Bravo_FIGEY domain-containing protein

Overview
NameBravo_FIGEY domain-containing protein
Smed IDSMED30015763
Length (bp)2774
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Bravo_FIGEY domain-containing protein (SMED30015763) t-SNE clustered cells

Violin plots show distribution of expression levels for Bravo_FIGEY domain-containing protein (SMED30015763) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Bravo_FIGEY domain-containing protein (SMED30015763) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Bravo_FIGEY domain-containing protein (SMED30015763) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30015763

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 8

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
head regionSMED30015763h1SMcG0010035 SmedASXL_015513SmedAsxl_ww_GCZZ01PMID:27034770
Currie et al., 2016
whole organism asexual adult RNA-sequencing evidence
nervous systemSMED30015763h1SMcG0010035 dd_Smed_v4_7836_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
cephalic gangliaSMED30015763h1SMcG0010035 dd_Smed_v4_7836_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
neuronSMED30015763h1SMcG0010035 dd_Smed_v4_7836_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult colorimetric in situ hybridization evidence
muscle cellSMED30015763h1SMcG0010035 dd_Smed_v4_7836_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
parenchymal cellSMED30015763h1SMcG0010035 dd_Smed_v4_7836_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
anterior sideSMED30015763h1SMcG0010035 dd_Smed_v4_7836_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
head regionSMED30015763h1SMcG0010035 dd_Smed_v6_7836_0_1dd_Smed_v6PMID:28171748
Stückemann et al., 2017
whole organism asexual adult RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Bravo_FIGEY domain-containing protein vs. TrEMBL
Match: A0A3Q0KT09 (Putative immunoglobulin domain superfamily (Sensory guidance protein) OS=Schistosoma mansoni OX=6183 PE=4 SV=1)

HSP 1 Score: 301.982 bits (772), Expect = 1.599e-85
Identity = 250/834 (29.98%), Postives = 386/834 (46.28%), Query Frame = 2
Query:   38 LLLFYF--IYSISGLEKFLQFIPHKDVTIRKSVYELD--EDPVSVDAFQSSQVLIKYIQSIRDLNFPEFKFYCHVKELETNFKISNAYLCKKQSIMGHEDCHLISKDTQKIKFQEHMQFETKFDPGTGIIADLNMDISAVKSRLQPFDGFYYCKLENHMGSISSNYIEIQDFEFYKTKLSNFINQISVRFAPSPINDFTSDSFPIYLDCGKLVGNYEENIPKWANKDLLSSFTWQLC----PDATSGIQCFSSVVDTQKKSSRPLEEFIDYYQFPNGTAVLLGIKGNDYIKAGLFCGLKAIVPKMYSAYLVKTKNALWRPISYTV---VGKYNKKIKQLSAENTEITIREGKYRSSRFKLYALYVGNPDHTKIKAEWKKDTYSLPSTFK-QGPYQLVFPIEISESYSGKYDLKIIQSEPFDTVTFRYNVKVVSSPKLKDNIKQQSVFYVTVDKSAQISVFFERDITKLSLEVNNMPIDLLTAKAKEKSVKNLCYKFPFLTGIDISANISLNEGMIYYEAKNLIKRSNSPQAKTHTVTFIAENDIGVSKVSYLIRVFENPTFIYYLNDFNCTDNCMDDQRHDFKCSINETEYKKEGFTIKYVWTINGLSVDNMQSGYAIKSFLEVNNDTITIKPIKSANLEKYKEMLGYFSKSNLSCRVDI-------------VPTSNPSETFYSTDQNPNLRPYLQAMVNLQANSVDT---ASTSRYXXXXXXXXXXXXXXXXXXYFCLRGSGETYNVDQKERAHGHDPEKEIRDNEIFQPYERDHETNVVQPSHLSFNXXXXXXXXXXXXELDVYDIDPGKFNEEGSFIGQYASDPRKNKIN 2455
            L++F F   Y  S  E++LQFIP   V      YE     + + +DA    QV I+ ++ + +L  P  + +C V  L++  ++ +AYLC+++S    ++C  I   T+ + F   ++F    +   G      +    VK  L   DGFY+CK  N  G + SN+IEIQD  +Y  ++     + +    P  IND      P+ L+CG+      E +P WA+    S F W  C    PD      C   V    +++S  +  + + Y  PNGT VL     + +   GL C        +YS Y   +     RP   T    +      I  LS     IT+R G    +  KL   Y  NP+HT +K  W KD   +PS F     Y L FP  I   +SG Y+L +     +D V F++ V VV  P++        +  V   ++   S   +  IT+ SLE+N +P        + +    L  ++P+L    I   +  N  ++ Y A NL+    S    THTV+ + +N+ G+++VS L+RV      +    D++CT +C++   H F C I+   Y+   F     W +NG+SV  M   Y    F++     + I P+   +L         F K N++CR  I                  P    Y +  +  + P + A ++LQ +   T   A+ S    ++I ++V + I VL     +R  GETY +D++ERA G+DPEKE+R+ E FQ YER  E   ++ S  S NDD +      DGELD Y++DPGKFNEEGSFIG+YA++  K   N
Sbjct:    7 LIVFVFGTPYGASTREQYLQFIPVNGVRHDTYFYEHPGLRNLIEIDATIKQQVRIRIVEHLNEL--PVLRIHCIVAPLDSTHELVSAYLCRRKSTHDSDEC--IDPKTRNVIFGR-VEFSANGNRSAGYTFSSRL---PVKDEL--LDGFYFCKYHNRNGELISNFIEIQDAYYYHKRMVRRPVKQTEYLPPLSINDL-----PLSLECGQT--KVSEALPSWADAAFPSPFMWSFCDVDSPDGIQSAGCMRRV----RQTSIHVTNYFESYVSPNGTLVLYKRTASAWKDMGLVCWSHLDSSAVYSTYFGGSNE---RPKLLTYDSNIPFIGSGITVLSPLTQRITVRIGP--QTGLKLMTKYRSNPEHTIVK--WTKDGKRIPSNFPGHNDYLLKFPDFIRREHSGTYNLLVENG--YDQVNFQFLVSVVGPPEVIR--APPPLLLVMEGENVTFSCQLDSFITE-SLEINGLPYQPNPTNFRTE----LRDQYPYLKDALIQP-LQRNGHILTYSAYNLLFTPGSKIGPTHTVSLVGKNEYGLARVSTLVRVLPRINILNAPKDYSCTTDCLNSVSHTFDCVIDTDPYQSTYFV--QTWELNGISVSKMTKDYQQSKFIKTEGTKLIITPVDDPSLTV------LFRKVNVTCRWRIFYPHVTSRIADLDTRLLEPDMKVYDSHDDVKIHPLMTAALDLQVDHDPTPASANISWITAVIIGILVIIAIGVLTACLVMRFRGETYMLDREERALGNDPEKELREKEAFQTYERAEEPP-LRGSRCSLNDDSAEIGSDGDGELDDYNLDPGKFNEEGSFIGEYATERHKGPSN 793          
BLAST of Bravo_FIGEY domain-containing protein vs. TrEMBL
Match: G4V9E1 (Putative immunoglobulin domain superfamily (Sensory guidance protein) OS=Schistosoma mansoni OX=6183 GN=Smp_172070 PE=4 SV=1)

