   + L       L  L       W+  R +    W L A L    +  + +++    VLPV + + H +PP S   +V+EQ+R+LMK ++++R  +P +   F       I   S +       +LYFL  PTL+YR++YP   S+ +  V  +F + + C+++  +I   L  P+F + +    +   ++     A  P I M+L +FF FLH WLNAFAE+ +FGDR FY+DWWN+TS S+Y+RTWN +++DWLY+Y+Y+D   L+ R       ++   M+ V L+SA+VHEY+  F   FFYPV+L +F   G +L F   +R +    NI++WT L++G  I  +LY  EWYAR++C      F   + PRS  C
Sbjct:   76 KQDRPLPSAAPDSTSKTQELHPGKRKVFITRKSLIDELMEVQHFRTIYHMFIAGLCVLIISTLAIDFIDEG--RLMLEFDLLLFSF-GQLPLALMTWVPMFLSTLLVPYQTLWLWARPRAGGAWMLGASLGCVLLAAHAVVL---CVLPVHVSVRHELPPASRCVLVFEQVRLLMKSYSFLRETVPGI---FCVRGGKGISPPSFS------SYLYFLFCPTLIYRETYPRTPSIRWNYVAKNFAQVLGCLLYACFILGRLCVPVFANMSREPFSTRALLLSILHATGPGIFMLLLIFFAFLHCWLNAFAEMLRFGDRMFYRDWWNSTSFSNYYRTWNVVVHDWLYSYVYQDGLWLLGR------RARGVAMLGVFLVSAVVHEYIFCFVLGFFYPVMLMLFLVFGGLLNFTMNDRHTGPAWNILMWTFLFMGQGIQVSLYCQEWYARRHCPLPQTTFWGMVTPRSWSC 523          
BLAST of O-acyltransferase vs. Ensembl Mouse
Match: Dgat1 (diacylglycerol O-acyltransferase 1 [Source:MGI Symbol;Acc:MGI:1333825])

HSP 1 Score: 107.457 bits (267), Expect = 1.933e-24
Identity = 81/332 (24.40%), Postives = 147/332 (44.28%), Query Frame = 3
Query:  483 LKALLDVFSVFIYLLIIGCAIVLPVRIVM-NHYVPPCSSAFIVYEQIRILMKIHAY--------VRTVIPKLHHLFKQSNQHDILQK-SINEVVCWKKFLYFLIIPTLVYRDSYPMRKSVNFKSVISSFLEFILCIIFMYYIFINLMRPIFHDFNPSF--MTLEEIIPKFFQAILPTILMMLSVFFCFLHSWLNAFAELTKFGDRQFYKDWWNATSLSDYFRTWNALIYDWLYTYIYRDFSLLMLRITNNKMISKSFGMISVLLISALVHEYVLAFCFRFFYPVLLTVFFFSGTVLYFVKANRASRIPNIMLWTGLYIGNSIFTTLYSSEWY 1442
            + AL +   + ++++ +   I  P  + +    + P  S F +     + +K+++Y         R V  K     K+ +     Q  S  + + ++   YF+  PTL Y  ++P    +  + ++   LE +        +    M P   +    F  M    II +  +  +P  L+ L  F+ F HS LNA AEL +FGDR+FY+DWWNA S++ +++ WN  ++ W   + Y+     MLR  ++K ++++     V L SA  HEY+++   R F     T       + + V         N  +W  L IG  +   +Y  ++Y
Sbjct:  165 VGALTEQMGLLLHVVNLATIICFPAAVALLVESITPVGSVFALASYSIMFLKLYSYRDVNLWCRQRRVKAKAVSTGKKVSGAAAQQAVSYPDNLTYRDLYYFIFAPTLCYELNFPRSPRIRKRFLLRRVLEMLFFTQLQVGLIQQWMVPTIQNSMKPFKDMDYSRIIERLLKLAVPNHLIWLIFFYWFFHSCLNAVAELLQFGDREFYRDWWNAESVTYFWQNWNIPVHKWCIRHFYKP----MLRHGSSKWVART----GVFLTSAFFHEYLVSVPLRMFRLWAFTAMMAQVPLAWIVGRFFQGNYGNAAVWVTLIIGQPVAVLMYVHDYY 488          
BLAST of O-acyltransferase vs. Ensembl Mouse
Match: Soat2 (sterol O-acyltransferase 2 [Source:MGI Symbol;Acc:MGI:1332226])

HSP 1 Score: 76.6406 bits (187), Expect = 4.444e-15
Identity = 58/230 (25.22%), Postives = 115/230 (50.00%), Query Frame = 3
Query:  123 RESTKIDASSSDHSNGDSKVLVRER-VYVDRDSLLTEMFRIPHFNSLLNMFLSFVILMMMKTVCNDWLKEGFFKHYHHFQWVSNEFAGIQXXXXXXXXXXXXXXXXXXXXKFWIIMRLK----WKLKALLDVFSVFIYLLIIGCAIVLPVRIVMNHYVPPCSSAFIVYEQIRILMKIHAYVRTVIPKLHHLFKQSNQHDILQKSINEVVCWKKFLYFLIIPTLVYRDSYP 797
            ++   + +++ D ++   ++   +R V++ R SL+ E+  + HF ++ +MF++ + ++++ T+  D++ EG  +    F  +   F G   + L       L  L       W+  R +    W L A L    +  + +++    VLPV + + H +PP S   +V+EQ+R+LMK ++++R  +P    +F       I   S +       +LYFL  PTL+YR++YP
Sbjct:   47 KQDRPLPSAAPDSTSKTQELHPGKRKVFITRKSLIDELMEVQHFRTIYHMFIAGLCVLIISTLAIDFIDEG--RLMLEFDLLLFSF-GQLPLALMTWVPMFLSTLLVPYQTLWLWARPRAGGAWMLGASLGCVLLAAHAVVL---CVLPVHVSVRHELPPASRCVLVFEQVRLLMKSYSFLRETVPG---IFCVRGGEGISPPSFS------SYLYFLFCPTLIYRETYP 261          
BLAST of O-acyltransferase vs. UniProt/SwissProt
Match: sp|O77760|SOAT1_CHLAE (Sterol O-acyltransferase 1 OS=Chlorocebus aethiops OX=9534 GN=SOAT1 PE=2 SV=1)

HSP 1 Score: 288.115 bits (736), Expect = 1.673e-89
Identity = 164/463 (35.42%), Postives = 259/463 (55.94%), Query Frame = 3
Query:  138 IDASSSDHSNGDSKVLVRE-RVYVDRDSLLTEMFRIPHFNSLLNMFLSFVILMMMKTVCNDWLKEGFFKHYHHFQWVSNEFAGIQXXXXXX-XXXXXXXXXXXXXXKFWIIMRLKWKLKALLDVFSVFIYLLI-IGCAIVLPVRIVMNHYVPPCSSAFIVYEQIRILMKIHAYVRTVIPKLHHLFKQSNQHDILQKSINEVVCWKKFLYFLIIPTLVYRDSYPMRKSVNFKSVISSFLEFILCIIFMYYIFINLMRPIFHDFNPSFMTLEEIIPKFFQAILPTILMMLSVFFCFLHSWLNAFAELTKFGDRQFYKDWWNATSLSDYFRTWNALIYDWLYTYIYRDFSLLMLRITNNKMISKSFGMISVLLISALVHEYVLAFCFRFFYPVLLTVFFFSGTVLYF-VKANRASRIPNIMLWTGLYIGNSIFTTLYSSEWYARKNCKRTNEGFLDFIVPRSLFCE 1514
            ++   ++H   D +    + ++++ R SLL E+  + H  ++ +MF++ +IL ++ T+  D++ EG  +    F  +S  F     V+ T  +       + + L + W     K     +  +F  F++++  IG     P  +V+ + +PP S   I++EQIR +MK H++VR  +P++ +  K+       + S   +    ++LYFL  PTL+YRDSYP   +V +  V   F +   C  ++YYIF  L  P+F +      +   ++   F +ILP +L++   FF FLH WLNAFAE+ +FGDR FYKDWWN+TS S+Y+RTWN +++DWLY Y Y+DF    L   + +   KS  M++V  +SA+VHEY LA C  FFYPVL  +F F G    F V  +R   I N+M+WT L++GN +    YS EWYAR++C   N  FLD++ PRS  C 
Sbjct:  100 LEGEKNNHRAKDLRAPPEQGKIFIARRSLLDELLEVDHIRTIYHMFIALLILFILSTLVVDYIDEG--RLVLEFSLLSYAFGKFPTVVWTWWIMFLSTFSVPYFLFQRWATGYSKSSHPLINSLFHGFLFMVFQIGILGFGPTYVVLAYTLPPASRFIIIFEQIRFVMKAHSFVRENVPRVLNSAKE-------KSSTVPIPTVNQYLYFLFAPTLIYRDSYPRNPTVRWGYVAMQFAQVFGCFFYVYYIFERLCAPLFRNIKQEPFSARVLVLCVFNSILPGVLILFLTFFAFLHCWLNAFAEMLRFGDRMFYKDWWNSTSYSNYYRTWNVVVHDWLYYYAYKDF----LWFFSKRF--KSAAMLAVFAVSAVVHEYALAVCLSFFYPVLFVLFMFFGMAFNFIVNDSRKKPIWNVMMWTSLFLGNGVLLCFYSQEWYARQHCPLKNPTFLDYVRPRSWTCR 547          
BLAST of O-acyltransferase vs. UniProt/SwissProt
Match: sp|P35610|SOAT1_HUMAN (Sterol O-acyltransferase 1 OS=Homo sapiens OX=9606 GN=SOAT1 PE=1 SV=3)

HSP 1 Score: 288.115 bits (736), Expect = 1.764e-89
Identity = 163/463 (35.21%), Postives = 259/463 (55.94%), Query Frame = 3
Query:  138 IDASSSDHSNGDSKVLVRE-RVYVDRDSLLTEMFRIPHFNSLLNMFLSFVILMMMKTVCNDWLKEGFFKHYHHFQWVSNEFAGIQXXXXXX-XXXXXXXXXXXXXXKFWIIMRLKWKLKALLDVFSVFIYLLI-IGCAIVLPVRIVMNHYVPPCSSAFIVYEQIRILMKIHAYVRTVIPKLHHLFKQSNQHDILQKSINEVVCWKKFLYFLIIPTLVYRDSYPMRKSVNFKSVISSFLEFILCIIFMYYIFINLMRPIFHDFNPSFMTLEEIIPKFFQAILPTILMMLSVFFCFLHSWLNAFAELTKFGDRQFYKDWWNATSLSDYFRTWNALIYDWLYTYIYRDFSLLMLRITNNKMISKSFGMISVLLISALVHEYVLAFCFRFFYPVLLTVFFFSGTVLYF-VKANRASRIPNIMLWTGLYIGNSIFTTLYSSEWYARKNCKRTNEGFLDFIVPRSLFCE 1514
            ++   ++H   D +    + ++++ R SLL E+  + H  ++ +MF++ +IL ++ T+  D++ EG  +    F  +S  F     V+ T  +       + + L + W     K     +  +F  F++++  IG     P  +V+ + +PP S   I++EQIR +MK H++VR  +P++ +  K+       + S   +    ++LYFL  PTL+YRDSYP   +V +  V   F +   C  ++YYIF  L  P+F +      +   ++   F +ILP +L++   FF FLH WLNAFAE+ +FGDR FYKDWWN+TS S+Y+RTWN +++DWLY Y Y+DF    L   + +   KS  M++V  +SA+VHEY LA C  FFYPVL  +F F G    F V  +R   I N+++WT L++GN +    YS EWYAR++C   N  FLD++ PRS  C 
Sbjct:  100 LEGEKNNHRAKDLRAPPEQGKIFIARRSLLDELLEVDHIRTIYHMFIALLILFILSTLVVDYIDEG--RLVLEFSLLSYAFGKFPTVVWTWWIMFLSTFSVPYFLFQHWATGYSKSSHPLIRSLFHGFLFMIFQIGVLGFGPTYVVLAYTLPPASRFIIIFEQIRFVMKAHSFVRENVPRVLNSAKE-------KSSTVPIPTVNQYLYFLFAPTLIYRDSYPRNPTVRWGYVAMKFAQVFGCFFYVYYIFERLCAPLFRNIKQEPFSARVLVLCVFNSILPGVLILFLTFFAFLHCWLNAFAEMLRFGDRMFYKDWWNSTSYSNYYRTWNVVVHDWLYYYAYKDF----LWFFSKRF--KSAAMLAVFAVSAVVHEYALAVCLSFFYPVLFVLFMFFGMAFNFIVNDSRKKPIWNVLMWTSLFLGNGVLLCFYSQEWYARQHCPLKNPTFLDYVRPRSWTCR 547          
BLAST of O-acyltransferase vs. UniProt/SwissProt
Match: sp|O77761|SOAT1_MACFA (Sterol O-acyltransferase 1 OS=Macaca fascicularis OX=9541 GN=SOAT1 PE=2 SV=1)

