alanine--tRNA ligase, cytoplasmic

Overview
Namealanine--tRNA ligase, cytoplasmic
Smed IDSMED30015750
Length (bp)3082
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of alanine--tRNA ligase, cytoplasmic (SMED30015750) t-SNE clustered cells

Violin plots show distribution of expression levels for alanine--tRNA ligase, cytoplasmic (SMED30015750) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of alanine--tRNA ligase, cytoplasmic (SMED30015750) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for alanine--tRNA ligase, cytoplasmic (SMED30015750) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30015750

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 3

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
X2 cellSMED30015750SMESG000001618.1 SmedASXL_011798SmedAsxl_ww_GCZZ01PMID:26114597
Zhu et al., 2015
FACS sorted cell population asexual adult RNA-sequencing evidence
parenchymal cellSMED30015750SMESG000001618.1 dd_Smed_v4_4233_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
epidermisSMED30015750SMESG000001618.1 dd_Smed_v4_4233_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of alanine--tRNA ligase, cytoplasmic vs. Ensembl Human
Match: AARS1 (alanyl-tRNA synthetase 1 [Source:HGNC Symbol;Acc:HGNC:20])

HSP 1 Score: 1029.24 bits (2660), Expect = 0.000e+0
Identity = 505/969 (52.12%), Postives = 672/969 (69.35%), Query Frame = 2
Query:   83 NSSTIRREFVDFFKEKSHLNIHSSSTIPLNDPTLLFSNAGMNQFKKIFLGTADPNSDMAKWKRVANSQKCIRAGGKHNDLDDVGKDVYHHTFFEMLGNWSFGDYFKKEAISWAWELLTKVWGLPKDRFYVTYFGGNTELGLESDEEAKDIWLSMGIDASRVLPFGMKDNFWEMGETGPCGPCSEIHFDRIGNRDASELVNADDPDVLEVWNLVFIQYNRELDRSLKSLPHKHVDTGMGFERIVSVIQNKSSNYDTDLFQPLFDRIQAETNCRSYQGKLGDDDEGGIDMAYRVLADHARTLTIALSDGGQPQNTGRGYVLRRILRRAVRYAVDKLHAKPGMFSNLVDTVVDLLGEAFPEIKHSKENVKQIINEEESQFMKTLKRGKKMFDKSLEDFKQIKTGQTFLPGRIAWMLYDTYGYPLDLTALMCDESGIKINMEEYETCRKLAQETSQGSGDTVYLSVDLDVHDIDKLQTKKLQPTDDIPKFKYNADENGNYQLECHQATVLAIKIKEGFXXXXXXXXXXXGLVMDSTNFYAESGGQMYDTGSMVLND---VEQTEFEVATVKLCGGFVLHIGRVLNGSLKVGDRLKLEVDDARRKCLMQNHTGTHVLNYALREIVGDVDQKGSLVAPDKLRFDFSAKGQVDNEQLRKVETICKSIINEKKQVYVKEVALSIAKEIQGIRAVFGETYPDPVRVVSIGVPVDDLINSINEPKPSLNASVEFCGGTHLTNSHHISELVITSESAISKGVRRIFALTGAEAEKACKIASQMECEVGKLENTFSKTMEDSRIRDLLNSIKDMKRELDEALISYWFKNSLRARLESLRKELDSLEKTKKELLQANLMEQAWPVIENAVSHNKKFLVIRFLDGADQTSINKAFREIQKKHKSLSLLGYSVDVTSNKIECKASVAKEMVTASFNAKNWIEKVTEIVGGKSGGSDQSAQVTGVALMNLHGLEEMANKFANMNI 2980
             +S IR+ F+DFFK   H  +HSS+TIPL+DPTLLF+NAGMNQFK IFL T DP+  MAK  R AN+QKCIRAGGKHNDLDDVGKDVYHHTFFEMLG+WSFGDYFK+ A   A ELLT+ +G+P +R YVTYFGG+   GLE+D E K IW ++G+D +++LP  MKDNFWEMG+TGPCGPCSEIH+DRIG RDA+ LVN DDP+VLE+WNLVFIQYNRE D  LK LP K +DTGMG ER+VSV+QNK SNYDTDLF P F+ IQ  T  R Y GK+G +D  GIDMAYRVLADHART+T+AL+DGG+P NTGRGYVLRRILRRAVRYA +KL+A  G F+ LVD VV  LG+AFPE+K   + VK IINEEE QF+KTL RG+++ D+ ++     KT    +PG  AW+LYDTYG+P+DLT L+ +E G+ ++M+ +E  RKLAQ  SQG G      + LD++ I++L+ + L+ TDD PK+ Y+ D +G+Y  E   ATV+A++ +E       S     G+V+D T FYAE GGQ+YD G +V  D    ++TEF V   ++ GG+VLHIG +  G LKVGD++ L +D+ RR+ +M NHT TH+LN+ALR ++G+ DQKGSLVAPD+LRFDF+AKG +  +Q++K E I   +I   K VY ++  L+ AK IQG+RAVF ETYPDPVRVVSIGVPV +L++  + P  SL  SVEFCGGTHL NS H    VI +E AI+KG+RRI A+TGAEA+KA + A  ++  +  +E         +  +D+   I D+   L  A+I  W K+ LR  L+SL+K +D L++  K  +Q  ++E+    I++  + N+  +++    GA   ++N+A +  +      S + ++VD  + KI C   V +        A  W+++V+ ++ GK GG D SAQ TG  +  L    ++A  FA + +
Sbjct:    6 TASEIRQRFIDFFKRNEHTYVHSSATIPLDDPTLLFANAGMNQFKPIFLNTIDPSHPMAKLSRAANTQKCIRAGGKHNDLDDVGKDVYHHTFFEMLGSWSFGDYFKELACKMALELLTQEFGIPIERLYVTYFGGDEAAGLEADLECKQIWQNLGLDDTKILPGNMKDNFWEMGDTGPCGPCSEIHYDRIGGRDAAHLVNQDDPNVLEIWNLVFIQYNREADGILKPLPKKSIDTGMGLERLVSVLQNKMSNYDTDLFVPYFEAIQKGTGARPYTGKVGAEDADGIDMAYRVLADHARTITVALADGGRPDNTGRGYVLRRILRRAVRYAHEKLNASRGFFATLVDVVVQSLGDAFPELKKDPDMVKDIINEEEVQFLKTLSRGRRILDRKIQSLGDSKT----IPGDTAWLLYDTYGFPVDLTGLIAEEKGLVVDMDGFEEERKLAQLKSQGKGAGGEDLIMLDIYAIEELRARGLEVTDDSPKYNYHLDSSGSYVFENTVATVMALR-REKMFVEEVSTGQECGVVLDKTCFYAEQGGQIYDEGYLVKVDDSSEDKTEFTVKNAQVRGGYVLHIGTIY-GDLKVGDQVWLFIDEPRRRPIMSNHTATHILNFALRSVLGEADQKGSLVAPDRLRFDFTAKGAMSTQQIKKAEEIANEMIEAAKAVYTQDCPLAAAKAIQGLRAVFDETYPDPVRVVSIGVPVSELLDDPSGPAGSLT-SVEFCGGTHLRNSSHAGAFVIVTEEAIAKGIRRIVAVTGAEAQKALRKAESLKKCLSVMEAKVKAQTAPN--KDVQREIADLGEALATAVIPQWQKDELRETLKSLKKVMDDLDRASKADVQKRVLEKTKQFIDS--NPNQPLVILEMESGASAKALNEALKLFKMHSPQTSAMLFTVDNEAGKITCLCQVPQNAANRGLKASEWVQQVSGLMDGKGGGKDVSAQATGKNVGCLQEALQLATSFAQLRL 963          
BLAST of alanine--tRNA ligase, cytoplasmic vs. Ensembl Human
Match: AARS2 (alanyl-tRNA synthetase 2, mitochondrial [Source:HGNC Symbol;Acc:HGNC:21022])

HSP 1 Score: 727.243 bits (1876), Expect = 0.000e+0
Identity = 393/949 (41.41%), Postives = 588/949 (61.96%), Query Frame = 2
Query:  107 FVDFFKEK-SHLNIHSSSTIPLNDPTLLFSNAGMNQFKKIFLGTADPNSDMAKWKRVANSQKCIRAGGKHNDLDDVGKDVYHHTFFEMLGNWSFG-DYFKKEAISWAWELLTKVWGLPKDRFYVTYFGGNTELGLESDEEAKDIWLSMGIDASRVLPFGMKDNFWEMGETGPCGPCSEIHFDRIGNRDASELVNADDPDVLEVWNLVFIQYNRELDRSLKSLPHKHVDTGMGFERIVSVIQNKSSNYDTDLFQPLFDRIQAETNCRSYQGKLGDDDEGGIDMAYRVLADHARTLTIALSDGGQPQNTGRGYVLRRILRRAVRYAVDKLHAKPGMFSNLVDTVVDLLGEAFPEIKHSKENVKQIINEEESQFMKTLKRGKKMFDKSLEDFKQIKTGQTFLPGRIAW--MLYDTYGYPLDLTALMCDESGIKINMEEYETCRKLAQETSQGSGDTVYL----SVDLDVHDIDKLQTKKLQPTDDIPKFKYNADENGNYQLECHQATVLAIKIKEGFXXXXXXXXXXXGLVMDSTNFYAESGGQMYDTGSMVLNDVEQTEFEVATVKLCGGFVLHIGRVLNGSLKVGDRLKLEVDDARRKCLMQNHTGTHVLNYALREIVGD-VDQKGSLVAPDKLRFDFSAKGQVDNEQLRKVETICKSIINEKKQVYVKEVALSIAKEIQGIRAVFGETYPDPVRVVSIGVPVDDLINSINEPKPSLNASVEFCGGTHLTNSHHISELVITSESAISKGVRRIFALTGAEAEKACKIASQMECEVGKLENTFSKTMEDSRIRDLLNSIKDMKR---ELDEALISYWFKNSLRARLESLRKELDSLEKTKKELLQANLMEQAWPVIENAVSHNKKFLVIRFLDGADQTSINKAFREIQKKHKSLSLLGYSVDVTSNKIECKASVAKEMVTASFNAKNWIEKVTEIVGGKSGGSDQSAQVTG 2917
            F++FF+++  H  + S+S  P  DP+LLF NAGMNQFK IFLGT DP S+MA ++RVANSQKC+RAGG HNDL+DVG+D+ HHTFFEMLGNW+FG +YFK+EA + AWELLT+V+G+P++R +++YF G+ + GL+ D E +DIWLS+G+ ASRVL FG ++NFWEMG+TGPCGPC+EIH+D  G   A +LV        E+WNLVF+Q+NRE D SL+ LP +HVDTGMG ER+V+V+Q K S YDTDLF PL + IQ       Y G++G  DEG  D AYRV+ADH RTL++ +SDG  P  +G   VLRRILRRAVR++++ L A PG   +LV  VV+ LG+A+PE++ +   +  +++E+E+ F+ +L+RG+++ D++L             P  +AW   L    G PLD+  LM +E G++++    E   +LAQE +Q             + LDVH + +LQ + + PTDD PK+ Y+   +G+Y+    +A VL +  ++G   +   +    GL++D TNFYAE GGQ  D G +V    E   F VA  ++CGGF+LH   V    L++GD+++L VD+A R   M  HT TH+LN+ALR+ +G   +Q+GS + P++LR D + +  +  EQLR VE   +  + + + VY++EV L++  ++ G+R+   E YPDPVRVVS+GVPV   ++  ++   +L  SVE C GTHL  +  + +LVI  +  +SKG  R+ A+TG +A++A ++   +  EV       S    D  + + L   KD+ R    ++ A++  W +  L A ++ L++  ++  + K ++ QA    Q     E    H+K  L++  +     + + K  R++ ++  S S+L  S      K+ C   VA+  +  +F A+ W   V   +GGK+ GS   AQ TG
Sbjct:   46 FLNFFRDRHGHRLVPSASVRPRGDPSLLFVNAGMNQFKPIFLGTVDPRSEMAGFRRVANSQKCVRAGGHHNDLEDVGRDLSHHTFFEMLGNWAFGGEYFKEEACNMAWELLTQVYGIPEERLWISYFDGDPKAGLDPDLETRDIWLSLGVPASRVLSFGPQENFWEMGDTGPCGPCTEIHYDLAGGVGAPQLV--------ELWNLVFMQHNREADGSLQPLPQRHVDTGMGLERLVAVLQGKHSTYDTDLFSPLLNAIQQGCRAPPYLGRVGVADEGRTDTAYRVVADHIRTLSVCISDGIFPGMSGPPLVLRRILRRAVRFSMEILKAPPGFLGSLVPVVVETLGDAYPELQRNSAQIANLVSEDEAAFLASLERGRRIIDRTLRTLGP----SDMFPAEVAWSLSLCGDLGLPLDMVELMLEEKGVQLDSAGLE---RLAQEEAQHRARQAEPVQKQGLWLDVHALGELQRQGVPPTDDSPKYNYSLRPSGSYEFGTCEAQVLQLYTEDGTAVASVGKGQRCGLLLDRTNFYAEQGGQASDRGYLVRAGQEDVLFPVARAQVCGGFILHEA-VAPECLRLGDQVQLHVDEAWRLGCMAKHTATHLLNWALRQTLGPGTEQQGSHLNPEQLRLDVTTQTPLTPEQLRAVENTVQEAVGQDEAVYMEEVPLALTAQVPGLRS-LDEVYPDPVRVVSVGVPVAHALDPASQ--AALQTSVELCCGTHLLRTGAVGDLVIIGDRQLSKGTTRLLAVTGEQAQQARELGQSLAQEVKAATERLSLGSRD--VAEALRLSKDIGRLIEAVETAVMPQWQRRELLATVKMLQRRANTAIR-KLQMGQAAKKTQ-----ELLERHSKGPLIVDTVSAESLSVLVKVVRQLCEQAPSTSVLLLSPQ-PMGKVLCACQVAQGAMP-TFTAEAWALAVCSHMGGKAWGSRVVAQGTG 965          
BLAST of alanine--tRNA ligase, cytoplasmic vs. Ensembl Human
Match: AARS1 (alanyl-tRNA synthetase 1 [Source:HGNC Symbol;Acc:HGNC:20])

HSP 1 Score: 254.603 bits (649), Expect = 1.151e-76
Identity = 126/250 (50.40%), Postives = 175/250 (70.00%), Query Frame = 2
Query: 1742 EQTEFEVATVKLCGGFVLHIGRVLNGSLKVGDRLKLEVDDARRKCLMQNHTGTHVLNYALREIVGDVDQKGSLVAPDKLRFDFSAKGQVDNEQLRKVETICKSIINEKKQVYVKEVALSIAKEIQGIRAVFGETYPDPVRVVSIGVPVDDLINSINEPKPSLNASVEFCGGTHLTNSHHISELVITSESAISKGVRRIFALTGAEAEKACKIASQMECEVGKLENTFSKTMEDSRIRDLLNSIKDMKREL 2491
            ++TEF V   ++ GG+VLHIG +  G LKVGD++ L +D+ RR+ +M NHT TH+LN+ALR ++G+ DQKGSLVAPD+LRFDF+AKG +  +Q++K E I   +I   K VY ++  L+ AK IQG+RAVF ETYPDPVRVVSIGVPV +L++  + P  SL  SVEFCGGTHL NS H    VI +E AI+KG+RRI A+TGAEA+KA + A  ++  +  +E         ++++      KD++RE+
Sbjct:    6 DKTEFTVKNAQVRGGYVLHIGTIY-GDLKVGDQVWLFIDEPRRRPIMSNHTATHILNFALRSVLGEADQKGSLVAPDRLRFDFTAKGAMSTQQIKKAEEIANEMIEAAKAVYTQDCPLAAAKAIQGLRAVFDETYPDPVRVVSIGVPVSELLDDPSGPAGSLT-SVEFCGGTHLRNSSHAGAFVIVTEEAIAKGIRRIVAVTGAEAQKALRKAESLKKCLSVME---------AKVKAQTAPNKDVQREI 244          
BLAST of alanine--tRNA ligase, cytoplasmic vs. Ensembl Celegans
Match: aars-2 (Alanine--tRNA ligase, cytoplasmic [Source:UniProtKB/Swiss-Prot;Acc:O01541])

HSP 1 Score: 986.097 bits (2548), Expect = 0.000e+0
Identity = 474/969 (48.92%), Postives = 664/969 (68.52%), Query Frame = 2
Query:   86 SSTIRREFVDFFKEK-SHLNIHSSSTIPLNDPTLLFSNAGMNQFKKIFLGTADPNSDMAKWKRVANSQKCIRAGGKHNDLDDVGKDVYHHTFFEMLGNWSFGDYFKKEAISWAWELLTKVWGLPKDRFYVTYFGGNTELGLESDEEAKDIWLSMGIDASRVLPFGMKDNFWEMGETGPCGPCSEIHFDRIGNRDASELVNADDPDVLEVWNLVFIQYNRELDRSLKSLPHKHVDTGMGFERIVSVIQNKSSNYDTDLFQPLFDRIQAETNCRSYQGKLGDDDEGGIDMAYRVLADHARTLTIALSDGGQPQNTGRGYVLRRILRRAVRYAVDKLHAKPGMFSNLVDTVVDLLGEAFPEIKHSKENVKQIINEEESQFMKTLKRGKKMFDKSLEDFKQIKTGQTFLPGRIAWMLYDTYGYPLDLTALMCDESGIKINMEEYETCRKLAQETSQGSGDTVYLSVDLDVHDIDKLQTKKLQPTDDIPKFKYNADENGN---YQLECHQATVLAIKIKEGFXXXXXXXXXXXGLVMDSTNFYAESGGQMYDTGSMVLNDVEQTEFEVATVKLCGGFVLHIGRVLNGSLKVGDRLKLEVDDARRKCLMQNHTGTHVLNYALREIVGDVDQKGSLVAPDKLRFDFSAKGQVDNEQLRKVETICKSIINEKKQVYVKEVALSIAKEIQGIRAVFGETYPDPVRVVSIGVPVDDLINSINEPKPSLNASVEFCGGTHLTNSHHISELVITSESAISKGVRRIFALTGAEAEKAC----KIASQMECEVGKLENTFSKTMEDSRIRDLLNSIKDMKRELDEALISYWFKNSLRARLESLRKELDSLEKTKKELLQANLMEQAWPVIENAVSHNKKFLVIRFLDGADQTSINKAFREIQKKHKSLSLLGYSVDVTSNKIECKASVAKEMVTASFNAKNWIEKVTEIVGGKSGGSDQSAQVTGVALMNLHGLEEMANKFA 2968
            +S +R  F++FF+EK  H  +HSSS IP +DPTLLF+NAGMNQFK +FLG ADPNSD+AK KR  N+QKCIRAGGKHNDLDDVGKDVYHHT+FEMLGNWSFGDYFKKE I+WAWELLT V+G+P +R YV+ FGG+   G+ +D EA+DIW S+G+   R+L FGMKDNFWEMG+ GPCGPCSEIH+DRIGNRDAS LVNADDP V+E+WNLVFIQ+NRE    LK LP KH+D G+G ER+++V+Q+K+SNYDTD+FQP+F+ I   +  R+Y G +GD+D+ G+DMAYRV+ADH RTLTIALSDGG+P N+GRGYVLRRILRR VRYA +KL+A+PG F++LV  V+ +LGE FPE+      V  IIN+EE QF+KTL RG+ +F ++++   +   G    PG ++W LYDTYG+P DLT LM +E G+ ++   +E  R+ A ETS         ++DLDVH + +LQ K +  TDD PK+ Y     G+   Y+ E     +LAI+ ++G      +  +   +++D TNFYAE GGQ+YD G +   + E  EF V+  ++ GG+++ +G    GS  VGD++    D+ R++ +M+NHTGTHVLNYALR+++ D DQKGSLVAPD++RFDF+ K  +  +Q++K E   + +I+ K QVY K   L  AK+++G+RA+F ETYPDPVRVV++G PV+ L+ +  + +   N +VEFCGGTHL N  HI  +VI SE AI+KG+RRI ALTG EAE+A     ++ +++E E    +          + + L   I+++  E + A + YW K+S+R + ++++K LD   K ++  +   ++ +A  +   AV+     LV  F   A+  +I+ A + ++    + +++ +SV+  S K+ C A V K +V+    A  W+ +V  ++GGK GG D +AQ+TG  +  L    E+A KFA
Sbjct:    6 ASEVRSTFINFFREKKEHTYVHSSSVIPHDDPTLLFANAGMNQFKPLFLGIADPNSDLAKLKRAVNTQKCIRAGGKHNDLDDVGKDVYHHTYFEMLGNWSFGDYFKKEIITWAWELLTTVYGIPAERLYVSVFGGDEANGVPADSEARDIWRSVGVPDERILNFGMKDNFWEMGDVGPCGPCSEIHYDRIGNRDASHLVNADDPMVVEIWNLVFIQFNREEGGVLKPLPAKHIDCGLGLERLIAVMQDKTSNYDTDIFQPIFEAIHKGSGVRAYTGFIGDEDKDGVDMAYRVVADHVRTLTIALSDGGRPDNSGRGYVLRRILRRGVRYASEKLNAQPGFFASLVPVVISILGETFPELSRDPVTVMDIINDEEKQFLKTLSRGRVLFQRAVQSLPE---GTMTFPGDVSWRLYDTYGFPADLTQLMAEEKGLSVDNTAFEEARRKAIETSSAGTGKFRDTLDLDVHALAELQQKGVPTTDDSPKYAYTFTGEGSDAVYKFEPCVGKILAIR-RDGKFVDQLAAGEEGAILLDRTNFYAEQGGQIYDVGVLTKVNDESNEFNVSNCQVRGGYIVLVGSA-EGSFSVGDQVNERFDEDRKQLIMKNHTGTHVLNYALRKVLADSDQKGSLVAPDRMRFDFTNKAGMTVQQVKKAEEYAQQLIDTKGQVYAKNSPLGEAKKVKGLRAMFDETYPDPVRVVAVGTPVEQLLQN-PDAEEGQNTTVEFCGGTHLQNVSHIGRIVIASEEAIAKGIRRIVALTGPEAERAIARADRLTARLEEESKHADKKDELLANKDKFKALQKKIQEIVDEANGAQLPYWRKDSIREKAKAIQKTLDGYTKAQQAAVAEKVLGEAKELA--AVAEQPTVLVHVFAANANSKAIDNALKLLK---DTKAVMAFSVNEDSGKVLCLAKVDKSLVSNGLKANEWVNEVCTVLGGKGGGKDANAQLTGENVDKLDAAVELAQKFA 963          
BLAST of alanine--tRNA ligase, cytoplasmic vs. Ensembl Celegans
Match: aars-2 (Alanine--tRNA ligase, cytoplasmic [Source:UniProtKB/Swiss-Prot;Acc:O01541])

HSP 1 Score: 986.097 bits (2548), Expect = 0.000e+0
Identity = 474/969 (48.92%), Postives = 664/969 (68.52%), Query Frame = 2
Query:   86 SSTIRREFVDFFKEK-SHLNIHSSSTIPLNDPTLLFSNAGMNQFKKIFLGTADPNSDMAKWKRVANSQKCIRAGGKHNDLDDVGKDVYHHTFFEMLGNWSFGDYFKKEAISWAWELLTKVWGLPKDRFYVTYFGGNTELGLESDEEAKDIWLSMGIDASRVLPFGMKDNFWEMGETGPCGPCSEIHFDRIGNRDASELVNADDPDVLEVWNLVFIQYNRELDRSLKSLPHKHVDTGMGFERIVSVIQNKSSNYDTDLFQPLFDRIQAETNCRSYQGKLGDDDEGGIDMAYRVLADHARTLTIALSDGGQPQNTGRGYVLRRILRRAVRYAVDKLHAKPGMFSNLVDTVVDLLGEAFPEIKHSKENVKQIINEEESQFMKTLKRGKKMFDKSLEDFKQIKTGQTFLPGRIAWMLYDTYGYPLDLTALMCDESGIKINMEEYETCRKLAQETSQGSGDTVYLSVDLDVHDIDKLQTKKLQPTDDIPKFKYNADENGN---YQLECHQATVLAIKIKEGFXXXXXXXXXXXGLVMDSTNFYAESGGQMYDTGSMVLNDVEQTEFEVATVKLCGGFVLHIGRVLNGSLKVGDRLKLEVDDARRKCLMQNHTGTHVLNYALREIVGDVDQKGSLVAPDKLRFDFSAKGQVDNEQLRKVETICKSIINEKKQVYVKEVALSIAKEIQGIRAVFGETYPDPVRVVSIGVPVDDLINSINEPKPSLNASVEFCGGTHLTNSHHISELVITSESAISKGVRRIFALTGAEAEKAC----KIASQMECEVGKLENTFSKTMEDSRIRDLLNSIKDMKRELDEALISYWFKNSLRARLESLRKELDSLEKTKKELLQANLMEQAWPVIENAVSHNKKFLVIRFLDGADQTSINKAFREIQKKHKSLSLLGYSVDVTSNKIECKASVAKEMVTASFNAKNWIEKVTEIVGGKSGGSDQSAQVTGVALMNLHGLEEMANKFA 2968
            +S +R  F++FF+EK  H  +HSSS IP +DPTLLF+NAGMNQFK +FLG ADPNSD+AK KR  N+QKCIRAGGKHNDLDDVGKDVYHHT+FEMLGNWSFGDYFKKE I+WAWELLT V+G+P +R YV+ FGG+   G+ +D EA+DIW S+G+   R+L FGMKDNFWEMG+ GPCGPCSEIH+DRIGNRDAS LVNADDP V+E+WNLVFIQ+NRE    LK LP KH+D G+G ER+++V+Q+K+SNYDTD+FQP+F+ I   +  R+Y G +GD+D+ G+DMAYRV+ADH RTLTIALSDGG+P N+GRGYVLRRILRR VRYA +KL+A+PG F++LV  V+ +LGE FPE+      V  IIN+EE QF+KTL RG+ +F ++++   +   G    PG ++W LYDTYG+P DLT LM +E G+ ++   +E  R+ A ETS         ++DLDVH + +LQ K +  TDD PK+ Y     G+   Y+ E     +LAI+ ++G      +  +   +++D TNFYAE GGQ+YD G +   + E  EF V+  ++ GG+++ +G    GS  VGD++    D+ R++ +M+NHTGTHVLNYALR+++ D DQKGSLVAPD++RFDF+ K  +  +Q++K E   + +I+ K QVY K   L  AK+++G+RA+F ETYPDPVRVV++G PV+ L+ +  + +   N +VEFCGGTHL N  HI  +VI SE AI+KG+RRI ALTG EAE+A     ++ +++E E    +          + + L   I+++  E + A + YW K+S+R + ++++K LD   K ++  +   ++ +A  +   AV+     LV  F   A+  +I+ A + ++    + +++ +SV+  S K+ C A V K +V+    A  W+ +V  ++GGK GG D +AQ+TG  +  L    E+A KFA
Sbjct:    6 ASEVRSTFINFFREKKEHTYVHSSSVIPHDDPTLLFANAGMNQFKPLFLGIADPNSDLAKLKRAVNTQKCIRAGGKHNDLDDVGKDVYHHTYFEMLGNWSFGDYFKKEIITWAWELLTTVYGIPAERLYVSVFGGDEANGVPADSEARDIWRSVGVPDERILNFGMKDNFWEMGDVGPCGPCSEIHYDRIGNRDASHLVNADDPMVVEIWNLVFIQFNREEGGVLKPLPAKHIDCGLGLERLIAVMQDKTSNYDTDIFQPIFEAIHKGSGVRAYTGFIGDEDKDGVDMAYRVVADHVRTLTIALSDGGRPDNSGRGYVLRRILRRGVRYASEKLNAQPGFFASLVPVVISILGETFPELSRDPVTVMDIINDEEKQFLKTLSRGRVLFQRAVQSLPE---GTMTFPGDVSWRLYDTYGFPADLTQLMAEEKGLSVDNTAFEEARRKAIETSSAGTGKFRDTLDLDVHALAELQQKGVPTTDDSPKYAYTFTGEGSDAVYKFEPCVGKILAIR-RDGKFVDQLAAGEEGAILLDRTNFYAEQGGQIYDVGVLTKVNDESNEFNVSNCQVRGGYIVLVGSA-EGSFSVGDQVNERFDEDRKQLIMKNHTGTHVLNYALRKVLADSDQKGSLVAPDRMRFDFTNKAGMTVQQVKKAEEYAQQLIDTKGQVYAKNSPLGEAKKVKGLRAMFDETYPDPVRVVAVGTPVEQLLQN-PDAEEGQNTTVEFCGGTHLQNVSHIGRIVIASEEAIAKGIRRIVALTGPEAERAIARADRLTARLEEESKHADKKDELLANKDKFKALQKKIQEIVDEANGAQLPYWRKDSIREKAKAIQKTLDGYTKAQQAAVAEKVLGEAKELA--AVAEQPTVLVHVFAANANSKAIDNALKLLK---DTKAVMAFSVNEDSGKVLCLAKVDKSLVSNGLKANEWVNEVCTVLGGKGGGKDANAQLTGENVDKLDAAVELAQKFA 963          
BLAST of alanine--tRNA ligase, cytoplasmic vs. Ensembl Celegans
Match: aars-2 (Alanine--tRNA ligase, cytoplasmic [Source:UniProtKB/Swiss-Prot;Acc:O01541])