HSP 1 Score: 301.597 bits (771), Expect = 2.082e-85
Identity = 249/832 (29.93%), Postives = 388/832 (46.63%), Query Frame = 2
Query:   38 LLLFYF--IYSISGLEKFLQFIPHKDVTIRKSVYELD--EDPVSVDAFQSSQVLIKYIQSIRDLNFPEFKFYCHVKELETNFKISNAYLCKKQSIMGHEDCHLISKDTQKIKFQEHMQFETKFDPGTGIIADLNMDISAVKSRLQPFDGFYYCKLENHMGSISSNYIEIQDFEFYKTKLSNFINQISVRFAPSPINDFTSDSFPIYLDCGKLVGNYEENIPKWANKDLLSSFTWQLC----PDATSGIQCFSSVVDTQKKSSRPLEEFIDYYQFPNGTAVLLGIKGNDYIKAGLFCGLKAIVPKMYSAYLVKTKNALWRPISY-TVVGKYNKKIKQLSAENTEITIREGKYRSSRFKLYALYVGNPDHTKIKAEWKKDTYSLPSTFK-QGPYQLVFPIEISESYSGKYDLKIIQSEPFDTVTFRYNVKVVSSPKLKDNIKQQSVFYVTVDKSAQISVFFERDITKLSLEVNNMPIDLLTAKAKEKSVKNLCYKFPFLTGIDISANISLNEGMIYYEAKNLIKRSNSPQAKTHTVTFIAENDIGVSKVSYLIRVFENPTFIYYLNDFNCTDNCMDDQRHDFKCSINETEYKKEGFTIKYVWTINGLSVDNMQSGYAIKSFLEVNNDTITIKPIKSANLEKYKEMLGYFSKSNLSCRVDI-------------VPTSNPSETFYSTDQNPNLRPYLQAMVNLQANSVDT---ASTSRYXXXXXXXXXXXXXXXXXXYFCLRGSGETYNVDQKERAHGHDPEKEIRDNEIFQPYERDHETNVVQPSHLSFNXXXXXXXXXXXXELDVYDIDPGKFNEEGSFIGQYASDPRKNKIN 2455
            L++F F   Y  S  E++LQFIP   V      YE     + + +DA    QV I+ ++ + +L  P  + +C V  L++  ++ +AYLC+++S    ++C  I   T+ + F   ++F    +   G      +    VK  L   DGFY+CK  N  G + SN+IEIQD  +Y  ++     + +    P  IND      P+ L+CG+      E +P WA+    S F W  C    PD      C   V    +++S  +  + + Y  PNGT VL     + +   GL C        +YS Y     N   + ++Y + +      I  LS     IT+R G    +  KL   Y  NP+HT +K  W KD   +PS F     Y L FP  I   +SG Y+L +     +D V F++ V VV  P++        +  V   ++   S   +  IT+ SLE+N +P        + +    L  ++P+L    I   +  N  ++ Y A NL+    S    THTV+ + +N+ G+++VS L+RV      +    D++CT +C++   H F C I+   Y+   F     W +NG+SV  M   Y    F++     + I P+   +L         F K N++CR  I                  P    Y +  +  + P + A ++LQ +   T   A+ S    ++I ++V + I VL     +R  GETY +D++ERA G+DPEKE+R+ E FQ YER  E   ++ S  S NDD +      DGELD Y++DPGKFNEEGSFIG+YA++  K   N
Sbjct:    8 LIVFVFGTPYGASTREQYLQFIPVNGVRHDTYFYEHPGLRNLIEIDATIKQQVRIRIVEHLNEL--PVLRIHCIVAPLDSTHELVSAYLCRRKSTHDSDEC--IDPKTRNVIFGR-VEFSANGNRSAGYTFSSRL---PVKDEL--LDGFYFCKYHNRNGELISNFIEIQDAYYYHKRMVRRPVKQTEYLPPLSINDL-----PLSLECGQT--KVSEALPSWADAAFPSPFMWSFCDVDSPDGIQSAGCMRRV----RQTSIHVTNYFESYVSPNGTLVLYKRTASAWKDMGLVCWSHLDSSAVYSTYF-GGSNERPKLLTYDSNIPFIGSGITVLSPLTQRITVRIGP--QTGLKLMTKYRSNPEHTIVK--WTKDGKRIPSNFPGHNDYLLKFPDFIRREHSGTYNLLVENG--YDQVNFQFLVSVVGPPEVIR--APPPLLLVMEGENVTFSCQLDSFITE-SLEINGLPYQPNPTNFRTE----LRDQYPYLKDALIQP-LQRNGHILTYSAYNLLFTPGSKIGPTHTVSLVGKNEYGLARVSTLVRVLPRINILNAPKDYSCTTDCLNSVSHTFDCVIDTDPYQSTYFV--QTWELNGISVSKMTKDYQQSKFIKTEGTKLIITPVDDPSLTV------LFRKVNVTCRWRIFYPHVTSRIADLDTRLLEPDMKVYDSHDDVKIHPLMTAALDLQVDHDPTPASANISWITAVIIGILVIIAIGVLTACLVMRFRGETYMLDREERALGNDPEKELREKEAFQTYERAEEPP-LRGSRCSLNDDSAEIGSDGDGELDDYNLDPGKFNEEGSFIGEYATERHKGPSN 794          
BLAST of Bravo_FIGEY domain-containing protein vs. TrEMBL
Match: A0A5K3EMV6 (Uncharacterized protein OS=Mesocestoides corti OX=53468 PE=4 SV=1)

HSP 1 Score: 275.789 bits (704), Expect = 4.300e-76
Identity = 229/827 (27.69%), Postives = 379/827 (45.83%), Query Frame = 2
Query:   20 MMNKQSLLLFYFIYSISGLEKFLQFIPHKDVTIRKSVYEL--DEDPVSVDAFQSSQVLIKYIQSIRDLNFPEFKFYCHVKELETNFKISNAYLCKKQSIMGHEDCHLISKDTQKIKFQEHMQFETKFDPGTGIIADLNMDISAVKSRLQPFDGFYYCKLENHMGSISSNYIEIQDFEFYKTKLSNFINQISVRFAPSPINDFTSDSFPIYLDCGKLVGNYEENIPKWANKDLLSSFTWQLC-PDATSGIQ---CFSSVVDTQKKSSRPLEEFIDYYQFPNGTAVLLGIKGNDYIKAGLFCGLKAIVPKMYSAYLVKTKNALWRPISYT-VVGKYNKKIKQLSAENTEITIREGKYRSSRFKLYALYVGNPDHTKIKAEWKKDTYSLPSTFKQGPYQLVFPIEISESYSGKYDLKIIQSEPFDTVTFRYNVKVVSSPKLKDNIKQQSVFYVTVDKSAQISVFFERDITKLSLEVNNMPIDLLTAKAKEKSVKNLCYKFPFLTGIDISANISLNEGMIYYEAKNLIKRSNSPQAKTHTVTFIAENDIGVSKVSYLIRVFENPTFIYYLNDFNCTDNCMDDQRHDFKCSINETEYKKEGFTIKYVWTINGLSVDNMQSGYAIKSFLEVNNDTITIKPIKSANLEKYKEMLGYFSKSNLSCRVDIVPTSNPSETF---------YSTDQNPNLRPYLQAMVNLQANS---VDTASTSRYXXXXXXXXXXXXXXXXXXYFCLRGSGETYNVDQKERAHGHDPEKEIRDNEIFQPYERDHETNVVQPSHLSFNXXXXXXXXXXXXELDVYDIDPGKFNEEGSFIGQYASDPRK 2443
            + N    +    I S  G   FL+F   +  T R   +       P+ VD     +V I+ ++ + ++  P  +F+C V +L  +  I+ A LC +        C             E  +F++  D  TG +   N     V+    P D  Y+C+L N  G I SN IE+QD + Y    S           P  ++      FP+ L+CG  +  Y  ++P WA +     + W +C  D  S ++   C+          S P+  + D+   PNGT ++  +   D+   G+ C    I   ++SAY    +N   +P  +T + G Y  +I   S +   +T+R G +      L ALY  NP    + A+W KD   LP       + L FP +I  SY+G Y L +    P++T+ F+Y V V   P +K +  +    +V     AQ++  F+  IT  S+ +N +PID L+A    +S++ L   FP++  ++       +E  I Y  ++L    NSP   +HTVT +A N +G  + + LIRV   P  ++ L++++C ++C +   H F C I    Y   G  +   W ++G  ++ +       +FL  ++  + +  ++  +   + E+   F+  +LSCR  +      +E F         Y T  +PNL   L A +    +S   V+ AS S  + +VI++++ +I+ VL +   +R  G+TY ++++E   G+DPEKE RD   FQ YER  E  V+   + S  D        D+GEL+ Y  DPG FNE GSFI  Y  D R+
Sbjct:    6 LCNSVVFVALLVIGSCFGGTPFLKFRQVESTTHRNGSFSYFGMNKPIIVDGL-FPRVTIQIVELLNNIP-PRLEFHCVVDKLSRDSPITTAQLCFETPSSSKLSCD--DALGSSYLLPEKYKFKSSGDVYTGYVFTSNW----VRDNF-PLDATYFCRLGNSNGVIQSNMIEVQDLDSYVAAFSK-----RKPLDPVLLDPIVGSHFPLSLECGNPI--YPVDLPAWAKQTFRVPYDWVVCEADVDSQLELRKCYDR--------SEPIVSYFDHTVLPNGTLIIHEL-AKDWRPIGILCISSFIRNMVFSAYF---QNNDGKPAPFTFITGSYPNQIIPHSPQYDRVTLRSGWHARDAITLNALYTANPK--IVTAKWTKDEGPLPLQITGSRHSLTFPQDIKPSYAGTYVLSL--KTPYETLRFKYEVLVEQPPVIKQDPPRD--VFVLQGHQAQLTAEFDGHITSRSVFINGIPIDTLSASNYRESLRLLRDSFPYIGELNPEIEFP-SESSIRYTVRDLAFTPNSPYGASHTVTMVAANSLGSVRTNTLIRVLPVPEVLHQLSEYSCVEDCFNHTTHRFYCDIELAPYS--GLRVVKTWELDGQDLERLDPRDNRLTFLNHSSREVVLNIVQGDS--DFDEL---FANVDLSCRFRVF--GPETELFAGHMYETPLYDTKSDPNLHGMLTAHIRKYPSSLKIVNVASISWIVAVVIAVLILLIVAVLAVCIVMRNKGKTYMLEREELVRGNDPEKEFRDRAAFQDYERCDEPPVLG-CNQSLEDAFQEVGSEDEGELEFYGTDPGHFNETGSFINVYTKDTRR 787          
BLAST of Bravo_FIGEY domain-containing protein vs. TrEMBL
Match: A0A564YQA6 (Bravo_FIGEY domain-containing protein OS=Hymenolepis diminuta OX=6216 GN=WMSIL1_LOCUS8748 PE=4 SV=1)