HSP 1 Score: 286.574 bits (732), Expect = 5.633e-89
Identity = 163/463 (35.21%), Postives = 258/463 (55.72%), Query Frame = 3
Query:  138 IDASSSDHSNGDSKVLVRE-RVYVDRDSLLTEMFRIPHFNSLLNMFLSFVILMMMKTVCNDWLKEGFFKHYHHFQWVSNEFAGIQXXXXXX-XXXXXXXXXXXXXXKFWIIMRLKWKLKALLDVFSVFIYLLI-IGCAIVLPVRIVMNHYVPPCSSAFIVYEQIRILMKIHAYVRTVIPKLHHLFKQSNQHDILQKSINEVVCWKKFLYFLIIPTLVYRDSYPMRKSVNFKSVISSFLEFILCIIFMYYIFINLMRPIFHDFNPSFMTLEEIIPKFFQAILPTILMMLSVFFCFLHSWLNAFAELTKFGDRQFYKDWWNATSLSDYFRTWNALIYDWLYTYIYRDFSLLMLRITNNKMISKSFGMISVLLISALVHEYVLAFCFRFFYPVLLTVFFFSGTVLYF-VKANRASRIPNIMLWTGLYIGNSIFTTLYSSEWYARKNCKRTNEGFLDFIVPRSLFCE 1514
            ++   ++H   D +    + ++++ R SLL E+  + H  ++ +MF++ +IL ++ T+  D++ EG  +    F  +S  F     V+ T  +       + + L + W     K     +  +F  F++++  IG     P  +V+ + +PP S   I++EQIR +MK H++VR  +P++ +  K+       + S   +    ++LYFL  PTL+YRDSYP   +V +  V   F +   C  ++YYIF  L  P+F +      +   ++   F +ILP +L++   FF FLH WLNAFAE+ +FGDR FYKDWWN+TS S+Y+RTWN +++DWLY Y Y+DF    L   + +   KS  M++   +SA+VHEY LA C  FFYPVL  +F F G    F V  +R   I N+M+WT L++GN +    YS EWYAR++C   N  FLD++ PRS  C 
Sbjct:  100 LEGEKNNHRAKDLRAPPEQGKIFIARRSLLDELLEVDHIRTIYHMFIALLILFILSTLVVDYIDEG--RLVLEFSLLSYAFGKFPTVVWTWWIMFLSTFSVPYFLFQRWATGYSKSSHPLINSLFHGFLFMVFQIGILGFGPTYVVLAYTLPPASRFIIIFEQIRFVMKAHSFVRENVPRVLNSAKE-------KSSTVPIPTVNQYLYFLFAPTLIYRDSYPRNPTVRWGYVAMQFAQVFGCFFYVYYIFERLCAPLFRNIKQEPFSARVLVLCVFNSILPGVLILFLTFFAFLHCWLNAFAEMLRFGDRMFYKDWWNSTSYSNYYRTWNVVVHDWLYYYAYKDF----LWFFSKRF--KSAAMLAAFAVSAVVHEYALAVCLSFFYPVLFVLFMFFGMAFNFIVNDSRKKPIWNVMMWTSLFLGNGVLLCFYSQEWYARQHCPLKNPTFLDYVRPRSWTCR 547          
BLAST of O-acyltransferase vs. UniProt/SwissProt
Match: sp|Q60457|SOAT1_CRIGR (Sterol O-acyltransferase 1 OS=Cricetulus griseus OX=10029 GN=SOAT1 PE=2 SV=1)

HSP 1 Score: 283.493 bits (724), Expect = 1.054e-87
Identity = 162/463 (34.99%), Postives = 260/463 (56.16%), Query Frame = 3
Query:  138 IDASSSDHSNGDSKVLVRE-RVYVDRDSLLTEMFRIPHFNSLLNMFLSFVILMMMKTVCNDWLKEGFFKHYHHFQWVSNEFAGIQXXXXXX-XXXXXXXXXXXXXXKFWIIMRLKWKLKALLDVFSVFIYLLI-IGCAIVLPVRIVMNHYVPPCSSAFIVYEQIRILMKIHAYVRTVIPKLHHLFKQSNQHDILQKSINEVVCWKKFLYFLIIPTLVYRDSYPMRKSVNFKSVISSFLEFILCIIFMYYIFINLMRPIFHDFNPSFMTLEEIIPKFFQAILPTILMMLSVFFCFLHSWLNAFAELTKFGDRQFYKDWWNATSLSDYFRTWNALIYDWLYTYIYRDFSLLMLRITNNKMISKSFGMISVLLISALVHEYVLAFCFRFFYPVLLTVFFFSGTVLYF-VKANRASRIPNIMLWTGLYIGNSIFTTLYSSEWYARKNCKRTNEGFLDFIVPRSLFCE 1514
            ++   ++H   D +    + ++++ R SLL E+F + H  ++ +MF+  +IL ++ T+  D++ EG  +    F  +   F  +  V+ T        + + + L + W     K     +  +   F +L+  +G    +P  +V+ + +PP S   ++ EQIR++MK H++VR  +P++ +  K+       + S   V    ++LYFL  PTL+YRDSYP   +V +  V   FL+   C+ ++YYIF  L  P+F +      +   ++   F +ILP +LM+   FF FLH WLNAFAE+ +FGDR FYKDWWN+TS S+Y+RTWN +++DWLY Y Y+D    +L   + +   KS  M++V  +SA+VHEY LA C  +FYPVL  +F F G    F V  +R   I NIM+W  L++G+ +    YS EWYAR++C   N  FLD++ PRS  C+
Sbjct:   96 LEEMKNNHRAKDLRAPPEKGKIFISRRSLLDELFEVDHIRTIYHMFIGLLILFILSTLVVDYIDEG--RLVLEFNLLGYAFGKLPTVIWTWWAMFLSTLSIPYFLFQRWAHGYSKTSHPLIYSLSHGFFFLVFQLGILGFVPTYVVLAYTLPPASRFIVILEQIRMVMKAHSFVRENVPRVLNAAKE-------KSSTVPVPTVNQYLYFLFAPTLIYRDSYPRTPTVRWGYVAVQFLQVFGCLFYVYYIFERLCAPLFRNIKQEPFSARVLVLCVFNSILPGVLMLFLTFFAFLHCWLNAFAEMLRFGDRMFYKDWWNSTSYSNYYRTWNVVVHDWLYYYAYKD----LLWFFSKRF--KSAAMLAVFALSAVVHEYALAVCLSYFYPVLFVLFMFFGMAFNFIVNDSRKRPIWNIMVWASLFLGHGVILCFYSQEWYARQHCPLKNPTFLDYVRPRSWTCQ 543          
BLAST of O-acyltransferase vs. UniProt/SwissProt
Match: sp|Q61263|SOAT1_MOUSE (Sterol O-acyltransferase 1 OS=Mus musculus OX=10090 GN=Soat1 PE=1 SV=2)

HSP 1 Score: 281.952 bits (720), Expect = 2.872e-87
Identity = 160/463 (34.56%), Postives = 262/463 (56.59%), Query Frame = 3
Query:  138 IDASSSDHSNGDSKVLVRE-RVYVDRDSLLTEMFRIPHFNSLLNMFLSFVILMMMKTVCNDWLKEGFFKHYHHFQWVSNEFAGIQXXXXXX-XXXXXXXXXXXXXXKFWIIMRLKWKLKALLDVFSVFIYLLI-IGCAIVLPVRIVMNHYVPPCSSAFIVYEQIRILMKIHAYVRTVIPKLHHLFKQSNQHDILQKSINEVVCWKKFLYFLIIPTLVYRDSYPMRKSVNFKSVISSFLEFILCIIFMYYIFINLMRPIFHDFNPSFMTLEEIIPKFFQAILPTILMMLSVFFCFLHSWLNAFAELTKFGDRQFYKDWWNATSLSDYFRTWNALIYDWLYTYIYRDFSLLMLRITNNKMISKSFGMISVLLISALVHEYVLAFCFRFFYPVLLTVFFFSGTVLYF-VKANRASRIPNIMLWTGLYIGNSIFTTLYSSEWYARKNCKRTNEGFLDFIVPRSLFCE 1514
            ++    +H   D +    + ++++ R SLL E+F + H  ++ +MF++ +IL ++ T+  D++ EG  +    F  ++  F     V+ T        + + + L + W     K     +  +    ++L+  +G    +P  +V+ + +PP S   ++ EQIR++MK H++VR  IP++ +  K+ +  D L  ++N+      +LYFL  PTL+YRD+YP   +V +  V   FL+   C+ ++YYIF  L  P+F +      +   ++   F +ILP +L++   FF FLH WLNAFAE+ +FGDR FYKDWWN+TS S+Y+RTWN +++DWLY Y+Y+D    +L   + +   KS  M++V  +SA+VHEY LA C  +FYPVL  +F F G    F V  +R   I NIM+W  L++G  +    YS EWYAR++C   N  FLD++ PR+  C 
Sbjct:   90 LEEMKKNHRAKDLRAPPEQGKIFISRQSLLDELFEVDHIRTIYHMFIALLILFVLSTIVVDYIDEG--RLVLEFNLLAYAFGKFPTVIWTWWAMFLSTLSIPYFLFQRWAHGYSKSSHPLIYSLVHGLLFLVFQLGVLGFVPTYVVLAYTLPPASRFILILEQIRLIMKAHSFVRENIPRVLNAAKEKSSKDPL-PTVNQ------YLYFLFAPTLIYRDNYPRTPTVRWGYVAMQFLQVFGCLFYVYYIFERLCAPLFRNIKQEPFSARVLVLCVFNSILPGVLILFLSFFAFLHCWLNAFAEMLRFGDRMFYKDWWNSTSYSNYYRTWNVVVHDWLYYYVYKD----LLWFFSKRF--KSAAMLAVFALSAVVHEYALAICLSYFYPVLFVLFMFFGMAFNFIVNDSRKRPIWNIMVWASLFLGYGLILCFYSQEWYARQHCPLKNPTFLDYVRPRTWTCR 537          
BLAST of O-acyltransferase vs. TrEMBL
Match: A0A210R6J1 (O-acyltransferase OS=Mizuhopecten yessoensis OX=6573 GN=KP79_PYT00054 PE=3 SV=1)

HSP 1 Score: 320.087 bits (819), Expect = 1.411e-99
Identity = 170/443 (38.37%), Postives = 263/443 (59.37%), Query Frame = 3
Query:  192 ERVYVDRDSLLTEMFRIPHFNSLLNMFLSFVILMMMKTVCNDWLKEGFFK-HYHHFQWVSNEFAGIQXXXXXXXXXXXXXXXXXXXXKFWIIMRLKWKLKALLDVFSVFIYLLIIGCAIVLPVRIVMNHYVPPCSSAFIVYEQIRILMKIHAYVRTVIPKLHHLFKQSNQHDILQKSINEVVCWKKFLYFLIIPTLVYRDSYPMRKSVNFKSVISSFLEFILCIIFMYYIFINLMRPIFHDFNPSFMTLEEIIPKFFQAILPTILMMLSVFFCFLHSWLNAFAELTKFGDRQFYKDWWNATSLSDYFRTWNALIYDWLYTYIYRDFSLLMLRITNNKMISKSFGMISVLLISALVHEYVLAFCFRFFYPVLLTVFFFSGTVLYFVKANRASRIPNIMLWTGLYIGNSIFTTLYSSEWYARKNCKRTNEGFLDFIVPRSLFCEI 1517
            ++V+  R S+LTE+F I H  ++ ++F++ +I+  + T   D + EG     +   +W   +F  +  + + +    ++++       +W+  R    +    D+F++ +++L     IVLP   +M H +PP S+  I  EQ+R++MK+HA+VR  IPK+  L         + K  N    + K+LYFL  PTLVYRDSYP  K++ +  V+++F + + C+++ YYIF     P+F++FN   +T + ++   F  +LP  L++   FF  LHSWLNAFAE+ +FGDR FYKDWWN+T+ ++Y+RTWN +++DWLYTYIY+DF  L+         +++  M  V LISA+VHEY+L  CF FFYPVL  +F  +G    FV     SR  N+ LW  L+IGN +   LYS EWYAR NC    + FLD+I+PRS  C I
Sbjct:   98 DKVFHLRRSMLTELFEISHIRTIYHIFVAILIVFSLNTFVYDLVNEGRLNLDFGLMKWTLGKFPKVMALWVCMTLSTLVIVYPTFY--YWVANRTPGPVNKT-DMFALGLFVLYQIAFIVLPNHYIMEHQIPPASAVIITTEQVRLIMKVHAFVRENIPKV--LASNKKDDGDVDKKTNLCPDFSKYLYFLFAPTLVYRDSYPRTKTIRWNYVVTNFAQVLACLLYTYYIFERFCVPVFNNFNKDHVTPKALLLSVFGCMLPGTLVLFIAFFAILHSWLNAFAEMLRFGDRMFYKDWWNSTTFANYYRTWNIVVHDWLYTYIYKDFHRLL------GPRNRAGAMALVFLISAVVHEYILTVCFSFFYPVLFVMFMGAGFTFIFVTDKGVSRSWNVFLWVALFIGNGLLMCLYSMEWYARINCPVNTDTFLDYIIPRSWTCMI 529          
BLAST of O-acyltransferase vs. TrEMBL
Match: A0A0L8GFZ3 (O-acyltransferase OS=Octopus bimaculoides OX=37653 GN=OCBIM_22034018mg PE=3 SV=1)