HSP 1 Score: 986.097 bits (2548), Expect = 0.000e+0
Identity = 474/969 (48.92%), Postives = 664/969 (68.52%), Query Frame = 2
Query:   86 SSTIRREFVDFFKEK-SHLNIHSSSTIPLNDPTLLFSNAGMNQFKKIFLGTADPNSDMAKWKRVANSQKCIRAGGKHNDLDDVGKDVYHHTFFEMLGNWSFGDYFKKEAISWAWELLTKVWGLPKDRFYVTYFGGNTELGLESDEEAKDIWLSMGIDASRVLPFGMKDNFWEMGETGPCGPCSEIHFDRIGNRDASELVNADDPDVLEVWNLVFIQYNRELDRSLKSLPHKHVDTGMGFERIVSVIQNKSSNYDTDLFQPLFDRIQAETNCRSYQGKLGDDDEGGIDMAYRVLADHARTLTIALSDGGQPQNTGRGYVLRRILRRAVRYAVDKLHAKPGMFSNLVDTVVDLLGEAFPEIKHSKENVKQIINEEESQFMKTLKRGKKMFDKSLEDFKQIKTGQTFLPGRIAWMLYDTYGYPLDLTALMCDESGIKINMEEYETCRKLAQETSQGSGDTVYLSVDLDVHDIDKLQTKKLQPTDDIPKFKYNADENGN---YQLECHQATVLAIKIKEGFXXXXXXXXXXXGLVMDSTNFYAESGGQMYDTGSMVLNDVEQTEFEVATVKLCGGFVLHIGRVLNGSLKVGDRLKLEVDDARRKCLMQNHTGTHVLNYALREIVGDVDQKGSLVAPDKLRFDFSAKGQVDNEQLRKVETICKSIINEKKQVYVKEVALSIAKEIQGIRAVFGETYPDPVRVVSIGVPVDDLINSINEPKPSLNASVEFCGGTHLTNSHHISELVITSESAISKGVRRIFALTGAEAEKAC----KIASQMECEVGKLENTFSKTMEDSRIRDLLNSIKDMKRELDEALISYWFKNSLRARLESLRKELDSLEKTKKELLQANLMEQAWPVIENAVSHNKKFLVIRFLDGADQTSINKAFREIQKKHKSLSLLGYSVDVTSNKIECKASVAKEMVTASFNAKNWIEKVTEIVGGKSGGSDQSAQVTGVALMNLHGLEEMANKFA 2968
            +S +R  F++FF+EK  H  +HSSS IP +DPTLLF+NAGMNQFK +FLG ADPNSD+AK KR  N+QKCIRAGGKHNDLDDVGKDVYHHT+FEMLGNWSFGDYFKKE I+WAWELLT V+G+P +R YV+ FGG+   G+ +D EA+DIW S+G+   R+L FGMKDNFWEMG+ GPCGPCSEIH+DRIGNRDAS LVNADDP V+E+WNLVFIQ+NRE    LK LP KH+D G+G ER+++V+Q+K+SNYDTD+FQP+F+ I   +  R+Y G +GD+D+ G+DMAYRV+ADH RTLTIALSDGG+P N+GRGYVLRRILRR VRYA +KL+A+PG F++LV  V+ +LGE FPE+      V  IIN+EE QF+KTL RG+ +F ++++   +   G    PG ++W LYDTYG+P DLT LM +E G+ ++   +E  R+ A ETS         ++DLDVH + +LQ K +  TDD PK+ Y     G+   Y+ E     +LAI+ ++G      +  +   +++D TNFYAE GGQ+YD G +   + E  EF V+  ++ GG+++ +G    GS  VGD++    D+ R++ +M+NHTGTHVLNYALR+++ D DQKGSLVAPD++RFDF+ K  +  +Q++K E   + +I+ K QVY K   L  AK+++G+RA+F ETYPDPVRVV++G PV+ L+ +  + +   N +VEFCGGTHL N  HI  +VI SE AI+KG+RRI ALTG EAE+A     ++ +++E E    +          + + L   I+++  E + A + YW K+S+R + ++++K LD   K ++  +   ++ +A  +   AV+     LV  F   A+  +I+ A + ++    + +++ +SV+  S K+ C A V K +V+    A  W+ +V  ++GGK GG D +AQ+TG  +  L    E+A KFA
Sbjct:    6 ASEVRSTFINFFREKKEHTYVHSSSVIPHDDPTLLFANAGMNQFKPLFLGIADPNSDLAKLKRAVNTQKCIRAGGKHNDLDDVGKDVYHHTYFEMLGNWSFGDYFKKEIITWAWELLTTVYGIPAERLYVSVFGGDEANGVPADSEARDIWRSVGVPDERILNFGMKDNFWEMGDVGPCGPCSEIHYDRIGNRDASHLVNADDPMVVEIWNLVFIQFNREEGGVLKPLPAKHIDCGLGLERLIAVMQDKTSNYDTDIFQPIFEAIHKGSGVRAYTGFIGDEDKDGVDMAYRVVADHVRTLTIALSDGGRPDNSGRGYVLRRILRRGVRYASEKLNAQPGFFASLVPVVISILGETFPELSRDPVTVMDIINDEEKQFLKTLSRGRVLFQRAVQSLPE---GTMTFPGDVSWRLYDTYGFPADLTQLMAEEKGLSVDNTAFEEARRKAIETSSAGTGKFRDTLDLDVHALAELQQKGVPTTDDSPKYAYTFTGEGSDAVYKFEPCVGKILAIR-RDGKFVDQLAAGEEGAILLDRTNFYAEQGGQIYDVGVLTKVNDESNEFNVSNCQVRGGYIVLVGSA-EGSFSVGDQVNERFDEDRKQLIMKNHTGTHVLNYALRKVLADSDQKGSLVAPDRMRFDFTNKAGMTVQQVKKAEEYAQQLIDTKGQVYAKNSPLGEAKKVKGLRAMFDETYPDPVRVVAVGTPVEQLLQN-PDAEEGQNTTVEFCGGTHLQNVSHIGRIVIASEEAIAKGIRRIVALTGPEAERAIARADRLTARLEEESKHADKKDELLANKDKFKALQKKIQEIVDEANGAQLPYWRKDSIREKAKAIQKTLDGYTKAQQAAVAEKVLGEAKELA--AVAEQPTVLVHVFAANANSKAIDNALKLLK---DTKAVMAFSVNEDSGKVLCLAKVDKSLVSNGLKANEWVNEVCTVLGGKGGGKDANAQLTGENVDKLDAAVELAQKFA 963          
BLAST of alanine--tRNA ligase, cytoplasmic vs. Ensembl Celegans
Match: aars-2 (Alanine--tRNA ligase, cytoplasmic [Source:UniProtKB/Swiss-Prot;Acc:O01541])

HSP 1 Score: 986.097 bits (2548), Expect = 0.000e+0
Identity = 474/969 (48.92%), Postives = 664/969 (68.52%), Query Frame = 2
Query:   86 SSTIRREFVDFFKEK-SHLNIHSSSTIPLNDPTLLFSNAGMNQFKKIFLGTADPNSDMAKWKRVANSQKCIRAGGKHNDLDDVGKDVYHHTFFEMLGNWSFGDYFKKEAISWAWELLTKVWGLPKDRFYVTYFGGNTELGLESDEEAKDIWLSMGIDASRVLPFGMKDNFWEMGETGPCGPCSEIHFDRIGNRDASELVNADDPDVLEVWNLVFIQYNRELDRSLKSLPHKHVDTGMGFERIVSVIQNKSSNYDTDLFQPLFDRIQAETNCRSYQGKLGDDDEGGIDMAYRVLADHARTLTIALSDGGQPQNTGRGYVLRRILRRAVRYAVDKLHAKPGMFSNLVDTVVDLLGEAFPEIKHSKENVKQIINEEESQFMKTLKRGKKMFDKSLEDFKQIKTGQTFLPGRIAWMLYDTYGYPLDLTALMCDESGIKINMEEYETCRKLAQETSQGSGDTVYLSVDLDVHDIDKLQTKKLQPTDDIPKFKYNADENGN---YQLECHQATVLAIKIKEGFXXXXXXXXXXXGLVMDSTNFYAESGGQMYDTGSMVLNDVEQTEFEVATVKLCGGFVLHIGRVLNGSLKVGDRLKLEVDDARRKCLMQNHTGTHVLNYALREIVGDVDQKGSLVAPDKLRFDFSAKGQVDNEQLRKVETICKSIINEKKQVYVKEVALSIAKEIQGIRAVFGETYPDPVRVVSIGVPVDDLINSINEPKPSLNASVEFCGGTHLTNSHHISELVITSESAISKGVRRIFALTGAEAEKAC----KIASQMECEVGKLENTFSKTMEDSRIRDLLNSIKDMKRELDEALISYWFKNSLRARLESLRKELDSLEKTKKELLQANLMEQAWPVIENAVSHNKKFLVIRFLDGADQTSINKAFREIQKKHKSLSLLGYSVDVTSNKIECKASVAKEMVTASFNAKNWIEKVTEIVGGKSGGSDQSAQVTGVALMNLHGLEEMANKFA 2968
            +S +R  F++FF+EK  H  +HSSS IP +DPTLLF+NAGMNQFK +FLG ADPNSD+AK KR  N+QKCIRAGGKHNDLDDVGKDVYHHT+FEMLGNWSFGDYFKKE I+WAWELLT V+G+P +R YV+ FGG+   G+ +D EA+DIW S+G+   R+L FGMKDNFWEMG+ GPCGPCSEIH+DRIGNRDAS LVNADDP V+E+WNLVFIQ+NRE    LK LP KH+D G+G ER+++V+Q+K+SNYDTD+FQP+F+ I   +  R+Y G +GD+D+ G+DMAYRV+ADH RTLTIALSDGG+P N+GRGYVLRRILRR VRYA +KL+A+PG F++LV  V+ +LGE FPE+      V  IIN+EE QF+KTL RG+ +F ++++   +   G    PG ++W LYDTYG+P DLT LM +E G+ ++   +E  R+ A ETS         ++DLDVH + +LQ K +  TDD PK+ Y     G+   Y+ E     +LAI+ ++G      +  +   +++D TNFYAE GGQ+YD G +   + E  EF V+  ++ GG+++ +G    GS  VGD++    D+ R++ +M+NHTGTHVLNYALR+++ D DQKGSLVAPD++RFDF+ K  +  +Q++K E   + +I+ K QVY K   L  AK+++G+RA+F ETYPDPVRVV++G PV+ L+ +  + +   N +VEFCGGTHL N  HI  +VI SE AI+KG+RRI ALTG EAE+A     ++ +++E E    +          + + L   I+++  E + A + YW K+S+R + ++++K LD   K ++  +   ++ +A  +   AV+     LV  F   A+  +I+ A + ++    + +++ +SV+  S K+ C A V K +V+    A  W+ +V  ++GGK GG D +AQ+TG  +  L    E+A KFA
Sbjct:    6 ASEVRSTFINFFREKKEHTYVHSSSVIPHDDPTLLFANAGMNQFKPLFLGIADPNSDLAKLKRAVNTQKCIRAGGKHNDLDDVGKDVYHHTYFEMLGNWSFGDYFKKEIITWAWELLTTVYGIPAERLYVSVFGGDEANGVPADSEARDIWRSVGVPDERILNFGMKDNFWEMGDVGPCGPCSEIHYDRIGNRDASHLVNADDPMVVEIWNLVFIQFNREEGGVLKPLPAKHIDCGLGLERLIAVMQDKTSNYDTDIFQPIFEAIHKGSGVRAYTGFIGDEDKDGVDMAYRVVADHVRTLTIALSDGGRPDNSGRGYVLRRILRRGVRYASEKLNAQPGFFASLVPVVISILGETFPELSRDPVTVMDIINDEEKQFLKTLSRGRVLFQRAVQSLPE---GTMTFPGDVSWRLYDTYGFPADLTQLMAEEKGLSVDNTAFEEARRKAIETSSAGTGKFRDTLDLDVHALAELQQKGVPTTDDSPKYAYTFTGEGSDAVYKFEPCVGKILAIR-RDGKFVDQLAAGEEGAILLDRTNFYAEQGGQIYDVGVLTKVNDESNEFNVSNCQVRGGYIVLVGSA-EGSFSVGDQVNERFDEDRKQLIMKNHTGTHVLNYALRKVLADSDQKGSLVAPDRMRFDFTNKAGMTVQQVKKAEEYAQQLIDTKGQVYAKNSPLGEAKKVKGLRAMFDETYPDPVRVVAVGTPVEQLLQN-PDAEEGQNTTVEFCGGTHLQNVSHIGRIVIASEEAIAKGIRRIVALTGPEAERAIARADRLTARLEEESKHADKKDELLANKDKFKALQKKIQEIVDEANGAQLPYWRKDSIREKAKAIQKTLDGYTKAQQAAVAEKVLGEAKELA--AVAEQPTVLVHVFAANANSKAIDNALKLLK---DTKAVMAFSVNEDSGKVLCLAKVDKSLVSNGLKANEWVNEVCTVLGGKGGGKDANAQLTGENVDKLDAAVELAQKFA 963          
BLAST of alanine--tRNA ligase, cytoplasmic vs. Ensembl Celegans
Match: aars-1 (Alanine--tRNA ligase, mitochondrial [Source:UniProtKB/Swiss-Prot;Acc:Q23122])

HSP 1 Score: 528.48 bits (1360), Expect = 5.888e-174
Identity = 309/779 (39.67%), Postives = 447/779 (57.38%), Query Frame = 2
Query:   89 STIRREFVDFFKEKSHLNIHSSSTIP-LNDPTLLFSNAGMNQFKKIFLGTADPNSDMAKWKRVANSQKCIRAGGKHNDLDDVGKDVYHHTFFEMLGNWSFGDYF-KKEAISWAWELLTKVWGLPKDRFYVTYFGGNTELGLESDEEAKDIWLSMGIDASRVLPFGMKDNFWEMGETGPCGPCSEIHFDRIGNRDASELVNADDPDVLEVWNLVFIQYNRELDRSLKSLPHKHVDTGMGFERIVSVIQNKSSNYDTDLFQPLFDRIQAETNCRSYQGKLGDDDEGGIDMAYRVLADHARTLTIALSDGGQPQNTGRGYVLRRILRRAVRYAVDKLHAKPGMFSNLVDTVVDLLGEAFPEIKHSKENVKQIINEEESQFMKTLKRGKKMFDKSLEDFKQIKTGQTFLPGRIAWMLYDTYGYPLDLTALMCDESGIKINMEEYETCRKLAQETSQGSGDTVYLSVDLDVHDIDKLQTKKLQPTDDIP----KFKYN-ADENGNYQLECHQATVLAIKIKEGFXXXXXXXXXXXGLVMDSTNFYAESGGQMYDTGSMVLNDVEQTEFEVATVKLCGGFVLHIGRVLNGSLKVGDRLKLE--VDDARRKCLMQNHTGTHVLNYALREIVGDVDQKGSLVAPDKLRFDFSAKGQVD------NEQLRKVETICKSIINEKKQVYVKEVALSIAKEIQGIRAVFGETY--PDPVRVVSIGVPVDDLINSINEPKPSLNASVEFCGGTHLTNSHHISELVITSESAISKGVRRIFALTGAEAEKACK 2374
            S +R+ F +FFK K+H  + SSS IP  ND TLLF+NAGMNQFK + L + +        +RVAN QKCIRAGGKHNDLDDVGKD++H TFFEM+GNWSF D F K+EA  +AWE L ++ G+  DR YV+YFGG  +LGL  D E ++IW  +G+ ++R+LPF + +NFWEMG  GPCGPC+EIH+DRIG RDAS LVN DD  V+E+WN+VF+   R+    ++ L   H+DTGMGFER++SV+QNK+SN+DTD+F P+ ++  +E   + Y G L        D  +R++ADH R  T+A+SDG  P  TG G+++R+++RRA    + KL  +    S LV  V   + E +PEI  +  ++++I N+EE+QF KT+ + KKMFD    + K        + GR A+ L++T+G PL +T  +    G +++  E+E CR  AQ+ SQ +                  Q K     DD P    K KY+    NG Y+    +  +L +  K+         +D   LV++   FY E GGQ  DTG ++++  E  E E A     G   +  GR L   L +   L++E  +D+ RR+ +M+ H+ TH+LN+AL+++     QKGS V  D+ RFD+S  G  D       E L K E   +  I       + E +L  AK+I+ +++   E       VRVV++G   D                VE C GTH+ +   I ++ I S+ ++ + +RRI  LTG EA  AC+
Sbjct:   25 SELRKSFYEFFKSKNHEILRSSSVIPDENDGTLLFTNAGMNQFKPLILSSTES-------RRVANIQKCIRAGGKHNDLDDVGKDLHHQTFFEMMGNWSFNDAFSKEEACRYAWEYLVEILGINADRLYVSYFGGIEKLGLPEDRECREIWKRIGVSSNRILPF-VAENFWEMGAAGPCGPCTEIHYDRIGGRDASRLVNIDDS-VVEIWNIVFMSSVRDSCGQIRHLGKNHIDTGMGFERLLSVVQNKTSNFDTDVFTPILEKT-SELAKKQYTGSLDSRQ----DATFRLVADHIRAATVAISDGAVPDGTGCGFIVRKMMRRAFLQGISKLGIERYAMSELVPVVASTMKEVYPEIHDTSTHIRKIFNDEEAQFWKTVDKAKKMFDSVAAESK-----SPIISGRKAFNLFETHGLPLAVTVELARNIGREVDETEFERCRLEAQKVSQKAS-----------------QFKLPISADDFPSHSDKEKYSYVFRNGKYEFPQVKTRILQV-YKDQQKAESLEANDRGFLVLEECQFYGEQGGQTSDTGHLLIDGREVFEVENAKKIAGGAVTVLFGRAL---LPIRRDLRVEQKLDETRREGVMRAHSATHLLNWALQKLGVGSGQKGSSVDCDRFRFDYST-GDEDLSKEQRTELLIKCEMKMREFIQNGGFTEIIETSLEEAKKIENLQSDVKEDRIGGASVRVVALGSGAD--------------VPVECCSGTHIHDVRVIDDVAIMSDKSMGQRLRRIIVLTGKEA-AACR 747          
BLAST of alanine--tRNA ligase, cytoplasmic vs. Ensembl Fly
Match: AlaRS (gene:FBgn0027094 transcript:FBtr0079722)

HSP 1 Score: 1036.56 bits (2679), Expect = 0.000e+0
Identity = 512/966 (53.00%), Postives = 668/966 (69.15%), Query Frame = 2
Query:   95 IRREFVDFFKEKSHLNIHSSSTIPLNDPTLLFSNAGMNQFKKIFLGTADPNSDMAKWKRVANSQKCIRAGGKHNDLDDVGKDVYHHTFFEMLGNWSFGDYFKKEAISWAWELLTKVWGLPKDRFYVTYFGGNTELGLESDEEAKDIWLSMGIDASRVLPFGMKDNFWEMGETGPCGPCSEIHFDRIGNRDASELVNADDPDVLEVWNLVFIQYNRELDRSLKSLPHKHVDTGMGFERIVSVIQNKSSNYDTDLFQPLFDRIQAETNCRSYQGKLGDDDEGGIDMAYRVLADHARTLTIALSDGGQPQNTGRGYVLRRILRRAVRYAVDKLHAKPGMFSNLVDTVVDLLGEAFPEIKHSKENVKQIINEEESQFMKTLKRGKKMFDKSLEDFKQIKTGQTFLPGRIAWMLYDTYGYPLDLTALMCDESGIKINMEEYETCRKLAQETSQGSGDTVYLSVDLDVHDIDKLQTKKLQPTDDIPKFKYNA---DENGNYQLECHQATVLAIKIKEGFXXXXXXXXXXXGLVMDSTNFYAESGGQMYDTGSMVLNDVEQTEFEVATVKLCGGFVLHIGRVLNGSLKVGDRLKLEVDDARRKCLMQNHTGTHVLNYALREIVG-DVDQKGSLVAPDKLRFDFSAKGQVDNEQLRKVETICKSIINEKKQVYVKEVALSIAKEIQGIRAVFGETYPDPVRVVSIGVPVDDLINSINEPKPSLNA----SVEFCGGTHLTNSHHISELVITSESAISKGVRRIFALTGAEAEKACKIASQMECEVGKLENTFSKTMEDSRIRDLLNSIKDMKRELDEALISYWFKNSLRARLESLRKELDSLEKTKKELLQANLMEQAWPVIENAVSHNKKFLVIRFLDGADQTSINKAFREIQKKHKSLSLLGYSVDVTSNKIECKASVAKEMVTASFNAKNWIEKVTEIVGGKSGGSDQSAQVTGVALMNLHGLEEMANKFA 2968
            +R  ++DFFKE+ H+ +HSSSTIPL+DPTLLF+NAGMNQFK IFLGTADPNS+M+KW RVAN+QKCIRAGGKHNDLDDVGKDVYHHTFFEMLGNWSFGDYFKKE  SWAWE LT+   LPKDR YVTYFGG+   GLE D E K +WL +G+    +LP  MKDNFWEMGETGPCGPCSE+HFDRIG R   ELVN DDPDVLE+WNLVFIQYNRE D SLK LP KH+D GMGFER+VSVIQNK SNYDTDLF PLFD IQA T    YQG++G DD  GIDMAYRVLADHART+TIAL+DGG P NTGRGYVLRRILRRAVRYA +KL+AKPG F+ LV+TVVDLLG+AFPE+K   +++  IINEEE QF+KTL RG+ + ++++E        QT +PG +AW LYDTYG+P+DLT LM +E  +KI+M+ YE  +  +   SQG G +    ++LDVH I +LQ + + PT+D  K+KY A   + +  Y      + ++A++ +  F  +  +     G+V+D TNFYAESGGQ+YD G++V  + E  EF V  V   GG++LHIG V+ G+LKVGD L+L +D  RR   M+NH+ TH LN+ L +++G D +QKGSLV P+KLRFDF++K  +  EQ+ K E + K ++ +   +Y KE  L++AK+I+G+R+VF E YPDPVRV+S GVPVD+L     E  P   A    SVEFCGGTHL  S HI + VI+SE AI+KG+RRI ALTG EA KA K +   E E+ +L+ T          +  +  I ++  ++  A I Y  K+ +R  L+ L+K LD  E+  +  +   ++E+A  + E   + N   LV +     +  +++ A ++++ +    + +  SVD  S KI C +SV K  V     A  W++ V+  +GGK GG  +SAQ +G     +  + ++A+KFA
Sbjct:    9 VRNAYLDFFKEQKHIYVHSSSTIPLDDPTLLFANAGMNQFKPIFLGTADPNSEMSKWVRVANTQKCIRAGGKHNDLDDVGKDVYHHTFFEMLGNWSFGDYFKKEICSWAWEFLTQRLALPKDRLYVTYFGGDAASGLEPDLECKQMWLDLGLKPEHILPGSMKDNFWEMGETGPCGPCSELHFDRIGGRSVPELVNMDDPDVLEIWNLVFIQYNRESDGSLKQLPKKHIDCGMGFERLVSVIQNKRSNYDTDLFVPLFDAIQAGTGAPPYQGRVGADDVDGIDMAYRVLADHARTITIALADGGTPDNTGRGYVLRRILRRAVRYATEKLNAKPGFFATLVNTVVDLLGDAFPEVKKDPQHIIDIINEEELQFLKTLTRGRNLLNRTIEKLGN----QTTIPGDVAWRLYDTYGFPVDLTQLMAEEKSLKIDMDGYEAAKHNSYVLSQGKGASKIEEINLDVHAISQLQEQGVPPTNDTFKYKYEAVSDERDSAYNYGVCNSKIVALRFENQF-VNEITSGQKAGIVLDKTNFYAESGGQIYDQGALVKVNDEANEFLVDRVYNRGGYILHIG-VVEGTLKVGDELELHIDVERRWLTMKNHSATHALNHCLLQVLGKDTEQKGSLVVPEKLRFDFNSKAAMTIEQVSKTEQLTKEMVYKNVPIYAKESKLALAKKIRGLRSVFDEVYPDPVRVISFGVPVDEL-----EQNPDSEAGEQTSVEFCGGTHLRRSGHIMDFVISSEEAIAKGIRRIVALTGPEALKALKKSEAFEQEIVRLKATIDNDKSGKDSKSHVKEIVELTEQISHATIPYVKKDEMRNLLKGLKKTLDDKERALRAAVSVTVVERAKTLCE--ANPNATVLVEQLEAFNNTKALDAALKQVRSQLPDAAAMFLSVDADSKKIFCLSSVPKSAVEKGLKANEWVQHVSATLGGKGGGKPESAQASGTNYEKVDEIVQLASKFA 961          
BLAST of alanine--tRNA ligase, cytoplasmic vs. Ensembl Fly
Match: AlaRS (gene:FBgn0027094 transcript:FBtr0079721)

HSP 1 Score: 1036.56 bits (2679), Expect = 0.000e+0
Identity = 512/966 (53.00%), Postives = 668/966 (69.15%), Query Frame = 2
Query:   95 IRREFVDFFKEKSHLNIHSSSTIPLNDPTLLFSNAGMNQFKKIFLGTADPNSDMAKWKRVANSQKCIRAGGKHNDLDDVGKDVYHHTFFEMLGNWSFGDYFKKEAISWAWELLTKVWGLPKDRFYVTYFGGNTELGLESDEEAKDIWLSMGIDASRVLPFGMKDNFWEMGETGPCGPCSEIHFDRIGNRDASELVNADDPDVLEVWNLVFIQYNRELDRSLKSLPHKHVDTGMGFERIVSVIQNKSSNYDTDLFQPLFDRIQAETNCRSYQGKLGDDDEGGIDMAYRVLADHARTLTIALSDGGQPQNTGRGYVLRRILRRAVRYAVDKLHAKPGMFSNLVDTVVDLLGEAFPEIKHSKENVKQIINEEESQFMKTLKRGKKMFDKSLEDFKQIKTGQTFLPGRIAWMLYDTYGYPLDLTALMCDESGIKINMEEYETCRKLAQETSQGSGDTVYLSVDLDVHDIDKLQTKKLQPTDDIPKFKYNA---DENGNYQLECHQATVLAIKIKEGFXXXXXXXXXXXGLVMDSTNFYAESGGQMYDTGSMVLNDVEQTEFEVATVKLCGGFVLHIGRVLNGSLKVGDRLKLEVDDARRKCLMQNHTGTHVLNYALREIVG-DVDQKGSLVAPDKLRFDFSAKGQVDNEQLRKVETICKSIINEKKQVYVKEVALSIAKEIQGIRAVFGETYPDPVRVVSIGVPVDDLINSINEPKPSLNA----SVEFCGGTHLTNSHHISELVITSESAISKGVRRIFALTGAEAEKACKIASQMECEVGKLENTFSKTMEDSRIRDLLNSIKDMKRELDEALISYWFKNSLRARLESLRKELDSLEKTKKELLQANLMEQAWPVIENAVSHNKKFLVIRFLDGADQTSINKAFREIQKKHKSLSLLGYSVDVTSNKIECKASVAKEMVTASFNAKNWIEKVTEIVGGKSGGSDQSAQVTGVALMNLHGLEEMANKFA 2968
            +R  ++DFFKE+ H+ +HSSSTIPL+DPTLLF+NAGMNQFK IFLGTADPNS+M+KW RVAN+QKCIRAGGKHNDLDDVGKDVYHHTFFEMLGNWSFGDYFKKE  SWAWE LT+   LPKDR YVTYFGG+   GLE D E K +WL +G+    +LP  MKDNFWEMGETGPCGPCSE+HFDRIG R   ELVN DDPDVLE+WNLVFIQYNRE D SLK LP KH+D GMGFER+VSVIQNK SNYDTDLF PLFD IQA T    YQG++G DD  GIDMAYRVLADHART+TIAL+DGG P NTGRGYVLRRILRRAVRYA +KL+AKPG F+ LV+TVVDLLG+AFPE+K   +++  IINEEE QF+KTL RG+ + ++++E        QT +PG +AW LYDTYG+P+DLT LM +E  +KI+M+ YE  +  +   SQG G +    ++LDVH I +LQ + + PT+D  K+KY A   + +  Y      + ++A++ +  F  +  +     G+V+D TNFYAESGGQ+YD G++V  + E  EF V  V   GG++LHIG V+ G+LKVGD L+L +D  RR   M+NH+ TH LN+ L +++G D +QKGSLV P+KLRFDF++K  +  EQ+ K E + K ++ +   +Y KE  L++AK+I+G+R+VF E YPDPVRV+S GVPVD+L     E  P   A    SVEFCGGTHL  S HI + VI+SE AI+KG+RRI ALTG EA KA K +   E E+ +L+ T          +  +  I ++  ++  A I Y  K+ +R  L+ L+K LD  E+  +  +   ++E+A  + E   + N   LV +     +  +++ A ++++ +    + +  SVD  S KI C +SV K  V     A  W++ V+  +GGK GG  +SAQ +G     +  + ++A+KFA
Sbjct:    9 VRNAYLDFFKEQKHIYVHSSSTIPLDDPTLLFANAGMNQFKPIFLGTADPNSEMSKWVRVANTQKCIRAGGKHNDLDDVGKDVYHHTFFEMLGNWSFGDYFKKEICSWAWEFLTQRLALPKDRLYVTYFGGDAASGLEPDLECKQMWLDLGLKPEHILPGSMKDNFWEMGETGPCGPCSELHFDRIGGRSVPELVNMDDPDVLEIWNLVFIQYNRESDGSLKQLPKKHIDCGMGFERLVSVIQNKRSNYDTDLFVPLFDAIQAGTGAPPYQGRVGADDVDGIDMAYRVLADHARTITIALADGGTPDNTGRGYVLRRILRRAVRYATEKLNAKPGFFATLVNTVVDLLGDAFPEVKKDPQHIIDIINEEELQFLKTLTRGRNLLNRTIEKLGN----QTTIPGDVAWRLYDTYGFPVDLTQLMAEEKSLKIDMDGYEAAKHNSYVLSQGKGASKIEEINLDVHAISQLQEQGVPPTNDTFKYKYEAVSDERDSAYNYGVCNSKIVALRFENQF-VNEITSGQKAGIVLDKTNFYAESGGQIYDQGALVKVNDEANEFLVDRVYNRGGYILHIG-VVEGTLKVGDELELHIDVERRWLTMKNHSATHALNHCLLQVLGKDTEQKGSLVVPEKLRFDFNSKAAMTIEQVSKTEQLTKEMVYKNVPIYAKESKLALAKKIRGLRSVFDEVYPDPVRVISFGVPVDEL-----EQNPDSEAGEQTSVEFCGGTHLRRSGHIMDFVISSEEAIAKGIRRIVALTGPEALKALKKSEAFEQEIVRLKATIDNDKSGKDSKSHVKEIVELTEQISHATIPYVKKDEMRNLLKGLKKTLDDKERALRAAVSVTVVERAKTLCE--ANPNATVLVEQLEAFNNTKALDAALKQVRSQLPDAAAMFLSVDADSKKIFCLSSVPKSAVEKGLKANEWVQHVSATLGGKGGGKPESAQASGTNYEKVDEIVQLASKFA 961          
BLAST of alanine--tRNA ligase, cytoplasmic vs. Ensembl Fly
Match: AlaRS-m (gene:FBgn0028962 transcript:FBtr0077168)