HSP 1 Score: 275.789 bits (704), Expect = 4.600e-76
Identity = 233/828 (28.14%), Postives = 392/828 (47.34%), Query Frame = 2
Query:   20 MMNKQSLLL----FYFIYSISGLEK--FLQFIPHKDVTIRKS--VYELDEDPVSVDA-FQSSQVLIKYIQSIRDLN--FPEFKFYCHVKELETNFKISNAYLCKKQSIMGHEDCHLISKDTQKIKFQEHMQFETKFDPGTGIIADLNMDISAVKSRLQPFDGFYYCKLENHMGSISSNYIEIQDFEFYKTKLSNFINQISVRFAPSPINDFTSDSFPIYLDCGKLVGNYEENIPKWANKDLLSSFTWQLCPDATSGIQCFSSVVDTQKKSSRPLEEFIDYYQFPNGTAVLLGIKGNDYIKAGLFCGLKAIVPKMYSAYLVKTKNALWRPISYTVVGKYNKKIKQLSAENTEITIREGKYRSSRFKLYALYVGNPDHTKIKAEWKKDTYSLPSTFKQGPYQLVFPIEISESYSGKYDLKIIQSEPFDTVTFRYNVKVVSSPKLKDNIKQQSVFYVTVDKSAQISVFFERDITKLSLEVNNMPIDLLTAKAKEKSVKNLCYKFPFLTGIDISANISL-NEGMIYYEAKNLIKRSNSPQAKTHTVTFIAENDIGVSKVSYLIRVFENPTFIYYLNDFNCTDNCMDDQRHDFKCSINETEYKKEGFTIKYVWTINGLSVDNMQSGYAIKSFLEVNNDTITIKPIKSANLEKYKEMLGYFSKSNLSCRVDIVP------TSNPSET-FYSTDQNPNLRPYLQAMVNLQANSVDTASTSRYXXXXXXXXXXXXXXXXXXYFCLRGSGETYNVDQKERAHGHDPEKEIRDNEIFQPYERDHETNVVQPSHLSFNXXXXXXXXXXXXELDVYDIDPGKFNEEGSFIGQYASDPRKN 2446
            MM+K+ LL     F F+   SG  +  FL F   +    R     Y   E P+ +D  F  + +LI     +  LN   P  +F+C +++L  +  I++A LC +        C   +         +  +F++  D   G +   N D    + R  P D  Y+C+L N  G I SN IE+QD + Y   +S F+ + SV   P         SFP+  +CG  + N E  +P WA     + + W +C ++  G+Q    + D   +  RP+ E+ ++   PNGT ++  +   DY   G+ C    +  K++S Y  +  +    P +Y + G Y  ++   S     ++IR G +      L ALY  NP    + A W KD  S+P  F    + LVFP +I  S++G Y L +    P++TV F+Y V +   P +K+   +  +  V+    AQIS  F+  ++  SL +N M ID L++    ++++ L   FP++   D++  I   +E  I Y  ++L    NSP   +HTV+ +  N +G  + + LIRV   P  I  L+D++C ++C +   H F C I    Y   G  +   W ++G  +  +       +FL+ +N  + +       L  + ++   F+ ++LSCR  +          +  ET +Y T  +P L   L A +    +   T++ S  + +VI++++ +I+ +L +   +   G+TY ++++ER  G+DPEKE RD + FQ +ER  E  +   +  S  D        D+GELD   +DPG FNE GSFI  Y  D R++
Sbjct:    1 MMSKEFLLFTVLSFIFVNFASGENETPFLNFKKVETAIYRNGSFTYFGAEKPIVIDGMFPLTTILI-----VELLNNAPPTVEFHCVIEKLSRDSPITSAQLCFETPSTRKPKCD--NAIGSSYLLSDKYKFKSSGDIYNGYVFTSNWD----RDRF-PLDATYFCRLGNRNGVIQSNTIEVQDLDSY---ISAFLKRKSV--GPILRGPLVGSSFPVSFECGSSLDNLE--LPNWAKDTFPAPYVWAVC-ESEPGVQL--EMRDCYDRH-RPIGEYFEHTVLPNGTLIIHDLV-KDYRPLGIICTTNYLYNKVFSVYF-QDDDGKGVPFTY-IPGTYPGQVIPKSPLYNRVSIRGGWHARDVITLNALYTANPQ--TVSASWSKDGGSIPIQFTANRHSLVFPQDIKSSFAGTYVLAL--KGPYETVYFKYEVVIEQPPTVKEAPPRHLI--VSQGNMAQISTEFDGRLSSRSLLINGMQIDTLSSANYRETLRMLGDAFPYIR--DLNPEIEFPSENSIRYTVRDLTFLPNSPYGSSHTVSMVGTNALGSVRTNTLIRVLPKPEVIRQLSDYSCLEDCFNQTMHRFYCDIELAPYV--GLRVIKTWELDGQDLARLDLRDNRLTFLKYSNTEVVMDIAHDNAL--FDDL---FANADLSCRFRVFGPETELFAGDIYETPYYDTKNDPTLHSMLTAAIRKNPSRSRTSNISWIVAVVIAVLILLIVAILAVSIMMGNKGKTYFLEREERMRGNDPEKEFRDRDPFQAFERRSEPPIPGLNQ-SLEDSFPEIGSVDEGELDYCGMDPGNFNETGSFINVYTKDSRQH 786          
BLAST of Bravo_FIGEY domain-containing protein vs. TrEMBL
Match: A0A4Z2CS03 (E3 ubiquitin-protein ligase TRIM56 (Fragment) OS=Schistosoma japonicum OX=6182 GN=EWB00_007983 PE=4 SV=1)