HSP 1 Score: 302.753 bits (774), Expect = 1.303e-93
Identity = 169/486 (34.77%), Postives = 270/486 (55.56%), Query Frame = 3
Query:  111 RRNNRESTKIDASSSDHSNGDSKVLVRERVYVDRDSLLTEMFRIPHFNSLLNMFLSFVILMMMKTVCNDWLKEGFFK-HYHHFQWVSNEFAGIQXXXXXXXXXXXXXXXXXXXXKFWIIMRLK-----------WKLKALLDVFSVFIYL---LIIGCAI---VLPVRIVMNHYVPPCSSAFIVYEQIRILMKIHAYVRTVIPKLHHLFKQSNQHDILQKSINEVVCWKKFLYFLIIPTLVYRDSYPMRKSVNFKSVISSFLEFILCIIFMYYIFINLMRPIFHDFNPSFMTLEEIIPKFFQAILPTILMMLSVFFCFLHSWLNAFAELTKFGDRQFYKDWWNATSLSDYFRTWNALIYDWLYTYIYRDFSLLMLRITNNKMISKSFGMISVLLISALVHEYVLAFCFRFFYPVLLTVFFFSGTVLYFVKANRASRIPNIMLWTGLYIGNSIFTTLYSSEWYARKNCKRTNEGFLDFIVPRSLFCE 1514
             +N +   +I  +     +G+    + E+V+V+R S+LTE+  I H  ++ N+F++ +++  + T+  D +  G     ++  QW   +F  +                       W+ M+L            W     +  + V+ ++   L +   +   VLPV  +  + +PP S+  IV EQ+R++MK+H++VR  +PK+ + +K+++  D      N    + K+LYFL  PTL+YRDSYP  + + +  V+S+F + + C+ + YYIF     P+F +FN   +T + ++   F  +LP  L++   FF  LHSWLNAFAE+ +FGDR FYKDWWN+T+ S+Y+RTWN +++DWLYTYIY+D    +  I   KM  ++ G+ SV LISA+ HEYVL   F FFYPVL  +F  +G    F+     SR  N+ +W  L+IGN +   LYS EWYAR+NC  T   F D+++PRS  C+
Sbjct:   20 EQNPQSLFEIKPNRVKRKDGE----LPEKVFVNRRSVLTELLEITHIQTIYNIFVAILLVFSLNTIVYDLIDTGRLHLDFNLIQWAFGKFPKVM--------------------ALWVCMQLATLLIFYPAFYYWASSKKIRPYKVWDWIWLGLFVAYQLLFFVLPVNYLYENNLPPASAVIIVTEQLRLIMKVHSFVRENVPKVLN-YKKADSDD------NVCPDFSKYLYFLFSPTLIYRDSYPRTQKIRWNYVVSNFSQVLACLFYTYYIFERFCVPVFRNFNREHVTPKALLLSVFGCMLPGTLVLFIGFFAILHSWLNAFAEMLRFGDRLFYKDWWNSTTFSNYYRTWNVVVHDWLYTYIYKD----VYTILGYKM--RNVGLTSVFLISAVFHEYVLVVSFGFFYPVLFVMFAGAGFGFVFLTDKGVSRSWNVFMWVALFIGNGLLMCLYSLEWYARQNCPATTNDFFDYLIPRSWTCD 468          
BLAST of O-acyltransferase vs. TrEMBL
Match: A0A2C9JQ14 (O-acyltransferase OS=Biomphalaria glabrata OX=6526 GN=106063279 PE=3 SV=1)

HSP 1 Score: 300.056 bits (767), Expect = 6.920e-92
Identity = 162/461 (35.14%), Postives = 271/461 (58.79%), Query Frame = 3
Query:  132 TKIDASSSDHSNGDSKVLVRERVYVDRDSLLTEMFRIPHFNSLLNMFLSFVILMMMKTVCNDWLKEGFFK-HYHHFQWVSNEFAGIQXXXXXXXXXXXXXXXXXXXXKFWIIMRLKWKLKALLDVFSVFIYLLIIGCAIVLPVRIVMNHYVPPCSSAFIVYEQIRILMKIHAYVRTVIPKLHHLFKQSNQHDILQKSINEVVCWKKFLYFLIIPTLVYRDSYPMRKSVNFKSVISSFLEFILCIIFMYYIFINLMRPIFHDFNPSFMTLEEIIPKFFQAILPTILMMLSVFFCFLHSWLNAFAELTKFGDRQFYKDWWNATSLSDYFRTWNALIYDWLYTYIYRDFSLLMLRITNNKMISKSFGMISVLLISALVHEYVLAFCFRFFYPVLLTVFFFSGTVLYFVKANRASRIPNIMLWTGLYIGNSIFTTLYSSEWYARKNCKRTNEGFLDFIVPRSLFC 1511
            T+  AS      G+    + ++V+V R S+LTE+F I H  ++ ++F++ +I+  + T+  D L++     ++   QW   +F  +  + + +    +L++        W   R   K   +LDV  + + ++     +++P+  ++ H +PP SS  +  EQ R LMK H+++R    ++  ++K+ +  D   +  +    + K+LYFL  PTLVYRD+YP  +++++K V+++FL+ + C+I++YYIF     P+F +FN   +T +  I   F  ++P  L++   FF  LHSW+NAFAE+ +FGDR FYKDWWN+T+ S+Y+RTWN +++DWLYTYIY+D   L+         ++   M  V LISA+ HEY+L   F+FFYPVL  +F  +G    F+    +SR  N+ +W  L+IGN +   LYS E+YAR+NC+ + E  LD ++PRS FC
Sbjct:   78 TEEVASKKKEKTGE----LPDKVFVTRSSVLTELFEISHVRTIYHIFVAVLIVFSLNTMLYDVLEKHTLNLNFGMIQWAFGKFPKVMALWMMMQGSTLLIVYPAFYC--WASYRTP-KNSGILDVIWISLVIIYQLAFLLIPLFYLIEHDLPPASSVVVTAEQTRFLMKTHSFIRENTARV--MYKKKDDDD---QETSLCPDFSKYLYFLFCPTLVYRDNYPRTQTISWKYVVTNFLQVLACLIYIYYIFERFCVPVFQNFNKDHITAKGFILSMFGCMMPGTLLLFISFFAILHSWMNAFAEMLRFGDRLFYKDWWNSTTFSNYYRTWNVVVHDWLYTYIYKDICKLV------GPRNRPGAMACVFLISAVFHEYILTCTFKFFYPVLFVMFAGAGFGFIFLTDKGSSRSWNVFMWVALFIGNGLLMCLYSMEFYARQNCQASTESLLDLMIPRSWFC 520          
BLAST of O-acyltransferase vs. TrEMBL
Match: E9FTT9 (O-acyltransferase OS=Daphnia pulex OX=6669 GN=DAPPUDRAFT_40502 PE=3 SV=1)

HSP 1 Score: 298.13 bits (762), Expect = 9.782e-92
Identity = 176/479 (36.74%), Postives = 279/479 (58.25%), Query Frame = 3
Query:  123 RESTKIDASSSDHSNGDSKVLVR-------ERVYVDRDSLLTEMFRIPHFNSLLNMFLSFVILMMMKTVCNDWLKEGFFKHYHHFQWVSNEFAGIQXXXXX-XXXXXXXXXXXXXXXKFWIIMRLKW---KLKALLDVFSVFIYLLIIGCAIVLPVRIVMNHYVPPCSSAFIVYEQIRILMKIHAYVRTVIPKLHHLFKQSNQHD---ILQKSINEVVC--WKKFLYFLIIPTLVYRDSYPMRKSVNFKSVISSFLEFILCIIFMYYIFINLMRPIFHDFNPSFMTLEEIIPKFFQAILPTILMMLSVFFCFLHSWLNAFAELTKFGDRQFYKDWWNATSLSDYFRTWNALIYDWLYTYIYRDFSLLMLRITNNKMISKSFGMISVLLISALVHEYVLAFCFRFFYPVLLTVFFFSGTVLYFVKANRASRIPNIMLWTGLYIGNSIFTTLYSSEWYARKNCKRTNEGFLDFIVPRSLFC 1511
            R   K  +   D   G+ K   +       E+ +V R+SLLT++F I H  ++ ++F++ +IL+ M T+  D + +G  +    F  +   F  +Q VL+T L  ++  +++ +    +W   RL       + + D F    Y+  IG AI +P++  + H +PP S+  ++ EQ+R++MK HA+VR+ IP     F Q    D    ++   N+  C  + K+LYF+  PTLVYRD YP  +S+ +K V  +FL+ +  + ++Y+IF+    P+F       MT + ++   F  +LP  L++L  FFC LHSWLNAFAE+ +FGDR FY+DWWN++S + Y+RTWN +++DWLYTY+Y+D   L  R   N++I      + V LIS++VHEY+++F F  FYPVLL +F   G +  FV  N   R+ NI +W  L+IG  +  +LYS EWYAR NC+ + +GFL+ ++PRS  C
Sbjct:   12 RVPQKYRSFLGDTQTGEEKKRKKLPCGSLPEKEFVVRNSLLTDLFEINHIQTIYHIFIAILILLFMNTMVEDIVDKG--RIDLEFTLILWAFGNLQTVLITWLGMMFFTLVVVYPAFHYWSHKRLAIVDDSRRLVWDYFWFACYVFYIGAAIWIPLKESLAHNLPPASAVTLLMEQVRLVMKTHAFVRSNIPVALFYFNQRQSRDERTSVKDDANQAPCPDFSKYLYFMFAPTLVYRDRYPRTRSIRWKWVCFNFLQVVGVLFYLYFIFVRFCVPVFRQIGHEPMTSKALVLAVFGCMLPGTLVLLCGFFCLLHSWLNAFAEMLRFGDRMFYQDWWNSSSYATYYRTWNVVVHDWLYTYVYKDVYELFGR--RNRLIPT----LVVFLISSIVHEYIISFTFHCFYPVLLLMF---GVLFSFV-TNVDPRLGNIFMWLTLFIGTGLCMSLYSMEWYARINCQPSFDGFLEILIPRSWTC 478          
BLAST of O-acyltransferase vs. TrEMBL
Match: A0A2C9JQ08 (O-acyltransferase OS=Biomphalaria glabrata OX=6526 GN=106063279 PE=3 SV=1)

HSP 1 Score: 298.901 bits (764), Expect = 1.370e-91
Identity = 158/441 (35.83%), Postives = 264/441 (59.86%), Query Frame = 3
Query:  192 ERVYVDRDSLLTEMFRIPHFNSLLNMFLSFVILMMMKTVCNDWLKEGFFK-HYHHFQWVSNEFAGIQXXXXXXXXXXXXXXXXXXXXKFWIIMRLKWKLKALLDVFSVFIYLLIIGCAIVLPVRIVMNHYVPPCSSAFIVYEQIRILMKIHAYVRTVIPKLHHLFKQSNQHDILQKSINEVVCWKKFLYFLIIPTLVYRDSYPMRKSVNFKSVISSFLEFILCIIFMYYIFINLMRPIFHDFNPSFMTLEEIIPKFFQAILPTILMMLSVFFCFLHSWLNAFAELTKFGDRQFYKDWWNATSLSDYFRTWNALIYDWLYTYIYRDFSLLMLRITNNKMISKSFGMISVLLISALVHEYVLAFCFRFFYPVLLTVFFFSGTVLYFVKANRASRIPNIMLWTGLYIGNSIFTTLYSSEWYARKNCKRTNEGFLDFIVPRSLFC 1511
            ++V+V R S+LTE+F I H  ++ ++F++ +I+  + T+  D L++     ++   QW   +F  +  + + +    +L++        W   R   K   +LDV  + + ++     +++P+  ++ H +PP SS  +  EQ R LMK H+++R    ++  ++K+ +  D   +  +    + K+LYFL  PTLVYRD+YP  +++++K V+++FL+ + C+I++YYIF     P+F +FN   +T +  I   F  ++P  L++   FF  LHSW+NAFAE+ +FGDR FYKDWWN+T+ S+Y+RTWN +++DWLYTYIY+D   L+         ++   M  V LISA+ HEY+L   F+FFYPVL  +F  +G    F+    +SR  N+ +W  L+IGN +   LYS E+YAR+NC+ + E  LD ++PRS FC
Sbjct:   77 DKVFVTRSSVLTELFEISHVRTIYHIFVAVLIVFSLNTMLYDVLEKHTLNLNFGMIQWAFGKFPKVMALWMMMQGSTLLIVYPAFYC--WASYRTP-KNSGILDVIWISLVIIYQLAFLLIPLFYLIEHDLPPASSVVVTAEQTRFLMKTHSFIRENTARV--MYKKKDDDD---QETSLCPDFSKYLYFLFCPTLVYRDNYPRTQTISWKYVVTNFLQVLACLIYIYYIFERFCVPVFQNFNKDHITAKGFILSMFGCMMPGTLLLFISFFAILHSWMNAFAEMLRFGDRLFYKDWWNSTTFSNYYRTWNVVVHDWLYTYIYKDICKLV------GPRNRPGAMACVFLISAVFHEYILTCTFKFFYPVLFVMFAGAGFGFIFLTDKGSSRSWNVFMWVALFIGNGLLMCLYSMEFYARQNCQASTESLLDLMIPRSWFC 503          
BLAST of O-acyltransferase vs. Ensembl Cavefish
Match: soat2 (sterol O-acyltransferase 2-like [Source:NCBI gene;Acc:103034708])