HSP 1 Score: 513.072 bits (1320), Expect = 3.071e-165
Identity = 331/985 (33.60%), Postives = 503/985 (51.07%), Query Frame = 2
Query:   95 IRREFVDFFK-EKSHLNIHSSSTIPLNDPTLLFSNAGMNQFKKIFLGTADPNSDMAKWKRVANSQKCIRAGGKHNDLDDVGKDVYHHTFFEMLGNWSFGDYFKKEAISWAWELLTKVWGLPKDRFYVTYFGGNTELGLESDEEAKDIWLSMGIDASRVLPFGMKDNFWEMGETGPCGPCSEIHFDR---IGNRDA-SELVNADDPDVLEVWNLVFIQYNRELDRSLKSLPHKHVDTGMGFERIVSVIQNKSSNYDTDLFQPLFDRIQAETNCRSYQGKLGDDDEGGI-DMAYRVLADHARTLTIALSDGGQPQNTGRGYVLRRILRRAVRYAVDKLHAKPGMFSNLVDTVVDLLGEAFPEIKHSKENVKQIINEEESQFMKTLKRGKKMFDKSLEDF-----------------------KQIKTGQTFLPGRIAWMLYDTYGYPLDLTALMCDESGIKINMEEYETCRKLAQETSQGS------GDTVYLSVDLDVHDIDKLQTKKLQPTDDIPKFKYNAD-ENGNYQLECHQATVLAIKIKEGFXXXXXXXXXXX------GLVMDSTNFYAESGGQMYDTGSMVLNDVEQTE----FEVATVKLCGGFVLHIGRVLNGS----LKVGDRLKLEVDDARRKCLMQNHTGTHVLNYALREIVGDVD-QKGSLVAPDKLRFDFSAKG-QVDNEQLRKVETICKSIINEKKQVYVKEVALSIAKEIQGIRAVFGETYPDP-VRVVSIGVPVDDLINSINEPKPSLNASVEFCGGTHLTNSHHISELVITSESAISKGVRRIFALTGAEAEKACKIASQMECEVGKLENTFSKTMEDSRIRDLLNSIKDMKRELDEALISYWFK-NSLRARLESLRKELDSLEKTKKELLQANLMEQAWPVIENAVSHNKKFLVIRFLDGA--DQTSINKAFREIQKKHKSLSLLGYSVDVTSNKIECKASVAKEMVTASFNAKNWIEKVTEIVGGK 2881
            IR+ F+D F     H  + SS  +P  DPT+ F NAGMNQFK +FLGTA      A  KRV NSQKC+R GGKHNDL  VG D YHHTFFEMLGNWSFGDYFK+EA + A ELL   + +   R YVTYF G+  LG+ +D E  +IW S+G  ASR+LPFG  DNFWEMG TGPCGPC+EIH D    +G+ +  ++LVNA   D+ E+WNLVFIQYNR  D S+  LP  HVDTGMGFER+ +V+QNKSSNYDTDLF P+FD IQ       Y G   D     + D +YR+LADHAR +T  L+DG  P    +   LRR+LR+A+  + + + A   + + LV  VV+ LGEA+PE+   ++ V  +I  E+  +    +   K F + L +F                       ++ K     +PG   + L DTYG   +    + +   +  ++E Y     LA+  ++G+      G    L+ +  + +   + TK+L PTD+  K+ Y+ D E+ +YQ+   +  VL + + +  V                 +V   +NFY ESGGQ  D G +++++ +Q +     +V  VK     V+HI ++ + +    L +GD ++L+VD  +R+    +HT TH+LN A+R +   V  Q  S V+ D+ + +    G ++    ++ +E +   +I     V V+ ++ +   E   I  V GE YP+  +R+V++  P   L            +S E C GTH TN+  +S   I +    ++      A+ G  AE   K A+ +   V  LE  F      +     L +I+      D  L  Y FK ++L    E L++  DS   T KE +   +      +++        F++      A  ++  + +A +    +   +      + V  + ++ +  V ++ +T  FNA  W++   +   G+
Sbjct:   17 IRKTFLDHFTVNHGHKFVRSSPVVPFCDPTVAFVNAGMNQFKSVFLGTA-----AAPHKRVVNSQKCVRVGGKHNDLSVVGTDGYHHTFFEMLGNWSFGDYFKREACAMALELLRGPYNIDPGRLYVTYFAGDKVLGIPADLECFEIWRSLGFPASRILPFGCADNFWEMGATGPCGPCTEIHIDHRPDLGSVEQRAKLVNAGRSDLTELWNLVFIQYNRHADGSISQLPAHHVDTGMGFERLTAVLQNKSSNYDTDLFTPIFDGIQQAAKTPVYSGSFPDGGNAAVLDTSYRILADHARMVTACLADGMLPDQNQK---LRRVLRKALNIS-EHVFAHDKLLTQLVPIVVETLGEAYPEMAAKQQAVIDLICHEQEVYKNLRESSSKAFAEVLMEFPNLDDIDLMECPGFVPAYRELQMQRCKFSNNTIPGDFLYKLTDTYGLTEESFLKLAELENMNCDLERYRAEVSLAKLKAKGNQRETAGGSLCDLATEQRIAEAQAMLTKRLTPTDNSHKYTYSFDKESDSYQIPPLKTRVLGMLLNDAEVSRTQGSRIQQPFTDLISIVTAGSNFYYESGGQQSDGGKILVSNHQQPDHPHSLDVIGVKHLNDCVVHICKLSSPTDAFQLAIGDEVELQVDAQQRQLNTCHHTATHLLNAAIRSLFKKVTYQVSSSVSSDQCKLELGLLGKRIQKTDVQLIEDLINRVICSAAPVEVQLLSAAEVLEQNDITMVPGEVYPEQGLRLVNVESPELQL------------SSKELCCGTHATNTSELSCFCIVNLKQTNRARFAFTAVAGQAAENVLKTAALLRHRVDLLEKQFQTDKLTNATEAELQTIRHNMLHTDIKL-PYAFKMDTLERITEMLKRIKDSSRTTLKEFVDVEMRT----LLQEKPLDTHPFILHYITSSALVEEIPLQRATKLCPDRPILV------ISVCDSVVKARCCVPEKCITEKFNASAWLQSFADTFNGQ 969          
BLAST of alanine--tRNA ligase, cytoplasmic vs. Ensembl Zebrafish
Match: aars1 (alanyl-tRNA synthetase 1 [Source:ZFIN;Acc:ZDB-GENE-030131-3663])

HSP 1 Score: 1041.57 bits (2692), Expect = 0.000e+0
Identity = 504/970 (51.96%), Postives = 685/970 (70.62%), Query Frame = 2
Query:   83 NSSTIRREFVDFFKEKSHLNIHSSSTIPLNDPTLLFSNAGMNQFKKIFLGTADPNSDMAKWKRVANSQKCIRAGGKHNDLDDVGKDVYHHTFFEMLGNWSFGDYFKKEAISWAWELLTKVWGLPKDRFYVTYFGGNTELGLESDEEAKDIWLSMGIDASRVLPFGMKDNFWEMGETGPCGPCSEIHFDRIGNRDASELVNADDPDVLEVWNLVFIQYNRELDRSLKSLPHKHVDTGMGFERIVSVIQNKSSNYDTDLFQPLFDRIQAETNCRSYQGKLGDDDEGGIDMAYRVLADHARTLTIALSDGGQPQNTGRGYVLRRILRRAVRYAVDKLHAKPGMFSNLVDTVVDLLGEAFPEIKHSKENVKQIINEEESQFMKTLKRGKKMFDKSLEDFKQIKTGQTFLPGRIAWMLYDTYGYPLDLTALMCDESGIKINMEEYETCRKLAQETSQGSGDTVYLSVDLDVHDIDKLQTKKLQPTDDIPKFKYNADENGNYQLECHQATVLAIKIKEGFXXXXXXXXXXXGLVMDSTNFYAESGGQMYDTGSMVL-NDV--EQTEFEVATVKLCGGFVLHIGRVLNGSLKVGDRLKLEVDDARRKCLMQNHTGTHVLNYALREIVGDVDQKGSLVAPDKLRFDFSAKGQVDNEQLRKVETICKSIINEKKQVYVKEVALSIAKEIQGIRAVFGETYPDPVRVVSIGVPVDDLINSINEPKPSLNASVEFCGGTHLTNSHHISELVITSESAISKGVRRIFALTGAEAEKACKIASQMECEVGKL-ENTFSKTMEDSRIRDLLNSIKDMKRELDEALISYWFKNSLRARLESLRKELDSLEKTKKELLQANLMEQAWPVIENAVSHNKKFLVIRFLDGADQTSINKAFREIQKKHKSLSLLGYSVDVTSNKIECKASVAKEMVTASFNAKNWIEKVTEIVGGKSGGSDQSAQVTGVALMNLHGLEEMANKFANMNI 2980
             ++ IR +F+DFF+   H  +HSS+TIPL+DPTLLF+NAGMNQFK IFL T DP+  MA+ +R AN+QKCIRAGGKHNDLDDVGKDVYHHTFFEMLG+WSFGDYFK  A   A ELLT+ +G+P +R YVTYFGG+ + GLE D E K IWL +G++ SR+LP  MKDNFWEMG+TGPCGPCSEIH+DRIG RDA+ LVN DDP+VLE+WNLVFIQ+NRE +  LK LP K +DTGMG ER+VSV+QNK SNYDTDLF P F+ IQ  T  R+Y GK+G +D  GIDMAYRVLADHART+TIALSDGG+P NTGRGYVLRRILRRAVRY+ +KL A+ G F++LVD VV  LG+AFPE++   + VK IINEEE+QF+KTL RG+++ D+ ++   +     T +PG  AW+LYDTYG+PLDLTAL+ +E G+ +++  +E  +K AQ  SQG G      + LD++ ID+L+ K +  TDD PK+KY +D+NGNY+ E    TVLA++ +E             G+++D T+FYAE GGQ +D G M+  ND   ++ EF V   ++ GG+VLHIG V  G+LKVGDRL L VD+ARR+ +M NHT TH+LNY LR ++G+ DQ+GSLVAPD+LRFDF+AKG +  +++R+ E I  ++I + K VY  +  L+ AK IQG+RAVF ETYPDPVRVVSIGVPV++L+   N P  SL  S+EFCGGTHL NS H +  VI SE AI+KG+RRI A+TGAEA+KA + A  ++  +  L E   ++++ +   +D+   I DM   L  A+IS W K+ +R  L+ L+K +D L++  K  +Q  ++E+   +I++  + N+  +V+    GA   ++N++ + ++      + + ++VD  + KI C   V +++      A  W+++V  ++ GK GG D SAQ TG     +    ++A++FA + +
Sbjct:    6 TAAQIREKFIDFFRRHEHQYVHSSATIPLDDPTLLFANAGMNQFKPIFLNTIDPSHPMARLRRAANTQKCIRAGGKHNDLDDVGKDVYHHTFFEMLGSWSFGDYFKHLACKMALELLTQEFGIPIERLYVTYFGGHADAGLEPDLECKQIWLDLGMEESRILPGSMKDNFWEMGDTGPCGPCSEIHYDRIGGRDAAHLVNMDDPNVLEIWNLVFIQFNRESETVLKPLPKKSIDTGMGLERLVSVLQNKMSNYDTDLFVPYFEAIQKGTGARAYTGKVGAEDTDGIDMAYRVLADHARTITIALSDGGRPDNTGRGYVLRRILRRAVRYSHEKLGAQRGFFASLVDVVVKSLGDAFPELRKDPDMVKDIINEEEAQFLKTLSRGRRILDRKIQSLGE----STTIPGDTAWLLYDTYGFPLDLTALIAEERGMGVDLLAFEEEKKAAQLKSQGKGSGDEDHIMLDIYAIDELRNKGVAATDDSPKYKYTSDDNGNYEFEQAVGTVLALR-RERMFVDEVITGQECGVLLDKTSFYAEQGGQSFDEGYMLRENDSAEDRMEFTVKNTQVRGGYVLHIGTVY-GTLKVGDRLTLHVDEARRRPIMSNHTATHILNYGLRSVLGEADQRGSLVAPDRLRFDFTAKGAMSTDEVRRTEEIAAAMIADAKGVYALDAPLAAAKAIQGLRAVFDETYPDPVRVVSIGVPVEELLADPNSPAGSLT-SIEFCGGTHLQNSSHAAPFVIVSEEAIAKGIRRIVAVTGAEAQKAQRKADALKLSLDALAEKVKAQSIPN---KDVQKEIADMTESLGTAVISQWRKDEMRESLKGLKKIMDDLDRASKADVQKRVLEKTKEIIDS--NPNQPLIVMEMESGASAKALNESLKMLKTNSPQTAAMLFTVDNDAGKIICLCQVPQDVANRGLKASEWVQEVCPLLDGKGGGKDMSAQATGRNTQCIQEALQLASEFARLKL 963          
BLAST of alanine--tRNA ligase, cytoplasmic vs. Ensembl Zebrafish
Match: aars1 (alanyl-tRNA synthetase 1 [Source:ZFIN;Acc:ZDB-GENE-030131-3663])

HSP 1 Score: 1041.18 bits (2691), Expect = 0.000e+0
Identity = 504/970 (51.96%), Postives = 685/970 (70.62%), Query Frame = 2
Query:   83 NSSTIRREFVDFFKEKSHLNIHSSSTIPLNDPTLLFSNAGMNQFKKIFLGTADPNSDMAKWKRVANSQKCIRAGGKHNDLDDVGKDVYHHTFFEMLGNWSFGDYFKKEAISWAWELLTKVWGLPKDRFYVTYFGGNTELGLESDEEAKDIWLSMGIDASRVLPFGMKDNFWEMGETGPCGPCSEIHFDRIGNRDASELVNADDPDVLEVWNLVFIQYNRELDRSLKSLPHKHVDTGMGFERIVSVIQNKSSNYDTDLFQPLFDRIQAETNCRSYQGKLGDDDEGGIDMAYRVLADHARTLTIALSDGGQPQNTGRGYVLRRILRRAVRYAVDKLHAKPGMFSNLVDTVVDLLGEAFPEIKHSKENVKQIINEEESQFMKTLKRGKKMFDKSLEDFKQIKTGQTFLPGRIAWMLYDTYGYPLDLTALMCDESGIKINMEEYETCRKLAQETSQGSGDTVYLSVDLDVHDIDKLQTKKLQPTDDIPKFKYNADENGNYQLECHQATVLAIKIKEGFXXXXXXXXXXXGLVMDSTNFYAESGGQMYDTGSMVL-NDV--EQTEFEVATVKLCGGFVLHIGRVLNGSLKVGDRLKLEVDDARRKCLMQNHTGTHVLNYALREIVGDVDQKGSLVAPDKLRFDFSAKGQVDNEQLRKVETICKSIINEKKQVYVKEVALSIAKEIQGIRAVFGETYPDPVRVVSIGVPVDDLINSINEPKPSLNASVEFCGGTHLTNSHHISELVITSESAISKGVRRIFALTGAEAEKACKIASQMECEVGKL-ENTFSKTMEDSRIRDLLNSIKDMKRELDEALISYWFKNSLRARLESLRKELDSLEKTKKELLQANLMEQAWPVIENAVSHNKKFLVIRFLDGADQTSINKAFREIQKKHKSLSLLGYSVDVTSNKIECKASVAKEMVTASFNAKNWIEKVTEIVGGKSGGSDQSAQVTGVALMNLHGLEEMANKFANMNI 2980
             ++ IR +F+DFF+   H  +HSS+TIPL+DPTLLF+NAGMNQFK IFL T DP+  MA+ +R AN+QKCIRAGGKHNDLDDVGKDVYHHTFFEMLG+WSFGDYFK  A   A ELLT+ +G+P +R YVTYFGG+ + GLE D E K IWL +G++ SR+LP  MKDNFWEMG+TGPCGPCSEIH+DRIG RDA+ LVN DDP+VLE+WNLVFIQ+NRE +  LK LP K +DTGMG ER+VSV+QNK SNYDTDLF P F+ IQ  T  R+Y GK+G +D  GIDMAYRVLADHART+TIALSDGG+P NTGRGYVLRRILRRAVRY+ +KL A+ G F++LVD VV+ LG+AFPE++   + VK IINEEE+QF+KTL RG+++ D+ ++         T +PG  AW+LYDTYG+PLDLTAL+ +E G+ +++  +E  +K AQ  SQG G      + LD++ ID+L+ K +  TDD PK+KY +D+NGNY+ E    TVLA++ +E             G+++D T+FYAE GGQ +D G M+  ND   ++ EF V   ++ GG+VLHIG V  G+LKVGDRL L VD+ARR+ +M NHT TH+LNY LR ++G+ DQ+GSLVAPD+LRFDF+AKG +  +++R+ E I  ++I + K VY  +  L+ AK IQG+RAVF ETYPDPVRVVSIGVPV++L+   N P  SL  S+EFCGGTHL NS H +  VI SE AI+KG+RRI A+TGAEA+KA + A  ++  +  L E   ++++ +   +D+   I DM   L  A+IS W K+ +R  L+ L+K +D L++  K  +Q  ++E+   +I++  + N+  +V+    GA   ++N++ + ++      + + ++VD  + KI C   V +++      A  W+++V  ++ GK GG D SAQ TG     +    ++A++FA + +
Sbjct:    6 TAAQIREKFIDFFRRHEHQYVHSSATIPLDDPTLLFANAGMNQFKPIFLNTIDPSHPMARLRRAANTQKCIRAGGKHNDLDDVGKDVYHHTFFEMLGSWSFGDYFKHLACKMALELLTQEFGIPIERLYVTYFGGHADAGLEPDLECKQIWLDLGMEESRILPGSMKDNFWEMGDTGPCGPCSEIHYDRIGGRDAAHLVNMDDPNVLEIWNLVFIQFNRESETVLKPLPKKSIDTGMGLERLVSVLQNKMSNYDTDLFVPYFEAIQKGTGARAYTGKVGAEDTDGIDMAYRVLADHARTITIALSDGGRPDNTGRGYVLRRILRRAVRYSHEKLGAQRGFFASLVDVVVESLGDAFPELRKDPDMVKDIINEEEAQFLKTLSRGRRILDRKIQSLGD----STTIPGDTAWLLYDTYGFPLDLTALIAEERGMGVDLLAFEEEKKAAQLKSQGKGSGDEDHIMLDIYAIDELRNKGVAATDDSPKYKYTSDDNGNYEFEQAVGTVLALR-RERMFVDEVITGQECGVLLDKTSFYAEQGGQSFDEGYMLRENDSAEDRMEFTVKNTQVRGGYVLHIGTVY-GTLKVGDRLTLHVDEARRRPIMSNHTATHILNYGLRSVLGEADQRGSLVAPDRLRFDFTAKGAMSTDEVRRTEEIAAAMIADAKGVYALDAPLAAAKAIQGLRAVFDETYPDPVRVVSIGVPVEELLADPNSPAGSLT-SIEFCGGTHLQNSSHAAPFVIVSEEAIAKGIRRIVAVTGAEAQKAQRKADALKLSLDALAEKVKAQSIPN---KDVQKEIADMTESLGTAVISQWRKDEMRESLKGLKKIMDDLDRASKADVQKRVLEKTKEIIDS--NPNQPLIVMEMESGASAKALNESLKMLKTNSPQTAAMLFTVDNDAGKIICLCQVPQDVANRGLKASEWVQEVCPLLDGKGGGKDMSAQATGRNTQCIQEALQLASEFARLKL 963          
BLAST of alanine--tRNA ligase, cytoplasmic vs. Ensembl Zebrafish
Match: aars1 (alanyl-tRNA synthetase 1 [Source:ZFIN;Acc:ZDB-GENE-030131-3663])

HSP 1 Score: 1040.8 bits (2690), Expect = 0.000e+0
Identity = 504/970 (51.96%), Postives = 685/970 (70.62%), Query Frame = 2
Query:   83 NSSTIRREFVDFFKEKSHLNIHSSSTIPLNDPTLLFSNAGMNQFKKIFLGTADPNSDMAKWKRVANSQKCIRAGGKHNDLDDVGKDVYHHTFFEMLGNWSFGDYFKKEAISWAWELLTKVWGLPKDRFYVTYFGGNTELGLESDEEAKDIWLSMGIDASRVLPFGMKDNFWEMGETGPCGPCSEIHFDRIGNRDASELVNADDPDVLEVWNLVFIQYNRELDRSLKSLPHKHVDTGMGFERIVSVIQNKSSNYDTDLFQPLFDRIQAETNCRSYQGKLGDDDEGGIDMAYRVLADHARTLTIALSDGGQPQNTGRGYVLRRILRRAVRYAVDKLHAKPGMFSNLVDTVVDLLGEAFPEIKHSKENVKQIINEEESQFMKTLKRGKKMFDKSLEDFKQIKTGQTFLPGRIAWMLYDTYGYPLDLTALMCDESGIKINMEEYETCRKLAQETSQGSGDTVYLSVDLDVHDIDKLQTKKLQPTDDIPKFKYNADENGNYQLECHQATVLAIKIKEGFXXXXXXXXXXXGLVMDSTNFYAESGGQMYDTGSMVL-NDV--EQTEFEVATVKLCGGFVLHIGRVLNGSLKVGDRLKLEVDDARRKCLMQNHTGTHVLNYALREIVGDVDQKGSLVAPDKLRFDFSAKGQVDNEQLRKVETICKSIINEKKQVYVKEVALSIAKEIQGIRAVFGETYPDPVRVVSIGVPVDDLINSINEPKPSLNASVEFCGGTHLTNSHHISELVITSESAISKGVRRIFALTGAEAEKACKIASQMECEVGKL-ENTFSKTMEDSRIRDLLNSIKDMKRELDEALISYWFKNSLRARLESLRKELDSLEKTKKELLQANLMEQAWPVIENAVSHNKKFLVIRFLDGADQTSINKAFREIQKKHKSLSLLGYSVDVTSNKIECKASVAKEMVTASFNAKNWIEKVTEIVGGKSGGSDQSAQVTGVALMNLHGLEEMANKFANMNI 2980
             ++ IR +F+DFF+   H  +HSS+TIPL+DPTLLF+NAGMNQFK IFL T DP+  MA+ +R AN+QKCIRAGGKHNDLDDVGKDVYHHTFFEMLG+WSFGDYFK  A   A ELLT+ +G+P +R YVTYFGG+ + GLE D E K IWL +G++ SR+LP  MKDNFWEMG+TGPCGPCSEIH+DRIG RDA+ LVN DDP+VLE+WNLVFIQ+NRE +  LK LP K +DTGMG ER+VSV+QNK SNYDTDLF P F+ IQ  T  R+Y GK+G +D  GIDMAYRVLADHART+TIALSDGG+P NTGRGYVLRRILRRAVRY+ +KL A+ G F++LVD VV  LG+AFPE++   + VK IINEEE+QF+KTL RG+++ D+ ++   +     T +PG  AW+LYDTYG+PLDLTAL+ +E G+ +++  +E  +K AQ  SQG G      + LD++ ID+L+ K +  TDD PK+KY +D+NGNY+ E    TVLA++ +E             G+++D T+FYAE GGQ +D G M+  ND   ++ EF V   ++ GG+VLHIG V  G+LKVGDRL L VD+ARR+ +M NHT TH+LNY LR ++G+ DQ+GSLVAPD+LRFDF+AKG +  +++R+ E I  ++I + K VY  +  L+ AK IQG+RAVF ETYPDPVRVVSIGVPV++L+   N P  SL  S+EFCGGTHL NS H +  VI SE AI+KG+RRI A+TGAEA+KA + A  ++  +  L E   ++++ +   +D+   I DM   L  A+IS W K+ +R  L+ L+K +D L++  K  +Q  ++E+   +I++  + N+  +V+    GA   ++N++ + ++      + + ++VD  + KI C   V +++      A  W+++V  ++ GK GG D SAQ TG     +    ++A++FA + +
Sbjct:   31 TAAQIREKFIDFFRRHEHQYVHSSATIPLDDPTLLFANAGMNQFKPIFLNTIDPSHPMARLRRAANTQKCIRAGGKHNDLDDVGKDVYHHTFFEMLGSWSFGDYFKHLACKMALELLTQEFGIPIERLYVTYFGGHADAGLEPDLECKQIWLDLGMEESRILPGSMKDNFWEMGDTGPCGPCSEIHYDRIGGRDAAHLVNMDDPNVLEIWNLVFIQFNRESETVLKPLPKKSIDTGMGLERLVSVLQNKMSNYDTDLFVPYFEAIQKGTGARAYTGKVGAEDTDGIDMAYRVLADHARTITIALSDGGRPDNTGRGYVLRRILRRAVRYSHEKLGAQRGFFASLVDVVVKSLGDAFPELRKDPDMVKDIINEEEAQFLKTLSRGRRILDRKIQSLGE----STTIPGDTAWLLYDTYGFPLDLTALIAEERGMGVDLLAFEEEKKAAQLKSQGKGSGDEDHIMLDIYAIDELRNKGVAATDDSPKYKYTSDDNGNYEFEQAVGTVLALR-RERMFVDEVITGQECGVLLDKTSFYAEQGGQSFDEGYMLRENDSAEDRMEFTVKNTQVRGGYVLHIGTVY-GTLKVGDRLTLHVDEARRRPIMSNHTATHILNYGLRSVLGEADQRGSLVAPDRLRFDFTAKGAMSTDEVRRTEEIAAAMIADAKGVYALDAPLAAAKAIQGLRAVFDETYPDPVRVVSIGVPVEELLADPNSPAGSLT-SIEFCGGTHLQNSSHAAPFVIVSEEAIAKGIRRIVAVTGAEAQKAQRKADALKLSLDALAEKVKAQSIPN---KDVQKEIADMTESLGTAVISQWRKDEMRESLKGLKKIMDDLDRASKADVQKRVLEKTKEIIDS--NPNQPLIVMEMESGASAKALNESLKMLKTNSPQTAAMLFTVDNDAGKIICLCQVPQDVANRGLKASEWVQEVCPLLDGKGGGKDMSAQATGRNTQCIQEALQLASEFARLKL 988          
BLAST of alanine--tRNA ligase, cytoplasmic vs. Ensembl Zebrafish
Match: aars1 (alanyl-tRNA synthetase 1 [Source:ZFIN;Acc:ZDB-GENE-030131-3663])