HSP 1 Score: 277.715 bits (709), Expect = 3.692e-74
Identity = 236/818 (28.85%), Postives = 381/818 (46.58%), Query Frame = 2
Query:   38 LLLFYFIYSISGLEKFLQFIPHKDVTIRKSVYELD--EDPVSVDAFQSSQVLIKYIQSIRDLNFPEFKFYCHVKELETNFKISNAYLCKKQSIMGHEDCHLISKDTQKIKFQEHMQFETKFDPGTGIIADLNMDISAVKSRLQPFDGFYYCKLENHMGSISSNYIEIQDFEFYKTKLSNFINQISVRFAPSPINDFTSDSFPIYLDCGKLVGNYEENIPKWANKDLLSSFTWQLC----PDATSGIQCFSSVVDTQKKSSRPLEEFIDYYQFPNGTAVLLGIKGNDYIKAGLFCGLKAIVPKMYSAYLVKTKNALWRPISYTV---VGKYNKKIKQLSAENTEITIREGKYRSSRFKLYALYVGNPDHTKIKAEWKKDTYSLPSTF-KQGPYQLVFPIEISESYSGKYDLKIIQSEPFDTVTFRYNVKVVSSPKLKDNIKQQSVFYVTVDKSAQISVFFERDITKLSLEVNNMPIDLLTAKAKEKSVKNLCYKFPFLTGIDISANISLNEGMIYYEAKNLIKRSNSPQAKTHTVTFIAENDIGVSKVSYLIRVFENPTFIYYLNDFNCTDNCMDDQRHDFKCSINETEYKKEGFTIKYVWTINGLSVDNMQSGYAIKSFLEVNNDTITIKPIKSANLEKYKEMLGYFSKSNLSCRVDI-------------VPTSNPSETFYSTDQNPNLRPYLQAMVNLQAN---SVDTASTSRYXXXXXXXXXXXXXXXXXXYFCLRGSGETYNVDQKERAHGHDPEKEIRDNEIFQPYERDHETNVVQPSHLSFNXXXXXXXXXXXXELDVYDIDPGKFNEEGSF 2413
            +L F   + +S  E++LQFIP   V+     YE     +P+ VDA    QV I+ ++ + +L  P  + +C V  L++  ++ +AYLC+++S+   ++C  I   T+ + F   ++F    +  +G         S +  R +  DGFY CK  N  G + SN+IEIQD  +Y  ++     + +    P  IN+      P+ L+CG+      E +P WA+    S F W  C    PD      C   V    +++S  +  + + Y  PNGT VL     + +   GL C        +YS Y      +L RP   T    +     +I  LS    +IT+R G    +  KL   Y  NP HT ++  W KD   +PS F +   Y L FP  I  ++SG Y+L ++++E  + V F+++V VV  P++        +  V   ++   S   +  IT+ SLE+N +P     A  + +    L  ++P+L  + I   +  N  ++ Y A NL     S    THTV+ + +N+ G+++VS ++RV      +    D++CT +C++   H F C IN   Y  E   I   W +NG++V  M   Y    FL+     + I P+   +L         F K N++CR  I                  P+   Y +  +  +   + A  NLQ +   +  +A+ S    ++I ++V + I VL     +R  GETY +D++ERA G+DPEKE+R+ E FQ YER  E   ++ S  S NDD +      DGELD Y++DP   N   S 
Sbjct:    9 ILTFKIPHGLSAKEQYLQFIPVNGVSHGTYFYEHPGLRNPIEVDATVQQQVRIRIVEHLNEL--PVLRIHCIVAPLDSTHELVSAYLCRRKSVHDSDEC--IDPKTRNVVFGR-VEFSAIGNRSSGYTFS-----SRLPVRDELLDGFYSCKFHNQNGELISNFIEIQDAYYYHKRMVRRPVKQTEFLPPLSINNL-----PLSLECGQ--TQVSEELPSWADAAFPSPFMWSFCDVDIPDGIQSAGCMRRV----RQTSIHVTNYFESYVSPNGTLVLYKRTASAWKDMGLVCWSHLDSSAVYSTYF---GGSLERPRLLTYDSNIPFIGNEITVLSPLIQKITVRIGP--RTGLKLVTKYRSNPKHTTVR--WTKDGKKIPSDFPRHNDYLLKFPDLIHRNHSGMYNL-LVENE-HNRVNFQFSVSVVGPPEVIR--APPPLILVMEGENVTFSCHLDSFITE-SLEINGLPYQPNAANFRTE----LRDQYPYLKDVLIQP-LQKNGHILTYSAYNLFFTPGSKIGPTHTVSLVGKNEYGLARVSTVVRVLPRLNILKAPKDYSCTTDCLNTASHIFDCVINTDSY--ESAYIVQTWELNGIAVSKMTKDYQQSKFLKTEGTKLIITPVDDPSLTV------LFRKVNVTCRWRIFYPHVTSRIADLDTRLLEPNMKVYDSHDDVKIHSLMTAAFNLQVDHDPAPASANISWITAVIIGILVIIAIGVLTACLVMRFRGETYMLDREERALGNDPEKELREKEAFQTYERVEEP-PLRGSRCSLNDDSAEIGSDADGELDDYNLDPENSNRTPSI 779          
BLAST of Bravo_FIGEY domain-containing protein vs. Planmine SMEST
Match: SMESG000064374.1 (SMESG000064374.1)

HSP 1 Score: 1607.42 bits (4161), Expect = 0.000e+0
Identity = 814/814 (100.00%), Postives = 814/814 (100.00%), Query Frame = 2
Query:   20 MMNKQSLLLFYFIYSISGLEKFLQFIPHKDVTIRKSVYELDEDPVSVDAFQSSQVLIKYIQSIRDLNFPEFKFYCHVKELETNFKISNAYLCKKQSIMGHEDCHLISKDTQKIKFQEHMQFETKFDPGTGIIADLNMDISAVKSRLQPFDGFYYCKLENHMGSISSNYIEIQDFEFYKTKLSNFINQISVRFAPSPINDFTSDSFPIYLDCGKLVGNYEENIPKWANKDLLSSFTWQLCPDATSGIQCFSSVVDTQKKSSRPLEEFIDYYQFPNGTAVLLGIKGNDYIKAGLFCGLKAIVPKMYSAYLVKTKNALWRPISYTVVGKYNKKIKQLSAENTEITIREGKYRSSRFKLYALYVGNPDHTKIKAEWKKDTYSLPSTFKQGPYQLVFPIEISESYSGKYDLKIIQSEPFDTVTFRYNVKVVSSPKLKDNIKQQSVFYVTVDKSAQISVFFERDITKLSLEVNNMPIDLLTAKAKEKSVKNLCYKFPFLTGIDISANISLNEGMIYYEAKNLIKRSNSPQAKTHTVTFIAENDIGVSKVSYLIRVFENPTFIYYLNDFNCTDNCMDDQRHDFKCSINETEYKKEGFTIKYVWTINGLSVDNMQSGYAIKSFLEVNNDTITIKPIKSANLEKYKEMLGYFSKSNLSCRVDIVPTSNPSETFYSTDQNPNLRPYLQAMVNLQANSVDTASTSRYXXXXXXXXXXXXXXXXXXYFCLRGSGETYNVDQKERAHGHDPEKEIRDNEIFQPYERDHETNVVQPSHLSFNXXXXXXXXXXXXELDVYDIDPGKFNEEGSFIGQYASDPRKNKINNS 2461
            MMNKQSLLLFYFIYSISGLEKFLQFIPHKDVTIRKSVYELDEDPVSVDAFQSSQVLIKYIQSIRDLNFPEFKFYCHVKELETNFKISNAYLCKKQSIMGHEDCHLISKDTQKIKFQEHMQFETKFDPGTGIIADLNMDISAVKSRLQPFDGFYYCKLENHMGSISSNYIEIQDFEFYKTKLSNFINQISVRFAPSPINDFTSDSFPIYLDCGKLVGNYEENIPKWANKDLLSSFTWQLCPDATSGIQCFSSVVDTQKKSSRPLEEFIDYYQFPNGTAVLLGIKGNDYIKAGLFCGLKAIVPKMYSAYLVKTKNALWRPISYTVVGKYNKKIKQLSAENTEITIREGKYRSSRFKLYALYVGNPDHTKIKAEWKKDTYSLPSTFKQGPYQLVFPIEISESYSGKYDLKIIQSEPFDTVTFRYNVKVVSSPKLKDNIKQQSVFYVTVDKSAQISVFFERDITKLSLEVNNMPIDLLTAKAKEKSVKNLCYKFPFLTGIDISANISLNEGMIYYEAKNLIKRSNSPQAKTHTVTFIAENDIGVSKVSYLIRVFENPTFIYYLNDFNCTDNCMDDQRHDFKCSINETEYKKEGFTIKYVWTINGLSVDNMQSGYAIKSFLEVNNDTITIKPIKSANLEKYKEMLGYFSKSNLSCRVDIVPTSNPSETFYSTDQNPNLRPYLQAMVNLQANSVDTASTSRYLPIVISLIVTVIIVVLILYFCLRGSGETYNVDQKERAHGHDPEKEIRDNEIFQPYERDHETNVVQPSHLSFNDDDSVGVGSDDGELDVYDIDPGKFNEEGSFIGQYASDPRKNKINNS
Sbjct:    1 MMNKQSLLLFYFIYSISGLEKFLQFIPHKDVTIRKSVYELDEDPVSVDAFQSSQVLIKYIQSIRDLNFPEFKFYCHVKELETNFKISNAYLCKKQSIMGHEDCHLISKDTQKIKFQEHMQFETKFDPGTGIIADLNMDISAVKSRLQPFDGFYYCKLENHMGSISSNYIEIQDFEFYKTKLSNFINQISVRFAPSPINDFTSDSFPIYLDCGKLVGNYEENIPKWANKDLLSSFTWQLCPDATSGIQCFSSVVDTQKKSSRPLEEFIDYYQFPNGTAVLLGIKGNDYIKAGLFCGLKAIVPKMYSAYLVKTKNALWRPISYTVVGKYNKKIKQLSAENTEITIREGKYRSSRFKLYALYVGNPDHTKIKAEWKKDTYSLPSTFKQGPYQLVFPIEISESYSGKYDLKIIQSEPFDTVTFRYNVKVVSSPKLKDNIKQQSVFYVTVDKSAQISVFFERDITKLSLEVNNMPIDLLTAKAKEKSVKNLCYKFPFLTGIDISANISLNEGMIYYEAKNLIKRSNSPQAKTHTVTFIAENDIGVSKVSYLIRVFENPTFIYYLNDFNCTDNCMDDQRHDFKCSINETEYKKEGFTIKYVWTINGLSVDNMQSGYAIKSFLEVNNDTITIKPIKSANLEKYKEMLGYFSKSNLSCRVDIVPTSNPSETFYSTDQNPNLRPYLQAMVNLQANSVDTASTSRYLPIVISLIVTVIIVVLILYFCLRGSGETYNVDQKERAHGHDPEKEIRDNEIFQPYERDHETNVVQPSHLSFNDDDSVGVGSDDGELDVYDIDPGKFNEEGSFIGQYASDPRKNKINNS 814          
BLAST of Bravo_FIGEY domain-containing protein vs. Planmine SMEST
Match: SMESG000064374.1 (SMESG000064374.1)