HSP 1 Score: 246.128 bits (627), Expect = 1.463e-74
Identity = 154/495 (31.11%), Postives = 258/495 (52.12%), Query Frame = 3
Query:   63 IKVQCKTFIQLL*MSKRRNNRESTKIDASSSDHSNGDSKV----LVRERVYVDRDSLLTEMFRIPHFNSLLNMFLSFVILMMMKTVCNDWLKEG-FFKHYHHFQWVSNEFAGIQXXXXXXXXXXXXXXXXXXXXKFWIIMRLKWKLKALLDVFSVFIYLLIIGCAIVLPVRIVMNHYVPPCSSAFIVYEQIRILMKIHAYVRTVIPKLHHLFKQSNQHDILQKSINEVVC----WKKFLYFLIIPTLVYRDSYPMRKSVNFKSVISSFLEFILCIIFMYYIFINLMRPIFHDFNPSFMTLEEIIPKFFQAILPTILMMLSVFFCFLHSWLNAFAELTKFGDRQFYKDWWNATSLSDYFRTWNALIYDWLYTYIYRDFSLLMLRITNNKMISKSFGMISVLLISALVHEYVLAFCFRFFYPVLLTVFFFSGTVLYF-VKANRASRIPNIMLWTGLYIGNSIFTTLYSSEWYARKNCKRTNEGFLDFIVPRSLFCEI 1517
            +KVQ    +        R+  +ST+ D + + HS+ D K     +   +V+V R S+L E+F I H  ++ +MF++ + L ++ T+  D++ +G     +  F +       +      +    +L     L     +  R  W +   +   +V + +  +G     PV +V+++ +PP S   ++ EQIR LMK ++++R  +  +           + +K+     C       +LYFL  PTL+YR++YP    + +  V  +F + +  + ++Y+I + L  P+F + +    +   ++   F + LP +LM+L  FF FLH WLNAFAE+ +F DR FYKDWWN+TS ++Y+RTWN +++DWLY Y YRDF  L    T ++   +S   +SV  +SA VHEY     F FFYPV+  +F   G V  F +   R   + N+++WT L+IG  +   LY  EWYA+ +C RT  GF + + PRS  C +
Sbjct:   63 MKVQMSEVLDKALTDSLRSLSQSTQWDINGNTHSHTDEKARRHRMEDGKVFVARRSILDELFEISHVRTIYHMFIAALFLFIISTLAVDYIDQGRLVLDFDLFFYAFGLLGTVVWAWFIMFTYTLLGPYHVLSQWADLYHRSSWNMSVSVAT-AVILLVAQMGVLGYFPVFVVVHYQLPPASRFIVILEQIRFLMKSYSFIRETVVAV-----------VREKTAKGESCRFPTLSNYLYFLFCPTLIYREAYPRNPYIRWNYVWRNFAKILGSLFYLYFILVRLCIPVFMNESNRPFSTRTLVLAIFHSTLPGMLMLLLGFFAFLHCWLNAFAEMLRFADRMFYKDWWNSTSFANYYRTWNIVVHDWLYYYAYRDFVWL----TGHRF--RSVATMSVFAVSAFVHEYAFTMGFGFFYPVMFVLFAVIGGVFNFTLNDKRKGPMWNVIMWTCLFIGQGVQVCLYCLEWYAQVHCPRTGTGFWELVTPRSWTCNL 539          
BLAST of O-acyltransferase vs. Ensembl Cavefish
Match: soat2 (sterol O-acyltransferase 2-like [Source:NCBI gene;Acc:103034708])

HSP 1 Score: 234.187 bits (596), Expect = 3.192e-70
Identity = 149/491 (30.35%), Postives = 250/491 (50.92%), Query Frame = 3
Query:   63 IKVQCKTFIQLL*MSKRRNNRESTKIDASSSDHSNGDSKVLVRERVYVDRDSLLTEMFRIPHFNSLLNMFLSFVILMMMKTVCNDWLKEG-FFKHYHHFQWVSNEFAGIQXXXXXXXXXXXXXXXXXXXXKFWIIMRLKWKLKALLDVFSVFIYLLIIGCAIVLPVRIVMNHYVPPCSSAFIVYEQIRILMKIHAYVRTVIPKLHHLFKQSNQHDILQKSINEVVC----WKKFLYFLIIPTLVYRDSYPMRKSVNFKSVISSFLEFILCIIFMYYIFINLMRPIFHDFNPSFMTLEEIIPKFFQAILPTILMMLSVFFCFLHSWLNAFAELTKFGDRQFYKDWWNATSLSDYFRTWNALIYDWLYTYIYRDFSLLMLRITNNKMISKSFGMISVLLISALVHEYVLAFCFRFFYPVLLTVFFFSGTVLYF-VKANRASRIPNIMLWTGLYIGNSIFTTLYSSEWYARKNCKRTNEGFLDFIVPRSLFCEI 1517
            +KVQ    +        R+  +ST+ D + + HS+ D K               +E+F I H  ++ +MF++ + L ++ T+  D++ +G     +  F +       +      +    +L     L     +  R  W +   +   +V + +  +G     PV +V+++ +PP S   ++ EQIR LMK ++++R  +  +           + +K+     C       +LYFL  PTL+YR++YP    + +  V  +F + +  + ++Y+I + L  P+F + +    +   ++   F + LP +LM+L  FF FLH WLNAFAE+ +F DR FYKDWWN+TS ++Y+RTWN +++DWLY Y YRDF  L    T ++   +S   +SV  +SA VHEY     F FFYPV+  +F   G V  F +   R   + N+++WT L+IG  +   LY  EWYA+ +C RT  GF + + PRS  C +
Sbjct:   63 MKVQMSEVLDKALTDSLRSLSQSTQWDINGNTHSHTDEKAR-------------SELFEISHVRTIYHMFIAALFLFIISTLAVDYIDQGRLVLDFDLFFYAFGLLGTVVWAWFIMFTYTLLGPYHVLSQWADLYHRSSWNMSVSVAT-AVILLVAQMGVLGYFPVFVVVHYQLPPASRFIVILEQIRFLMKSYSFIRETVVAV-----------VREKTAKGESCRFPTLSNYLYFLFCPTLIYREAYPRNPYIRWNYVWRNFAKILGSLFYLYFILVRLCIPVFMNESNRPFSTRTLVLAIFHSTLPGMLMLLLGFFAFLHCWLNAFAEMLRFADRMFYKDWWNSTSFANYYRTWNIVVHDWLYYYAYRDFVWL----TGHRF--RSVATMSVFAVSAFVHEYAFTMGFGFFYPVMFVLFAVIGGVFNFTLNDKRKGPMWNVIMWTCLFIGQGVQVCLYCLEWYAQVHCPRTGTGFWELVTPRSWTCNL 522          
BLAST of O-acyltransferase vs. Ensembl Cavefish
Match: soat1 (sterol O-acyltransferase 1 [Source:ZFIN;Acc:ZDB-GENE-081105-177])

HSP 1 Score: 209.92 bits (533), Expect = 1.232e-61
Identity = 115/322 (35.71%), Postives = 175/322 (54.35%), Query Frame = 3
Query:  549 LPVRIVMNHYVPPCSSAFIVYEQIRILMKIHAYVRTVIPKLHHLFKQSNQHDILQKSINEVVCWKKFLYFLIIPTLVYRDSYPMRKSVNFKSVISSFLEFILCIIFMYYIFINLMRPIFHDFNPSFMTLEEIIPKFFQAILPTILMMLSVFFCFLHSWLNAFAELTKFGDRQFYKDWWNATSLSDYFRTWNALIYDWLYTYIYRDFSLLMLRITNNKMISKSFGMISVLLISALVHEYVLAFCFRFFYPVLLTVFFFSGTVLYFV-KANRASRIPNIMLWTGLYIGNSIFTTLYSSEWYARKNCKRTNEGFLDFIVPRSLFC 1511
            LP  IV+ + +PP S   ++ EQ+R++MK+H+++R  I ++    +          ++ +V     +LYFL +                           + C+ + YY+F+ L  P F         L  ++   F +ILP +L++   FF FLH WLNAFAE+ +FGDR FYKDWWN+TS ++Y+RTWN +++DWLY Y+YRDF    L ++  +   ++  M  V  +SA+VHEYVLA CF FFYPVL  +F   G +  F+    R   + N+++WT L++G  +   LYS EWYA+  C       LD + PRS  C
Sbjct:  162 LPTYIVLRNGLPPASRFILILEQVRLMMKVHSFIRENIQRVWSSGRDG----SDSSAVPQV---TPYLYFLFV---------------------------LGCLFYAYYVFVRLCIPQFRSLQ--LFDLRAMVLCVFNSILPGVLVLFLGFFAFLHCWLNAFAEMLRFGDRMFYKDWWNSTSFANYYRTWNVVVHDWLYYYVYRDF----LWMSQKRF--RAAAMFIVFTVSAVVHEYVLAICFGFFYPVLFCLFMCFGMMFNFILHDRRKGPVWNVIMWTALFLGQGVLICLYSQEWYAQIYCPLQEPSLLDLLKPRSWTC 441          
BLAST of O-acyltransferase vs. Ensembl Cavefish
Match: ENSAMXT00000047082.1 (pep primary_assembly:Astyanax_mexicanus-2.0:APWO02000700.1:23967:37034:1 gene:ENSAMXG00000013993.2 transcript:ENSAMXT00000047082.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 203.371 bits (516), Expect = 2.875e-59
Identity = 114/322 (35.40%), Postives = 174/322 (54.04%), Query Frame = 3
Query:  552 PVRIVMNHYVPPCSSAFIVYEQIRILMKIHAYVRTVIPKLHHLFKQSNQHDILQKSINEVVCWKKFLYFLIIPTLVYRDSYPMRKSVNFKSVISSFLEFILCIIFMYYIFINLMRPIFHDFNPSFMTLEEIIPKFFQAILPTILMMLSVFFCFLHSWLNAFAELTKFGDRQFYKDWWNATSLSDYFRTWNALIYDWLYTYIYRDFSLLMLRITNNKMISKSFGMISVLLISALVHEYVLAFCFRFFYPVLLTVFFFSGTVLYFV-KANRASRIPNIMLWTGLYIGNSIFTTLYSSEWYARKNCKRTNEGF-LDFIVPRSLFC 1511
            P  IV+ + +PP S   ++ EQ+R++MK+H+++R  I ++      S+   + Q +         +LYFL +                           + C+ + YY+F+ L  P F         L  ++   F +ILP +L++   FF FLH WLNAFAE+ +FGDR FYKDWWN+TS ++Y+RTWN +++DWLY Y+YRDF    L ++  +   ++  M  V  +SA+VHEYVLA CF FFYPVL  +F   G +  F+    R   + N+++WT L++G  +   LYS EWYA+  C         D + PRS+ C
Sbjct:  171 PTYIVLRNGLPPASRFILILEQVRLMMKVHSFIRENIQRVW----SSDSSAVPQVT--------PYLYFLFV---------------------------LGCLFYAYYVFVRLCIPQFRSLQ--LFDLRAMVLCVFNSILPGVLVLFLGFFAFLHCWLNAFAEMLRFGDRMFYKDWWNSTSFANYYRTWNVVVHDWLYYYVYRDF----LWMSQKRF--RAAAMFIVFTVSAVVHEYVLAICFGFFYPVLFCLFMCFGMMFNFILHDRRKGPVWNVIMWTALFLGQGVLICLYSQEWYAQIYCPLQEVTVSSDLLKPRSVTC 445          
BLAST of O-acyltransferase vs. Ensembl Cavefish
Match: ENSAMXT00000014398.2 (pep primary_assembly:Astyanax_mexicanus-2.0:APWO02000700.1:19594:35534:1 gene:ENSAMXG00000013993.2 transcript:ENSAMXT00000014398.2 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 202.601 bits (514), Expect = 1.723e-58
Identity = 104/259 (40.15%), Postives = 158/259 (61.00%), Query Frame = 3
Query:  552 PVRIVMNHYVPPCSSAFIVYEQIRILMKIHAYVRTVIPKLHHLFKQSNQHDILQKSINEVVCWKKFLYFLIIPTLVYRDSYPMRKSVNFKSVISSFLEFILCIIFMYYIFINLMRPIFHDFNPSFMTLEEIIPKFFQAILPTILMMLSVFFCFLHSWLNAFAELTKFGDRQFYKDWWNATSLSDYFRTWNALIYDWLYTYIYRDFSLLMLRITNNKMISKSFGMISVLLISALVHEYVLAFCFRFFYPVLLTVFFFSGT 1328
            P  IV+ + +PP S   ++ EQ+R++MK+H+++R  I ++    +          ++ +V     +LYFL  PTL+YRD+YP    V +  V +  L+ + C+ + YY+F+ L  P F         L  ++   F +ILP +L++   FF FLH WLNAFAE+ +FGDR FYKDWWN+TS ++Y+RTWN +++DWLY Y+YRDF    L ++  +   ++  M  V  +SA+VHEYVLA CF FFYPVL  +F   G+
Sbjct:  239 PTYIVLRNGLPPASRFILILEQVRLMMKVHSFIRENIQRVWSSGRDG----SDSSAVPQVT---PYLYFLFAPTLIYRDNYPRNPYVRWSYVATKLLQVLGCLFYAYYVFVRLCIPQFRSLQ--LFDLRAMVLCVFNSILPGVLVLFLGFFAFLHCWLNAFAEMLRFGDRMFYKDWWNSTSFANYYRTWNVVVHDWLYYYVYRDF----LWMSQKRF--RAAAMFIVFTVSAVVHEYVLAICFGFFYPVLFCLFMCFGS 482          
BLAST of O-acyltransferase vs. Ensembl Sea Lamprey
Match: soat2 (sterol O-acyltransferase 2 [Source:ZFIN;Acc:ZDB-GENE-061013-742])