HSP 1 Score: 1036.94 bits (2680), Expect = 0.000e+0
Identity = 502/970 (51.75%), Postives = 683/970 (70.41%), Query Frame = 2
Query:   83 NSSTIRREFVDFFKEKSHLNIHSSSTIPLNDPTLLFSNAGMNQFKKIFLGTADPNSDMAKWKRVANSQKCIRAGGKHNDLDDVGKDVYHHTFFEMLGNWSFGDYFKKEAISWAWELLTKVWGLPKDRFYVTYFGGNTELGLESDEEAKDIWLSMGIDASRVLPFGMKDNFWEMGETGPCGPCSEIHFDRIGNRDASELVNADDPDVLEVWNLVFIQYNRELDRSLKSLPHKHVDTGMGFERIVSVIQNKSSNYDTDLFQPLFDRIQAETNCRSYQGKLGDDDEGGIDMAYRVLADHARTLTIALSDGGQPQNTGRGYVLRRILRRAVRYAVDKLHAKPGMFSNLVDTVVDLLGEAFPEIKHSKENVKQIINEEESQFMKTLKRGKKMFDKSLEDFKQIKTGQTFLPGRIAWMLYDTYGYPLDLTALMCDESGIKINMEEYETCRKLAQETSQGSGDTVYLSVDLDVHDIDKLQTKKLQPTDDIPKFKYNADENGNYQLECHQATVLAIKIKEGFXXXXXXXXXXXGLVMDSTNFYAESGGQMYDTGSMVL-NDV--EQTEFEVATVKLCGGFVLHIGRVLNGSLKVGDRLKLEVDDARRKCLMQNHTGTHVLNYALREIVGDVDQKGSLVAPDKLRFDFSAKGQVDNEQLRKVETICKSIINEKKQVYVKEVALSIAKEIQGIRAVFGETYPDPVRVVSIGVPVDDLINSINEPKPSLNASVEFCGGTHLTNSHHISELVITSESAISKGVRRIFALTGAEAEKACKIASQMECEVGKL-ENTFSKTMEDSRIRDLLNSIKDMKRELDEALISYWFKNSLRARLESLRKELDSLEKTKKELLQANLMEQAWPVIENAVSHNKKFLVIRFLDGADQTSINKAFREIQKKHKSLSLLGYSVDVTSNKIECKASVAKEMVTASFNAKNWIEKVTEIVGGKSGGSDQSAQVTGVALMNLHGLEEMANKFANMNI 2980
             ++ IR +F+D  +   H  +HSS+TIPL+DPTLLF+NAGMNQFK IFL T DP+  MA+ +R AN+QKCIRAGGKHNDLDDVGKDVYHHTFFEMLG+WSFGDYFK  A   A ELLT+ +G+P +R YVTYFGG+ + GLE D E K IWL +G++ SR+LP  MKDNFWEMG+TGPCGPCSEIH+DRIG RDA+ LVN DDP+VLE+WNLVFIQ+NRE +  LK LP K +DTGMG ER+VSV+QNK SNYDTDLF P F+ IQ  T  R+Y GK+G +D  GIDMAYRVLADHART+TIALSDGG+P NTGRGYVLRRILRRAVRY+ +KL A+ G F++LVD VV  LG+AFPE++   + VK IINEEE+QF+KTL RG+++ D+ ++   +     T +PG  AW+LYDTYG+PLDLTAL+ +E G+ +++  +E  +K AQ  SQG G      + LD++ ID+L+ K +  TDD PK+KY +D+NGNY+ E    TVLA++ +E             G+++D T+FYAE GGQ +D G M+  ND   ++ EF V   ++ GG+VLHIG V  G+LKVGDRL L VD+ARR+ +M NHT TH+LNY LR ++G+ DQ+GSLVAPD+LRFDF+AKG +  +++R+ E I  ++I + K VY  +  L+ AK IQG+RAVF ETYPDPVRVVSIGVPV++L+   N P  SL  S+EFCGGTHL NS H +  VI SE AI+KG+RRI A+TGAEA+KA + A  ++  +  L E   ++++ +   +D+   I DM   L  A+IS W K+ +R  L+ L+K +D L++  K  +Q  ++E+   +I++  + N+  +V+    GA   ++N++ + ++      + + ++VD  + KI C   V +++      A  W+++V  ++ GK GG D SAQ TG     +    ++A++FA + +
Sbjct:    6 TAAQIREKFIDLIRRHEHQYVHSSATIPLDDPTLLFANAGMNQFKPIFLNTIDPSHPMARLRRAANTQKCIRAGGKHNDLDDVGKDVYHHTFFEMLGSWSFGDYFKHLACKMALELLTQEFGIPIERLYVTYFGGHADAGLEPDLECKQIWLDLGMEESRILPGSMKDNFWEMGDTGPCGPCSEIHYDRIGGRDAAHLVNMDDPNVLEIWNLVFIQFNRESETVLKPLPKKSIDTGMGLERLVSVLQNKMSNYDTDLFVPYFEAIQKGTGARAYTGKVGAEDTDGIDMAYRVLADHARTITIALSDGGRPDNTGRGYVLRRILRRAVRYSHEKLGAQRGFFASLVDVVVKSLGDAFPELRKDPDMVKDIINEEEAQFLKTLSRGRRILDRKIQSLGE----STTIPGDTAWLLYDTYGFPLDLTALIAEERGMGVDLLAFEEEKKAAQLKSQGKGSGDEDHIMLDIYAIDELRNKGVAATDDSPKYKYTSDDNGNYEFEQAVGTVLALR-RERMFVDEVITGQECGVLLDKTSFYAEQGGQSFDEGYMLRENDSAEDRMEFTVKNTQVRGGYVLHIGTVY-GTLKVGDRLTLHVDEARRRPIMSNHTATHILNYGLRSVLGEADQRGSLVAPDRLRFDFTAKGAMSTDEVRRTEEIAAAMIADAKGVYALDAPLAAAKAIQGLRAVFDETYPDPVRVVSIGVPVEELLADPNSPAGSLT-SIEFCGGTHLQNSSHAAPFVIVSEEAIAKGIRRIVAVTGAEAQKAQRKADALKLSLDALAEKVKAQSIPN---KDVQKEIADMTESLGTAVISQWRKDEMRESLKGLKKIMDDLDRASKADVQKRVLEKTKEIIDS--NPNQPLIVMEMESGASAKALNESLKMLKTNSPQTAAMLFTVDNDAGKIICLCQVPQDVANRGLKASEWVQEVCPLLDGKGGGKDMSAQATGRNTQCIQEALQLASEFARLKL 963          
BLAST of alanine--tRNA ligase, cytoplasmic vs. Ensembl Zebrafish
Match: aars2 (alanyl-tRNA synthetase 2, mitochondrial (putative) [Source:ZFIN;Acc:ZDB-GENE-041008-213])

HSP 1 Score: 770.77 bits (1989), Expect = 0.000e+0
Identity = 434/984 (44.11%), Postives = 606/984 (61.59%), Query Frame = 2
Query:   83 NSSTIRREFVDFFKEK-SHLNIHSSSTIPLNDPTLLFSNAGMNQFKKIFLGTADPNSDMAKWKRVANSQKCIRAGGKHNDLDDVGKDVYHHTFFEMLGNWSFGDYFKKEAISWAWELLTKVWGLPKDRFYVTYFGGNTELGLESDEEAKDIWLSMGIDASRVLPFGMKDNFWEMGETGPCGPCSEIHFDRIGNRDASELVNADDPDVLEVWNLVFIQYNRELDRSLKSLPHKHVDTGMGFERIVSVIQNKSSNYDTDLFQPLFDRIQAETNCRSYQGKLGDDDEGGIDMAYRVLADHARTLTIALSDGGQPQNTGRGYVLRRILRRAVRYAVDKLHAKPGMFSNLVDTVVDLLGEAFPEIKHSKENVKQIINEEESQFMKTLKRGKKMFDKSLEDFKQIKTGQTFLPGRIAWMLYDTYGYPLDLTALMCDESG-------IKINMEEYETCRKLAQETSQGSGDTVYLSVDLDVHDIDKLQTKKLQPTDDIPKFKYNADENGNYQLECHQATVLAIKIKEGFXXXXXXXXXXXGLVMDSTNFYAESGGQMYDTGSMVLNDVEQTEFEVATVKLCGGFVLHIGRVLNG-SLKVGDRLKLEVDDARRKCLMQNHTGTHVLNYALREIVGD-VDQKGSLVAPDKLRFDFSAKGQVDNEQLRKVETICKSIINEKKQVYVKEVALSIAKEIQGIRAVFGETYPDPVRVVSIGVPVDDLINSINEPKPSLNASVEFCGGTHLTNSHHISELVITSESAISKGVRRIFALTGAEAEKACKIASQMECEVGKLENT--FSKTMEDSRIRDLLNSIKDMKRELDEALISYWFKNSLRARLESLRKELDSLEKTKKELLQANLMEQAWPVIENAVSHNKKFLVIRFLDGADQTSINKAFREIQKK-HKSLSLLGYSVDVTSNKIECKASVAKEMVTASFNAKNWIEKVTEIVGGKSGGSDQSAQVTGVALMN------LHGLEEMA-NKFANM 2974
             S  +RR+F+DFF+E   H  + SSS  P  DP+LLF NAGMNQFK I LG ADP S+M  ++RV NSQKC+RAGGKHNDL DVGKDVYHHTFFEMLGNWSFGDYFK EA + AW LLT+ +G+P  R YV+YF G+   GL +DEE +DIWLSMG+ A  VLPFGMKDNFWEMGETGPCGPC+EIH+D IGNR+A+ LVNAD PDV+E+WNLVF+QYNRE + SL++LP   VDTGMG ER+V+V+Q K SNYDTDLF PL   I   +   +YQG+ G  D   +DMAYRV+ADH RT+ + ++DG  P   G   VLRRILRRAVR++ + L A  G  ++LV TV  LLG+A+PE+    + +  +IN+ E+ F+ +LK+G+++ D++L +  +     +F P  +AW LY   G+PLDL  LM +E G       +K+  +EYE   KL  ++ +  G+ +     LD+H + +LQ +++  TDD PK+ Y+   +G Y  E  +A+VLA+   +G + S   +     +++D T+FYAE GGQ  D G    + ++   F V  V+L GG+V+H  +V    +L+ GD++ L VD+A R   M NHT THVLN+ALRE++G  V Q+GS  + ++LRFDFS KG +   +L+KVE +  +II +   V+V+EV LS AK+I G+R V  E YPDPVRVVS+ VPV DL+ S    + +   SVE C GTHL  +  I + V+ SE  + KGV RI A TG +A KA +    ++ E+  LE     S T+     + L   +  +   +D   +  W +  L+ RL+++      L+ +   + +  + E A    E    H+ K +V+  +     + + K   ++ K   KSL +L +S   +S K+ C   V K     S  A  W   V   +GG + G+  +A+  G A+        LH  EE A NK  N+
Sbjct:   36 TSKRVRRKFIDFFREGYGHRVVPSSSVRPRGDPSLLFVNAGMNQFKPILLGCADPRSEMVSYRRVVNSQKCVRAGGKHNDLQDVGKDVYHHTFFEMLGNWSFGDYFKVEACAMAWRLLTEEYGIPAQRLYVSYFSGDPANGLPADEETRDIWLSMGLRADHVLPFGMKDNFWEMGETGPCGPCTEIHYDHIGNRNAALLVNADSPDVVEIWNLVFMQYNRESNGSLRALPQCSVDTGMGLERLVTVLQGKRSNYDTDLFTPLLSAIHQCSKAPAYQGRTGAADVAQLDMAYRVVADHIRTICVCIADGVYPGMAGAELVLRRILRRAVRFSTEVLQAPEGALASLVPTVAHLLGDAYPELNTESDRIMDLINQNEAHFLSSLKQGRRVIDRTLSNMDE---NSSFFPASVAWSLYRNLGFPLDLIDLMLEEKGKIVDKKEMKVLEDEYE---KLGLQSEEDEGEKLD---QLDLHSLAELQRQRVPHTDDSPKYCYSVGSDGQYVFEPCKASVLALYC-DGALVSEVRQGQHCAVILDQTSFYAEQGGQANDQGYFTKDGLQDVLFPVKCVRLAGGYVVH--KVTAAETLRTGDQVHLHVDEAWRLGCMINHTATHVLNFALRELLGPIVSQRGSHCSANRLRFDFSVKGTLTVSELQKVEELVLNIIRQNADVHVEEVPLSSAKQIAGLRTV-DELYPDPVRVVSVAVPVSDLLAS----ERAEQTSVELCCGTHLLRTGAIRDFVVVSERQMMKGVCRIVAFTGDDAIKAREAGQALQEELESLEARMGLSNTLSIQEAKRLSKEVGHLINAVDITPMPQWKRLELQTRLKAM------LKSSNNSIRKLEIKEAALKAKELLDKHSNKPVVVDLIQTDSISVLMKTVVQLSKSTPKSLVML-FSHWESSGKLLCACLVPKGSTGGS--AIEWALSVCSRLGGNAEGAKDTAKGVGNAVKVEDVAEILHWAEEFAHNKIRNV 993          
BLAST of alanine--tRNA ligase, cytoplasmic vs. Ensembl Xenopus
Match: kmt5b (lysine methyltransferase 5B [Source:Xenbase;Acc:XB-GENE-852757])

HSP 1 Score: 1038.48 bits (2684), Expect = 0.000e+0
Identity = 509/969 (52.53%), Postives = 684/969 (70.59%), Query Frame = 2
Query:   83 NSSTIRREFVDFFKEKSHLNIHSSSTIPLNDPTLLFSNAGMNQFKKIFLGTADPNSDMAKWKRVANSQKCIRAGGKHNDLDDVGKDVYHHTFFEMLGNWSFGDYFKKEAISWAWELLTKVWGLPKDRFYVTYFGGNTELGLESDEEAKDIWLSMGIDASRVLPFGMKDNFWEMGETGPCGPCSEIHFDRIGNRDASELVNADDPDVLEVWNLVFIQYNRELDRSLKSLPHKHVDTGMGFERIVSVIQNKSSNYDTDLFQPLFDRIQAETNCRSYQGKLGDDDEGGIDMAYRVLADHARTLTIALSDGGQPQNTGRGYVLRRILRRAVRYAVDKLHAKPGMFSNLVDTVVDLLGEAFPEIKHSKENVKQIINEEESQFMKTLKRGKKMFDKSLEDFKQIKTGQTFLPGRIAWMLYDTYGYPLDLTALMCDESGIKINMEEYETCRKLAQETSQGSGDTVYLSVDLDVHDIDKLQTKKLQPTDDIPKFKYNADENGNYQLECHQATVLAIKIKEGFXXXXXXXXXXXGLVMDSTNFYAESGGQMYDTGSMVLND---VEQTEFEVATVKLCGGFVLHIGRVLNGSLKVGDRLKLEVDDARRKCLMQNHTGTHVLNYALREIVGDVDQKGSLVAPDKLRFDFSAKGQVDNEQLRKVETICKSIINEKKQVYVKEVALSIAKEIQGIRAVFGETYPDPVRVVSIGVPVDDLINSINEPKPSLNASVEFCGGTHLTNSHHISELVITSESAISKGVRRIFALTGAEAEKACKIASQMECEVGKLENTFSKTMEDSRIRDLLNSIKDMKRELDEALISYWFKNSLRARLESLRKELDSLEKTKKELLQANLMEQAWPVIENAVSHNKKFLVIRFLDGADQTSINKAFREIQKKHKSLSLLGYSVDVTSNKIECKASVAKEMVTASFNAKNWIEKVTEIVGGKSGGSDQSAQVTGVALMNLHGLEEMANKFANMNI 2980
             +S IR++F+DFFKE +H  +HSS+T+PL+DPTLLF+NAGMNQFK IFL T DP+  MAK  R AN+QKCIRAGGKHNDLDDVGKDVYHHTFFEMLG+WSFGDYFK+ A   A +LLTK +G+  +R YVTYFGGN   GLE D E K IWL++G+  SR+LP  MKDNFWEMG+TGPCGPCSEIHFDRIG RDA+ LVN DDP+VLE+WNLVFIQ+NRE D +LK LP K +DTGMG ER+VSV+QNK SNYDTDLF P F+ I+  T  R Y GK+G +D  GIDMAYRVLADHART+T+AL+DGG+P NTGRGYVLRRILRRAVRYA +KL+A  G F+ LVD VV  LG AFPE+K   + VK IINEEE+QF+KTL RG+++ D+ +    + K     +PG  AW+LYDTYG+P+DLT+L+ +E G+ +++E +E  RK AQ  SQG G      + LD++ I++L+++ L+PTDD+PK+KY ++ +G Y+ E   ATV AI+  + F    +S     GLV+D T FYAE GGQ YD G MV  +    ++TEF V   ++ GG+VLH+G  L G LKVGD++ L VD+ +R+ +M NHT TH+LN+ALR ++G+ DQ+GSLVAPD+LRFDF+AKG +  +++RK E I   II E K VY  + +L+ AK IQG+RAVF ETYPDPVRVVSIG+PV+DL+   + P  S+  SVEFCGGTHL NS H    +I +E AI+KG+RRI A+TGAEA+KA +    ++  +  LE    K  ++S  +D+   I D+   L  A I+ W K+ LR +L++L+K +D L++  K  +Q  ++E    +IE     N+  LV+   +GA   ++N++ + ++ +    + + +SVD  + KI C   V ++       A  W+++V++++ G+ GG D SAQ TG  +  L  + ++A  FA M +
Sbjct:   37 TASEIRQKFIDFFKENAHTYVHSSATVPLDDPTLLFANAGMNQFKPIFLNTIDPSHPMAKLNRAANTQKCIRAGGKHNDLDDVGKDVYHHTFFEMLGSWSFGDYFKELACKLALDLLTKEFGIDIERLYVTYFGGNEAAGLEPDLECKQIWLNLGLPESRILPGSMKDNFWEMGDTGPCGPCSEIHFDRIGGRDAAHLVNMDDPNVLEIWNLVFIQFNRETDGTLKPLPKKSIDTGMGLERLVSVLQNKMSNYDTDLFVPYFEAIEKGTGARPYTGKVGAEDVDGIDMAYRVLADHARTITVALADGGRPDNTGRGYVLRRILRRAVRYAHEKLNASKGFFATLVDVVVQSLGNAFPELKKDPDMVKDIINEEETQFLKTLNRGRRILDRKINSLGEHKV----IPGDTAWLLYDTYGFPVDLTSLIAEERGLTLDLESFEEERKAAQLKSQGKGTGDEDLLMLDIYAIEELRSQGLEPTDDLPKYKYTSNADGVYEFESLIATVKAIRRDKMF-VEEASTGQECGLVLDKTCFYAEQGGQTYDEGYMVKEEESSEDKTEFTVRNTQVRGGYVLHMG-TLYGHLKVGDQVCLYVDEPKRRPIMSNHTATHILNFALRSVLGEADQRGSLVAPDRLRFDFTAKGAMSTQEIRKTEEIANDIIKENKVVYALDCSLAEAKAIQGLRAVFDETYPDPVRVVSIGIPVEDLLADPSSPAGSIT-SVEFCGGTHLQNSGHAGPFIIVTEEAIAKGIRRIVAVTGAEAQKALRRQDALKVNLSDLEKKVKK--QNSPNKDVQKEIADLSENLATASIAQWQKDVLREQLKTLKKTMDDLDRASKADVQKRVLEITKQLIEE--HPNQPLLVLEMENGASAKALNESLKLLKSQSPHTAAMIFSVDNDAGKITCLCQVPQDTADKGLKANEWVQQVSDLMDGRGGGKDTSAQATGKNVGCLSQVLKLAEDFAKMKL 994          
BLAST of alanine--tRNA ligase, cytoplasmic vs. Ensembl Xenopus
Match: kmt5b (lysine methyltransferase 5B [Source:Xenbase;Acc:XB-GENE-852757])

HSP 1 Score: 1017.68 bits (2630), Expect = 0.000e+0
Identity = 504/969 (52.01%), Postives = 675/969 (69.66%), Query Frame = 2
Query:   83 NSSTIRREFVDFFKEKSHLNIHSSSTIPLNDPTLLFSNAGMNQFKKIFLGTADPNSDMAKWKRVANSQKCIRAGGKHNDLDDVGKDVYHHTFFEMLGNWSFGDYFKKEAISWAWELLTKVWGLPKDRFYVTYFGGNTELGLESDEEAKDIWLSMGIDASRVLPFGMKDNFWEMGETGPCGPCSEIHFDRIGNRDASELVNADDPDVLEVWNLVFIQYNRELDRSLKSLPHKHVDTGMGFERIVSVIQNKSSNYDTDLFQPLFDRIQAETNCRSYQGKLGDDDEGGIDMAYRVLADHARTLTIALSDGGQPQNTGRGYVLRRILRRAVRYAVDKLHAKPGMFSNLVDTVVDLLGEAFPEIKHSKENVKQIINEEESQFMKTLKRGKKMFDKSLEDFKQIKTGQTFLPGRIAWMLYDTYGYPLDLTALMCDESGIKINMEEYETCRKLAQETSQGSGDTVYLSVDLDVHDIDKLQTKKLQPTDDIPKFKYNADENGNYQLECHQATVLAIKIKEGFXXXXXXXXXXXGLVMDSTNFYAESGGQMYDTGSMVLND---VEQTEFEVATVKLCGGFVLHIGRVLNGSLKVGDRLKLEVDDARRKCLMQNHTGTHVLNYALREIVGDVDQKGSLVAPDKLRFDFSAKGQVDNEQLRKVETICKSIINEKKQVYVKEVALSIAKEIQGIRAVFGETYPDPVRVVSIGVPVDDLINSINEPKPSLNASVEFCGGTHLTNSHHISELVITSESAISKGVRRIFALTGAEAEKACKIASQMECEVGKLENTFSKTMEDSRIRDLLNSIKDMKRELDEALISYWFKNSLRARLESLRKELDSLEKTKKELLQANLMEQAWPVIENAVSHNKKFLVIRFLDGADQTSINKAFREIQKKHKSLSLLGYSVDVTSNKIECKASVAKEMVTASFNAKNWIEKVTEIVGGKSGGSDQSAQVTGVALMNLHGLEEMANKFANMNI 2980
             +S IR++F+DFFKE +H  +HSS+T+PL+DPTLLF+NAGMNQFK IFL T DP+  MAK  R AN+QKCIRAGGKHNDLDDVGKDVYHHTFFEMLG+WSFGDYFK               GL  +R YVTYFGGN   GLE D E K IWL++G+  SR+LP  MKDNFWEMG+TGPCGPCSEIHFDRIG RDA+ LVN DDP+VLE+WNLVFIQ+NRE D +LK LP K +DTGMG ER+VSV+QNK SNYDTDLF P F+ I+  T  R Y GK+G +D  GIDMAYRVLADHART+T+AL+DGG+P NTGRGYVLRRILRRAVRYA +KL+A  G F+ LVD VV  LG AFPE+K   + VK IINEEE+QF+KTL RG+++ D+ +    + K     +PG  AW+LYDTYG+P+DLT+L+ +E G+ +++E +E  RK AQ  SQG G      + LD++ I++L+++ L+PTDD+PK+KY ++ +G Y+ E   ATV AI+  + F    +S     GLV+D T FYAE GGQ YD G MV  +    ++TEF V   ++ GG+VLH+G  L G LKVGD++ L VD+ +R+ +M NHT TH+LN+ALR ++G+ DQ+GSLVAPD+LRFDF+AKG +  +++RK E I   II E K VY  + +L+ AK IQG+RAVF ETYPDPVRVVSIG+PV+DL+   + P  S+  SVEFCGGTHL NS H    +I +E AI+KG+RRI A+TGAEA+KA +    ++  +  LE    K  ++S  +D+   I D+   L  A I+ W K+ LR +L++L+K +D L++  K  +Q  ++E    +IE     N+  LV+   +GA   ++N++ + ++ +    + + +SVD  + KI C   V ++       A  W+++V++++ G+ GG D SAQ TG  +  L  + ++A  FA M +
Sbjct:   47 TASEIRQKFIDFFKENAHTYVHSSATVPLDDPTLLFANAGMNQFKPIFLNTIDPSHPMAKLNRAANTQKCIRAGGKHNDLDDVGKDVYHHTFFEMLGSWSFGDYFK---------------GL-FERLYVTYFGGNEAAGLEPDLECKQIWLNLGLPESRILPGSMKDNFWEMGDTGPCGPCSEIHFDRIGGRDAAHLVNMDDPNVLEIWNLVFIQFNRETDGTLKPLPKKSIDTGMGLERLVSVLQNKMSNYDTDLFVPYFEAIEKGTGARPYTGKVGAEDVDGIDMAYRVLADHARTITVALADGGRPDNTGRGYVLRRILRRAVRYAHEKLNASKGFFATLVDVVVQSLGNAFPELKKDPDMVKDIINEEETQFLKTLNRGRRILDRKINSLGEHKV----IPGDTAWLLYDTYGFPVDLTSLIAEERGLTLDLESFEEERKAAQLKSQGKGTGDEDLLMLDIYAIEELRSQGLEPTDDLPKYKYTSNADGVYEFESLIATVKAIRRDKMF-VEEASTGQECGLVLDKTCFYAEQGGQTYDEGYMVKEEESSEDKTEFTVRNTQVRGGYVLHMG-TLYGHLKVGDQVCLYVDEPKRRPIMSNHTATHILNFALRSVLGEADQRGSLVAPDRLRFDFTAKGAMSTQEIRKTEEIANDIIKENKVVYALDCSLAEAKAIQGLRAVFDETYPDPVRVVSIGIPVEDLLADPSSPAGSIT-SVEFCGGTHLQNSGHAGPFIIVTEEAIAKGIRRIVAVTGAEAQKALRRQDALKVNLSDLEKKVKK--QNSPNKDVQKEIADLSENLATASIAQWQKDVLREQLKTLKKTMDDLDRASKADVQKRVLEITKQLIEE--HPNQPLLVLEMENGASAKALNESLKLLKSQSPHTAAMIFSVDNDAGKITCLCQVPQDTADKGLKANEWVQQVSDLMDGRGGGKDTSAQATGKNVGCLSQVLKLAEDFAKMKL 988          
BLAST of alanine--tRNA ligase, cytoplasmic vs. Ensembl Xenopus
Match: kmt5b (lysine methyltransferase 5B [Source:Xenbase;Acc:XB-GENE-852757])