HSP 1 Score: 1605.11 bits (4155), Expect = 0.000e+0
Identity = 813/813 (100.00%), Postives = 813/813 (100.00%), Query Frame = 2
Query:   23 MNKQSLLLFYFIYSISGLEKFLQFIPHKDVTIRKSVYELDEDPVSVDAFQSSQVLIKYIQSIRDLNFPEFKFYCHVKELETNFKISNAYLCKKQSIMGHEDCHLISKDTQKIKFQEHMQFETKFDPGTGIIADLNMDISAVKSRLQPFDGFYYCKLENHMGSISSNYIEIQDFEFYKTKLSNFINQISVRFAPSPINDFTSDSFPIYLDCGKLVGNYEENIPKWANKDLLSSFTWQLCPDATSGIQCFSSVVDTQKKSSRPLEEFIDYYQFPNGTAVLLGIKGNDYIKAGLFCGLKAIVPKMYSAYLVKTKNALWRPISYTVVGKYNKKIKQLSAENTEITIREGKYRSSRFKLYALYVGNPDHTKIKAEWKKDTYSLPSTFKQGPYQLVFPIEISESYSGKYDLKIIQSEPFDTVTFRYNVKVVSSPKLKDNIKQQSVFYVTVDKSAQISVFFERDITKLSLEVNNMPIDLLTAKAKEKSVKNLCYKFPFLTGIDISANISLNEGMIYYEAKNLIKRSNSPQAKTHTVTFIAENDIGVSKVSYLIRVFENPTFIYYLNDFNCTDNCMDDQRHDFKCSINETEYKKEGFTIKYVWTINGLSVDNMQSGYAIKSFLEVNNDTITIKPIKSANLEKYKEMLGYFSKSNLSCRVDIVPTSNPSETFYSTDQNPNLRPYLQAMVNLQANSVDTASTSRYXXXXXXXXXXXXXXXXXXYFCLRGSGETYNVDQKERAHGHDPEKEIRDNEIFQPYERDHETNVVQPSHLSFNXXXXXXXXXXXXELDVYDIDPGKFNEEGSFIGQYASDPRKNKINNS 2461
            MNKQSLLLFYFIYSISGLEKFLQFIPHKDVTIRKSVYELDEDPVSVDAFQSSQVLIKYIQSIRDLNFPEFKFYCHVKELETNFKISNAYLCKKQSIMGHEDCHLISKDTQKIKFQEHMQFETKFDPGTGIIADLNMDISAVKSRLQPFDGFYYCKLENHMGSISSNYIEIQDFEFYKTKLSNFINQISVRFAPSPINDFTSDSFPIYLDCGKLVGNYEENIPKWANKDLLSSFTWQLCPDATSGIQCFSSVVDTQKKSSRPLEEFIDYYQFPNGTAVLLGIKGNDYIKAGLFCGLKAIVPKMYSAYLVKTKNALWRPISYTVVGKYNKKIKQLSAENTEITIREGKYRSSRFKLYALYVGNPDHTKIKAEWKKDTYSLPSTFKQGPYQLVFPIEISESYSGKYDLKIIQSEPFDTVTFRYNVKVVSSPKLKDNIKQQSVFYVTVDKSAQISVFFERDITKLSLEVNNMPIDLLTAKAKEKSVKNLCYKFPFLTGIDISANISLNEGMIYYEAKNLIKRSNSPQAKTHTVTFIAENDIGVSKVSYLIRVFENPTFIYYLNDFNCTDNCMDDQRHDFKCSINETEYKKEGFTIKYVWTINGLSVDNMQSGYAIKSFLEVNNDTITIKPIKSANLEKYKEMLGYFSKSNLSCRVDIVPTSNPSETFYSTDQNPNLRPYLQAMVNLQANSVDTASTSRYLPIVISLIVTVIIVVLILYFCLRGSGETYNVDQKERAHGHDPEKEIRDNEIFQPYERDHETNVVQPSHLSFNDDDSVGVGSDDGELDVYDIDPGKFNEEGSFIGQYASDPRKNKINNS
Sbjct:    1 MNKQSLLLFYFIYSISGLEKFLQFIPHKDVTIRKSVYELDEDPVSVDAFQSSQVLIKYIQSIRDLNFPEFKFYCHVKELETNFKISNAYLCKKQSIMGHEDCHLISKDTQKIKFQEHMQFETKFDPGTGIIADLNMDISAVKSRLQPFDGFYYCKLENHMGSISSNYIEIQDFEFYKTKLSNFINQISVRFAPSPINDFTSDSFPIYLDCGKLVGNYEENIPKWANKDLLSSFTWQLCPDATSGIQCFSSVVDTQKKSSRPLEEFIDYYQFPNGTAVLLGIKGNDYIKAGLFCGLKAIVPKMYSAYLVKTKNALWRPISYTVVGKYNKKIKQLSAENTEITIREGKYRSSRFKLYALYVGNPDHTKIKAEWKKDTYSLPSTFKQGPYQLVFPIEISESYSGKYDLKIIQSEPFDTVTFRYNVKVVSSPKLKDNIKQQSVFYVTVDKSAQISVFFERDITKLSLEVNNMPIDLLTAKAKEKSVKNLCYKFPFLTGIDISANISLNEGMIYYEAKNLIKRSNSPQAKTHTVTFIAENDIGVSKVSYLIRVFENPTFIYYLNDFNCTDNCMDDQRHDFKCSINETEYKKEGFTIKYVWTINGLSVDNMQSGYAIKSFLEVNNDTITIKPIKSANLEKYKEMLGYFSKSNLSCRVDIVPTSNPSETFYSTDQNPNLRPYLQAMVNLQANSVDTASTSRYLPIVISLIVTVIIVVLILYFCLRGSGETYNVDQKERAHGHDPEKEIRDNEIFQPYERDHETNVVQPSHLSFNDDDSVGVGSDDGELDVYDIDPGKFNEEGSFIGQYASDPRKNKINNS 813          
BLAST of Bravo_FIGEY domain-containing protein vs. Planmine SMEST
Match: SMESG000064379.1 (SMESG000064379.1)