HSP 1 Score: 276.944 bits (707), Expect = 1.210e-87
Identity = 165/482 (34.23%), Postives = 269/482 (55.81%), Query Frame = 3
Query:  120 NRESTKID-ASSSDHSNGDSKVLVRE--------RVYVDRDSLLTEMFRIPHFNSLLNMFLSFVILMMMKTVCNDWLKEGFFKHYHHFQWVSNEFAGIQXXXXXXXXXXXXXXXXXXXXKFWIIMRLKWKLKALL--DVFSVFIYLL-----IIGCAIVLPVRIVMNHYVPPCSSAFIVYEQIRILMKIHAYVRTVIPKLHHLFKQSNQHDILQKSINEVVCWKKFLYFLIIPTLVYRDSYPMRKSVNFKSVISSFLEFILCIIFMYYIFINLMRPIFHDFNPSFMTLEEIIPKFFQAILPTILMMLSVFFCFLHSWLNAFAELTKFGDRQFYKDWWNATSLSDYFRTWNALIYDWLYTYIYRDFSLLMLRITNNKMISKSFGMISVLLISALVHEYVLAFCFRFFYPVLLTVFFFSGTVLYF-VKANRASRIPNIMLWTGLYIGNSIFTTLYSSEWYARKNCKRTNEGFLDFIVPRSLFCE 1514
               S+ ID  S++   NG     VR         ++++ R S+L E+F I H  ++ +MF++ ++L ++ TV  D++ +G  +    F  +   F  +   L   L +++  +L      +W++ R     +A+    +++ +  LL     I+G  +  PV  V+++ +PP S   ++ EQ+R++MK H++VR  +P++        Q      S  ++  +  +LYFL  PTL+YRDSYP   ++ +K V  +F + + C+ + YY+F+ L  P+F +F    +++  ++   F   LP +L++L  FF FLH WLNAFAE+ +F DR FY+DWWN+TS ++Y+RTWN +++DWLY Y YRDF        + +   K+  M SV  +SA+VHEYVL  C  FFYPV+  +FF  G +  F V   R S I N+++WT L+IG  I   LYS EWYA+++C    E F D I P S  C+
Sbjct:   24 EESSSTIDLKSAAVLQNGGDVEKVRSLRPLSEKGKLFLPRPSVLDELFEINHVRTIYHMFIAVLMLFVISTVAVDFIDQG--RLVLDFDLLVFAFGQLPTALWAWLCMFLGTLLV----PYWLLCRWGTGYQAVHWHGLYTAYYGLLYFAFQILGLGVT-PVYAVVHYSLPPASRFILILEQVRLVMKAHSFVRENVPRIM-------QSHCKGDSPPKLPDFNHYLYFLFCPTLIYRDSYPRTPTIRWKFVAMNFAQVLGCLFYAYYVFVRLCIPLFRNFGKEPLSIRVLVLNMFNCTLPGVLILLLAFFAFLHCWLNAFAEMLRFADRMFYQDWWNSTSFANYYRTWNVVVHDWLYYYTYRDFRWAF----SGRF--KAAAMFSVFSLSAVVHEYVLTVCLGFFYPVMFVLFFGFGMLFNFVVHDKRKSPIWNVVMWTFLFIGQGIMVCLYSLEWYAQQHCPAKGETFFDLITPLSWSCQ 485          
BLAST of O-acyltransferase vs. Ensembl Sea Lamprey
Match: ENSPMAT00000004896.1 (pep scaffold:Pmarinus_7.0:GL476574:469247:474793:-1 gene:ENSPMAG00000004447.1 transcript:ENSPMAT00000004896.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 163.31 bits (412), Expect = 3.093e-47
Identity = 91/241 (37.76%), Postives = 135/241 (56.02%), Query Frame = 3
Query:  807 SVNFKSVISSFLEFILCIIFMYYIFINLMRPIFHDFNPSFMTLEEIIPKFFQAILP-----TILMMLSVFFCFLHSWLNAFAELTKFGDRQFYKDWWNATSLSDYFRTWNALIYDWLYTYIYRDFSLLMLRITNNKMISKSFGMISVLLISALVHEYVLAFCFRFFYPVLLTVFFFSGTVLYF-VKANRASRIPNIMLWTGLYIGNSIFTTLYSSEWYARKNCKRTNEGFLDFIVPRSLFC 1511
            S+ +  V +   E     IF  Y F   + P+F D     +TLE ++     A++P     T L+ +  FF FLH WLN F EL +F DR FYKDWWN+ S ++Y+RTWN +++DWLYTY Y D    ++R+ + +   +   M+ V + SA+VHEYV+  CF  F PV+L +F   GT+L F +   R++ + NI +W  L +G  +  TLY  EW A ++C    E   +FI P+   C
Sbjct:    4 SIRWDYVRTKLAEAGKLWIFTQYRFTAWVMPLFQDVQREPLTLERLVLYVCHAMVPGDGPTTHLLFIITFFAFLHCWLNLFGELMRFADRMFYKDWWNSRSFANYYRTWNVVVHDWLYTYFYGD----LIRVFSRRY--RRAAMLIVFIFSAIVHEYVITVCFGLFCPVMLFLFICFGTMLNFLLHDGRSNDVWNIFMWFALILGQGVLVTLYFLEWSALRDCPSKPETVWEFITPQFWSC 238          
BLAST of O-acyltransferase vs. Ensembl Sea Lamprey
Match: dgat1a (diacylglycerol O-acyltransferase 1a [Source:ZFIN;Acc:ZDB-GENE-030131-4600])

HSP 1 Score: 91.2781 bits (225), Expect = 4.087e-20
Identity = 61/237 (25.74%), Postives = 112/237 (47.26%), Query Frame = 3
Query:  741 KKFLYFLIIPTLVYRDSYPMRKSVNFKSVISSFLEFILCIIFMYYIFINLMRP-IFHDFNPSF-MTLEEIIPKFFQAILPTILMMLSVFFCFLHSWLNAFAELTKFGDRQFYKD-WWNATSLSDYFRTWNALIYDWLYTYIYRDFSLLMLRITNNKMISKSFGMISVLLISALVHEYVLAFCFRFFYPVLLTVFFFSGTVLYFVKANRASRIPNIMLWTGLYIGNSIFTTLYSSEWY 1442
            +   YF+  PTL Y  ++P    +  + ++    E +  +  M       + P I +   P   M +  ++ +  +  +P  L+ L  F+ F HS LN  AE+ KFGDR+FY+D WWNA +++ ++  WN  ++ W   + Y+     +L+   NKM ++    + V L+SA  HEY+++   R F             + +FV +  +    N  +W  L +G  +   +Y  ++Y
Sbjct:  195 RDLYYFVFAPTLCYELNFPRTSRIRKRFLLRRIFEMLFLMQLMLGFIQQWIVPSIRNSMKPLIEMDVSRVVERLLKLAVPNHLIWLIFFYWFFHSCLNLLAEIMKFGDREFYRDWWWNAQTVTYFWANWNIPVHKWCVRHFYKP----LLKRGFNKMHAQ----LGVFLLSAFFHEYLVSVPLRMFRIWAFMGMMAQVPLAWFVGSFLSGNYGNSAVWLSLILGQPVAVFMYVHDYY 423          
BLAST of O-acyltransferase vs. Ensembl Yeast
Match: ARE2 (Acyl-CoA:sterol acyltransferase; endoplasmic reticulum enzyme that contributes the major sterol esterification activity in the presence of oxygen; ARE2 has a paralog, ARE1, that arose from the whole genome duplication [Source:SGD;Acc:S000005302])

HSP 1 Score: 85.5001 bits (210), Expect = 4.914e-18
Identity = 78/271 (28.78%), Postives = 127/271 (46.86%), Query Frame = 3
Query:  681 FKQSNQH--DILQKSINEVVCWKKFLYFLIIPTLVYRDSYPMRKSVNFKSVISS--------FLEFILCIIFMYYIFINLM-------RPIFHDFNPSFMTLEEIIPKFFQAILPTILMMLSVFFCFLHSWLNAFAELTKFGDRQFYKDWWNATSLSDYFRTWNALIYDWLYTYIYRDFSLLMLRITNNKMISKSFGMISVLLISALVHEYVLAFCFR-----FFYPVLLTVFFFSGTVLYFVKANRASRIPNIMLWTGLYIGNSIFTTLY 1427
            F+ S+Q   D  QK  N +   K F +F + PTL+Y+  YP  K + +  V+          FL  I   I MY + +  +         I          L +I+P F       I+M +  F+    + LN  AELT+FGDR FY DWWN  S +D+ R WN  ++ +L  ++Y   S+   +      ++KS   +    +S++VHE  +   F+      F+  +L +   + T   F++ NR + I N++ W G+ +G S+  TLY
Sbjct:  386 FELSSQSLSDQTQKFPNNISA-KSFFWFTMFPTLIYQIEYPRTKEIRWSYVLEKICAIFGTIFLMMIDAQILMYPVAMRALAVRNSEWTGILDRLLKWVGLLVDIVPGF-------IVMYILDFYLIWDAILNCVAELTRFGDRYFYGDWWNCVSWADFSRIWNIPVHKFLLRHVYHS-SMSSFK------LNKSQATLMTFFLSSVVHELAMYVIFKKLRFYLFFFQMLQMPLVALTNTKFMR-NR-TIIGNVIFWLGICMGPSVMCTLY 639          
BLAST of O-acyltransferase vs. Ensembl Yeast
Match: ARE1 (Acyl-CoA:sterol acyltransferase; endoplasmic reticulum enzyme that contributes the major sterol esterification activity in the absence of oxygen; ARE1 has a paralog, ARE2, that arose from the whole genome duplication [Source:SGD;Acc:S000000644])

HSP 1 Score: 81.2629 bits (199), Expect = 8.270e-17
Identity = 79/292 (27.05%), Postives = 130/292 (44.52%), Query Frame = 3
Query:  633 KIHAYVRTVIPKLHHLFKQS--------NQHDILQKSINEVVCWKKFLYFLIIPTLVYRDSYPMRKSVNFKSVISS--------FLEFILCIIFMYYIFINLMR----PIFHDFNPS----FMTLEEIIPKFFQAILPTILMMLSVFFCFLHSWLNAFAELTKFGDRQFYKDWWNATSLSDYFRTWNALIYDWLYTYIYRDFSLLMLRITNNKMISKSFGMISVLLISALVHEYVLAFCFRFF--YPVLLTVFFFSGTVLYFVKANRA-SRIPNIMLWTGLYIGNSIFTTLY 1427
            ++  Y  ++ P+   + ++S        N         N + C   F  F + P LVY+ +YP    + ++ V+          FL  +    FM+ + +  ++    P F  + P+    F  L ++IP F      T+L ML+ F+    + LN  AELT+F DR FY DWWN  S  ++ R WN  ++ +L  ++Y   S+  L       +SKS   +    +SA+ HE  +   FR    Y  +  +  F  T L   K  RA  ++ N++   G+  G SI  TLY
Sbjct:  331 QLQKYKESLSPETREILQKSCDFCLFELNYQTKDNDFPNNISC-SNFFMFCLFPVLVYQINYPRTSRIRWRYVLEKVCAIIGTIFLMMVTAQFFMHPVAMRCIQFHNTPTFGGWIPATQEWFHLLFDMIPGF------TVLYMLT-FYMIWDALLNCVAELTRFADRYFYGDWWNCVSFEEFSRIWNVPVHKFLLRHVYHS-SMGALH------LSKSQATLFTFFLSAVFHEMAMFAIFRRVRGYLFMFQLSQFVWTALSNTKFLRARPQLSNVVFSFGVCSGPSIIMTLY 607          
BLAST of O-acyltransferase vs. Ensembl Nematostella
Match: EDO49468 (O-acyltransferase [Source:UniProtKB/TrEMBL;Acc:A7RG44])

HSP 1 Score: 279.256 bits (713), Expect = 2.851e-89
Identity = 155/420 (36.90%), Postives = 252/420 (60.00%), Query Frame = 3
Query:  219 LLTEMFRIPHFNSLLNMFLSFVILMMMKTVCNDWLKEGFFKHYHHFQWVSNEFAGIQXXXXXXXXXXXXXXXXXXXXKFWIIMRLKWKLKALLDVFSVFIYLLIIGCAIVLPVRIVMNHYVPPCSSAFIVYEQIRILMKIHAYVRTVIPKLHHLFKQSNQHDILQKSINEVVCWKKFLYFLIIPTLVYRDSYPMRKSVNFKSVISSFLEFILCIIFMYYIFINLMRPIFHDFNPSFMTLEEIIPKFFQAILPTILMMLSVFFCFLHSWLNAFAELTKFGDRQFYKDWWNATSLSDYFRTWNALIYDWLYTYIYRDFSLLMLRITNNKMISKSFGMISVLLISALVHEYVLAFCFRFFYPVLLTVFFFSGTVLYFVKA---NRASRIPNIMLWTGLYIGNSIFTTLYSSEWYARKNCKRTN 1469
            +L ++ ++ H  ++ N+F++ + + ++ TV  D++  G  +    F  +   F  +  V+   L + I+ +L F L +FW   +  W     +     +I  +++ C  V P++ V  H +PP SS  I+ EQIR+++K+HA+VR+ +PK+  L+   N+        NE+  + ++LYFL  PTLVYRD YPM   + +  V+S+F +  +CI++ YY+F     P+F +        + +I   F  +LP  ++++  FF  LHSWLNAFAE+T+F DR FYKDWWNA S +D++RTWN +++DWLYTYIY+D    ++++TNN+ +S     ++V ++SA+ HEYVL F FRFF+P+L T+F   G    F+K    N+ S+  NI +W  L++GN +   LYS EWYA +NC R N
Sbjct:    1 MLRDLLQVSHVQTIYNIFVALLAVFVLNTVIYDFIDTG--RLSLDFSIMFWAFGKVSTVINVWLVMLIMSLLIFPLFRFWHSSQSTWYHLPNIVWLVGYIGYIVVFC--VFPIQEVYTHNLPPVSSIIILTEQIRLILKVHAFVRSNVPKV--LYTSENE--------NEIPEFGQYLYFLFCPTLVYRDHYPMTPCIRWDYVVSNFFQVAMCILYTYYVFARFCVPVFRNTGKEAGNFKNLILSAFSCMLPGTMVLVLGFFAILHSWLNAFAEMTRFADRMFYKDWWNAPSYADWYRTWNVVVHDWLYTYIYKD----LVQLTNNRNLST----VAVFVVSAIAHEYVLMFAFRFFFPILFTMFGGVGLSFVFLKPSKHNKHSQWWNIFMWITLFLGNGLLMCLYSQEWYATQNCPRKN 398          
BLAST of O-acyltransferase vs. Ensembl Nematostella
Match: EDO47288 (O-acyltransferase [Source:UniProtKB/TrEMBL;Acc:A7RML0])