HSP 1 Score: 1012.29 bits (2616), Expect = 0.000e+0
Identity = 503/971 (51.80%), Postives = 675/971 (69.52%), Query Frame = 2
Query:   83 NSSTIRREFVDFFKEKSHLNIHSSSTIPLNDPTLLFSNAGMNQFKKIFLGTADPNSDMAKWKRVANSQKCIRAGGKHNDLDDVGKDVYHHTFFEMLGNWSFGDYFKKEAISWAWELLTKVWGLPKDRFYVTYFGGNTELGLESDEEAKDIWLSMGIDASRVLPFGMKDNFWEMGETGPCGPCSEIHFDRIGNRDASELVNADDPDVLEVWNLVFIQYNRELDRSLKSLPHKHVDTGMGFERIVSVIQNKSSNYDTDLFQPLFDRIQAETNCRSYQGKLGDDDEGGIDMAYRVLADHARTLTIALSDGGQPQNTGRGYVLRRILRRAVRYAVDKLHAKPGMFSNLVDTVVDLLGEAFPEIKHSKENVKQIINEEESQFMKTLKRGKKMFDKSLEDFKQIKTGQTFLPGRIAWMLYDTYGYPLDLTALMCDESGIKINMEEYETCRKLAQETSQGSGDTVYLSVDLDVHDIDKLQTKKLQPTDDIPKFKYNADENGNYQLECHQATVLAIKIKEGFXXXXXXXXXXXGLVMDSTNFYAESGGQMYDTGSMVLND---VEQTEFEVATVKLCGGFVLHIGRVLNGSLKVGDRLKLEVDDARRKCLMQNHT--GTHVLNYALREIVGDVDQKGSLVAPDKLRFDFSAKGQVDNEQLRKVETICKSIINEKKQVYVKEVALSIAKEIQGIRAVFGETYPDPVRVVSIGVPVDDLINSINEPKPSLNASVEFCGGTHLTNSHHISELVITSESAISKGVRRIFALTGAEAEKACKIASQMECEVGKLENTFSKTMEDSRIRDLLNSIKDMKRELDEALISYWFKNSLRARLESLRKELDSLEKTKKELLQANLMEQAWPVIENAVSHNKKFLVIRFLDGADQTSINKAFREIQKKHKSLSLLGYSVDVTSNKIECKASVAKEMVTASFNAKNWIEKVTEIVGGKSGGSDQSAQVTGVALMNLHGLEEMANKFANMNI 2980
             +S IR++F+DFFKE +H  +HSS+T+PL+DPTLLF+NAGMNQFK IFL T DP+  MAK  R AN+QKCIRAGGKHNDLDDVGKDVYHHTFFEMLG+WSFGDYFK+ A   A +LLTK +G+  +R YVTYFGGN   GLE D E K IWL++G+  SR+LP  MKDNFWEMG+TGPCGPCSEIHFDRIG RDA+ LVN DDP+VLE+WNLVFIQ+NRE D +LK LP K +DTGMG ER+VSV+QNK SNYDTDLF P F+ I+  T  R Y GK+G +D  GIDMAYRVLADHART+T+AL+DGG+P NTGRGYVLRRILRRAVRYA +KL+A  G F+ LVD VV  LG AFPE+K   + VK IINEEE+QF+KTL RG+++ D+ +    + K     +PG  AW+LYDTYG+P+DLT+L+ +E G+ +++E +E  RK AQ  SQG G      + LD++ I++L+++ L+PTDD+PK+KY ++ +G Y+ E   ATV AI+  + F    +S     GLV+D T FYAE GGQ YD G MV  +    ++TEF V   ++ GG+VLH+G  L G LKVGD+            +M+  T   TH+LN+ALR ++G+ DQ+GSLVAPD+LRFDF+AKG +  +++RK E I   II E K VY  + +L+ AK IQG+RAVF ETYPDPVRVVSIG+PV+DL+   + P  S+  SVEFCGGTHL NS H    +I +E AI+KG+RRI A+TGAEA+KA +    ++  +  LE    K  ++S  +D+   I D+   L  A I+ W K+ LR +L++L+K +D L++  K  +Q  ++E    +IE     N+  LV+   +GA   ++N++ + ++ +    + + +SVD  + KI C   V ++       A  W+++V++++ G+ GG D SAQ TG  +  L  + ++A  FA M +
Sbjct:    6 TASEIRQKFIDFFKENAHTYVHSSATVPLDDPTLLFANAGMNQFKPIFLNTIDPSHPMAKLNRAANTQKCIRAGGKHNDLDDVGKDVYHHTFFEMLGSWSFGDYFKELACKLALDLLTKEFGIDIERLYVTYFGGNEAAGLEPDLECKQIWLNLGLPESRILPGSMKDNFWEMGDTGPCGPCSEIHFDRIGGRDAAHLVNMDDPNVLEIWNLVFIQFNRETDGTLKPLPKKSIDTGMGLERLVSVLQNKMSNYDTDLFVPYFEAIEKGTGARPYTGKVGAEDVDGIDMAYRVLADHARTITVALADGGRPDNTGRGYVLRRILRRAVRYAHEKLNASKGFFATLVDVVVQSLGNAFPELKKDPDMVKDIINEEETQFLKTLNRGRRILDRKINSLGEHKV----IPGDTAWLLYDTYGFPVDLTSLIAEERGLTLDLESFEEERKAAQLKSQGKGTGDEDLLMLDIYAIEELRSQGLEPTDDLPKYKYTSNADGVYEFESLIATVKAIRRDKMF-VEEASTGQECGLVLDKTCFYAEQGGQTYDEGYMVKEEESSEDKTEFTVRNTQVRGGYVLHMG-TLYGHLKVGDQ------------VMRPGTSCSTHILNFALRSVLGEADQRGSLVAPDRLRFDFTAKGAMSTQEIRKTEEIANDIIKENKVVYALDCSLAEAKAIQGLRAVFDETYPDPVRVVSIGIPVEDLLADPSSPAGSIT-SVEFCGGTHLQNSGHAGPFIIVTEEAIAKGIRRIVAVTGAEAQKALRRQDALKVNLSDLEKKVKK--QNSPNKDVQKEIADLSENLATASIAQWQKDVLREQLKTLKKTMDDLDRASKADVQKRVLEITKQLIEE--HPNQPLLVLEMENGASAKALNESLKLLKSQSPHTAAMIFSVDNDAGKITCLCQVPQDTADKGLKANEWVQQVSDLMDGRGGGKDTSAQATGKNVGCLSQVLKLAEDFAKMKL 953          
BLAST of alanine--tRNA ligase, cytoplasmic vs. Ensembl Xenopus
Match: kmt5b (lysine methyltransferase 5B [Source:Xenbase;Acc:XB-GENE-852757])

HSP 1 Score: 1005.74 bits (2599), Expect = 0.000e+0
Identity = 508/990 (51.31%), Postives = 673/990 (67.98%), Query Frame = 2
Query:   83 NSSTIRREFVDFFKEKSHLNIHSSSTIPLNDPTLLFSNAGMNQFKKIFLGTADPNSDMAKWKRVANSQKCIRAGGKHNDLDDVGKDVYHHTFFEMLGNWSFGDYFKKEAISWAWELLTKVWGLPKDRFYVTYFGGNTELGLESDEEAKDIWLSMGIDASRVLPFGMKDNFWEMGETGPCGPCSEIHFDRIGNRDASELVNADDPDVLEVWNLVFIQYNRELDRSLKSLPHKHVDTGMGFERIVSVIQNKSSNYDTDLFQPLFDRIQAETNCRSYQGKLGDDDEGGIDMAYRVLADHARTLTIALSDGGQPQNTGRGYVLRRILRRAVRYAVDKLHAKPGMFSNLVDTVVDLLGEAFPEIKHSKENVKQIINEEESQFMKTLKRGKKMFDKSLEDFKQIKTGQTFLPGRIAWMLYDTYGYPLDLTALMCDESGIKINMEEYETCRKLAQETSQGSGDTVYLSVDLDVHDIDKLQTKKLQPTDDIPKFKYNADENGNYQLECHQATVLAIKIKEGFXXXXXXXXXXXGLVMDSTNFYAESGGQMYDTGSMVLND---VEQTEFEVATVKLCGGFVLHIGRVLNGSLKVGDRLKLEVDDARRKCLMQNHTGTHVLNYALREIVGDVDQKGSLVAPDKLRFDFSAKGQVDNEQLRKVETICKSIINEKKQVYVKEVALSIAKEIQGIRAVFGETYPDPVRVVSIGVPVDDLINSINEPKPSLNASVEFCGGTHLTNSHHISELVITSESAISKGVRRIFALTGAEAEKACKIASQMECEVGKLENTFSKTMEDSRIRDLLNSIKDMKRELDEALISYWFKNSLRARLESLRKELDSLEKTKKELLQANLMEQAWPVIENAVSHNKKFLVIRFLDGAD-----------QTSINKAFREIQKKHKSLSLLG----------YSVDVTSNKIECKASVAKEMVTASFNAKNWIEKVTEIVGGKSGGSDQSAQVTGVALMNLHGLEEMANKFANMNI 2980
             +S IR++F+DFFKE +H  +HSS+T+PL+DPTLLF+NAGMNQFK IFL T DP+  MAK  R AN+QKCIRAGGKHNDLDDVGKDVYHHTFFEMLG+WSFGDYFK               GL  +R YVTYFGGN   GLE D E K IWL++G+  SR+LP  MKDNFWEMG+TGPCGPCSEIHFDRIG RDA+ LVN DDP+VLE+WNLVFIQ+NRE D +LK LP K +DTGMG ER+VSV+QNK SNYDTDLF P F+ I+  T  R Y GK+G +D  GIDMAYRVLADHART+T+AL+DGG+P NTGRGYVLRRILRRAVRYA +KL+A  G F+ LVD VV  LG AFPE+K   + VK IINEEE+QF+KTL RG+++ D+ +    + K     +PG  AW+LYDTYG+P+DLT+L+ +E G+ +++E +E  RK AQ  SQG G      + LD++ I++L+++ L+PTDD+PK+KY ++ +G Y+ E   ATV AI+  + F    +S     GLV+D T FYAE GGQ YD G MV  +    ++TEF V   ++ GG+VLH+G  L G LKVGD++ L VD+ +R+ +M NHT TH+LN+ALR ++G+ DQ+GSLVAPD+LRFDF+AKG +  +++RK E I   II E K VY  + +L+ AK IQG+RAVF ETYPDPVRVVSIG+PV+DL+   + P  S+  SVEFCGGTHL NS H    +I +E AI+KG+RRI A+TGAEA+KA +    ++  +  LE    K  ++S  +D+   I D+   L  A I+ W K+ LR +L++L+K +D L++  K  +Q  ++E    +IE     N+  LV+   +G                +     +IQ  ++SL LL           +SVD  + KI C   V ++       A  W+++V++++ G+ GG D SAQ TG  +  L  + ++A  FA M +
Sbjct:    6 TASEIRQKFIDFFKENAHTYVHSSATVPLDDPTLLFANAGMNQFKPIFLNTIDPSHPMAKLNRAANTQKCIRAGGKHNDLDDVGKDVYHHTFFEMLGSWSFGDYFK---------------GL-FERLYVTYFGGNEAAGLEPDLECKQIWLNLGLPESRILPGSMKDNFWEMGDTGPCGPCSEIHFDRIGGRDAAHLVNMDDPNVLEIWNLVFIQFNRETDGTLKPLPKKSIDTGMGLERLVSVLQNKMSNYDTDLFVPYFEAIEKGTGARPYTGKVGAEDVDGIDMAYRVLADHARTITVALADGGRPDNTGRGYVLRRILRRAVRYAHEKLNASKGFFATLVDVVVQSLGNAFPELKKDPDMVKDIINEEETQFLKTLNRGRRILDRKINSLGEHKV----IPGDTAWLLYDTYGFPVDLTSLIAEERGLTLDLESFEEERKAAQLKSQGKGTGDEDLLMLDIYAIEELRSQGLEPTDDLPKYKYTSNADGVYEFESLIATVKAIRRDKMF-VEEASTGQECGLVLDKTCFYAEQGGQTYDEGYMVKEEESSEDKTEFTVRNTQVRGGYVLHMG-TLYGHLKVGDQVCLYVDEPKRRPIMSNHTATHILNFALRSVLGEADQRGSLVAPDRLRFDFTAKGAMSTQEIRKTEEIANDIIKENKVVYALDCSLAEAKAIQGLRAVFDETYPDPVRVVSIGIPVEDLLADPSSPAGSIT-SVEFCGGTHLQNSGHAGPFIIVTEEAIAKGIRRIVAVTGAEAQKALRRQDALKVNLSDLEKKVKK--QNSPNKDVQKEIADLSENLATASIAQWQKDVLREQLKTLKKTMDDLDRASKADVQKRVLEITKQLIEE--HPNQPLLVLEMENGRQLLLSFFPEIMYMLGLGSLLSKIQALNESLKLLKSQSPHTAAMIFSVDNDAGKITCLCQVPQDTADKGLKANEWVQQVSDLMDGRGGGKDTSAQATGKNVGCLSQVLKLAEDFAKMKL 968          
BLAST of alanine--tRNA ligase, cytoplasmic vs. Ensembl Mouse
Match: Aars (alanyl-tRNA synthetase [Source:MGI Symbol;Acc:MGI:2384560])

HSP 1 Score: 1032.71 bits (2669), Expect = 0.000e+0
Identity = 501/965 (51.92%), Postives = 668/965 (69.22%), Query Frame = 2
Query:   95 IRREFVDFFKEKSHLNIHSSSTIPLNDPTLLFSNAGMNQFKKIFLGTADPNSDMAKWKRVANSQKCIRAGGKHNDLDDVGKDVYHHTFFEMLGNWSFGDYFKKEAISWAWELLTKVWGLPKDRFYVTYFGGNTELGLESDEEAKDIWLSMGIDASRVLPFGMKDNFWEMGETGPCGPCSEIHFDRIGNRDASELVNADDPDVLEVWNLVFIQYNRELDRSLKSLPHKHVDTGMGFERIVSVIQNKSSNYDTDLFQPLFDRIQAETNCRSYQGKLGDDDEGGIDMAYRVLADHARTLTIALSDGGQPQNTGRGYVLRRILRRAVRYAVDKLHAKPGMFSNLVDTVVDLLGEAFPEIKHSKENVKQIINEEESQFMKTLKRGKKMFDKSLEDFKQIKTGQTFLPGRIAWMLYDTYGYPLDLTALMCDESGIKINMEEYETCRKLAQETSQGSGDTVYLSVDLDVHDIDKLQTKKLQPTDDIPKFKYNADENGNYQLECHQATVLAIKIKEGFXXXXXXXXXXXGLVMDSTNFYAESGGQMYDTGSMVLND---VEQTEFEVATVKLCGGFVLHIGRVLNGSLKVGDRLKLEVDDARRKCLMQNHTGTHVLNYALREIVGDVDQKGSLVAPDKLRFDFSAKGQVDNEQLRKVETICKSIINEKKQVYVKEVALSIAKEIQGIRAVFGETYPDPVRVVSIGVPVDDLINSINEPKPSLNASVEFCGGTHLTNSHHISELVITSESAISKGVRRIFALTGAEAEKACKIASQMECEVGKLENTFSKTMEDSRIRDLLNSIKDMKRELDEALISYWFKNSLRARLESLRKELDSLEKTKKELLQANLMEQAWPVIENAVSHNKKFLVIRFLDGADQTSINKAFREIQKKHKSLSLLGYSVDVTSNKIECKASVAKEMVTASFNAKNWIEKVTEIVGGKSGGSDQSAQVTGVALMNLHGLEEMANKFANMNI 2980
            IR  F++FF+   H  +HSS+TIPL+DPTLLF+NAGMNQFK IFL T DP+  MAK  R AN+QKCIRAGGKHNDLDDVGKDVYHHTFFEMLG+WSFGDYFK+ A   A ELLT+ +G+P +R YVTYFGG+   GLE D E + IW ++G+D +R+LP  MKDNFWEMG+TGPCGPCSEIH+DRIG RDA+ LVN DDP+VLE+WNLVFIQYNRE D  LK LP K +DTGMG ER+VSV+QNK SNYDTDLF P F+ IQ  T  R Y GK+G +D  GIDMAYRVLADHART+T+AL+DGG+P NTGRGYVLRRILRRAVRY+ +KL+A  G F+ LVD VV  LG+AFPE+K   E VK IINEEE QF+KTL RG+++ D+ ++     KT    +PG  AW+LYDTYG+P+DLT L+ +E G+ ++M  +E  R+LAQ  SQG G      + LD++ I++L+ K L+ TDD PK+ Y +D +G+Y  EC  ATVLA++ +E             G+V+D T FYAE GGQ+YD G +V  D    ++TEF V   ++ GG+VLHIG +  G+LKVGD+++L +D+ RR+ +M NHT TH+LN+ALR ++G+ DQKGSLVAPD+LRFDF+AKG +  +Q++K E I   +I   K VY ++  L+ AK IQG+RAVF ETYPDPVRVVSIGVPV +L++    P  SL  SVEFCGGTHL NS H    VI +E AI+KG+RRI A+TGAEA+KA + +  ++  +  +E         +  +D+   I D+   L  A+I  W K+  R  L+SL+K +D L++  K  +Q  ++E+   +I++  + N+  +++    GA   ++N+A +  +      S + ++VD  + KI C   V +        A  W+++V+ ++ GK GG D SAQ TG  +  L    ++A  FA + +
Sbjct:   10 IRERFINFFRRNEHTYVHSSATIPLDDPTLLFANAGMNQFKPIFLNTIDPSHPMAKLSRAANTQKCIRAGGKHNDLDDVGKDVYHHTFFEMLGSWSFGDYFKELACKMALELLTQEFGIPVERLYVTYFGGDEAAGLEPDLECRQIWQNLGLDEARILPGNMKDNFWEMGDTGPCGPCSEIHYDRIGGRDAAHLVNQDDPNVLEIWNLVFIQYNRESDGVLKPLPKKSIDTGMGLERLVSVLQNKMSNYDTDLFMPYFEAIQKGTGARPYTGKVGAEDADGIDMAYRVLADHARTITVALADGGRPDNTGRGYVLRRILRRAVRYSHEKLNASRGFFATLVDVVVQSLGDAFPELKKDPEMVKDIINEEEVQFLKTLSRGRRILDRKIQSLGDCKT----IPGDTAWLLYDTYGFPVDLTGLIAEEKGLVVDMNGFEEERRLAQLKSQGKGAGDEDLIMLDIYAIEELRAKGLEATDDSPKYNYQSDSSGSYVFECTVATVLALR-REKMFVDEVVTGQECGVVLDKTCFYAEQGGQIYDEGYLVKVDDSSEDKTEFTVKNAQVRGGYVLHIGTIY-GNLKVGDQVRLFIDEPRRRPVMSNHTATHILNFALRSVLGEADQKGSLVAPDRLRFDFTAKGAMSTQQIKKAEEIVNGMIEAAKPVYTQDCPLAAAKAIQGLRAVFDETYPDPVRVVSIGVPVSELLDDPCGPAGSLT-SVEFCGGTHLRNSSHAGAFVIVTEEAIAKGIRRIVAVTGAEAQKALRKSETLKKSLSAMEAKVKAQTAPN--KDVQREIADLGEALATAVIPQWQKDEQRETLKSLKKVMDDLDRASKADVQKRVLEKTKQLIDS--NPNQPLVILEMESGASAKALNEALKLFKTHSPQTSAMLFTVDNEAGKITCLCQVPQNAANRGLKASEWVQQVSGLMDGKGGGKDMSAQATGKNVGCLQEALQLATSFAQLRL 963          
BLAST of alanine--tRNA ligase, cytoplasmic vs. Ensembl Mouse
Match: Aars2 (alanyl-tRNA synthetase 2, mitochondrial [Source:MGI Symbol;Acc:MGI:2681839])

HSP 1 Score: 737.643 bits (1903), Expect = 0.000e+0
Identity = 391/952 (41.07%), Postives = 589/952 (61.87%), Query Frame = 2
Query:   83 NSSTIRREFVDFFKEK-SHLNIHSSSTIPLNDPTLLFSNAGMNQFKKIFLGTADPNSDMAKWKRVANSQKCIRAGGKHNDLDDVGKDVYHHTFFEMLGNWSFG-DYFKKEAISWAWELLTKVWGLPKDRFYVTYFGGNTELGLESDEEAKDIWLSMGIDASRVLPFGMKDNFWEMGETGPCGPCSEIHFDRIGNRDASELVNADDPDVLEVWNLVFIQYNRELDRSLKSLPHKHVDTGMGFERIVSVIQNKSSNYDTDLFQPLFDRIQAETNCRSYQGKLGDDDEGGIDMAYRVLADHARTLTIALSDGGQPQNTGRGYVLRRILRRAVRYAVDKLHAKPGMFSNLVDTVVDLLGEAFPEIKHSKENVKQIINEEESQFMKTLKRGKKMFDKSLEDFKQIKTGQTFLPGRIAW--MLYDTYGYPLDLTALMCDESGIKINMEEYET-CRKLAQETSQGSGDTVYLSVDLDVHDIDKLQTKKLQPTDDIPKFKYNADENGNYQLECHQATVLAIKIKEGFXXXXXXXXXXXGLVMDSTNFYAESGGQMYDTGSMVLNDVEQTEFEVATVKLCGGFVLHIGRVLNGSLKVGDRLKLEVDDARRKCLMQNHTGTHVLNYALREIVGD-VDQKGSLVAPDKLRFDFSAKGQVDNEQLRKVETICKSIINEKKQVYVKEVALSIAKEIQGIRAVFGETYPDPVRVVSIGVPVDDLINSINEPKPSLNASVEFCGGTHLTNSHHISELVITSESAISKGVRRIFALTGAEAEKACKIASQMECEVGKLENTFSKTMED-SRIRDLLNSIKDMKRELDEALISYWFKNSLRARLESLRKELDSLEKTKKELLQANLMEQAWPVIENAVSHNKKFLVIRFLDGADQTSINKAFREIQKKHKSLSLLGYSVDVTSNKIECKASVAKEMVTASFNAKNWIEKVTEIVGGKSGGSDQSAQVTG 2917
            + + +R  F+ FF+++  H  + S++  P  DP+LLF NAGMNQFK IFLGT DP S+MA ++RV NSQKC+RAGG+HNDL+DVG+D+ HHTFFEMLGNW+FG +YFK+EA S AWELLT+V+G+P+DR +V+YF G+++ GL+ D E +DIWLS+G+ ASRVL FG ++NFWEMG+TGPCGPC+EIH+D  G            P ++E+WNLVF+Q+ RE D SL+ LP +HVDTGMG ER+V+V+Q K S YDTDLF PL D I        Y G++G  DEG ID AYRV+ADH RTL++ ++DG  P  +G   VLRRILRRAVRY+ + L A PG   +LV  VV+ LG A+PE++ +   +  +++E+E+ F+ +L+RG+++ D+++   K++     F P  +AW   L    G PLDL  LM +E G+K++    E   +K AQ  +Q +       + LDVH +++L  + +  TDD PK+ Y    NG+Y+    +A VL +  + G   +        GL++D TNFYAE GGQ  D G +V    +   F VA  +LCGGF+LH        L+VGD+++L VD A R   M  HT TH+L++ALR+ +G   +Q+GS + P++LRFD + +  +  EQLR VE+  + ++ + K V+++EV L+    I G+R+   E YPDPVRVVS+GVPV   +   ++   +++ SVE C GTHL ++  + +LVI  E  + KG+ R+ A+TG +A++A ++   +  EV       S+   D      L   I  +    + A+I  W +  L+  L+ L++  ++     ++L +    E++  +++    H++  L++  +     + + K  R++ K+  S+S+L  S   T + + C   VA++  T +F A+ W   V   +GGK+ GS   AQ TG
Sbjct:   33 HGAAVRDAFLSFFRDRHGHRLVPSATVRPRGDPSLLFVNAGMNQFKPIFLGTVDPRSEMAGFRRVVNSQKCVRAGGRHNDLEDVGRDLSHHTFFEMLGNWAFGGEYFKEEACSMAWELLTQVYGIPEDRLWVSYFSGDSQTGLDPDLETRDIWLSLGVPASRVLSFGPQENFWEMGDTGPCGPCTEIHYDLAGG--------VGSPQLVELWNLVFMQHYREADGSLQLLPQRHVDTGMGLERLVAVLQGKRSTYDTDLFSPLLDAIHQSCGAPPYSGRVGAADEGRIDTAYRVVADHIRTLSVCIADGVSPGMSGAPLVLRRILRRAVRYSTEVLQAPPGFLGSLVPVVVETLGSAYPELEKNSVKIASLVSEDEAAFLASLQRGRRIIDRTV---KRLGPSDLF-PAEVAWSLSLSGNLGIPLDLVELMLEEKGVKLDTAGLEQLAQKEAQHRAQQAEADQEDRLCLDVHALEELHRQGIPTTDDSPKYNYTLHPNGDYEFGLCEARVLQLYSETGTAVASVGAGQRCGLLLDRTNFYAEQGGQASDRGYLVRTGQQDMLFPVAGAQLCGGFILHEAMAPE-RLQVGDQVQLYVDKAWRMGCMVKHTATHLLSWALRQTLGPTTEQRGSHLNPERLRFDVATQTLLTTEQLRTVESYVQEVVGQDKPVFMEEVPLAHTARIPGLRS-LDEVYPDPVRVVSVGVPVAHALGPASQ--AAMHTSVELCCGTHLLSTGAVGDLVIIGERQLVKGITRLLAITGEQAQQAREVGQSLSQEVEAASERLSQGSRDLPEAHRLSKDIGRLTEVAESAVIPQWQRQELQTTLKMLQRRANT---AIRKLEKGQATEKSQELLKR---HSEGPLIVDTVSAESLSVLVKVVRQLCKQAPSISVLLLSPQPTGS-VLCACQVAQD-ATPTFTAEAWALAVCSHMGGKAWGSRVVAQGTG 960          
BLAST of alanine--tRNA ligase, cytoplasmic vs. UniProt/SwissProt
Match: sp|Q9VLM8|SYAC_DROME (Alanine--tRNA ligase, cytoplasmic OS=Drosophila melanogaster OX=7227 GN=AlaRS PE=2 SV=1)

HSP 1 Score: 1036.56 bits (2679), Expect = 0.000e+0
Identity = 512/966 (53.00%), Postives = 668/966 (69.15%), Query Frame = 2
Query:   95 IRREFVDFFKEKSHLNIHSSSTIPLNDPTLLFSNAGMNQFKKIFLGTADPNSDMAKWKRVANSQKCIRAGGKHNDLDDVGKDVYHHTFFEMLGNWSFGDYFKKEAISWAWELLTKVWGLPKDRFYVTYFGGNTELGLESDEEAKDIWLSMGIDASRVLPFGMKDNFWEMGETGPCGPCSEIHFDRIGNRDASELVNADDPDVLEVWNLVFIQYNRELDRSLKSLPHKHVDTGMGFERIVSVIQNKSSNYDTDLFQPLFDRIQAETNCRSYQGKLGDDDEGGIDMAYRVLADHARTLTIALSDGGQPQNTGRGYVLRRILRRAVRYAVDKLHAKPGMFSNLVDTVVDLLGEAFPEIKHSKENVKQIINEEESQFMKTLKRGKKMFDKSLEDFKQIKTGQTFLPGRIAWMLYDTYGYPLDLTALMCDESGIKINMEEYETCRKLAQETSQGSGDTVYLSVDLDVHDIDKLQTKKLQPTDDIPKFKYNA---DENGNYQLECHQATVLAIKIKEGFXXXXXXXXXXXGLVMDSTNFYAESGGQMYDTGSMVLNDVEQTEFEVATVKLCGGFVLHIGRVLNGSLKVGDRLKLEVDDARRKCLMQNHTGTHVLNYALREIVG-DVDQKGSLVAPDKLRFDFSAKGQVDNEQLRKVETICKSIINEKKQVYVKEVALSIAKEIQGIRAVFGETYPDPVRVVSIGVPVDDLINSINEPKPSLNA----SVEFCGGTHLTNSHHISELVITSESAISKGVRRIFALTGAEAEKACKIASQMECEVGKLENTFSKTMEDSRIRDLLNSIKDMKRELDEALISYWFKNSLRARLESLRKELDSLEKTKKELLQANLMEQAWPVIENAVSHNKKFLVIRFLDGADQTSINKAFREIQKKHKSLSLLGYSVDVTSNKIECKASVAKEMVTASFNAKNWIEKVTEIVGGKSGGSDQSAQVTGVALMNLHGLEEMANKFA 2968
            +R  ++DFFKE+ H+ +HSSSTIPL+DPTLLF+NAGMNQFK IFLGTADPNS+M+KW RVAN+QKCIRAGGKHNDLDDVGKDVYHHTFFEMLGNWSFGDYFKKE  SWAWE LT+   LPKDR YVTYFGG+   GLE D E K +WL +G+    +LP  MKDNFWEMGETGPCGPCSE+HFDRIG R   ELVN DDPDVLE+WNLVFIQYNRE D SLK LP KH+D GMGFER+VSVIQNK SNYDTDLF PLFD IQA T    YQG++G DD  GIDMAYRVLADHART+TIAL+DGG P NTGRGYVLRRILRRAVRYA +KL+AKPG F+ LV+TVVDLLG+AFPE+K   +++  IINEEE QF+KTL RG+ + ++++E        QT +PG +AW LYDTYG+P+DLT LM +E  +KI+M+ YE  +  +   SQG G +    ++LDVH I +LQ + + PT+D  K+KY A   + +  Y      + ++A++ +  F  +  +     G+V+D TNFYAESGGQ+YD G++V  + E  EF V  V   GG++LHIG V+ G+LKVGD L+L +D  RR   M+NH+ TH LN+ L +++G D +QKGSLV P+KLRFDF++K  +  EQ+ K E + K ++ +   +Y KE  L++AK+I+G+R+VF E YPDPVRV+S GVPVD+L     E  P   A    SVEFCGGTHL  S HI + VI+SE AI+KG+RRI ALTG EA KA K +   E E+ +L+ T          +  +  I ++  ++  A I Y  K+ +R  L+ L+K LD  E+  +  +   ++E+A  + E   + N   LV +     +  +++ A ++++ +    + +  SVD  S KI C +SV K  V     A  W++ V+  +GGK GG  +SAQ +G     +  + ++A+KFA
Sbjct:    9 VRNAYLDFFKEQKHIYVHSSSTIPLDDPTLLFANAGMNQFKPIFLGTADPNSEMSKWVRVANTQKCIRAGGKHNDLDDVGKDVYHHTFFEMLGNWSFGDYFKKEICSWAWEFLTQRLALPKDRLYVTYFGGDAASGLEPDLECKQMWLDLGLKPEHILPGSMKDNFWEMGETGPCGPCSELHFDRIGGRSVPELVNMDDPDVLEIWNLVFIQYNRESDGSLKQLPKKHIDCGMGFERLVSVIQNKRSNYDTDLFVPLFDAIQAGTGAPPYQGRVGADDVDGIDMAYRVLADHARTITIALADGGTPDNTGRGYVLRRILRRAVRYATEKLNAKPGFFATLVNTVVDLLGDAFPEVKKDPQHIIDIINEEELQFLKTLTRGRNLLNRTIEKLGN----QTTIPGDVAWRLYDTYGFPVDLTQLMAEEKSLKIDMDGYEAAKHNSYVLSQGKGASKIEEINLDVHAISQLQEQGVPPTNDTFKYKYEAVSDERDSAYNYGVCNSKIVALRFENQF-VNEITSGQKAGIVLDKTNFYAESGGQIYDQGALVKVNDEANEFLVDRVYNRGGYILHIG-VVEGTLKVGDELELHIDVERRWLTMKNHSATHALNHCLLQVLGKDTEQKGSLVVPEKLRFDFNSKAAMTIEQVSKTEQLTKEMVYKNVPIYAKESKLALAKKIRGLRSVFDEVYPDPVRVISFGVPVDEL-----EQNPDSEAGEQTSVEFCGGTHLRRSGHIMDFVISSEEAIAKGIRRIVALTGPEALKALKKSEAFEQEIVRLKATIDNDKSGKDSKSHVKEIVELTEQISHATIPYVKKDEMRNLLKGLKKTLDDKERALRAAVSVTVVERAKTLCE--ANPNATVLVEQLEAFNNTKALDAALKQVRSQLPDAAAMFLSVDADSKKIFCLSSVPKSAVEKGLKANEWVQHVSATLGGKGGGKPESAQASGTNYEKVDEIVQLASKFA 961          
BLAST of alanine--tRNA ligase, cytoplasmic vs. UniProt/SwissProt
Match: sp|Q8BGQ7|SYAC_MOUSE (Alanine--tRNA ligase, cytoplasmic OS=Mus musculus OX=10090 GN=Aars1 PE=1 SV=1)