HSP 1 Score: 647.506 bits (1669), Expect = 0.000e+0
Identity = 380/817 (46.51%), Postives = 507/817 (62.06%), Query Frame = 2
Query:   38 LLLFYFIYSISGLEKFLQFIPHKDVTIRKSVYELDEDPVSVDAFQSSQVLIKYIQSIRDLNFPEFKFYCHVKELETNFKISNAYLCKKQSIMGHEDCHLISKDTQKIKFQEHMQFETKFDPGTGIIADLNMDISAVKSRLQPFDGFYYCKLENHMGSISSNYIEIQDFEFYKTKLS-------NFINQISVRFAPSPINDFTSDSFPIYLDCGKLVGNYEENIPKWANKDLLSS-FTWQLCPDATSGIQCFSSVVDTQKKSSRPLEEFIDYYQFPNGTAVLLGIKGNDYIKAGLFCGL-KAIVPKMYSAYLVKTKNALWRPISYTVVGKYNKKIKQLSAENTEITIREGKY-RSSRFKLYALYVGNPDHTKIKAEWKKDTYSLPSTFKQGPYQLVFPIEISESYSGKYDLKIIQSEPFDTVTFRYNVKVVSSPKLKDNIKQQSVFYVTVDKSAQISVFFERDITKLSLEVNNMPIDLLTAKAKEKSVKNLCYKFPFLTGIDISANISLNEGMIYYEAKNLIKRSNSPQAKTHTVTFIAENDIGVSKVSYLIRVFENPTFIYYLNDFNCTDNCMDDQRHDFKCSINETEYKKEGFTIKYVWTINGLSVDNMQSGYAIKSFLEVNNDTITIKPIKSANLEKYKEMLGYFSKSNLSCRVDIVPTSNPSETFYSTDQNPNLRPYLQAMVNLQANSVDTASTSRYXXXXXXXXXXXXXXXXXXYFCLRGSGETYNVDQKERAHGHDPEKEIRDNEIFQPYERDHETNVVQPSHLSFNXXXXXXXXXXXXELDVYDIDPGKFNEEGSFIGQYASDPRKNKINN 2458
            L+LFYFI SI GLEKFLQF PHKDV  R++ Y+ +E  ++ DA+  SQVLIKY+      +     FYCHVK L+ N+KI+ AY CKK S+   EDC+ I K T +I F  H  F   FD   G+I  L++       R +PF GFYYCKL N +GSISSNY EIQD EFY+ + +       NF N +  R A      FTS+SFP Y+ C   +  YE+N+PKW N DL S    W+ C       +C  +     + +   LE+F   YQFPNG+ VL+G+K  DY ++GL C +  +  P+  S Y  K +   W+ I Y  +  Y +KIK L+  +  IT REG Y   +RFKLYALYV NPD   I  EW+KD   LPSTF    ++L+FPIEI +S SG Y+L + QS+P D  TFRY V +   PKLKD   + SV Y   D   ++S+ FERDIT LSLE+NN+PID+L+   KE  +K L  K+ FLTGIDISANIS+++G+I YE KNL K  N+ + KTH VTFIAEN  GVSK+SYLIR+ ENP FI+YL DF+C +NC +  +H FKC+I E EYKK GF  KYVW++NGLS+ N   G+    +L++N DTIT+KP KS N  + + M   FS S LSC+V I  + N  +  Y++D +PN++  L+A + LQ N ++ + TS  +P+++S IV V +V L LYFC + SG+TYNVDQ      +DPE E  DN I+QP+ ++ ETNV   ++LS N   +    SD  EL+ Y++D   FNE+     Q A D  + KI N
Sbjct:    4 LMLFYFIPSIFGLEKFLQFTPHKDVRERRTSYQFNELSINYDAYLDSQVLIKYLLHYTYAS-NNVTFYCHVKPLDKNYKITKAYFCKKGSLTTQEDCYEIYKKTHEISFGFHFNFSIIFDSTEGMIIRLSIRGYHTFRRARPFHGFYYCKLYNILGSISSNYAEIQDHEFYRLRWTLLFDYRFNFDNDVR-RTA-----HFTSESFPFYILCCNAILKYEKNVPKWLNYDLFSQQLEWRFCRPFHRNRRCLMN----NEANYTFLEDFFHCYQFPNGSIVLMGLKRTDYRESGLLCSIDTSDDPQYLSEYFFKNETR-WQYIYYYALNSYRRKIKFLTETDFNITTREGIYDNKTRFKLYALYVSNPDPKSIAYEWRKDNARLPSTFTGTSHELLFPIEIYDSDSGLYELTVSQSKPPDNATFRYKVTISCPPKLKDRSTRPSVIYSLDDFFPRLSLSFERDITNLSLEINNIPIDVLSETNKENDLKRLFLKYEFLTGIDISANISVSQGLIEYEVKNLTKNLNTSEGKTHIVTFIAENPTGVSKISYLIRILENPKFIHYLKDFSCINNCSNQDKHIFKCAIEELEYKKIGFLTKYVWSLNGLSL-NYVKGHEQMIYLDINRDTITLKPFKSENPIRDQRMTRLFSNSILSCKVII--SFNNKDIRYNSDNHPNVKSLLEAKIKLQENQINVSLTSWMIPLILSFIVMVAVVTLTLYFCQKFSGKTYNVDQNGSTSANDPEIECIDNVIYQPHRKNLETNVGGQTYLSCN---TYDNISDKEELNAYELDSALFNEDRFISFQNAIDGGRFKIIN 802          
BLAST of Bravo_FIGEY domain-containing protein vs. Planmine SMEST
Match: SMESG000064379.1 (SMESG000064379.1)