HSP 1 Score: 96.6709 bits (239), Expect = 1.694e-21
Identity = 66/310 (21.29%), Postives = 141/310 (45.48%), Query Frame = 3
Query:  543 IVLPVRIVMNHYVPPCSSAFIVYEQIRILMKIHAYVRTVIPKLHHLFKQSNQHDILQKSINEV-------VCWKKFLYFLIIPTLVYRDSYPMRKSVNFKSVISSFLEFILCIIFMYYIFINLMRPIFHDFNPSFMTLE--EIIPKFFQAILPTILMMLSVFFCFLHSWLNAFAELTKFGDRQFYKDWWNATSLSDYFRTWNALIYDWLYTYIYRDFSLLMLRITNNKMISKSFGMISVLLISALVHEYVLAFCFRFFYPVLLTVFFFSGTVLYFVKAN-RASRIPNIMLWTGLYIGNSIFTTLYSSEWY 1442
            +V+P+ +++++  PP ++  +      + +K+ +Y+   +   + L K S + ++      E        +  +   YFL+ PTL Y  ++P   ++  + +I   +EF   +  M  +    + P   +       +E      +  +  +P   + L  F+C+ HS+LN   EL +F DR FYKDWWN+ ++  +++ WN   + W   ++Y+     M+R    +  S     I+V ++SA  HEY+++   R       +       + +F+K         N+++W  + +G  +   +Y  ++Y
Sbjct:  144 LVVPIIVILSYKPPPWAAGIVCGAYSMLWLKLISYISVNLWHRNKLIKTSEKENVSNGKNKEPMVEYPDNLTQQDLYYFLLCPTLCYELNFPRLPAIRKRFLIRRIVEFFFLLGLMIGVAQQWIVPTIKNSIKPLQRMEYARAAERVMKLAIPNHFLWLLFFYCYFHSFLNITGELLRFADRCFYKDWWNSNTVQYFWQNWNIPAHRWAVRHLYKP----MIR----RGYSNFQAQIAVFMLSAFFHEYLVSVPLRMIKLWSFSAMIGQLPMAFFIKRYIHNPNYGNVVVWCSIILGQPLAIMMYFHDYY 445          
BLAST of O-acyltransferase vs. Ensembl Medaka
Match: soat1 (sterol O-acyltransferase 1 [Source:NCBI gene;Acc:101164716])

HSP 1 Score: 269.24 bits (687), Expect = 4.236e-83
Identity = 135/337 (40.06%), Postives = 203/337 (60.24%), Query Frame = 3
Query:  507 SVFIYLLIIGCAIVLPVRIVMNHYVPPCSSAFIVYEQIRILMKIHAYVRTVIPKLHHLFKQSNQHDILQKSINEVVCWKKFLYFLIIPTLVYRDSYPMRKSVNFKSVISSFLEFILCIIFMYYIFINLMRPIFHDFNPSFMTLEEIIPKFFQAILPTILMMLSVFFCFLHSWLNAFAELTKFGDRQFYKDWWNATSLSDYFRTWNALIYDWLYTYIYRDFSLLMLRITNNKMISKSFGMISVLLISALVHEYVLAFCFRFFYPVLLTVFFFSGTVLYFV-KANRASRIPNIMLWTGLYIGNSIFTTLYSSEWYARKNCKRTNEGFLDFIVPRSLFCE 1514
            S F+   ++G  + LP  +V+ + +PP S   I+ EQ+R++MK H++VR  +PK+    K           +++      +LYFL  PTL+YRD YP      +  V S+FL+ + C+ + YY+F+ L  P F   +  F+ L  ++   F +ILP +L++L  FF FLH WLNAFAE+ +F DR FYKDWWN+TS ++Y+RTWN +++DWLY Y+YRDF    L I+  +   +   M+ V  ISA+VHEY+LA CF FFYPVL  +F   G +  F+    R   I N+++WT L++G  +   LYS EWYA++ C      FL+++ PRS  C+
Sbjct:  229 SAFLLYQVLGLGL-LPAYVVVTNSLPPASCFIIIIEQVRLMMKAHSFVRENVPKVLSWAKDKTSPGPAVPQVSQ------YLYFLFAPTLIYRDKYPRNPVTRWSYVASNFLQVLGCLCYAYYVFVRLCIPQFRSISLQFLDLRAMVLCVFNSILPGVLVLLLAFFAFLHCWLNAFAEMLRFADRMFYKDWWNSTSFANYYRTWNVVVHDWLYYYVYRDF----LLISQKRF--RLAAMLFVFTISAVVHEYILAVCFGFFYPVLFCLFMCFGMMFNFILHDRRKGPIWNVIMWTALFLGQGVIICLYSQEWYAQRYCPVKEPSFLEWVTPRSWSCQ 552          
BLAST of O-acyltransferase vs. Ensembl Medaka
Match: soat2 (sterol O-acyltransferase 1 [Source:NCBI gene;Acc:101162519])

HSP 1 Score: 246.899 bits (629), Expect = 6.838e-75
Identity = 153/466 (32.83%), Postives = 254/466 (54.51%), Query Frame = 3
Query:  129 STKIDASSSDHSNGDSKVLVRERVYVDRDSLLTEMFRIPHFNSLLNMFLSFVILMMMKTVCNDWLKEGFFKHYHHFQWVSNEFAGI-QXXXXXXXXXXXXXXXXXXXXKFWIIMRLKWKLKALLDVFSVFIYLLIIGCAIVL-PVRIVMNHYVPPCSSAFIVYEQIRILMKIHAYVRTVIPKLHHLFKQSNQHDILQKSINEVVCWKKFLYFLIIPTLVYRDSYPMRKSVNFKSVISSFLEFILCIIFMYYIFINLMRPIFH-DFNPSFMTLEEIIPKFFQAILPTILMMLSVFFCFLHSWLNAFAELTKFGDRQFYKDWWNATSLSDYFRTWNALIYDWLYTYIYRDFSLLMLRITNNKMISKSFGMISVLLISALVHEYVLAFCFRFFYPVLLTVFFFSGTVLYF-VKANRASRIPNIMLWTGLYIGNSIFTTLYSSEWYARKNCKRTNEGFLDFIVPRSLFCE 1514
              K++  S      D KV      +V R SLL E+F I H  ++ +MF++ +++  + T+  D++ +G  +    F  +   F  +  +  +  +     + + F  + FW  +      K  L + +  I   +  C + L PV +V++H +PP S   ++ EQIR LMK ++++R V+P +    K + +    +        +  +LYFL  PTL++R+SYP    + +K V  +F + + C+ + Y+I + L  P+F  + N  F +   ++   F +ILP I+++L  FF FLH WLN F EL +F DR FYKDWWN+TS ++Y+RTWN +++DWLY Y YRDF  L      ++   ++  M+SV ++SA+VHEY LA  F FFYPV+  +F   G    F +   R S + N+++W  L++G  +   LY  EWYA+ +C RT + F + ++PRS  C 
Sbjct:   84 GKKLNKQSGSQRMDDGKV------FVARASLLDELFEISHIRTIYHMFIAVLLIFCLSTLAVDYIDQG--RLVLEFDLLFFAFGKLWTVTWVWAVMFLYTLSVPFYTLIFWGSLYHNSHFKLGLSLSTGLILFAVQTCILGLFPVYMVVHHQLPPASRFIVILEQIRFLMKAYSFIREVVPVI---LKNTPK----KGETPRFPTFSSYLYFLFCPTLIFRESYPRNNQIRWKYVFVTFGKILGCLFYGYFILVRLCIPVFRPEINQPF-SKRTMVLAVFNSILPGIMLLLLCFFAFLHCWLNLFGELLRFADRMFYKDWWNSTSFANYYRTWNVVVHDWLYYYGYRDFLWL------SRKRFRAAAMLSVFIVSAVVHEYALAMGFGFFYPVMFCLFAVFGVAFNFTMNDKRQSPVFNVIMWACLFLGQGVQVCLYCQEWYAQIHCPRTGDSFWEIVLPRSWSCS 527          
BLAST of O-acyltransferase vs. Ensembl Medaka
Match: DGAT1 (diacylglycerol O-acyltransferase 1 [Source:NCBI gene;Acc:101155899])

HSP 1 Score: 99.3673 bits (246), Expect = 7.352e-22
Identity = 62/236 (26.27%), Postives = 112/236 (47.46%), Query Frame = 3
Query:  741 KKFLYFLIIPTLVYRDSYPMRKSVNFKSVISSFLEFILCIIFMYYIFINLMRPIFHDFNPSF--MTLEEIIPKFFQAILPTILMMLSVFFCFLHSWLNAFAELTKFGDRQFYKDWWNATSLSDYFRTWNALIYDWLYTYIYRDFSLLMLRITNNKMISKSFGMISVLLISALVHEYVLAFCFRFFYPVLLTVFFFSGTVLYFVKANRASRIPNIMLWTGLYIGNSIFTTLYSSEWY 1442
            +   YF++ PTL Y+ ++P    +  + ++    E +  +  +  +    M P   +    F  M    ++ +  +  +P  L+ L  F+ F HS +N  AEL +FGDR+FY+DWWN+ S++ ++  WN  ++ W   + Y+     MLR   NK ++++F    V L+SA  HEY+++   + F             + +FV         N  +W  L IG  I   +Y  ++Y
Sbjct:  250 RDMYYFILAPTLCYQLNFPRSHRIRKRFLMRRLFEMLFLMQLLVGLIQQWMVPTIQNSMRPFQEMDFSRMVERLLKLAVPNHLIWLIFFYWFFHSSMNFVAELLQFGDREFYRDWWNSESVTYFWANWNIPVHKWCLRHFYKP----MLRRGINKFLAQTF----VFLLSAFFHEYLVSVPLKMFRLWAFMGMMTQVPLAWFVGRYLNGNYGNAAVWMSLIIGQPIAVLMYVHDYY 477          
BLAST of O-acyltransferase vs. Ensembl Medaka
Match: DGAT1 (diacylglycerol O-acyltransferase 1 [Source:NCBI gene;Acc:101155899])

HSP 1 Score: 98.9821 bits (245), Expect = 8.524e-22
Identity = 62/236 (26.27%), Postives = 112/236 (47.46%), Query Frame = 3
Query:  741 KKFLYFLIIPTLVYRDSYPMRKSVNFKSVISSFLEFILCIIFMYYIFINLMRPIFHDFNPSF--MTLEEIIPKFFQAILPTILMMLSVFFCFLHSWLNAFAELTKFGDRQFYKDWWNATSLSDYFRTWNALIYDWLYTYIYRDFSLLMLRITNNKMISKSFGMISVLLISALVHEYVLAFCFRFFYPVLLTVFFFSGTVLYFVKANRASRIPNIMLWTGLYIGNSIFTTLYSSEWY 1442
            +   YF++ PTL Y+ ++P    +  + ++    E +  +  +  +    M P   +    F  M    ++ +  +  +P  L+ L  F+ F HS +N  AEL +FGDR+FY+DWWN+ S++ ++  WN  ++ W   + Y+     MLR   NK ++++F    V L+SA  HEY+++   + F             + +FV         N  +W  L IG  I   +Y  ++Y
Sbjct:  233 RDMYYFILAPTLCYQLNFPRSHRIRKRFLMRRLFEMLFLMQLLVGLIQQWMVPTIQNSMRPFQEMDFSRMVERLLKLAVPNHLIWLIFFYWFFHSSMNFVAELLQFGDREFYRDWWNSESVTYFWANWNIPVHKWCLRHFYKP----MLRRGINKFLAQTF----VFLLSAFFHEYLVSVPLKMFRLWAFMGMMTQVPLAWFVGRYLNGNYGNAAVWMSLIIGQPIAVLMYVHDYY 460          
BLAST of O-acyltransferase vs. Ensembl Medaka
Match: dgat1b (diacylglycerol O-acyltransferase 1 [Source:NCBI gene;Acc:101166984])