HSP 1 Score: 1032.71 bits (2669), Expect = 0.000e+0
Identity = 501/965 (51.92%), Postives = 668/965 (69.22%), Query Frame = 2
Query:   95 IRREFVDFFKEKSHLNIHSSSTIPLNDPTLLFSNAGMNQFKKIFLGTADPNSDMAKWKRVANSQKCIRAGGKHNDLDDVGKDVYHHTFFEMLGNWSFGDYFKKEAISWAWELLTKVWGLPKDRFYVTYFGGNTELGLESDEEAKDIWLSMGIDASRVLPFGMKDNFWEMGETGPCGPCSEIHFDRIGNRDASELVNADDPDVLEVWNLVFIQYNRELDRSLKSLPHKHVDTGMGFERIVSVIQNKSSNYDTDLFQPLFDRIQAETNCRSYQGKLGDDDEGGIDMAYRVLADHARTLTIALSDGGQPQNTGRGYVLRRILRRAVRYAVDKLHAKPGMFSNLVDTVVDLLGEAFPEIKHSKENVKQIINEEESQFMKTLKRGKKMFDKSLEDFKQIKTGQTFLPGRIAWMLYDTYGYPLDLTALMCDESGIKINMEEYETCRKLAQETSQGSGDTVYLSVDLDVHDIDKLQTKKLQPTDDIPKFKYNADENGNYQLECHQATVLAIKIKEGFXXXXXXXXXXXGLVMDSTNFYAESGGQMYDTGSMVLND---VEQTEFEVATVKLCGGFVLHIGRVLNGSLKVGDRLKLEVDDARRKCLMQNHTGTHVLNYALREIVGDVDQKGSLVAPDKLRFDFSAKGQVDNEQLRKVETICKSIINEKKQVYVKEVALSIAKEIQGIRAVFGETYPDPVRVVSIGVPVDDLINSINEPKPSLNASVEFCGGTHLTNSHHISELVITSESAISKGVRRIFALTGAEAEKACKIASQMECEVGKLENTFSKTMEDSRIRDLLNSIKDMKRELDEALISYWFKNSLRARLESLRKELDSLEKTKKELLQANLMEQAWPVIENAVSHNKKFLVIRFLDGADQTSINKAFREIQKKHKSLSLLGYSVDVTSNKIECKASVAKEMVTASFNAKNWIEKVTEIVGGKSGGSDQSAQVTGVALMNLHGLEEMANKFANMNI 2980
            IR  F++FF+   H  +HSS+TIPL+DPTLLF+NAGMNQFK IFL T DP+  MAK  R AN+QKCIRAGGKHNDLDDVGKDVYHHTFFEMLG+WSFGDYFK+ A   A ELLT+ +G+P +R YVTYFGG+   GLE D E + IW ++G+D +R+LP  MKDNFWEMG+TGPCGPCSEIH+DRIG RDA+ LVN DDP+VLE+WNLVFIQYNRE D  LK LP K +DTGMG ER+VSV+QNK SNYDTDLF P F+ IQ  T  R Y GK+G +D  GIDMAYRVLADHART+T+AL+DGG+P NTGRGYVLRRILRRAVRY+ +KL+A  G F+ LVD VV  LG+AFPE+K   E VK IINEEE QF+KTL RG+++ D+ ++     KT    +PG  AW+LYDTYG+P+DLT L+ +E G+ ++M  +E  R+LAQ  SQG G      + LD++ I++L+ K L+ TDD PK+ Y +D +G+Y  EC  ATVLA++ +E             G+V+D T FYAE GGQ+YD G +V  D    ++TEF V   ++ GG+VLHIG +  G+LKVGD+++L +D+ RR+ +M NHT TH+LN+ALR ++G+ DQKGSLVAPD+LRFDF+AKG +  +Q++K E I   +I   K VY ++  L+ AK IQG+RAVF ETYPDPVRVVSIGVPV +L++    P  SL  SVEFCGGTHL NS H    VI +E AI+KG+RRI A+TGAEA+KA + +  ++  +  +E         +  +D+   I D+   L  A+I  W K+  R  L+SL+K +D L++  K  +Q  ++E+   +I++  + N+  +++    GA   ++N+A +  +      S + ++VD  + KI C   V +        A  W+++V+ ++ GK GG D SAQ TG  +  L    ++A  FA + +
Sbjct:   10 IRERFINFFRRNEHTYVHSSATIPLDDPTLLFANAGMNQFKPIFLNTIDPSHPMAKLSRAANTQKCIRAGGKHNDLDDVGKDVYHHTFFEMLGSWSFGDYFKELACKMALELLTQEFGIPVERLYVTYFGGDEAAGLEPDLECRQIWQNLGLDEARILPGNMKDNFWEMGDTGPCGPCSEIHYDRIGGRDAAHLVNQDDPNVLEIWNLVFIQYNRESDGVLKPLPKKSIDTGMGLERLVSVLQNKMSNYDTDLFMPYFEAIQKGTGARPYTGKVGAEDADGIDMAYRVLADHARTITVALADGGRPDNTGRGYVLRRILRRAVRYSHEKLNASRGFFATLVDVVVQSLGDAFPELKKDPEMVKDIINEEEVQFLKTLSRGRRILDRKIQSLGDCKT----IPGDTAWLLYDTYGFPVDLTGLIAEEKGLVVDMNGFEEERRLAQLKSQGKGAGDEDLIMLDIYAIEELRAKGLEATDDSPKYNYQSDSSGSYVFECTVATVLALR-REKMFVDEVVTGQECGVVLDKTCFYAEQGGQIYDEGYLVKVDDSSEDKTEFTVKNAQVRGGYVLHIGTIY-GNLKVGDQVRLFIDEPRRRPVMSNHTATHILNFALRSVLGEADQKGSLVAPDRLRFDFTAKGAMSTQQIKKAEEIVNGMIEAAKPVYTQDCPLAAAKAIQGLRAVFDETYPDPVRVVSIGVPVSELLDDPCGPAGSLT-SVEFCGGTHLRNSSHAGAFVIVTEEAIAKGIRRIVAVTGAEAQKALRKSETLKKSLSAMEAKVKAQTAPN--KDVQREIADLGEALATAVIPQWQKDEQRETLKSLKKVMDDLDRASKADVQKRVLEKTKQLIDS--NPNQPLVILEMESGASAKALNEALKLFKTHSPQTSAMLFTVDNEAGKITCLCQVPQNAANRGLKASEWVQQVSGLMDGKGGGKDMSAQATGKNVGCLQEALQLATSFAQLRL 963          
BLAST of alanine--tRNA ligase, cytoplasmic vs. UniProt/SwissProt
Match: sp|Q5RC02|SYAC_PONAB (Alanine--tRNA ligase, cytoplasmic OS=Pongo abelii OX=9601 GN=AARS1 PE=2 SV=1)

HSP 1 Score: 1029.24 bits (2660), Expect = 0.000e+0
Identity = 505/969 (52.12%), Postives = 673/969 (69.45%), Query Frame = 2
Query:   83 NSSTIRREFVDFFKEKSHLNIHSSSTIPLNDPTLLFSNAGMNQFKKIFLGTADPNSDMAKWKRVANSQKCIRAGGKHNDLDDVGKDVYHHTFFEMLGNWSFGDYFKKEAISWAWELLTKVWGLPKDRFYVTYFGGNTELGLESDEEAKDIWLSMGIDASRVLPFGMKDNFWEMGETGPCGPCSEIHFDRIGNRDASELVNADDPDVLEVWNLVFIQYNRELDRSLKSLPHKHVDTGMGFERIVSVIQNKSSNYDTDLFQPLFDRIQAETNCRSYQGKLGDDDEGGIDMAYRVLADHARTLTIALSDGGQPQNTGRGYVLRRILRRAVRYAVDKLHAKPGMFSNLVDTVVDLLGEAFPEIKHSKENVKQIINEEESQFMKTLKRGKKMFDKSLEDFKQIKTGQTFLPGRIAWMLYDTYGYPLDLTALMCDESGIKINMEEYETCRKLAQETSQGSGDTVYLSVDLDVHDIDKLQTKKLQPTDDIPKFKYNADENGNYQLECHQATVLAIKIKEGFXXXXXXXXXXXGLVMDSTNFYAESGGQMYDTGSMVLND---VEQTEFEVATVKLCGGFVLHIGRVLNGSLKVGDRLKLEVDDARRKCLMQNHTGTHVLNYALREIVGDVDQKGSLVAPDKLRFDFSAKGQVDNEQLRKVETICKSIINEKKQVYVKEVALSIAKEIQGIRAVFGETYPDPVRVVSIGVPVDDLINSINEPKPSLNASVEFCGGTHLTNSHHISELVITSESAISKGVRRIFALTGAEAEKACKIASQMECEVGKLENTFSKTMEDSRIRDLLNSIKDMKRELDEALISYWFKNSLRARLESLRKELDSLEKTKKELLQANLMEQAWPVIENAVSHNKKFLVIRFLDGADQTSINKAFREIQKKHKSLSLLGYSVDVTSNKIECKASVAKEMVTASFNAKNWIEKVTEIVGGKSGGSDQSAQVTGVALMNLHGLEEMANKFANMNI 2980
             +S IR+ F+DFFK   H  IHSS+TIPL+DPTLLF+NAGMNQFK IFL T DP+  MAK  R AN+QKCIRAGGKHNDLDDVGKDVYHHTFFEMLG+WSFGDYFK+ A   A ELLT+ +G+P +R YVTYFGG+   GLE D E K IW ++G+D +++LP  MKDNFWEMG+TGPCGPCSEIH+DRIG RDA+ LVN DDP+VLE+WNLVFIQYNRE D  LK LP K +DTGMG ER+VSV+QNK SNYDTDLF P F+ IQ  T  R Y GK+G +D  GIDMAYRVLADHART+T+AL+DGG+P NTGRGYVLRRILRRAVRYA +KL+A  G F+ LVD VV  LG+AFPE+K   + VK IINEEE QF+KTL RG+++ D+ ++     KT    +PG  AW+LYDTYG+P+DLT L+ +E G+ ++M+ +E  RKLAQ  SQG G      + LD++ I++L+ + L+ TDD PK+ Y+ D +G+Y  E   ATV+A++ +E       S     G+V+D T FYAE GGQ+YD G +V  D    ++TEF V   ++ GG+VLHIG +  G LKVGD++ L +D+ RR+ +M NHT TH+LN+ALR ++G+ DQKGSLVAPD+LRFDF+AKG +  +Q++K E I   +I   K VY ++ +L+ AK IQG+RAVF ETYPDPVRVVSIGVPV +L++  + P  SL  SVEFCGGTHL NS H    VI +E AI+KG+RRI A+TGAEA+KA + A  ++  +  +E         +  +D+   I D+   L  A+I  W K+ LR  L+SL+K +D L++  K  +Q  ++E+   +I++  + N+  +++    GA   ++N+A +  +      + + ++VD  + KI C   V +        A  W+++V+ ++ GK GG D SAQ TG  +  L    ++A  FA + +
Sbjct:    6 TASKIRQRFIDFFKRNEHTYIHSSATIPLDDPTLLFANAGMNQFKPIFLNTIDPSHPMAKPSRAANTQKCIRAGGKHNDLDDVGKDVYHHTFFEMLGSWSFGDYFKELACKMALELLTQEFGIPIERLYVTYFGGDEAAGLEPDLECKQIWQNLGLDDTKILPGNMKDNFWEMGDTGPCGPCSEIHYDRIGGRDAAHLVNQDDPNVLEIWNLVFIQYNREADGILKPLPKKSIDTGMGLERLVSVLQNKMSNYDTDLFVPYFEAIQKGTGARPYTGKVGAEDADGIDMAYRVLADHARTITVALADGGRPDNTGRGYVLRRILRRAVRYAHEKLNASRGFFATLVDVVVQSLGDAFPELKKDPDMVKDIINEEEVQFLKTLSRGRRILDRKIQSLGDSKT----IPGDTAWLLYDTYGFPVDLTGLIAEEKGLVVDMDGFEEERKLAQLKSQGKGAGGEDLIMLDIYAIEELRARDLEVTDDSPKYNYHLDSSGSYVFENTVATVMALR-REKMFVEEVSTGQECGVVLDKTCFYAEQGGQIYDEGYLVKVDDSSEDKTEFTVKNAQVRGGYVLHIGTIY-GDLKVGDQVWLFIDEPRRRPIMSNHTATHILNFALRSVLGEADQKGSLVAPDRLRFDFTAKGAMSTQQIKKAEEIANEMIEAAKPVYTQDCSLAAAKAIQGLRAVFDETYPDPVRVVSIGVPVSELLDDPSGPAGSLT-SVEFCGGTHLRNSSHAGAFVIVTEEAIAKGIRRIVAVTGAEAQKALRKAGSLKKPLSVMEAKVKAQTAPN--KDVQREIADLGEALATAVIPQWQKDELRETLKSLKKVMDDLDRASKADVQKRVLEKTKQLIDS--NPNQPLVILEMESGASAKALNEALKLFKMHSPQTAAMLFTVDNEAGKITCLCQVPQNAANRGLKASEWVQQVSGLMDGKGGGKDVSAQATGKNVGCLQEALQLATSFAQLRL 963          
BLAST of alanine--tRNA ligase, cytoplasmic vs. UniProt/SwissProt
Match: sp|P49588|SYAC_HUMAN (Alanine--tRNA ligase, cytoplasmic OS=Homo sapiens OX=9606 GN=AARS1 PE=1 SV=2)

HSP 1 Score: 1029.24 bits (2660), Expect = 0.000e+0
Identity = 505/969 (52.12%), Postives = 672/969 (69.35%), Query Frame = 2
Query:   83 NSSTIRREFVDFFKEKSHLNIHSSSTIPLNDPTLLFSNAGMNQFKKIFLGTADPNSDMAKWKRVANSQKCIRAGGKHNDLDDVGKDVYHHTFFEMLGNWSFGDYFKKEAISWAWELLTKVWGLPKDRFYVTYFGGNTELGLESDEEAKDIWLSMGIDASRVLPFGMKDNFWEMGETGPCGPCSEIHFDRIGNRDASELVNADDPDVLEVWNLVFIQYNRELDRSLKSLPHKHVDTGMGFERIVSVIQNKSSNYDTDLFQPLFDRIQAETNCRSYQGKLGDDDEGGIDMAYRVLADHARTLTIALSDGGQPQNTGRGYVLRRILRRAVRYAVDKLHAKPGMFSNLVDTVVDLLGEAFPEIKHSKENVKQIINEEESQFMKTLKRGKKMFDKSLEDFKQIKTGQTFLPGRIAWMLYDTYGYPLDLTALMCDESGIKINMEEYETCRKLAQETSQGSGDTVYLSVDLDVHDIDKLQTKKLQPTDDIPKFKYNADENGNYQLECHQATVLAIKIKEGFXXXXXXXXXXXGLVMDSTNFYAESGGQMYDTGSMVLND---VEQTEFEVATVKLCGGFVLHIGRVLNGSLKVGDRLKLEVDDARRKCLMQNHTGTHVLNYALREIVGDVDQKGSLVAPDKLRFDFSAKGQVDNEQLRKVETICKSIINEKKQVYVKEVALSIAKEIQGIRAVFGETYPDPVRVVSIGVPVDDLINSINEPKPSLNASVEFCGGTHLTNSHHISELVITSESAISKGVRRIFALTGAEAEKACKIASQMECEVGKLENTFSKTMEDSRIRDLLNSIKDMKRELDEALISYWFKNSLRARLESLRKELDSLEKTKKELLQANLMEQAWPVIENAVSHNKKFLVIRFLDGADQTSINKAFREIQKKHKSLSLLGYSVDVTSNKIECKASVAKEMVTASFNAKNWIEKVTEIVGGKSGGSDQSAQVTGVALMNLHGLEEMANKFANMNI 2980
             +S IR+ F+DFFK   H  +HSS+TIPL+DPTLLF+NAGMNQFK IFL T DP+  MAK  R AN+QKCIRAGGKHNDLDDVGKDVYHHTFFEMLG+WSFGDYFK+ A   A ELLT+ +G+P +R YVTYFGG+   GLE+D E K IW ++G+D +++LP  MKDNFWEMG+TGPCGPCSEIH+DRIG RDA+ LVN DDP+VLE+WNLVFIQYNRE D  LK LP K +DTGMG ER+VSV+QNK SNYDTDLF P F+ IQ  T  R Y GK+G +D  GIDMAYRVLADHART+T+AL+DGG+P NTGRGYVLRRILRRAVRYA +KL+A  G F+ LVD VV  LG+AFPE+K   + VK IINEEE QF+KTL RG+++ D+ ++     KT    +PG  AW+LYDTYG+P+DLT L+ +E G+ ++M+ +E  RKLAQ  SQG G      + LD++ I++L+ + L+ TDD PK+ Y+ D +G+Y  E   ATV+A++ +E       S     G+V+D T FYAE GGQ+YD G +V  D    ++TEF V   ++ GG+VLHIG +  G LKVGD++ L +D+ RR+ +M NHT TH+LN+ALR ++G+ DQKGSLVAPD+LRFDF+AKG +  +Q++K E I   +I   K VY ++  L+ AK IQG+RAVF ETYPDPVRVVSIGVPV +L++  + P  SL  SVEFCGGTHL NS H    VI +E AI+KG+RRI A+TGAEA+KA + A  ++  +  +E         +  +D+   I D+   L  A+I  W K+ LR  L+SL+K +D L++  K  +Q  ++E+    I++  + N+  +++    GA   ++N+A +  +      S + ++VD  + KI C   V +        A  W+++V+ ++ GK GG D SAQ TG  +  L    ++A  FA + +
Sbjct:    6 TASEIRQRFIDFFKRNEHTYVHSSATIPLDDPTLLFANAGMNQFKPIFLNTIDPSHPMAKLSRAANTQKCIRAGGKHNDLDDVGKDVYHHTFFEMLGSWSFGDYFKELACKMALELLTQEFGIPIERLYVTYFGGDEAAGLEADLECKQIWQNLGLDDTKILPGNMKDNFWEMGDTGPCGPCSEIHYDRIGGRDAAHLVNQDDPNVLEIWNLVFIQYNREADGILKPLPKKSIDTGMGLERLVSVLQNKMSNYDTDLFVPYFEAIQKGTGARPYTGKVGAEDADGIDMAYRVLADHARTITVALADGGRPDNTGRGYVLRRILRRAVRYAHEKLNASRGFFATLVDVVVQSLGDAFPELKKDPDMVKDIINEEEVQFLKTLSRGRRILDRKIQSLGDSKT----IPGDTAWLLYDTYGFPVDLTGLIAEEKGLVVDMDGFEEERKLAQLKSQGKGAGGEDLIMLDIYAIEELRARGLEVTDDSPKYNYHLDSSGSYVFENTVATVMALR-REKMFVEEVSTGQECGVVLDKTCFYAEQGGQIYDEGYLVKVDDSSEDKTEFTVKNAQVRGGYVLHIGTIY-GDLKVGDQVWLFIDEPRRRPIMSNHTATHILNFALRSVLGEADQKGSLVAPDRLRFDFTAKGAMSTQQIKKAEEIANEMIEAAKAVYTQDCPLAAAKAIQGLRAVFDETYPDPVRVVSIGVPVSELLDDPSGPAGSLT-SVEFCGGTHLRNSSHAGAFVIVTEEAIAKGIRRIVAVTGAEAQKALRKAESLKKCLSVMEAKVKAQTAPN--KDVQREIADLGEALATAVIPQWQKDELRETLKSLKKVMDDLDRASKADVQKRVLEKTKQFIDS--NPNQPLVILEMESGASAKALNEALKLFKMHSPQTSAMLFTVDNEAGKITCLCQVPQNAANRGLKASEWVQQVSGLMDGKGGGKDVSAQATGKNVGCLQEALQLATSFAQLRL 963          
BLAST of alanine--tRNA ligase, cytoplasmic vs. UniProt/SwissProt
Match: sp|P50475|SYAC_RAT (Alanine--tRNA ligase, cytoplasmic OS=Rattus norvegicus OX=10116 GN=Aars1 PE=1 SV=3)

HSP 1 Score: 1028.47 bits (2658), Expect = 0.000e+0
Identity = 499/965 (51.71%), Postives = 671/965 (69.53%), Query Frame = 2
Query:   95 IRREFVDFFKEKSHLNIHSSSTIPLNDPTLLFSNAGMNQFKKIFLGTADPNSDMAKWKRVANSQKCIRAGGKHNDLDDVGKDVYHHTFFEMLGNWSFGDYFKKEAISWAWELLTKVWGLPKDRFYVTYFGGNTELGLESDEEAKDIWLSMGIDASRVLPFGMKDNFWEMGETGPCGPCSEIHFDRIGNRDASELVNADDPDVLEVWNLVFIQYNRELDRSLKSLPHKHVDTGMGFERIVSVIQNKSSNYDTDLFQPLFDRIQAETNCRSYQGKLGDDDEGGIDMAYRVLADHARTLTIALSDGGQPQNTGRGYVLRRILRRAVRYAVDKLHAKPGMFSNLVDTVVDLLGEAFPEIKHSKENVKQIINEEESQFMKTLKRGKKMFDKSLEDFKQIKTGQTFLPGRIAWMLYDTYGYPLDLTALMCDESGIKINMEEYETCRKLAQETSQGSGDTVYLSVDLDVHDIDKLQTKKLQPTDDIPKFKYNADENGNYQLECHQATVLAIKIKEGFXXXXXXXXXXXGLVMDSTNFYAESGGQMYDTGSMVLND---VEQTEFEVATVKLCGGFVLHIGRVLNGSLKVGDRLKLEVDDARRKCLMQNHTGTHVLNYALREIVGDVDQKGSLVAPDKLRFDFSAKGQVDNEQLRKVETICKSIINEKKQVYVKEVALSIAKEIQGIRAVFGETYPDPVRVVSIGVPVDDLINSINEPKPSLNASVEFCGGTHLTNSHHISELVITSESAISKGVRRIFALTGAEAEKACKIASQMECEVGKLENTFSKTMEDSRIRDLLNSIKDMKRELDEALISYWFKNSLRARLESLRKELDSLEKTKKELLQANLMEQAWPVIENAVSHNKKFLVIRFLDGADQTSINKAFREIQKKHKSLSLLGYSVDVTSNKIECKASVAKEMVTASFNAKNWIEKVTEIVGGKSGGSDQSAQVTGVALMNLHGLEEMANKFANMNI 2980
            IR  F+++FK   H  +HSS+TIPL+DPTLLF+NAGMNQFK IFL T DP+  MAK  R AN+QKCIRAGGKHNDLDDVGKDVYHHTFFEMLG+WSFGDYFK+ A   A ELLT+ +G+P +R YVTYFGG+   GLE D E + IW ++G+D +++LP  MKDNFWEMG+TGPCGPCSEIH+DRIG RDA+ LVN DDP+VLE+WNLVFIQYNRE D  LK LP K +DTGMG ER+VSV+QNK SNYDTDLF P F+ IQ  T  R Y GK+G +D  GIDMAYRVLADHART+T+AL+DGG+P NTGRGYVLRRILRRAVRY+ +KL+A  G F+ LVD VV  LG+AFPE+K   + VK IINEEE QF+KTL RG+++ D+ ++     +T    +PG  AW+LYDTYG+P+DLT L+ +E G+ ++M+ +E  RKLAQ  SQG G      + LD++ I++L+ K L+ TDD PK+ Y++D +G+Y  EC  ATVLA++ +E             G+V+D T FYAE GGQ++D G +V  D    ++TEF V   ++ GG+VLHIG +  G+L+VGD+++L +D+ RR+ +M NHT TH+LN+ALR ++GD DQKGSLVAPD+LRFDF+AKG +  EQ++K E I   +I   K VY  +  L+ AK IQG+RAVF ETYPDPVRVVSIGVPV +L++  + P  SL  SVEFCGGTHL NS H    VI +E AI+KG+RRI A+TGAEA+KA + +  ++  +  +E       + +  +D+   I D+   L  A+I  W K+  R  L+SL+K +D L++  K  +Q  ++E+   +I++  + N+  +++    GA   ++N+A +  +      S + ++VD  + KI C   V +        A  W+++V+ ++ GK GG D SAQ TG  +  L    ++A  FA + +
Sbjct:   10 IRERFINYFKRNEHTYVHSSATIPLDDPTLLFANAGMNQFKPIFLNTVDPSHPMAKLSRAANTQKCIRAGGKHNDLDDVGKDVYHHTFFEMLGSWSFGDYFKELACKMALELLTQEFGIPVERLYVTYFGGDEAAGLEPDLECRQIWQNLGLDEAKILPGNMKDNFWEMGDTGPCGPCSEIHYDRIGGRDAAHLVNQDDPNVLEIWNLVFIQYNRESDGVLKPLPKKSIDTGMGLERLVSVLQNKMSNYDTDLFVPYFEAIQKGTGARPYTGKVGAEDTDGIDMAYRVLADHARTITVALADGGRPDNTGRGYVLRRILRRAVRYSHEKLNASRGFFATLVDVVVQSLGDAFPELKKDPDMVKDIINEEEVQFLKTLSRGRRILDRKIQSLGDCQT----IPGDTAWLLYDTYGFPVDLTGLIAEEKGLVVDMDGFEEERKLAQLKSQGKGAGGEDLIMLDIYAIEELRAKGLEATDDSPKYNYHSDSSGSYVFECTVATVLALR-REKMFVDEVVTGQECGVVLDKTCFYAEQGGQIFDEGYLVKVDDSSEDKTEFTVKNAQVRGGYVLHIGTIY-GNLRVGDQVRLFIDEPRRRPVMSNHTATHILNFALRSVLGDADQKGSLVAPDRLRFDFTAKGAMSTEQIKKTEEIVNGMIEAAKPVYTLDCPLAAAKAIQGLRAVFDETYPDPVRVVSIGVPVSELLDDPSGPAGSLT-SVEFCGGTHLRNSSHAGAFVIVTEEAIAKGIRRIVAVTGAEAQKALRKSETLKKSLSAME--VKVKAQSAPNKDVQKEIADLGEVLATAVIPQWQKDEQRETLKSLKKVMDDLDRASKADVQKRVLEKTKQLIDS--NPNQPLVILEMESGASAKALNEALKLFKTHSPQTSAMLFTVDNEAGKITCLCQVPQNAANRGLKASEWVQQVSGLMDGKGGGKDMSAQATGKNVGCLQEALQLATSFAQLRL 963          
BLAST of alanine--tRNA ligase, cytoplasmic vs. TrEMBL
Match: A0A1S3HSL5 (alanine--tRNA ligase, cytoplasmic OS=Lingula unguis OX=7574 GN=LOC106157824 PE=3 SV=1)