HSP 1 Score: 645.58 bits (1664), Expect = 0.000e+0
Identity = 379/816 (46.45%), Postives = 506/816 (62.01%), Query Frame = 2
Query:   41 LLFYFIYSISGLEKFLQFIPHKDVTIRKSVYELDEDPVSVDAFQSSQVLIKYIQSIRDLNFPEFKFYCHVKELETNFKISNAYLCKKQSIMGHEDCHLISKDTQKIKFQEHMQFETKFDPGTGIIADLNMDISAVKSRLQPFDGFYYCKLENHMGSISSNYIEIQDFEFYKTKLS-------NFINQISVRFAPSPINDFTSDSFPIYLDCGKLVGNYEENIPKWANKDLLSS-FTWQLCPDATSGIQCFSSVVDTQKKSSRPLEEFIDYYQFPNGTAVLLGIKGNDYIKAGLFCGL-KAIVPKMYSAYLVKTKNALWRPISYTVVGKYNKKIKQLSAENTEITIREGKY-RSSRFKLYALYVGNPDHTKIKAEWKKDTYSLPSTFKQGPYQLVFPIEISESYSGKYDLKIIQSEPFDTVTFRYNVKVVSSPKLKDNIKQQSVFYVTVDKSAQISVFFERDITKLSLEVNNMPIDLLTAKAKEKSVKNLCYKFPFLTGIDISANISLNEGMIYYEAKNLIKRSNSPQAKTHTVTFIAENDIGVSKVSYLIRVFENPTFIYYLNDFNCTDNCMDDQRHDFKCSINETEYKKEGFTIKYVWTINGLSVDNMQSGYAIKSFLEVNNDTITIKPIKSANLEKYKEMLGYFSKSNLSCRVDIVPTSNPSETFYSTDQNPNLRPYLQAMVNLQANSVDTASTSRYXXXXXXXXXXXXXXXXXXYFCLRGSGETYNVDQKERAHGHDPEKEIRDNEIFQPYERDHETNVVQPSHLSFNXXXXXXXXXXXXELDVYDIDPGKFNEEGSFIGQYASDPRKNKINN 2458
            +LFYFI SI GLEKFLQF PHKDV  R++ Y+ +E  ++ DA+  SQVLIKY+      +     FYCHVK L+ N+KI+ AY CKK S+   EDC+ I K T +I F  H  F   FD   G+I  L++       R +PF GFYYCKL N +GSISSNY EIQD EFY+ + +       NF N +  R A      FTS+SFP Y+ C   +  YE+N+PKW N DL S    W+ C       +C  +     + +   LE+F   YQFPNG+ VL+G+K  DY ++GL C +  +  P+  S Y  K +   W+ I Y  +  Y +KIK L+  +  IT REG Y   +RFKLYALYV NPD   I  EW+KD   LPSTF    ++L+FPIEI +S SG Y+L + QS+P D  TFRY V +   PKLKD   + SV Y   D   ++S+ FERDIT LSLE+NN+PID+L+   KE  +K L  K+ FLTGIDISANIS+++G+I YE KNL K  N+ + KTH VTFIAEN  GVSK+SYLIR+ ENP FI+YL DF+C +NC +  +H FKC+I E EYKK GF  KYVW++NGLS+ N   G+    +L++N DTIT+KP KS N  + + M   FS S LSC+V I  + N  +  Y++D +PN++  L+A + LQ N ++ + TS  +P+++S IV V +V L LYFC + SG+TYNVDQ      +DPE E  DN I+QP+ ++ ETNV   ++LS N   +    SD  EL+ Y++D   FNE+     Q A D  + KI N
Sbjct:    1 MLFYFIPSIFGLEKFLQFTPHKDVRERRTSYQFNELSINYDAYLDSQVLIKYLLHYTYAS-NNVTFYCHVKPLDKNYKITKAYFCKKGSLTTQEDCYEIYKKTHEISFGFHFNFSIIFDSTEGMIIRLSIRGYHTFRRARPFHGFYYCKLYNILGSISSNYAEIQDHEFYRLRWTLLFDYRFNFDNDVR-RTA-----HFTSESFPFYILCCNAILKYEKNVPKWLNYDLFSQQLEWRFCRPFHRNRRCLMN----NEANYTFLEDFFHCYQFPNGSIVLMGLKRTDYRESGLLCSIDTSDDPQYLSEYFFKNETR-WQYIYYYALNSYRRKIKFLTETDFNITTREGIYDNKTRFKLYALYVSNPDPKSIAYEWRKDNARLPSTFTGTSHELLFPIEIYDSDSGLYELTVSQSKPPDNATFRYKVTISCPPKLKDRSTRPSVIYSLDDFFPRLSLSFERDITNLSLEINNIPIDVLSETNKENDLKRLFLKYEFLTGIDISANISVSQGLIEYEVKNLTKNLNTSEGKTHIVTFIAENPTGVSKISYLIRILENPKFIHYLKDFSCINNCSNQDKHIFKCAIEELEYKKIGFLTKYVWSLNGLSL-NYVKGHEQMIYLDINRDTITLKPFKSENPIRDQRMTRLFSNSILSCKVII--SFNNKDIRYNSDNHPNVKSLLEAKIKLQENQINVSLTSWMIPLILSFIVMVAVVTLTLYFCQKFSGKTYNVDQNGSTSANDPEIECIDNVIYQPHRKNLETNVGGQTYLSCN---TYDNISDKEELNAYELDSALFNEDRFISFQNAIDGGRFKIIN 798          
BLAST of Bravo_FIGEY domain-containing protein vs. Planmine SMEST
Match: SMESG000064377.1 (SMESG000064377.1)