HSP 1 Score: 96.6709 bits (239), Expect = 6.815e-21
Identity = 72/274 (26.28%), Postives = 122/274 (44.53%), Query Frame = 3
Query:  630 MKIHAYVRTV-IPKLHHLFKQSNQHDILQKSINEVVCWKKFLYFLIIPTLVYRDSYPMRKSVNFKSVISSFLEFILCIIFMYYIFINLMRPIFHD-FNP-SFMTLEEIIPKFFQAILPTILMMLSVFFCFLHSWLNAFAELTKFGDRQFYKDWWNATSLSDYFRTWNALIYDWLYTYIYRDFSLLMLRITNNKMISKSFGMISVLLISALVHEYVLAFCFRFFYPVLLTVFFFSGTVLYFVKANRASRIPNIMLWTGLYIGNSIFTTLYSSEWY 1442
            +K    VR++  P  HH  +   +H +       +   +   YF+  PTL Y  ++P    +    ++    E    I  +  +    M PI      P   M L  +  +  +  +P  L+ L  F+ F HS +N  AEL +FGDRQFYKDWWN+ S++ +++ WN  ++ W   + Y+     +LR   +K+ S+S    +V  +SA  HEY+++   R F     T       + +FV         N  +W  + IG      +Y  ++Y
Sbjct:  233 VKARKLVRSLSCPTPHHFHR--GEHKVCYPGNLTI---RDMYYFVFAPTLCYELNFPRSPEIRMSFLLRRLFEMFFFIQVLVGLTQQWMIPIIQSSMKPLEDMDLSRMTERLLRLAVPNHLLWLMFFYWFFHSSMNFTAELLRFGDRQFYKDWWNSESVTYFWQNWNIPVHKWCLRHFYKP----LLRKGFSKIASQS----AVFFLSAFFHEYLVSVPLRMFRLWAFTGMMAQLPLAWFVGRFLRGNYGNAAVWISIIIGQPFAVLMYVHDYY 493          
BLAST of O-acyltransferase vs. Planmine SMEST
Match: SMESG000000989.1 (SMESG000000989.1)

HSP 1 Score: 904.434 bits (2336), Expect = 0.000e+0
Identity = 462/472 (97.88%), Postives = 470/472 (99.58%), Query Frame = 3
Query:  102 MSKRRNNRESTKIDASSSDHSNGDSKVLVRERVYVDRDSLLTEMFRIPHFNSLLNMFLSFVILMMMKTVCNDWLKEGFFKHYHHFQWVSNEFAGIQXXXXXXXXXXXXXXXXXXXXKFWIIMRLKWKLKALLDVFSVFIYLLIIGCAIVLPVRIVMNHYVPPCSSAFIVYEQIRILMKIHAYVRTVIPKLHHLFKQSNQHDILQKSINEVVCWKKFLYFLIIPTLVYRDSYPMRKSVNFKSVISSFLEFILCIIFMYYIFINLMRPIFHDFNPSFMTLEEIIPKFFQAILPTILMMLSVFFCFLHSWLNAFAELTKFGDRQFYKDWWNATSLSDYFRTWNALIYDWLYTYIYRDFSLLMLRITNNKMISKSFGMISVLLISALVHEYVLAFCFRFFYPVLLTVFFFSGTVLYFVKANRASRIPNIMLWTGLYIGNSIFTTLYSSEWYARKNCKRTNEGFLDFIVPRSLFCEI 1517
            MSKRRNNRESTKIDASSSDHSNGDSKVLVRERVYV+RDSLLTEMFRIPHFNSLLNMFLSFVILMMMKTVCNDWLKEGFFKHYHHFQWVSNEFAGIQIVLLTLLALYILVILSFLLVKFWI MRLKWKLKALLDVFSVFIYLLIIGCA+V+PV+IVMNHYVPPCSSAFIVYEQIRILMKIHAYVRTVIPKLHHLFKQSNQHDI+QKSINEVVCWKKFLYFLIIPTL+YRDSYPMRKSVNFKSVISSFLEFILCIIFMYYIFINLMRPIFHDFNPSFMTLE IIPKFFQAILPTILMMLSVFFCFLHSWLNAFAELTKFGDRQFYKDWWNATSLSDYFRTWNALIYDWLYTYIYRDFSLLMLRITNNKMISKSFGMISVLLISALVHEYVLAFCFRFFYPVLLTVFFFSGTVLYFVKANRASRIPNIMLWTGLYIGNS+FTTLYSSEWYARKNCKRTNEGFLDFIVPRSLFCE+
Sbjct:    1 MSKRRNNRESTKIDASSSDHSNGDSKVLVRERVYVNRDSLLTEMFRIPHFNSLLNMFLSFVILMMMKTVCNDWLKEGFFKHYHHFQWVSNEFAGIQIVLLTLLALYILVILSFLLVKFWIRMRLKWKLKALLDVFSVFIYLLIIGCAVVVPVQIVMNHYVPPCSSAFIVYEQIRILMKIHAYVRTVIPKLHHLFKQSNQHDIIQKSINEVVCWKKFLYFLIIPTLIYRDSYPMRKSVNFKSVISSFLEFILCIIFMYYIFINLMRPIFHDFNPSFMTLEVIIPKFFQAILPTILMMLSVFFCFLHSWLNAFAELTKFGDRQFYKDWWNATSLSDYFRTWNALIYDWLYTYIYRDFSLLMLRITNNKMISKSFGMISVLLISALVHEYVLAFCFRFFYPVLLTVFFFSGTVLYFVKANRASRIPNIMLWTGLYIGNSMFTTLYSSEWYARKNCKRTNEGFLDFIVPRSLFCEM 472          
BLAST of O-acyltransferase vs. Planmine SMEST
Match: SMESG000000988.1 (SMESG000000988.1)

HSP 1 Score: 871.692 bits (2251), Expect = 0.000e+0
Identity = 449/472 (95.13%), Postives = 458/472 (97.03%), Query Frame = 3
Query:  102 MSKRRNNRESTKIDASSSDHSNGDSKVLVRERVYVDRDSLLTEMFRIPHFNSLLNMFLSFVILMMMKTVCNDWLKEGFFKHYHHFQWVSNEFAGIQXXXXXXXXXXXXXXXXXXXXKFWIIMRLKWKLKALLDVFSVFIYLLIIGCAIVLPVRIVMNHYVPPCSSAFIVYEQIRILMKIHAYVRTVIPKLHHLFKQSNQHDILQKSINEVVCWKKFLYFLIIPTLVYRDSYPMRKSVNFKSVISSFLEFILCIIFMYYIFINLMRPIFHDFNPSFMTLEEIIPKFFQAILPTILMMLSVFFCFLHSWLNAFAELTKFGDRQFYKDWWNATSLSDYFRTWNALIYDWLYTYIYRDFSLLMLRITNNKMISKSFGMISVLLISALVHEYVLAFCFRFFYPVLLTVFFFSGTVLYFVKANRASRIPNIMLWTGLYIGNSIFTTLYSSEWYARKNCKRTNEGFLDFIVPRSLFCEI 1517
            MSKRRNN+ S   DA+SSD+ NGDSK  V ERVYVDRDSLLTEMFRIPHFNSLLNMFLSFVILMMMKTVCNDWLKEGFFKHYHHFQWVSNEFAGIQIVLLTLLALYILVILSFLLVKFWI MRLKWKLKALLDVFSVFIYLLIIGCA+V+PV+IVMNHYVPPCSS FIVYEQIRILMKIHAYVRTVIPKLHHLFKQSNQHDILQKSIN VVCW+KFLYFLIIPTL+YRDSYPMRKSVNFKSVISSFLEFILCIIFMYYIFINLMRPIFHDFNPSFMTLE IIPKFFQAILPTILMMLSVFFCFLHSWLNAFAELTKFGDRQFYKDWWNATSLSDYFRTWNALIYDWLYTYIYRDFSLLMLRITNNKMISKSFGMISVLLISALVHEYVLAFCFRFFYPVLLTVFFFSGTVLYFVKANRASRIPNIMLWTGLYIGNS+F TLYSSEWYARKNCKRTNE FLDFIVPRSLFCEI
Sbjct:    1 MSKRRNNKGSNNSDANSSDNFNGDSKAFVPERVYVDRDSLLTEMFRIPHFNSLLNMFLSFVILMMMKTVCNDWLKEGFFKHYHHFQWVSNEFAGIQIVLLTLLALYILVILSFLLVKFWIRMRLKWKLKALLDVFSVFIYLLIIGCAVVVPVQIVMNHYVPPCSSIFIVYEQIRILMKIHAYVRTVIPKLHHLFKQSNQHDILQKSINGVVCWEKFLYFLIIPTLIYRDSYPMRKSVNFKSVISSFLEFILCIIFMYYIFINLMRPIFHDFNPSFMTLEVIIPKFFQAILPTILMMLSVFFCFLHSWLNAFAELTKFGDRQFYKDWWNATSLSDYFRTWNALIYDWLYTYIYRDFSLLMLRITNNKMISKSFGMISVLLISALVHEYVLAFCFRFFYPVLLTVFFFSGTVLYFVKANRASRIPNIMLWTGLYIGNSMFVTLYSSEWYARKNCKRTNERFLDFIVPRSLFCEI 472          
BLAST of O-acyltransferase vs. Planmine SMEST
Match: SMESG000024271.1 (SMESG000024271.1)

HSP 1 Score: 95.1301 bits (235), Expect = 1.349e-20
Identity = 71/273 (26.01%), Postives = 131/273 (47.99%), Query Frame = 3
Query:  663 PKLH--HLFKQSNQHDILQ--KSINEVVCWKKFLYFLIIPTLVYRDSYPMRKSVNFKSVISSFLEFILCIIFMYYIFINLMRPIFHDFNPSFMT--LEEIIPKFFQAILPTILMMLSVFFCFLHSWLNAFAELTKFGDRQFYKDWWNATSLSDYFRTWNALIYDWLYTYIYRDFSLLMLRITNNKMISKSFGMISVLLISALVHEYVLAFCFRFF----YPVLLTVFFFSGTVLYFVKANRASRIPNIMLWTGLYIGNSIFTTLYSSEWYARK 1451
            PK+H   + K    H IL+  +   + +  K   YF++ PTL Y  ++P    +  K +    LE I     ++ +    + P+ H+    F       ++ +  +  +P  L+ L +F+   HS LN  AEL  FGDR FYKDWWNA ++++++ TWN  ++ W   +I+    + +L+    K+ +     + V  ISA  HE++++   R F    +  ++    F+  V  ++K ++A    N  +W  L IG  +   +Y  ++Y + 
Sbjct:  245 PKVHGDEIDKIDTGHVILRHFQRYPDNLNLKDLYYFIVAPTLCYELNFPRTLKIRKKFLWKRTLELIFLPQLVFCLIQQWILPLLHNSVTPFSNSHFSVVLERMLKLSIPNHLIWLMLFYAMFHSGLNVCAELLYFGDRLFYKDWWNANTVTEFWSTWNIPVHRWARRHIF----MPLLKRKYTKLTAS----VVVFFISAFFHEFLVSVPLRMFRLWSFTAMIGQVPFAMFVSKYLKRSQAG---NFAVWISLIIGQPLAMMMYFHDYYVQN 506          
BLAST of O-acyltransferase vs. Planmine SMEST
Match: SMESG000024271.1 (SMESG000024271.1)