HSP 1 Score: 1106.66 bits (2861), Expect = 0.000e+0
Identity = 541/974 (55.54%), Postives = 691/974 (70.94%), Query Frame = 2
Query:   74 MDRNSST--IRREFVDFFKEKSHLNIHSSSTIPLNDPTLLFSNAGMNQFKKIFLGTADPNSDMAKWKRVANSQKCIRAGGKHNDLDDVGKDVYHHTFFEMLGNWSFGDYFKKEAISWAWELLTKVWGLPKDRFYVTYFGGNTELGLESDEEAKDIWLSMGIDASRVLPFGMKDNFWEMGETGPCGPCSEIHFDRIGNRDASELVNADDPDVLEVWNLVFIQYNRELDRSLKSLPHKHVDTGMGFERIVSVIQNKSSNYDTDLFQPLFDRIQAETNCRSYQGKLGDDDEGGIDMAYRVLADHARTLTIALSDGGQPQNTGRGYVLRRILRRAVRYAVDKLHAKPGMFSNLVDTVVDLLGEAFPEIKHSKENVKQIINEEESQFMKTLKRGKKMFDKSLEDFKQIKTGQTFLPGRIAWMLYDTYGYPLDLTALMCDESGIKINMEEYETCRKLAQETSQGSGDTVYLSVDLDVHDIDKLQTKKLQPTDDIPKFKYNADENGNYQLECHQATVLAIKIKEGFXXXXXXXXXXXGLVMDSTNFYAESGGQMYDTGSMVLNDVEQTEFEVATVKLCGGFVLHIGRVLNGSLKVGDRLKLEVDDARRKCLMQNHTGTHVLNYALREIVGDVDQKGSLVAPDKLRFDFSAKGQVDNEQLRKVETICKSIINEKKQVYVKEVALSIAKEIQGIRAVFGETYPDPVRVVSIGVPVDDLINSINEPKPSLNASVEFCGGTHLTNSHHISELVITSESAISKGVRRIFALTGAEAEKACKIASQMECEVGKLENTF---SKTMEDSRIRDLLNSIKDMKRELDEALISYWFKNSLRARLESLRKELDSLEKTKKELLQANLMEQAWPVIENAVSHNKKFLVIRFLDGADQTSINKAFREIQKKHKSLSLLGYSVDVTSNKIECKASVAKEMVTASFNAKNWIEKVTEIVGGKSGGSDQSAQVTGVALMNLHGLEEMANKFANMNI 2980
            MD+N S   +R+ F+DFF EK HL +HSSS IP  DPTLLF+NAGMNQFK IFLGT DPNSDM+KW R ANSQKCIRAGGKHNDLDDVGKDVYHHTFFEMLGNWSFGDYFKKE  +WAWE LT+   L KDR YVTYFGG+   GLE DEEAK+IW+ +G+ A RVLPF MKDNFWEMGETGPCGPCSEIH+DRIG RDA  LVN DDPDVLE+WNLVFIQYNRE D SLK LP KH+D GMG ER+VSV+Q K SNYDTD+F PLFD IQ  T  R Y GK+G +D  G+DMAYRVLADHARTLT+ALSDGG+P + GRGYVLRRILRR VRYA +KL AKPG F++LVDTVV LLG+AFPE+K   E VK IINEEE+QF+KTL RG+K+  +++      KT    LPG +AW LYDTYG+P+DLT LM +E G+ ++M  YE  +K AQ TSQ  G TV   V LDVH +++LQ++   PTDD+PK+ Y +DE+GNY  E   A V AI++ +    S        G+++D T FYAE+GGQ YD G +     E+ EF V  V++ GG+VLHIG V  G+LKVGD +KL +D+ RR+ +M NHTGTH+LN+ALR+++G+ DQ+GSLVAPD+LRFDF+AKG +   Q+++VE I   I  + + VY K+VAL IAK IQG+RAVF ETYPDPVRVVS+GVP++DL+     P  SL  +VEFCGGTHL  S H+ + V+ SE AI+KG+RRI A+TG EAEKA   A  ++ ++  L+      SKT + ++ + L   I  +  E   A I YW K+++R  L+ L+K LD L+K +K+ +   ++E+A  +IE     NK  ++  F  G++  +++ A ++        + + ++VD  + KI C + V KE+ T    A  W++ +++ + GK GG D SAQ TG     L    +MA +F+ M +
Sbjct:    1 MDQNMSGNDVRKAFIDFFAEKEHLYVHSSSVIPHEDPTLLFANAGMNQFKPIFLGTVDPNSDMSKWVRAANSQKCIRAGGKHNDLDDVGKDVYHHTFFEMLGNWSFGDYFKKEVCAWAWEFLTERMKLEKDRLYVTYFGGHEPSGLEPDEEAKEIWIKLGLPADRVLPFDMKDNFWEMGETGPCGPCSEIHYDRIGGRDAKHLVNMDDPDVLEIWNLVFIQYNRENDGSLKLLPSKHIDCGMGLERLVSVVQQKMSNYDTDMFMPLFDTIQKNTGARPYAGKVGKEDADGVDMAYRVLADHARTLTVALSDGGRPDSVGRGYVLRRILRRGVRYATEKLGAKPGTFASLVDTVVLLLGDAFPELKKDPEMVKDIINEEEAQFLKTLSRGQKLLMRTIGKLGDCKT----LPGDLAWRLYDTYGFPVDLTQLMVEEKGLDVDMNGYEDSKKQAQLTSQAGGGTVDDQVSLDVHALNELQSQGFPPTDDLPKYNYTSDESGNYVFESCTAKVKAIRMNKQM-VSEVGSGQECGILLDRTCFYAEAGGQTYDEGFITKEGDEEFEFVVKNVQVRGGYVLHIGSV-EGTLKVGDSVKLAIDEGRRRPVMSNHTGTHMLNFALRKVLGEADQRGSLVAPDRLRFDFTAKGSMTAAQVKEVEEITNGIAKKNEPVYAKDVALPIAKSIQGLRAVFDETYPDPVRVVSVGVPIEDLVADPTGPAGSLT-TVEFCGGTHLQRSGHLGDFVVVSEEAIAKGIRRIVAITGHEAEKALHKAGLLDKDLAALKQKIEQNSKTQQFTQ-KQLSTEIVRLTEEASHATIPYWRKDNIRNELKGLKKALDDLDKARKQAVMTEVVEEAKKMIE--ACPNKPVVIHEFKAGSNAKALDAAMKQYNSLSPQTAAMFFTVDEDAGKIICMSRVPKEVCTKGLKANEWVQHLSDTIKGKGGGKDVSAQATGTNTSGLSEAMKMAEEFSTMKL 964          
BLAST of alanine--tRNA ligase, cytoplasmic vs. TrEMBL
Match: A0A210PZB4 (Alanine--tRNA ligase, cytoplasmic OS=Mizuhopecten yessoensis OX=6573 GN=KP79_PYT13469 PE=3 SV=1)

HSP 1 Score: 1102.81 bits (2851), Expect = 0.000e+0
Identity = 533/977 (54.55%), Postives = 701/977 (71.75%), Query Frame = 2
Query:   71 KMDRN--SSTIRREFVDFFKEKSHLNIHSSSTIPLNDPTLLFSNAGMNQFKKIFLGTADPNSDMAKWKRVANSQKCIRAGGKHNDLDDVGKDVYHHTFFEMLGNWSFGDYFKKEAISWAWELLTKVWGLPKDRFYVTYFGGNTELGLESDEEAKDIWLSMGIDASRVLPFGMKDNFWEMGETGPCGPCSEIHFDRIGNRDASELVNADDPDVLEVWNLVFIQYNRELDRSLKSLPHKHVDTGMGFERIVSVIQNKSSNYDTDLFQPLFDRIQAETNCRSYQGKLGDDDEGGIDMAYRVLADHARTLTIALSDGGQPQNTGRGYVLRRILRRAVRYAVDKLHAKPGMFSNLVDTVVDLLGEAFPEIKHSKENVKQIINEEESQFMKTLKRGKKMFDKSLEDFKQIKTGQTFLPGRIAWMLYDTYGYPLDLTALMCDESGIKINMEEYETCRKLAQETSQGSGDTVYLSVDLDVHDIDKLQTKKLQPTDDIPKFKYNADENGNYQLECHQATVLAIKIKEGFXXXXXXXXXXXGLVMDSTNFYAESGGQMYDTGSMVLNDVEQTEFEVATVKLCGGFVLHIGRVLNGSLKVGDRLKLEVDDARRKCLMQNHTGTHVLNYALREIVGDVDQKGSLVAPDKLRFDFSAKGQVDNEQLRKVETICKSIINEKKQVYVKEVALSIAKEIQGIRAVFGETYPDPVRVVSIGVPVDDLINSINEPKPSLNASVEFCGGTHLTNSHHISELVITSESAISKGVRRIFALTGAEAEKACKIASQMECEVGKLENTFSKTMEDSRI--RDLLNSIKDMKRELDEALISYWFKNSLRARLESLRKELDSLEKTKKELLQANLMEQAWPVIENAVSHNKKFLVIRFLDGADQTSINKAFREIQKKHKSLSLLGYSVDVTSNKIECKASVAKEMVTASFNAKNWIEKVTEIVGGKSGGSDQSAQVTGVALMNLHGLEE---MANKFANMNI 2980
            KMD +   + +R+ F+D+FKE+ H+ +HSSSTIPL+DPTLLF+NAGMNQFK IFLGT DPNSDM+K+ RV NSQKCIRAGGKHNDLDDVGKDVYHHTFFEMLGNWSFGDYFKK+  ++AWELL     +PK+R YVTYFGGN  +GL  D + +DIW+++G+   RVLPF M DNFWEMGETGPCGPC+EIHFDRIG RDA  LVN DDPDVLEVWNLVF+Q+NR+ D +L  LP+KH D GMG ER+VSV+Q K+SNYDTDLF P+FD IQ  T  R+Y G +G +D  G+DMAYRVLADHART+TIALSD G+P N GRGYVLRRILRRAVRYA +KL AKPGMF++L+DTVV+LLG+AFPE+    E +K IINEEE QF+KTL RG+++ ++++      KT    LPG +AW LYDTYG+P+DLT LM +E G+ ++M+ YE C+K AQ  SQGSG TV   ++LDVH I  LQ K L PTDD PK+ Y ADE GNY+ E     VLAI+  + F     +     G+++D T+FYAE GGQ+YD G +V  + E TEF+V  V++ GG+VLHIG V+ G+LKVGD ++L +D++ R  +M+NHTGTH+LN+ LR ++   DQKGSLVAPD+LRFDF+AK  +  +Q+++ E I   +  + ++VY KE +L +AK IQG+RAVF ETYPDPVRV+SIGVPV+DL++    P  SL  SVEFCGGTHL  + HI + VI +E AI+KG RRI A+TGAEA +A      ++  V  L   F   ++   +  ++L   I  M  E+ +++I YW ++ LRA L+ L+ +LD L+K++K  + A ++EQ   +IE   + N+ F+V  F  G++  S++ A ++ +      S + +SVD  ++KI C + V K  V+   NAK+W+ +V  ++ GK GG D +AQ TG    N  GL+E   MA KFA M +
Sbjct:   21 KMDASLTGNQVRQLFIDYFKEQQHIYVHSSSTIPLDDPTLLFANAGMNQFKPIFLGTVDPNSDMSKYVRVVNSQKCIRAGGKHNDLDDVGKDVYHHTFFEMLGNWSFGDYFKKDCCAFAWELLVDRIKMPKERLYVTYFGGNEAMGLAPDNDTRDIWINLGVAVDRVLPFDMGDNFWEMGETGPCGPCTEIHFDRIGGRDAKHLVNMDDPDVLEVWNLVFMQFNRDTDGTLHDLPNKHCDCGMGLERLVSVMQGKTSNYDTDLFMPIFDAIQKATGARTYTGHVGKEDVDGVDMAYRVLADHARTITIALSDSGRPDNVGRGYVLRRILRRAVRYATEKLGAKPGMFASLIDTVVELLGDAFPEVTKDPEELKNIINEEEEQFLKTLSRGRRLLERTIGKLGDTKT----LPGEVAWRLYDTYGFPVDLTQLMAEEKGLMVDMDTYEECKKAAQLMSQGSGCTVDDQINLDVHAISDLQKKGLSPTDDSPKYNYTADEEGNYKFESTMGKVLAIRHSKQF-VDEVTSGRECGILLDRTSFYAEQGGQIYDQGFLVKVNEEDTEFQVRNVQVRGGYVLHIG-VIVGTLKVGDTVQLSIDESHRMAVMKNHTGTHMLNFGLRGVLQTADQKGSLVAPDRLRFDFTAKKAMTPDQVKETEEIVNVMAEKNEEVYAKETSLPVAKSIQGLRAVFDETYPDPVRVLSIGVPVEDLVSDPMGPAASLT-SVEFCGGTHLRRAGHIGKFVIVTEEAIAKGSRRITAVTGAEATRALHRTDLLDKNVKNLAEKFDTCLKTKELSEKELTKMIVQMDDEITKSVIPYWQRDRLRADLKRLKGKLDDLDKSRKAAITAEVVEQTKKMIE--ANPNQSFIVHEFKAGSNAKSLDAAMKQYKTSSPETSAMFFSVDKEASKILCMSCVPKSSVSKGLNAKDWVNEVVPVIQGKCGGKDLAAQATG---SNTDGLQEAINMATKFAQMKL 985          
BLAST of alanine--tRNA ligase, cytoplasmic vs. TrEMBL
Match: V3ZQB6 (AA_TRNA_LIGASE_II_ALA domain-containing protein OS=Lottia gigantea OX=225164 GN=LOTGIDRAFT_197664 PE=3 SV=1)

HSP 1 Score: 1099.35 bits (2842), Expect = 0.000e+0
Identity = 533/969 (55.01%), Postives = 690/969 (71.21%), Query Frame = 2
Query:   77 DRNSSTIRREFVDFFKEKSHLNIHSSSTIPLNDPTLLFSNAGMNQFKKIFLGTADPNSDMAKWKRVANSQKCIRAGGKHNDLDDVGKDVYHHTFFEMLGNWSFGDYFKKEAISWAWELLTKVWGLPKDRFYVTYFGGNTELGLESDEEAKDIWLSMGIDASRVLPFGMKDNFWEMGETGPCGPCSEIHFDRIGNRDASELVNADDPDVLEVWNLVFIQYNRELDRSLKSLPHKHVDTGMGFERIVSVIQNKSSNYDTDLFQPLFDRIQAETNCRSYQGKLGDDDEGGIDMAYRVLADHARTLTIALSDGGQPQNTGRGYVLRRILRRAVRYAVDKLHAKPGMFSNLVDTVVDLLGEAFPEIKHSKENVKQIINEEESQFMKTLKRGKKMFDKSLEDFKQIKTGQT-FLPGRIAWMLYDTYGYPLDLTALMCDESGIKINMEEYETCRKLAQETSQGSGDTVYLSVDLDVHDIDKLQTKKLQPTDDIPKFKYNADENGNYQLECHQATVLAIKIKEGFXXXXXXXXXXXGLVMDSTNFYAESGGQMYDTGSMVLNDVEQTEFEVATVKLCGGFVLHIGRVLNGSLKVGDRLKLEVDDARRKCLMQNHTGTHVLNYALREIVGDVDQKGSLVAPDKLRFDFSAKGQVDNEQLRKVETICKSIINEKKQVYVKEVALSIAKEIQGIRAVFGETYPDPVRVVSIGVPVDDLINSINEPKPSLNASVEFCGGTHLTNSHHISELVITSESAISKGVRRIFALTGAEAEKACKIASQMECEVGKLENTFSKTMEDSRIRDLLNSIKDMKRELDEALISYWFKNSLRARLESLRKELDSLEKTKKELLQANLMEQAWPVIENAVSHNKKFLVIRFLDGADQTSINKAFREIQKKHKSLSLLGYSVDVTSNKIECKASVAKEMVTASFNAKNWIEKVTEIVGGKSGGSDQSAQVTGVALMNLHGLEEMANKFANMNI 2980
            D   + +R  F++FFKEK H  +HSSSTIPL+DPTLLF+NAGMNQFK IFLG  DPNSDMAKW R  NSQKC+RAGGKHNDLDDVGKDVYHHTFFEMLGNWSFGDY+KKE  +WAWE+LT+   L K R YV+YFGG  E GLE D EA+DIWLS+G+ A+RVLPF MKDNFWEMGETGPCGPCSEIH+DRIG R+  ELVN DDPDVLE+WNLVFIQYNR+ D SLKSLP KH+D G+G ER+VSVIQ+K SNYDTDLF P+FD IQ  T  ++Y GK+G +D  G+DMAYRVLADH RTLTI LSDGG+P NTGRGYVLRRILRRAVRY  +KL+ KPGMFS+LVDTVV LLG+AFPE+K   E VK I+NEEE QF+KTL RG  +  ++++     K G T  LPG +AW LYDTYG+P+DLT LM +E+G+ I+M  +E  RK AQ  SQG+G +V   ++LDVH I+ LQ+K + PTDD  K+ Y AD  GNY  E     V+A++  + F     S     G+++D TNFYAE GGQ+YD G MV    E+ E  +  V++ GG+VLHIG  + G LKVGD++KL VD+ RR  +M+NHTGTH+LNY LR ++ + DQ+GSLVAPD+LRFDF++KG +   Q++KVE     + ++ ++VY KE +LS+AK IQG+RAVF E YPDPVR+VS+G+PV+ L +    P  S+  SVEFCGGTHL  + HI  +VI SE AISKG+RRI A+TG+EA+K+      ++  V +L+N       D   ++L   I  +  E+ ++ I+YW ++ LR+ L+SL+K++D L+K KK  +   ++E+   +IE   + N K++V  F  G++  +++ A ++ +      S    SVD  +NKI C + V KE  +   +AK WI++V   + GK GG D SAQ TG  +  L+    +A KFA M +
Sbjct:    3 DMTGTDVRNLFINFFKEKKHTYVHSSSTIPLDDPTLLFTNAGMNQFKPIFLGVVDPNSDMAKWSRAVNSQKCVRAGGKHNDLDDVGKDVYHHTFFEMLGNWSFGDYYKKETCTWAWEMLTERLKLDKTRLYVSYFGGKPEAGLEPDNEARDIWLSLGLPANRVLPFDMKDNFWEMGETGPCGPCSEIHYDRIGGREVPELVNQDDPDVLEIWNLVFIQYNRDADGSLKSLPRKHIDCGLGLERLVSVIQDKRSNYDTDLFTPIFDVIQKMTGTKAYTGKVGKEDTDGVDMAYRVLADHIRTLTITLSDGGRPDNTGRGYVLRRILRRAVRYGTEKLNFKPGMFSSLVDTVVTLLGDAFPEVKRDPETVKAILNEEEVQFLKTLTRGHHLLQRTIK-----KLGDTNILPGDVAWRLYDTYGFPVDLTTLMAEENGLSIDMGAFEESRKKAQLMSQGAGGSVDDKINLDVHGINHLQSKNIPPTDDSSKYNYRADTQGNYVFEPASGKVIALRYNKEF-VDSVSTGQECGVLLDKTNFYAEQGGQIYDEGFMVKEGEEEVELRIKNVQVRGGYVLHIG-TIEGVLKVGDQVKLSVDEERRCSVMKNHTGTHMLNYGLRCVLNEADQRGSLVAPDRLRFDFTSKGSMTPAQVKKVEEEVNKMADKNEEVYAKESSLSVAKSIQGLRAVFDEVYPDPVRIVSVGIPVEKLESDPMGPAGSV-TSVEFCGGTHLRRAGHIGSMVIVSEDAISKGIRRIIAVTGSEAQKSHHKVDVLQKSVTELKNILESKSRDITDKELTRRIVQLDDEVAQSTIAYWQRDGLRSELKSLKKKMDDLDKNKKAAVLNEVVEECKKMIE--ANPNIKYIVHEFKAGSNAKALDAAMKQYKASSPQTSAFFVSVDNEANKILCMSCVPKEAASKGLSAKLWIDQVVPAINGKGGGKDVSAQATGTNIGALNEAISLATKFAEMKL 961          
BLAST of alanine--tRNA ligase, cytoplasmic vs. TrEMBL
Match: A0A4D5S0H8 (Putative alanyl-trna synthetase (Fragment) OS=Ixodes scapularis OX=6945 PE=3 SV=1)

HSP 1 Score: 1077.39 bits (2785), Expect = 0.000e+0
Identity = 516/971 (53.14%), Postives = 689/971 (70.96%), Query Frame = 2
Query:   83 NSSTIRREFVDFFKEK-SHLNIHSSSTIPLNDPTLLFSNAGMNQFKKIFLGTADPNSDMAKWKRVANSQKCIRAGGKHNDLDDVGKDVYHHTFFEMLGNWSFGDYFKKEAISWAWELLTKVWGLPKDRFYVTYFGGNTELGLESDEEAKDIWLSMGIDASRVLPFGMKDNFWEMGETGPCGPCSEIHFDRIGNRDASELVNADDPDVLEVWNLVFIQYNRELDRSLKSLPHKHVDTGMGFERIVSVIQNKSSNYDTDLFQPLFDRIQAETNCRSYQGKLGDDDEGGIDMAYRVLADHARTLTIALSDGGQPQNTGRGYVLRRILRRAVRYAVDKLHAKPGMFSNLVDTVVDLLGEAFPEIKHSKENVKQIINEEESQFMKTLKRGKKMFDKSLEDFKQIKTGQTFLPGRIAWMLYDTYGYPLDLTALMCDESGIKINMEEYETCRKLAQETSQGSGDTVYLSVDLDVHDIDKLQTKKLQPTDDIPKFKYNA---DENGNYQLECHQATVLAIKIKEGFXXXXXXXXXXXGLVMDSTNFYAESGGQMYDTGSMVLNDVEQTEFEVATVKLCGGFVLHIGRVLNGSLKVGDRLKLEVDDARRKCLMQNHTGTHVLNYALREIV-GDVDQKGSLVAPDKLRFDFSAKGQVDNEQLRKVETICKSIINEKKQVYVKEVALSIAKEIQGIRAVFGETYPDPVRVVSIGVPVDDLINSINEPKPSLNASVEFCGGTHLTNSHHISELVITSESAISKGVRRIFALTGAEAEKACKIASQMECEVGKLENTFSKTMEDSRIRDLLNSIKDMKRELDEALISYWFKNSLRARLESLRKELDSLEKTKKELLQANLMEQAWPVIENAVSHNKKFLVIRFLDGADQTSINKAFREIQKKHKSLSLLGYSVDVTSNKIECKASVAKEMVTASFNAKNWIEKVTEIVGGKSGGSDQSAQVTGVALMNLHGLEEMANKFANMNI 2980
             ++ IR++F+DFF +K  HL++ SSS IP +DPTLLF+NAGMNQFK IFLGT DPNSD  K+KRV ++QKCIRAGGKHNDLDDVGKDVYHHTFFEMLGNWSFGD+FKKE  SWAWELLTKV+ L  +R YVTYFGGN   GLE D E K IW+++G+   R+LP  MKDNFWEMGETGPCGPCSEIH+DRIG R+AS LVNAD PDVLE+WNLVFIQYNRE D  L+ LP +HVDTGMGFER+VSVIQ+K SNYDTD+F P+FD IQ  T  R YQG++G +D  GIDMAYRVLADH+RTLTIALSDGG+P N GRGYVLRRILRRAVRYA +K++A PG F++LV  VV +LG+ FPE+K   E+V  IINEEE QF+KTL RG+++ +K++         Q FLPG +AW LYDTYG+P+DLT LM +E G+ ++ME YE  +  AQ  SQ     V   + LDVH I  LQ+K +  T+D+PK+ Y A   D+  +Y+      TVL ++  + F           G+++D TNFYAESGGQ YDTG M     E  EF V  V   GG+V+HIGR+++G+LKVGD+LKL +D+ RRK +M NHTGTH+LN+ALR+++  + DQ+GSLVAPD+LRFDF+ K  +   +++  E     +I++  +VY K+  LSIAK IQG+RAVF ETYPDPVRVVSIGVPVDDL+   + P  SL  S+EFCGGTHL  + H+ + VIT+E AI+KG+RRI ALTG EA KA K A   + EV +++   +K  + ++ ++L+  + ++  E+ ++ ISYW K+ LR  L++L+K+LD L+++ K   Q   +E    ++E     + +++V     G +  +++ A ++++    + + + +S D    K+ C +SV K++V     A  WI++V+E++GGK GG ++SAQ  G  + +L    E+A+ FA + +
Sbjct:    3 TAAEIRQQFIDFFVQKYDHLHVRSSSVIPHDDPTLLFTNAGMNQFKPIFLGTVDPNSDAGKYKRVVDTQKCIRAGGKHNDLDDVGKDVYHHTFFEMLGNWSFGDFFKKEICSWAWELLTKVYKLQGERLYVTYFGGNEAAGLEPDLECKQIWMNLGVPEERILPGSMKDNFWEMGETGPCGPCSEIHYDRIGGRNASHLVNADVPDVLEIWNLVFIQYNRETDGKLRLLPKQHVDTGMGFERLVSVIQDKPSNYDTDVFVPIFDAIQKATGVRPYQGRVGKEDTDGIDMAYRVLADHSRTLTIALSDGGRPDNVGRGYVLRRILRRAVRYATEKMNAAPGTFASLVPVVVQILGDVFPELKKDTESVMDIINEEEGQFLKTLSRGRRLLEKTVNKLGD----QKFLPGDVAWRLYDTYGFPIDLTQLMVEEKGLAVDMESYEKAKAAAQLASQAGDSKVDDGLKLDVHAIADLQSKNVPTTNDLPKYDYRATSNDKAASYEFSPCSGTVLVLRTSKQF-VDSIEAGQQCGVILDQTNFYAESGGQTYDTGFMTCETNEDLEFAVTEVHTQGGYVVHIGRLISGTLKVGDKLKLAIDEQRRKLVMNNHTGTHILNFALRKVLTAEADQRGSLVAPDRLRFDFANKKPMSPAEVKAAEQSAVELISKNGEVYAKDSPLSIAKAIQGLRAVFNETYPDPVRVVSIGVPVDDLMADPSSPAGSLT-SIEFCGGTHLKRAGHVGDFVITTEEAIAKGIRRIVALTGPEAAKALKKAEHYQNEVNRIKAEGAKVTQAAQGKELVKQLVELTEEISQSNISYWKKDELRTELKNLKKQLDDLDRSNKAQAQQMAIENVKKLLEQ--KKDSEYIVHALEVGDNAKALDAALKQVRTITPNAAAMFFSCDAEKGKVICLSSVPKDIVARGLTANGWIKEVSEVIGGKGGGREESAQAIGNNVSSLDKALEVAHNFAKLKL 965          
BLAST of alanine--tRNA ligase, cytoplasmic vs. TrEMBL
Match: A0A131Y3G4 (Putative alanyl-trna synthetase OS=Ixodes ricinus OX=34613 PE=2 SV=1)