HSP 1 Score: 322.783 bits (826), Expect = 6.332e-104
Identity = 175/288 (60.76%), Postives = 193/288 (67.01%), Query Frame = 2
Query:  197 IQSIRDLNFPEFKFYCHVKELETNFKISNAYLCKKQSIMGHEDCHLISKDTQKIKFQEHMQFETKFDPGTGIIADLNMDISAVKSRLQPFDGFYYCKLENHMGSISSNYIEIQDFEFYKTKLSNFINQISVRFAPSPINDFTSDSFPIYLDCGKLVGNYEENIPKWANKDLLSSFTWQLCPDATSGIQCFSSVVDTQKKSSRPLEEFIDYYQFPNGTAVLLGIKGNDYIKAGLFCGLKAIVPKMYSAYLVKTKNALWRPISYTVVGKYNKKIKQLSAENTEITIREGK 1060
            +QSIRDLNFP FKFYCHVKELETNFKISNAYLCKKQSIM HEDCHLISKDTQKIKFQEHMQF+TKFDPGTGIIADLNMDISAVKSRLQPFDGFYYC                        KL N +  IS  +    I DF                 Y+ N                    ATSGIQCFS+VVD+QKKSSRPLEE I+YYQFPNGTAVLLGI  N +I++G+FCG       +Y  YLVKT N  WRP +YT+VGKYN KIKQLS +NTE+ IR+GK
Sbjct:    1 MQSIRDLNFPVFKFYCHVKELETNFKISNAYLCKKQSIMDHEDCHLISKDTQKIKFQEHMQFKTKFDPGTGIIADLNMDISAVKSRLQPFDGFYYC------------------------KLENHMGSISSNYIE--IQDFEF---------------YKTN--------------------ATSGIQCFSNVVDSQKKSSRPLEELINYYQFPNGTAVLLGINRNKFIQSGIFCGFNRSEAAVYYDYLVKT-NLSWRPNNYTIVGKYNIKIKQLSPKNTEVIIRDGK 226          
The following BLAST results are available for this feature:
BLAST of Bravo_FIGEY domain-containing protein vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Bravo_FIGEY domain-containing protein vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Bravo_FIGEY domain-containing protein vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Bravo_FIGEY domain-containing protein vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Bravo_FIGEY domain-containing protein vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Bravo_FIGEY domain-containing protein vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Bravo_FIGEY domain-containing protein vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Bravo_FIGEY domain-containing protein vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A3Q0KT091.599e-8529.98Putative immunoglobulin domain superfamily (Sensor... [more]
G4V9E12.082e-8529.93Putative immunoglobulin domain superfamily (Sensor... [more]
A0A5K3EMV64.300e-7627.69Uncharacterized protein OS=Mesocestoides corti OX=... [more]
A0A564YQA64.600e-7628.14Bravo_FIGEY domain-containing protein OS=Hymenolep... [more]
A0A4Z2CS033.692e-7428.85E3 ubiquitin-protein ligase TRIM56 (Fragment) OS=S... [more]
back to top
BLAST of Bravo_FIGEY domain-containing protein vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Bravo_FIGEY domain-containing protein vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Bravo_FIGEY domain-containing protein vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Bravo_FIGEY domain-containing protein vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Bravo_FIGEY domain-containing protein vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Bravo_FIGEY domain-containing protein vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000064374.10.000e+0100.00SMESG000064374.1[more]
SMESG000064374.10.000e+0100.00SMESG000064374.1[more]
SMESG000064379.10.000e+046.51SMESG000064379.1[more]
SMESG000064379.10.000e+046.45SMESG000064379.1[more]
SMESG000064377.16.332e-10460.76SMESG000064377.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30015763 ID=SMED30015763|Name=Bravo_FIGEY domain-containing protein|organism=Schmidtea mediterranea sexual|type=transcript|length=2774bp
ATTTTTTAATTAGTATTATATGATGAATAAACAATCGCTCTTATTGTTTT
ATTTTATTTATTCAATTTCCGGCCTAGAAAAATTCCTCCAGTTCATACCT
CATAAAGATGTGACTATCAGAAAATCTGTGTACGAATTAGACGAAGATCC
AGTTAGTGTCGATGCATTTCAAAGCAGTCAAGTTTTGATAAAATACATTC
AATCTATCCGAGATTTGAATTTTCCAGAGTTTAAATTTTATTGCCATGTA
AAGGAATTAGAGACAAATTTTAAAATTAGCAATGCATATTTATGCAAGAA
ACAGTCCATTATGGGCCATGAAGATTGCCATCTAATATCGAAGGATACAC
AGAAAATAAAATTTCAAGAACACATGCAATTCGAAACCAAATTTGATCCT
GGAACCGGGATAATTGCCGACCTAAACATGGATATTAGTGCAGTTAAATC
ACGACTCCAACCATTTGATGGGTTTTATTATTGTAAATTGGAAAATCACA
TGGGATCAATCTCTTCTAATTATATTGAGATTCAAGATTTTGAGTTCTAT
AAAACAAAATTATCAAATTTTATTAATCAGATATCAGTAAGATTTGCACC
TAGTCCAATCAATGATTTCACGTCCGACTCGTTTCCAATTTATCTTGATT
GCGGCAAACTTGTAGGAAATTATGAAGAAAATATACCGAAATGGGCAAAC
AAAGATTTGTTATCATCATTTACTTGGCAATTATGTCCAGATGCTACCAG
TGGAATCCAGTGTTTCTCAAGTGTAGTTGATACCCAGAAAAAATCATCCA
GACCCTTGGAAGAATTCATAGATTATTATCAATTTCCAAATGGGACTGCT
GTATTATTGGGAATTAAAGGAAACGATTATATAAAAGCAGGACTTTTTTG
CGGTCTCAAAGCAATTGTGCCAAAAATGTATTCAGCTTATCTCGTTAAAA
CAAAAAATGCGTTATGGCGACCAATTAGTTACACGGTTGTGGGTAAATAC
AATAAAAAAATAAAACAGCTCAGTGCAGAGAATACCGAAATAACTATAAG
AGAAGGAAAGTATAGGTCTTCAAGGTTTAAACTTTACGCTTTATATGTCG
GTAACCCAGATCACACAAAAATTAAGGCTGAATGGAAAAAAGATACTTAC
AGTTTACCTTCGACTTTCAAACAAGGACCTTATCAATTGGTTTTTCCAAT
AGAAATAAGTGAATCATATTCGGGTAAATATGATCTTAAGATCATTCAAA
GTGAACCCTTTGACACTGTAACATTTAGATATAATGTTAAGGTTGTCAGT
TCACCAAAACTGAAGGATAATATTAAACAGCAATCAGTTTTTTATGTCAC
CGTTGATAAATCTGCCCAAATTTCCGTGTTTTTTGAACGAGACATAACGA
AATTGAGTCTTGAAGTTAATAATATGCCAATTGATTTATTGACAGCAAAA
GCTAAGGAAAAGAGCGTAAAAAATCTTTGTTATAAATTTCCTTTCCTAAC
AGGAATTGATATATCAGCAAACATTTCTCTGAATGAAGGAATGATCTATT
ATGAGGCGAAAAATCTGATCAAAAGGTCGAATTCCCCTCAAGCTAAAACC
CACACAGTGACATTTATTGCTGAAAATGATATTGGAGTTTCCAAAGTTTC
ATATTTAATTCGAGTTTTTGAAAATCCTACATTCATCTATTATTTAAATG
ACTTCAACTGTACGGATAATTGCATGGATGATCAGAGACATGATTTTAAA
TGTTCTATTAATGAAACTGAGTATAAAAAGGAAGGATTCACAATTAAATA
TGTGTGGACAATAAATGGACTAAGTGTAGATAATATGCAGTCAGGATACG
CCATAAAATCTTTCCTAGAAGTAAATAATGATACAATTACTATCAAACCA
ATTAAAAGTGCCAATTTGGAGAAATATAAGGAAATGTTGGGATATTTTAG
CAAATCGAATCTCAGTTGCAGAGTAGACATTGTCCCGACAAGTAATCCGT
CAGAAACATTTTATAGCACTGATCAGAATCCCAACCTCAGACCATATTTG
CAGGCCATGGTCAACCTGCAAGCGAACTCCGTTGATACAGCATCAACCTC
TCGATATTTGCCAATAGTCATATCATTGATAGTGACTGTTATCATTGTTG
TACTAATTTTGTACTTTTGTTTACGTGGTTCAGGAGAAACATACAACGTT
GACCAAAAAGAACGCGCTCATGGTCATGATCCGGAAAAAGAAATACGAGA
CAACGAAATTTTTCAACCTTATGAACGGGACCATGAAACCAATGTTGTGC
AACCGAGCCATTTATCCTTCAATGACGATGACAGTGTCGGTGTAGGAAGT
GACGATGGCGAGTTAGATGTTTACGATATAGATCCAGGAAAATTCAATGA
GGAAGGATCTTTTATAGGACAATATGCATCGGATCCTAGAAAAAATAAAA
TAAACAATTCTTAATGATAATTATGTATTTTTTAAGAAACATTTATTTGA
ACTTTAGAATTTTAGAAAAAAACAACAATTTTCGTCATTGCTAAACAATC
CAGTCTCGGTGAAATGTTACGCAATTGTTACAATGATTCTCTGAGATTAT
TATATTAAGAAATCAAATATTCTTTATGAATCTCTGCTCTTATTTTCATG
TTTTTAAGAAAATTTATTTATTAACATTTATTAGAAAGAATGTAGCTCTT
ACTAATTGAAAATCGTAATCAGATTTTCGTATAATACTATTTTATTTGGT
TCTGTATATTTATATTCCTTGTAC
back to top

protein sequence of SMED30015763-orf-1

>SMED30015763-orf-1 ID=SMED30015763-orf-1|Name=SMED30015763-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=815bp
MMNKQSLLLFYFIYSISGLEKFLQFIPHKDVTIRKSVYELDEDPVSVDAF
QSSQVLIKYIQSIRDLNFPEFKFYCHVKELETNFKISNAYLCKKQSIMGH
EDCHLISKDTQKIKFQEHMQFETKFDPGTGIIADLNMDISAVKSRLQPFD
GFYYCKLENHMGSISSNYIEIQDFEFYKTKLSNFINQISVRFAPSPINDF
TSDSFPIYLDCGKLVGNYEENIPKWANKDLLSSFTWQLCPDATSGIQCFS
SVVDTQKKSSRPLEEFIDYYQFPNGTAVLLGIKGNDYIKAGLFCGLKAIV
PKMYSAYLVKTKNALWRPISYTVVGKYNKKIKQLSAENTEITIREGKYRS
SRFKLYALYVGNPDHTKIKAEWKKDTYSLPSTFKQGPYQLVFPIEISESY
SGKYDLKIIQSEPFDTVTFRYNVKVVSSPKLKDNIKQQSVFYVTVDKSAQ
ISVFFERDITKLSLEVNNMPIDLLTAKAKEKSVKNLCYKFPFLTGIDISA
NISLNEGMIYYEAKNLIKRSNSPQAKTHTVTFIAENDIGVSKVSYLIRVF
ENPTFIYYLNDFNCTDNCMDDQRHDFKCSINETEYKKEGFTIKYVWTING
LSVDNMQSGYAIKSFLEVNNDTITIKPIKSANLEKYKEMLGYFSKSNLSC
RVDIVPTSNPSETFYSTDQNPNLRPYLQAMVNLQANSVDTASTSRYLPIV
ISLIVTVIIVVLILYFCLRGSGETYNVDQKERAHGHDPEKEIRDNEIFQP
YERDHETNVVQPSHLSFNDDDSVGVGSDDGELDVYDIDPGKFNEEGSFIG
QYASDPRKNKINNS*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000099neuron
PLANA:0000101muscle cell
PLANA:0000140anterior region of the whole animal
PLANA:0000418head
Vocabulary: INTERPRO
TermDefinition
IPR026966Neurofascin/L1/NrCAM_C
Vocabulary: cellular component
TermDefinition
GO:0016020membrane
GO:0016021integral component of membrane
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR026966Neurofascin/L1/NrCAM, C-terminal domainPFAMPF13882Bravo_FIGEYcoord: 721..804
e-value: 3.1E-16
score: 60.5
NoneNo IPR availablePANTHERPTHR13817TITINcoord: 685..809
NoneNo IPR availablePANTHERPTHR13817:SF108CELL ADHESION MOLECULE L1-LIKE Acoord: 685..809
NoneNo IPR availableSIGNALP_EUKSignalP-noTMSignalP-noTMcoord: 1..18
score: 0.501
NoneNo IPR availableTMHMMTMhelixcoord: 696..718