HSP 1 Score: 95.1301 bits (235), Expect = 1.389e-20
Identity = 71/273 (26.01%), Postives = 131/273 (47.99%), Query Frame = 3
Query:  663 PKLH--HLFKQSNQHDILQ--KSINEVVCWKKFLYFLIIPTLVYRDSYPMRKSVNFKSVISSFLEFILCIIFMYYIFINLMRPIFHDFNPSFMT--LEEIIPKFFQAILPTILMMLSVFFCFLHSWLNAFAELTKFGDRQFYKDWWNATSLSDYFRTWNALIYDWLYTYIYRDFSLLMLRITNNKMISKSFGMISVLLISALVHEYVLAFCFRFF----YPVLLTVFFFSGTVLYFVKANRASRIPNIMLWTGLYIGNSIFTTLYSSEWYARK 1451
            PK+H   + K    H IL+  +   + +  K   YF++ PTL Y  ++P    +  K +    LE I     ++ +    + P+ H+    F       ++ +  +  +P  L+ L +F+   HS LN  AEL  FGDR FYKDWWNA ++++++ TWN  ++ W   +I+    + +L+    K+ +     + V  ISA  HE++++   R F    +  ++    F+  V  ++K ++A    N  +W  L IG  +   +Y  ++Y + 
Sbjct:  230 PKVHGDEIDKIDTGHVILRHFQRYPDNLNLKDLYYFIVAPTLCYELNFPRTLKIRKKFLWKRTLELIFLPQLVFCLIQQWILPLLHNSVTPFSNSHFSVVLERMLKLSIPNHLIWLMLFYAMFHSGLNVCAELLYFGDRLFYKDWWNANTVTEFWSTWNIPVHRWARRHIF----MPLLKRKYTKLTAS----VVVFFISAFFHEFLVSVPLRMFRLWSFTAMIGQVPFAMFVSKYLKRSQAG---NFAVWISLIIGQPLAMMMYFHDYYVQN 491          
The following BLAST results are available for this feature:
BLAST of O-acyltransferase vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
SOAT13.784e-9135.21sterol O-acyltransferase 1 [Source:HGNC Symbol;Acc... [more]
SOAT14.413e-9135.21sterol O-acyltransferase 1 [Source:HGNC Symbol;Acc... [more]
SOAT13.674e-9035.21sterol O-acyltransferase 1 [Source:HGNC Symbol;Acc... [more]
SOAT21.231e-8232.52sterol O-acyltransferase 2 [Source:HGNC Symbol;Acc... [more]
DGAT13.279e-2327.87diacylglycerol O-acyltransferase 1 [Source:HGNC Sy... [more]
back to top
BLAST of O-acyltransferase vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
mboa-14.989e-5727.20O-acyltransferase [Source:UniProtKB/TrEMBL;Acc:Q1... [more]
mboa-27.415e-1928.63O-acyltransferase [Source:UniProtKB/TrEMBL;Acc:F1... [more]
mboa-27.415e-1928.63O-acyltransferase [Source:UniProtKB/TrEMBL;Acc:F1... [more]
mboa-24.018e-1828.63O-acyltransferase [Source:UniProtKB/TrEMBL;Acc:F1... [more]
mboa-24.018e-1828.63O-acyltransferase [Source:UniProtKB/TrEMBL;Acc:F1... [more]
back to top
BLAST of O-acyltransferase vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
CG81122.394e-5329.35gene:FBgn0037612 transcript:FBtr0305337[more]
mdy5.393e-1926.25gene:FBgn0004797 transcript:FBtr0080916[more]
mdy5.393e-1926.25gene:FBgn0004797 transcript:FBtr0080915[more]
mdy5.393e-1926.25gene:FBgn0004797 transcript:FBtr0080917[more]
mdy5.393e-1926.25gene:FBgn0004797 transcript:FBtr0347182[more]
back to top
BLAST of O-acyltransferase vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
soat16.953e-8333.55sterol O-acyltransferase 1 [Source:ZFIN;Acc:ZDB-GE... [more]
soat16.953e-8333.55sterol O-acyltransferase 1 [Source:ZFIN;Acc:ZDB-GE... [more]
soat21.581e-7038.11sterol O-acyltransferase 2 [Source:ZFIN;Acc:ZDB-GE... [more]
soat26.444e-4829.89sterol O-acyltransferase 2 [Source:ZFIN;Acc:ZDB-GE... [more]
dgat1b6.088e-2026.27diacylglycerol O-acyltransferase 1b [Source:ZFIN;A... [more]
back to top
BLAST of O-acyltransferase vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ythdc15.592e-8541.67YTH domain containing 1 [Source:Xenbase;Acc:XB-GEN... [more]
ythdc16.726e-8541.36YTH domain containing 1 [Source:Xenbase;Acc:XB-GEN... [more]
ythdc11.871e-8233.26YTH domain containing 1 [Source:Xenbase;Acc:XB-GEN... [more]
ythdc18.801e-8135.07YTH domain containing 1 [Source:Xenbase;Acc:XB-GEN... [more]
ythdc11.424e-8035.07YTH domain containing 1 [Source:Xenbase;Acc:XB-GEN... [more]
back to top
BLAST of O-acyltransferase vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Soat14.106e-8834.56sterol O-acyltransferase 1 [Source:MGI Symbol;Acc:... [more]
Soat14.106e-8834.56sterol O-acyltransferase 1 [Source:MGI Symbol;Acc:... [more]
Soat24.932e-8332.20sterol O-acyltransferase 2 [Source:MGI Symbol;Acc:... [more]
Dgat11.933e-2424.40diacylglycerol O-acyltransferase 1 [Source:MGI Sym... [more]
Soat24.444e-1525.22sterol O-acyltransferase 2 [Source:MGI Symbol;Acc:... [more]
back to top
BLAST of O-acyltransferase vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|O77760|SOAT1_CHLAE1.673e-8935.42Sterol O-acyltransferase 1 OS=Chlorocebus aethiops... [more]
sp|P35610|SOAT1_HUMAN1.764e-8935.21Sterol O-acyltransferase 1 OS=Homo sapiens OX=9606... [more]
sp|O77761|SOAT1_MACFA5.633e-8935.21Sterol O-acyltransferase 1 OS=Macaca fascicularis ... [more]
sp|Q60457|SOAT1_CRIGR1.054e-8734.99Sterol O-acyltransferase 1 OS=Cricetulus griseus O... [more]
sp|Q61263|SOAT1_MOUSE2.872e-8734.56Sterol O-acyltransferase 1 OS=Mus musculus OX=1009... [more]
back to top
BLAST of O-acyltransferase vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A210R6J11.411e-9938.37O-acyltransferase OS=Mizuhopecten yessoensis OX=65... [more]
A0A0L8GFZ31.303e-9334.77O-acyltransferase OS=Octopus bimaculoides OX=37653... [more]
A0A2C9JQ146.920e-9235.14O-acyltransferase OS=Biomphalaria glabrata OX=6526... [more]
E9FTT99.782e-9236.74O-acyltransferase OS=Daphnia pulex OX=6669 GN=DAPP... [more]
A0A2C9JQ081.370e-9135.83O-acyltransferase OS=Biomphalaria glabrata OX=6526... [more]
back to top
BLAST of O-acyltransferase vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
soat21.463e-7431.11sterol O-acyltransferase 2-like [Source:NCBI gene;... [more]
soat23.192e-7030.35sterol O-acyltransferase 2-like [Source:NCBI gene;... [more]
soat11.232e-6135.71sterol O-acyltransferase 1 [Source:ZFIN;Acc:ZDB-GE... [more]
ENSAMXT00000047082.12.875e-5935.40pep primary_assembly:Astyanax_mexicanus-2.0:APWO02... [more]
ENSAMXT00000014398.21.723e-5840.15pep primary_assembly:Astyanax_mexicanus-2.0:APWO02... [more]
back to top
BLAST of O-acyltransferase vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 3
Match NameE-valueIdentityDescription
soat21.210e-8734.23sterol O-acyltransferase 2 [Source:ZFIN;Acc:ZDB-GE... [more]
ENSPMAT00000004896.13.093e-4737.76pep scaffold:Pmarinus_7.0:GL476574:469247:474793:-... [more]
dgat1a4.087e-2025.74diacylglycerol O-acyltransferase 1a [Source:ZFIN;A... [more]
back to top
BLAST of O-acyltransferase vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 2
Match NameE-valueIdentityDescription
ARE24.914e-1828.78Acyl-CoA:sterol acyltransferase; endoplasmic retic... [more]
ARE18.270e-1727.05Acyl-CoA:sterol acyltransferase; endoplasmic retic... [more]
back to top
BLAST of O-acyltransferase vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 2
Match NameE-valueIdentityDescription
EDO494682.851e-8936.90O-acyltransferase [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO472881.694e-2121.29O-acyltransferase [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of O-acyltransferase vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
soat14.236e-8340.06sterol O-acyltransferase 1 [Source:NCBI gene;Acc:1... [more]
soat26.838e-7532.83sterol O-acyltransferase 1 [Source:NCBI gene;Acc:1... [more]
DGAT17.352e-2226.27diacylglycerol O-acyltransferase 1 [Source:NCBI ge... [more]
DGAT18.524e-2226.27diacylglycerol O-acyltransferase 1 [Source:NCBI ge... [more]
dgat1b6.815e-2126.28diacylglycerol O-acyltransferase 1 [Source:NCBI ge... [more]
back to top
BLAST of O-acyltransferase vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 4
Match NameE-valueIdentityDescription
SMESG000000989.10.000e+097.88SMESG000000989.1[more]
SMESG000000988.10.000e+095.13SMESG000000988.1[more]
SMESG000024271.11.349e-2026.01SMESG000024271.1[more]
SMESG000024271.11.389e-2026.01SMESG000024271.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30015783 ID=SMED30015783|Name=O-acyltransferase|organism=Schmidtea mediterranea sexual|type=transcript|length=1566bp
GTTTTAGATAAGCTAAACTTAGAAGTTTATAAATATAAAAACTGTACTTT
AGGTCATTTGGTATCAAGGTTCAGTGTAAAACTTTCATACAACTATTGTA
AATGTCAAAACGTCGGAACAATAGAGAATCAACTAAAATTGACGCTAGTT
CTTCAGACCATTCCAATGGAGATTCGAAAGTGCTTGTTCGTGAAAGAGTC
TATGTCGATCGAGATTCTTTACTAACGGAAATGTTTAGAATTCCACATTT
CAATTCATTGTTAAACATGTTTCTCTCATTTGTAATACTAATGATGATGA
AAACCGTCTGCAATGACTGGCTGAAGGAAGGCTTTTTCAAGCATTACCAT
CATTTTCAGTGGGTCAGCAATGAATTTGCAGGAATCCAAATCGTTCTCTT
AACTCTATTGGCATTATACATCCTAGTTATTCTATCCTTTTTACTTGTAA
AGTTCTGGATAATAATGAGATTAAAATGGAAATTGAAAGCTCTCCTCGAT
GTTTTCTCTGTATTTATTTATTTGTTAATAATTGGATGCGCTATTGTTTT
ACCAGTGCGAATCGTAATGAACCATTACGTACCGCCGTGCAGTTCAGCAT
TCATTGTTTATGAGCAAATTAGAATTCTCATGAAAATTCATGCATATGTT
AGAACTGTCATCCCGAAACTTCACCACTTATTTAAACAATCAAATCAACA
TGACATCTTACAAAAAAGTATAAATGAAGTTGTTTGTTGGAAAAAGTTTC
TCTATTTTCTAATCATACCGACATTGGTCTACCGAGATTCATATCCAATG
AGAAAGTCTGTAAACTTCAAATCCGTCATATCTTCCTTCCTGGAATTCAT
TTTGTGCATTATTTTCATGTACTACATTTTCATTAATCTCATGCGACCAA
TATTCCATGATTTCAATCCTTCATTCATGACATTAGAAGAAATTATTCCG
AAATTTTTTCAAGCCATTCTTCCAACAATTTTAATGATGCTTTCAGTGTT
CTTCTGTTTCCTTCATTCGTGGTTGAATGCATTTGCAGAACTAACCAAGT
TTGGAGACAGACAATTCTATAAAGATTGGTGGAATGCGACATCTTTGAGT
GATTATTTTCGAACGTGGAACGCTTTGATTTATGATTGGTTATACACGTA
TATATATAGGGACTTTTCTCTATTAATGTTGAGAATTACAAATAACAAAA
TGATATCTAAGTCATTCGGTATGATAAGTGTATTGCTTATCTCTGCACTA
GTTCACGAATACGTTTTGGCATTTTGTTTTCGATTCTTTTACCCAGTTTT
ATTAACGGTGTTTTTCTTTTCTGGTACCGTGCTATATTTTGTGAAAGCTA
ATAGAGCCTCGAGAATTCCGAACATTATGTTATGGACTGGCTTGTATATA
GGGAATTCTATATTTACCACCCTTTATAGTTCAGAATGGTATGCTAGGAA
GAATTGCAAACGGACAAATGAGGGGTTTTTGGATTTTATTGTCCCGAGAA
GTTTATTTTGTGAAATATGATATTGGTTTATATTGTATTTTATAAAAATT
CTTCTATTTATGAAAC
back to top

protein sequence of SMED30015783-orf-1

>SMED30015783-orf-1 ID=SMED30015783-orf-1|Name=SMED30015783-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=473bp
MSKRRNNRESTKIDASSSDHSNGDSKVLVRERVYVDRDSLLTEMFRIPHF
NSLLNMFLSFVILMMMKTVCNDWLKEGFFKHYHHFQWVSNEFAGIQIVLL
TLLALYILVILSFLLVKFWIIMRLKWKLKALLDVFSVFIYLLIIGCAIVL
PVRIVMNHYVPPCSSAFIVYEQIRILMKIHAYVRTVIPKLHHLFKQSNQH
DILQKSINEVVCWKKFLYFLIIPTLVYRDSYPMRKSVNFKSVISSFLEFI
LCIIFMYYIFINLMRPIFHDFNPSFMTLEEIIPKFFQAILPTILMMLSVF
FCFLHSWLNAFAELTKFGDRQFYKDWWNATSLSDYFRTWNALIYDWLYTY
IYRDFSLLMLRITNNKMISKSFGMISVLLISALVHEYVLAFCFRFFYPVL
LTVFFFSGTVLYFVKANRASRIPNIMLWTGLYIGNSIFTTLYSSEWYARK
NCKRTNEGFLDFIVPRSLFCEI*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000026gut
PLANA:0000070intestinal phagocyte
PLANA:0003116parenchymal cell
Vocabulary: INTERPRO
TermDefinition
IPR014371Oat_ACAT_DAG_ARE
IPR004299MBOAT_fam
Vocabulary: molecular function
TermDefinition
GO:0008374O-acyltransferase activity
GO:0016740transferase activity
GO:0016746transferase activity, transferring acyl groups
Vocabulary: cellular component
TermDefinition
GO:0005783endoplasmic reticulum
GO:0005789endoplasmic reticulum membrane
GO:0016020membrane
GO:0016021integral component of membrane
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR014371Sterol O-acyltransferase, ACAT/DAG/ARE typesPIRSFPIRSF000439Oat_ACAT_DAG_AREcoord: 1..454
e-value: 1.5E-88
score: 295.5
IPR014371Sterol O-acyltransferase, ACAT/DAG/ARE typesPANTHERPTHR10408STEROL O-ACYLTRANSFERASEcoord: 5..456
IPR004299Membrane bound O-acyl transferase, MBOATPFAMPF03062MBOATcoord: 102..444
e-value: 4.0E-21
score: 75.8
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 1..15
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 1..24
NoneNo IPR availablePANTHERPTHR10408:SF8O-ACYLTRANSFERASEcoord: 5..456
NoneNo IPR availableTMHMMTMhelixcoord: 242..264
NoneNo IPR availableTMHMMTMhelixcoord: 134..156
NoneNo IPR availableTMHMMTMhelixcoord: 47..69
NoneNo IPR availableTMHMMTMhelixcoord: 372..391
NoneNo IPR availableTMHMMTMhelixcoord: 92..114
NoneNo IPR availableTMHMMTMhelixcoord: 285..307
NoneNo IPR availableTMHMMTMhelixcoord: 335..352
NoneNo IPR availableTMHMMTMhelixcoord: 395..414