HSP 1 Score: 1077.39 bits (2785), Expect = 0.000e+0
Identity = 515/971 (53.04%), Postives = 689/971 (70.96%), Query Frame = 2
Query:   83 NSSTIRREFVDFFKEK-SHLNIHSSSTIPLNDPTLLFSNAGMNQFKKIFLGTADPNSDMAKWKRVANSQKCIRAGGKHNDLDDVGKDVYHHTFFEMLGNWSFGDYFKKEAISWAWELLTKVWGLPKDRFYVTYFGGNTELGLESDEEAKDIWLSMGIDASRVLPFGMKDNFWEMGETGPCGPCSEIHFDRIGNRDASELVNADDPDVLEVWNLVFIQYNRELDRSLKSLPHKHVDTGMGFERIVSVIQNKSSNYDTDLFQPLFDRIQAETNCRSYQGKLGDDDEGGIDMAYRVLADHARTLTIALSDGGQPQNTGRGYVLRRILRRAVRYAVDKLHAKPGMFSNLVDTVVDLLGEAFPEIKHSKENVKQIINEEESQFMKTLKRGKKMFDKSLEDFKQIKTGQTFLPGRIAWMLYDTYGYPLDLTALMCDESGIKINMEEYETCRKLAQETSQGSGDTVYLSVDLDVHDIDKLQTKKLQPTDDIPKFKYNA---DENGNYQLECHQATVLAIKIKEGFXXXXXXXXXXXGLVMDSTNFYAESGGQMYDTGSMVLNDVEQTEFEVATVKLCGGFVLHIGRVLNGSLKVGDRLKLEVDDARRKCLMQNHTGTHVLNYALREIV-GDVDQKGSLVAPDKLRFDFSAKGQVDNEQLRKVETICKSIINEKKQVYVKEVALSIAKEIQGIRAVFGETYPDPVRVVSIGVPVDDLINSINEPKPSLNASVEFCGGTHLTNSHHISELVITSESAISKGVRRIFALTGAEAEKACKIASQMECEVGKLENTFSKTMEDSRIRDLLNSIKDMKRELDEALISYWFKNSLRARLESLRKELDSLEKTKKELLQANLMEQAWPVIENAVSHNKKFLVIRFLDGADQTSINKAFREIQKKHKSLSLLGYSVDVTSNKIECKASVAKEMVTASFNAKNWIEKVTEIVGGKSGGSDQSAQVTGVALMNLHGLEEMANKFANMNI 2980
             ++ IR++F+DFF +K  HL++ SSS IP +DPTLLF+NAGMNQFK IFLGT DPNSD  K+KRV ++QKCIRAGGKHNDLDDVGKDVYHHTFFEMLGNWSFGD+FKKE  SWAWELLTKV+ L ++R YVTYFGGN   GLE D E K IW+++G+   R+LP  MKDNFWEMGETGPCGPCSEIH+DRIG R+AS LVNAD PDVLE+WNLVFIQYNRE D  L+ LP +HVDTGMGFER+VSVIQ+K SNYDTD+F P+FD IQ  T  R YQG++G +D  GIDMAYRVLADH+RTLTIALSDGG+P N GRGYVLRRILRRAVRYA +K++A PG F++LV  VV +LG+ FPE+K   E+V  IINEEE QF+KTL RG+++ +K++         Q FLPG +AW LYDTYG+P+DLT LM +E G+ ++ME YE  +  AQ  SQ     V   + LDVH I  LQ+K +  T+D+PK+ Y A   D+  +Y+      TVL ++  + F           G+++D TNFYAESGGQ YDTG M     E  EF V  V   GG+V+HIGR+++G+LKVGD+LKL +D+ RRK +M NHTGTH+LN+ALR+++  + DQ+GSLVAPD+LRFDF+ K  +   +++  E     +I++  +VY K+  LS+AK IQG+RAVF ETYPDPVRVVSIGVPVDDL+   + P  SL  S+EFCGGTHL  + H+ + VIT+E AI+KG+RRI ALTG EA KA K A   + EV +++   +K  + ++ ++L+  + ++  E+ ++ ISYW K+ LR  L++L+K+LD L+++ K   Q   +E    ++E     + +++V     G +  +++ A ++++    + + + +S D    K+ C +SV K +V     A  WI++V+E++GGK GG ++SAQ  G  + +L    E+A+ FA + +
Sbjct:    3 TAAEIRQQFIDFFAQKYDHLHVRSSSVIPHDDPTLLFTNAGMNQFKPIFLGTVDPNSDAGKYKRVVDTQKCIRAGGKHNDLDDVGKDVYHHTFFEMLGNWSFGDFFKKEICSWAWELLTKVYKLREERLYVTYFGGNEAAGLEPDLECKQIWMNLGVPEERILPGSMKDNFWEMGETGPCGPCSEIHYDRIGGRNASHLVNADVPDVLEIWNLVFIQYNRETDGKLRLLPKQHVDTGMGFERLVSVIQDKPSNYDTDVFVPIFDAIQKATGVRPYQGRVGKEDTDGIDMAYRVLADHSRTLTIALSDGGRPDNVGRGYVLRRILRRAVRYATEKMNAAPGTFASLVPVVVQILGDVFPELKKDTESVMDIINEEEGQFLKTLSRGRRLLEKTVNKLGD----QKFLPGDVAWRLYDTYGFPIDLTQLMVEEKGLAVDMESYEKAKAAAQLASQAGDSKVDDGLKLDVHAIADLQSKNVPTTNDLPKYDYRATSNDKAASYEFSPCSGTVLVLRTSKQF-VESIEAGQQCGVILDQTNFYAESGGQTYDTGFMTCETNEDVEFAVTEVHTQGGYVVHIGRLISGTLKVGDKLKLAIDEQRRKLVMNNHTGTHILNFALRKVLTAEADQRGSLVAPDRLRFDFANKKPMSPAEVKAAEQSAVELISKNGEVYAKDSPLSLAKAIQGLRAVFNETYPDPVRVVSIGVPVDDLMADPSSPAGSLT-SIEFCGGTHLKRAGHVGDFVITTEEAIAKGIRRIVALTGPEAAKALKKAEHYQNEVNRIKAEGAKVTQAAQGKELVKQLVELTEEISQSNISYWKKDELRTELKNLKKQLDDLDRSNKAQAQQMAIENVKKLLEEE-KKDSEYIVHALEVGDNAKALDAALKQVRTITPNAAAMFFSCDAEKGKVICLSSVPKGIVARGLTANGWIKEVSEVIGGKGGGREESAQAIGNNVSSLDKALEVAHNFAKLKL 966          
BLAST of alanine--tRNA ligase, cytoplasmic vs. Ensembl Cavefish
Match: aars1 (alanyl-tRNA synthetase 1 [Source:ZFIN;Acc:ZDB-GENE-030131-3663])

HSP 1 Score: 1043.88 bits (2698), Expect = 0.000e+0
Identity = 510/973 (52.42%), Postives = 686/973 (70.50%), Query Frame = 2
Query:   83 NSSTIRREFVDFFKEKSHLNIHSSSTIPLNDPTLLFSNAGMNQFKKIFLGTADPNSDMAKWKRVANSQKCIRAGGKHNDLDDVGKDVYHHTFFEMLGNWSFGDYFKKEAISWAWELLTKVWGLPKDRFYVTYFGGNTELGLESDEEAKDIWLSMGIDASRVLPFGMKDNFWEMGETGPCGPCSEIHFDRIGNRDASELVNADDPDVLEVWNLVFIQYNRELDRSLKSLPHKHVDTGMGFERIVSVIQNKSSNYDTDLFQPLFDRIQAETNCRSYQGKLGDDDEGGIDMAYRVLADHARTLTIALSDGGQPQNTGRGYVLRRILRRAVRYAVDKLHAKPGMFSNLVDTVVDLLGEAFPEIKHSKENVKQIINEEESQFMKTLKRGKKMFDKSLEDFKQIKTGQTFLPGRIAWMLYDTYGYPLDLTALMCDESGIKINMEEYETCRKLAQETSQGSGDTVYLSVDLDVHDIDKLQTKKLQPTDDIPKFKYNADENGNYQLECHQATVLAIKIKEGFXXXXXXXXXXXGLVMDSTNFYAESGGQMYDTGSMVL-NDV--EQTEFEVATVKLCGGFVLHIGRVLNGSLKVGDRLKLEVDDARRKCLMQNHTGTHVLNYALREIVGDVDQKGSLVAPDKLRFDFSAKGQVDNEQLRKVETICKSIINEKKQVYVKEVALSIAKEIQGIRAVFGETYPDPVRVVSIGVPVDDLINSINEPKPSLNASVEFCGGTHLTNSHHISELVITSESAISKGVRRIFALTGAEAEKACKIASQMECEVGKL-ENTFSKTMEDSRIRDLLNSIKDMKRELDEALISYWFKNSLRARLESLRKELDSLEKTKKELLQANLMEQAWPVIENAVSHNKKFLVIRFLDGADQTSINKAFREIQKKHKSLSLLGYSVDVTSNKIECKASVAKEMVTASFNAKNWIEKVTEIVGGKSGGSDQSAQVTGVALMNLHGLEE---MANKFANMNI 2980
             ++ IR +F+DFF+   H  +HSSSTIPL+DPTLLF+NAGMNQFK IFL T DP+  MA+ KR AN+QKCIRAGGKHNDLDDVGKDVYHHTFFEMLG+WSFGDYFK  A   A ELLTK +G+P +R YVTYFGG+ E GLE D E K IWL +G+D SR+LP  MKDNFWEMG+TGPCGPCSEIHFDRIG RDAS LVN DDP+VLE+WNLVFIQ+NRE +  LK LP K +DTGMG ER+VSV+QNK SNYDTDLF P F+ IQ  T  R Y GK+G +D  GIDMAYRVLADHART+TIALSDGG+P NTGRGYVLRRILRRAVRY+ +KL A+ G F+ LVD VV+ LG+AFPE++   + VK IINEEE+QF+KTL RG+++ D+ ++     KT    +PG  AW+LYDTYG+PLDLTAL+ +E G+ ++M  +E  +K AQ  SQG G      + LD++ I++L+ K +  TDD PK++Y +D+NG+Y  E    TVLA++ +  F     +     G+++D T+FYAE GGQ +D G M+  ND   ++ EF V   ++ GG+VLH+G V  G+LKVGDR+ L +D+ARR+ +M NHT TH+LN+ALR ++G+ DQ+GSLVAPD+LRFDF+AKG +  +++ + E +  ++I + KQVY  E  L+ AK IQG+RAVF ETYPDPVRVVSIGVPV++L++  N P  SL  S+EFCGGTHL NS H +  VI SE AI+KG+RRI A+TGAEA+KA + A  +   +  + E   ++T  +   +D+   I D+   L  A+IS W K+ +R  L+ L+K +D L++  K  +Q  ++++   +I+   + N+  +V+    GA   ++N++ + ++      + + ++VD  + KI C   V +E+      A  W+++V  ++ GK GG D SAQ TG    N H ++E   +AN+FA + +
Sbjct:    6 TAAQIREKFIDFFRRHEHQYVHSSSTIPLDDPTLLFANAGMNQFKPIFLNTIDPSHPMARLKRAANTQKCIRAGGKHNDLDDVGKDVYHHTFFEMLGSWSFGDYFKHLACEMALELLTKEFGIPIERLYVTYFGGHEEAGLEPDLECKQIWLDLGMDESRILPGSMKDNFWEMGDTGPCGPCSEIHFDRIGGRDASHLVNMDDPNVLEIWNLVFIQFNRESETELKPLPKKSIDTGMGLERLVSVLQNKMSNYDTDLFIPYFEAIQKGTGARPYTGKVGAEDTDGIDMAYRVLADHARTITIALSDGGRPDNTGRGYVLRRILRRAVRYSHEKLGAQKGFFATLVDVVVESLGDAFPELRKDPDMVKDIINEEEAQFLKTLSRGRRILDRKIQSLGDSKT----IPGDTAWLLYDTYGFPLDLTALIAEERGMGVDMAAFEEEKKAAQLKSQGKGSGDEDHIMLDIYAIEELRNKGIPATDDSPKYRYTSDDNGSYGFEEVVGTVLALRRERTF-VDEVTTGQECGVLLDQTSFYAEQGGQTFDEGYMLRENDSTEDRMEFTVKNTQVRGGYVLHVGTVY-GTLKVGDRVTLHIDEARRRPIMSNHTATHILNFALRGVLGEADQRGSLVAPDRLRFDFTAKGAMSTKEVHRTEEMACAMIADSKQVYAMEAPLAAAKAIQGLRAVFDETYPDPVRVVSIGVPVEELLSDPNSPSGSLT-SIEFCGGTHLQNSSHAAPFVIVSEEAIAKGIRRIVAVTGAEAQKAQRKADALRQALSAMDEKVKAQTAPN---KDIQKEIADLTESLGTAVISQWQKDEMRESLKGLKKVMDDLDRASKADVQKRVLDKTKEIIDG--NPNQPLIVMEMESGASAKALNESLKLLKTNSPQTAAMLFTVDNDAGKIICLCQVPQEVANRGLKANEWVQEVCPLLDGKGGGKDMSAQATG---RNTHCIQEALQLANEFARLKL 963          
BLAST of alanine--tRNA ligase, cytoplasmic vs. Ensembl Cavefish
Match: aars1 (alanyl-tRNA synthetase 1 [Source:ZFIN;Acc:ZDB-GENE-030131-3663])

HSP 1 Score: 1043.11 bits (2696), Expect = 0.000e+0
Identity = 510/973 (52.42%), Postives = 686/973 (70.50%), Query Frame = 2
Query:   83 NSSTIRREFVDFFKEKSHLNIHSSSTIPLNDPTLLFSNAGMNQFKKIFLGTADPNSDMAKWKRVANSQKCIRAGGKHNDLDDVGKDVYHHTFFEMLGNWSFGDYFKKEAISWAWELLTKVWGLPKDRFYVTYFGGNTELGLESDEEAKDIWLSMGIDASRVLPFGMKDNFWEMGETGPCGPCSEIHFDRIGNRDASELVNADDPDVLEVWNLVFIQYNRELDRSLKSLPHKHVDTGMGFERIVSVIQNKSSNYDTDLFQPLFDRIQAETNCRSYQGKLGDDDEGGIDMAYRVLADHARTLTIALSDGGQPQNTGRGYVLRRILRRAVRYAVDKLHAKPGMFSNLVDTVVDLLGEAFPEIKHSKENVKQIINEEESQFMKTLKRGKKMFDKSLEDFKQIKTGQTFLPGRIAWMLYDTYGYPLDLTALMCDESGIKINMEEYETCRKLAQETSQGSGDTVYLSVDLDVHDIDKLQTKKLQPTDDIPKFKYNADENGNYQLECHQATVLAIKIKEGFXXXXXXXXXXXGLVMDSTNFYAESGGQMYDTGSMVL-NDV--EQTEFEVATVKLCGGFVLHIGRVLNGSLKVGDRLKLEVDDARRKCLMQNHTGTHVLNYALREIVGDVDQKGSLVAPDKLRFDFSAKGQVDNEQLRKVETICKSIINEKKQVYVKEVALSIAKEIQGIRAVFGETYPDPVRVVSIGVPVDDLINSINEPKPSLNASVEFCGGTHLTNSHHISELVITSESAISKGVRRIFALTGAEAEKACKIASQMECEVGKL-ENTFSKTMEDSRIRDLLNSIKDMKRELDEALISYWFKNSLRARLESLRKELDSLEKTKKELLQANLMEQAWPVIENAVSHNKKFLVIRFLDGADQTSINKAFREIQKKHKSLSLLGYSVDVTSNKIECKASVAKEMVTASFNAKNWIEKVTEIVGGKSGGSDQSAQVTGVALMNLHGLEE---MANKFANMNI 2980
             ++ IR +F+DFF+   H  +HSSSTIPL+DPTLLF+NAGMNQFK IFL T DP+  MA+ KR AN+QKCIRAGGKHNDLDDVGKDVYHHTFFEMLG+WSFGDYFK  A   A ELLTK +G+P +R YVTYFGG+ E GLE D E K IWL +G+D SR+LP  MKDNFWEMG+TGPCGPCSEIHFDRIG RDAS LVN DDP+VLE+WNLVFIQ+NRE +  LK LP K +DTGMG ER+VSV+QNK SNYDTDLF P F+ IQ  T  R Y GK+G +D  GIDMAYRVLADHART+TIALSDGG+P NTGRGYVLRRILRRAVRY+ +KL A+ G F+ LVD VV+ LG+AFPE++   + VK IINEEE+QF+KTL RG+++ D+ ++     KT    +PG  AW+LYDTYG+PLDLTAL+ +E G+ ++M  +E  +K AQ  SQG G      + LD++ I++L+ K +  TDD PK++Y +D+NG+Y  E    TVLA++ +  F     +     G+++D T+FYAE GGQ +D G M+  ND   ++ EF V   ++ GG+VLH+G V  G+LKVGDR+ L +D+ARR+ +M NHT TH+LN+ALR ++G+ DQ+GSLVAPD+LRFDF+AKG +  +++ + E +  ++I + KQVY  E  L+ AK IQG+RAVF ETYPDPVRVVSIGVPV++L++  N P  SL  S+EFCGGTHL NS H +  VI SE AI+KG+RRI A+TGAEA+KA + A  +   +  + E   ++T  +   +D+   I D+   L  A+IS W K+ +R  L+ L+K +D L++  K  +Q  ++++   +I+   + N+  +V+    GA   ++N++ + ++      + + ++VD  + KI C   V +E+      A  W+++V  ++ GK GG D SAQ TG    N H ++E   +AN+FA + +
Sbjct:   32 TAAQIREKFIDFFRRHEHQYVHSSSTIPLDDPTLLFANAGMNQFKPIFLNTIDPSHPMARLKRAANTQKCIRAGGKHNDLDDVGKDVYHHTFFEMLGSWSFGDYFKHLACEMALELLTKEFGIPIERLYVTYFGGHEEAGLEPDLECKQIWLDLGMDESRILPGSMKDNFWEMGDTGPCGPCSEIHFDRIGGRDASHLVNMDDPNVLEIWNLVFIQFNRESETELKPLPKKSIDTGMGLERLVSVLQNKMSNYDTDLFIPYFEAIQKGTGARPYTGKVGAEDTDGIDMAYRVLADHARTITIALSDGGRPDNTGRGYVLRRILRRAVRYSHEKLGAQKGFFATLVDVVVESLGDAFPELRKDPDMVKDIINEEEAQFLKTLSRGRRILDRKIQSLGDSKT----IPGDTAWLLYDTYGFPLDLTALIAEERGMGVDMAAFEEEKKAAQLKSQGKGSGDEDHIMLDIYAIEELRNKGIPATDDSPKYRYTSDDNGSYGFEEVVGTVLALRRERTF-VDEVTTGQECGVLLDQTSFYAEQGGQTFDEGYMLRENDSTEDRMEFTVKNTQVRGGYVLHVGTVY-GTLKVGDRVTLHIDEARRRPIMSNHTATHILNFALRGVLGEADQRGSLVAPDRLRFDFTAKGAMSTKEVHRTEEMACAMIADSKQVYAMEAPLAAAKAIQGLRAVFDETYPDPVRVVSIGVPVEELLSDPNSPSGSLT-SIEFCGGTHLQNSSHAAPFVIVSEEAIAKGIRRIVAVTGAEAQKAQRKADALRQALSAMDEKVKAQTAPN---KDIQKEIADLTESLGTAVISQWQKDEMRESLKGLKKVMDDLDRASKADVQKRVLDKTKEIIDG--NPNQPLIVMEMESGASAKALNESLKLLKTNSPQTAAMLFTVDNDAGKIICLCQVPQEVANRGLKANEWVQEVCPLLDGKGGGKDMSAQATG---RNTHCIQEALQLANEFARLKL 989          
BLAST of alanine--tRNA ligase, cytoplasmic vs. Ensembl Cavefish
Match: aars1 (alanyl-tRNA synthetase 1 [Source:ZFIN;Acc:ZDB-GENE-030131-3663])

HSP 1 Score: 1035.02 bits (2675), Expect = 0.000e+0
Identity = 507/973 (52.11%), Postives = 683/973 (70.20%), Query Frame = 2
Query:   83 NSSTIRREFVDFFKEKSHLNIHSSSTIPLNDPTLLFSNAGMNQFKKIFLGTADPNSDMAKWKRVANSQKCIRAGGKHNDLDDVGKDVYHHTFFEMLGNWSFGDYFKKEAISWAWELLTKVWGLPKDRFYVTYFGGNTELGLESDEEAKDIWLSMGIDASRVLPFGMKDNFWEMGETGPCGPCSEIHFDRIGNRDASELVNADDPDVLEVWNLVFIQYNRELDRSLKSLPHKHVDTGMGFERIVSVIQNKSSNYDTDLFQPLFDRIQAETNCRSYQGKLGDDDEGGIDMAYRVLADHARTLTIALSDGGQPQNTGRGYVLRRILRRAVRYAVDKLHAKPGMFSNLVDTVVDLLGEAFPEIKHSKENVKQIINEEESQFMKTLKRGKKMFDKSLEDFKQIKTGQTFLPGRIAWMLYDTYGYPLDLTALMCDESGIKINMEEYETCRKLAQETSQGSGDTVYLSVDLDVHDIDKLQTKKLQPTDDIPKFKYNADENGNYQLECHQATVLAIKIKEGFXXXXXXXXXXXGLVMDSTNFYAESGGQMYDTGSMVL-NDV--EQTEFEVATVKLCGGFVLHIGRVLNGSLKVGDRLKLEVDDARRKCLMQNHTGTHVLNYALREIVGDVDQKGSLVAPDKLRFDFSAKGQVDNEQLRKVETICKSIINEKKQVYVKEVALSIAKEIQGIRAVFGETYPDPVRVVSIGVPVDDLINSINEPKPSLNASVEFCGGTHLTNSHHISELVITSESAISKGVRRIFALTGAEAEKACKIASQMECEVGKL-ENTFSKTMEDSRIRDLLNSIKDMKRELDEALISYWFKNSLRARLESLRKELDSLEKTKKELLQANLMEQAWPVIENAVSHNKKFLVIRFLDGADQTSINKAFREIQKKHKSLSLLGYSVDVTSNKIECKASVAKEMVTASFNAKNWIEKVTEIVGGKSGGSDQSAQVTGVALMNLHGLEE---MANKFANMNI 2980
             ++ IR +F+DFF+   H  +HSSSTIPL+DPTLLF+NAGMNQFK IFL T DP+  MA+ KR AN+QKCIRAGGKHNDLDDVGKDVYHHTFFEMLG+WSFGDYFK  A   A ELLTK +G+P +R YVTYFGG+ E GLE D E K IWL +G+D SR+LP  MKDNFWEMG+TGPCGPCSEIHFDRIG RDAS LVN DDP+VLE+WNLVFIQ+NRE +  LK LP K +DTGMG ER+VSV+QNK SNYDTDLF P F+ IQ  T  R Y GK+G +D  GIDMAYRVLADHART+TIALSDGG+P NTGRGYVLRRILRRAVRY+ +KL A+ G F+ LVD VV+ LG+AFPE++   + VK IINEEE+QF+KTL RG+++ D+ ++    I+          AW+LYDTYG+PLDLTAL+ +E G+ ++M  +E  +K AQ  SQG G      + LD++ I++L+ K +  TDD PK++Y +D+NG+Y  E    TVLA++ +  F     +     G+++D T+FYAE GGQ +D G M+  ND   ++ EF V   ++ GG+VLH+G V  G+LKVGDR+ L +D+ARR+ +M NHT TH+LN+ALR ++G+ DQ+GSLVAPD+LRFDF+AKG +  +++ + E +  ++I + KQVY  E  L+ AK IQG+RAVF ETYPDPVRVVSIGVPV++L++  N P  SL  S+EFCGGTHL NS H +  VI SE AI+KG+RRI A+TGAEA+KA + A  +   +  + E   ++T  +   +D+   I D+   L  A+IS W K+ +R  L+ L+K +D L++  K  +Q  ++++   +I+   + N+  +V+    GA   ++N++ + ++      + + ++VD  + KI C   V +E+      A  W+++V  ++ GK GG D SAQ TG    N H ++E   +AN+FA + +
Sbjct:    6 TAAQIREKFIDFFRRHEHQYVHSSSTIPLDDPTLLFANAGMNQFKPIFLNTIDPSHPMARLKRAANTQKCIRAGGKHNDLDDVGKDVYHHTFFEMLGSWSFGDYFKHLACEMALELLTKEFGIPIERLYVTYFGGHEEAGLEPDLECKQIWLDLGMDESRILPGSMKDNFWEMGDTGPCGPCSEIHFDRIGGRDASHLVNMDDPNVLEIWNLVFIQFNRESETELKPLPKKSIDTGMGLERLVSVLQNKMSNYDTDLFIPYFEAIQKGTGARPYTGKVGAEDTDGIDMAYRVLADHARTITIALSDGGRPDNTGRGYVLRRILRRAVRYSHEKLGAQKGFFATLVDVVVESLGDAFPELRKDPDMVKDIINEEEAQFLKTLSRGRRILDRKIQSLGDIQRNLR----DTAWLLYDTYGFPLDLTALIAEERGMGVDMAAFEEEKKAAQLKSQGKGSGDEDHIMLDIYAIEELRNKGIPATDDSPKYRYTSDDNGSYGFEEVVGTVLALRRERTF-VDEVTTGQECGVLLDQTSFYAEQGGQTFDEGYMLRENDSTEDRMEFTVKNTQVRGGYVLHVGTVY-GTLKVGDRVTLHIDEARRRPIMSNHTATHILNFALRGVLGEADQRGSLVAPDRLRFDFTAKGAMSTKEVHRTEEMACAMIADSKQVYAMEAPLAAAKAIQGLRAVFDETYPDPVRVVSIGVPVEELLSDPNSPSGSLT-SIEFCGGTHLQNSSHAAPFVIVSEEAIAKGIRRIVAVTGAEAQKAQRKADALRQALSAMDEKVKAQTAPN---KDIQKEIADLTESLGTAVISQWQKDEMRESLKGLKKVMDDLDRASKADVQKRVLDKTKEIIDG--NPNQPLIVMEMESGASAKALNESLKLLKTNSPQTAAMLFTVDNDAGKIICLCQVPQEVANRGLKANEWVQEVCPLLDGKGGGKDMSAQATG---RNTHCIQEALQLANEFARLKL 963          
BLAST of alanine--tRNA ligase, cytoplasmic vs. Ensembl Cavefish
Match: aars2 (alanyl-tRNA synthetase 2, mitochondrial [Source:NCBI gene;Acc:103031244])

HSP 1 Score: 744.962 bits (1922), Expect = 0.000e+0
Identity = 405/977 (41.45%), Postives = 599/977 (61.31%), Query Frame = 2
Query:   83 NSSTIRREFVDFFKEK-SHLNIHSSSTIPLNDPTLLFSNAGMNQFKKIFLGTADPNSDMAKWKRVANSQKCIRAGGKHNDLDDVGKDVYHHTFFEMLGNWSFGDYFKKEAISWAWELLTKVWGLPKDRFYVTYFGGNTELGLESDEEAKDIWLSMGIDASRVLPFGMKDNFWEMGETGPCGPCSEIHFDRIGNRDASELVNADDPDVLEVWNLVFIQYNRELDRSLKSLPHKHVDTGMGFERIVSVIQNKSSNYDTDLFQPLFDRIQAETNCRSYQGKLGDDDEGGIDMAYRVLADHARTLTIALSDGGQPQNTGRGYVLRRILRRAVRYAVDKLHAKPGMFSNLVDTVVDLLGEAFPEIKHSKENVKQIINEEESQFMKTLKRGKKMFDKSLEDFKQIKTGQTFLPGRIAWMLYDTYGYPLDLTALMCDESGIKINMEEYETC----RKLAQETSQGSGDTVYLSVDLDVHDIDKLQTKKLQPTDDIPKFKYNADENGNYQLECHQATVLAIKIKEGFXXXXXXXXXXXGLVMDSTNFYAESGGQMYDTGSMVLNDVEQTEFEVATVKLCGGFVLHIGRVLNGSLKVGDRLKLEVDDARRKCLMQNHTGTHVLNYALREIVGD-VDQKGSLVAPDKLRFDFSAKGQVDNEQLRKVETICKSIINEKKQVYVKEVALSIAKEIQGIRAVFGETYPDPVRVVSIGVPVDDLINSINEPKPSLNASVEFCGGTHLTNSHHISELVITSESAISKGVRRIFALTGAEAEKACKIASQMECEVGKLEN--TFSKTMEDSRIRDLLNSIKDMKRELDEALISYWFKNSLRARLESLRKELDSLEKTKKELLQANLMEQAWPVIENAVSHNKKFLVIRFLDGADQTSINKAFREIQKKHK----SLSLLGYSVDVTSNKIECKASVAKEMVTASFNAKNWIEKVTEIVGGKSGGSDQSAQVTGVA------LMNLHGLEEMAN 2959
             S + R+ F+ FF E+  H  + S+   P  DP+LLF NAGMNQFK I LG ADP S+MA ++RV NSQKC+RAGGKHNDL+DVG+DVYHHTFFEMLGNWSFGDYFK EA S AW LLT+V+ +P +R YV+YF G+   GL +DEE + IWLS+G+    VLPFGM+DNFWEMGETGPCGPC+EIH+D +GNR+A+ LVNAD+PDV+E+WNLVF+Q+NRE D  L++LP   VDTGMG ER+++V+QNK SNYDTDLF PL   I   +    Y+G+ G  D G +DMAYRV+ADH RTL + ++DG  P  TG   VLRRILRRAVR++ + L A  GM ++LV TV  +LG+A+PE+      + ++IN  E+QF+ +LK+G+++ +++L    ++       P  +AW L+   G+PLDL  LM +E  + +N +  E      +KL  +T  G+G+     + +D+  + +LQ++ +  T+D  K+ Y+  ++G Y      A+VLA+   +             G+V+D T FYAE GGQ +D G    N ++   F V  V+L GG+V+H       +L+ GD+++L VD+ +R   M  HT THVLN+ALRE++G  V Q+GS V  +++RFDFS++  +   QL++VET+ ++II + ++++ +E+ ++ A +I G+R V  E YPDPVRVVS+GVPV +L++     +     S+E C GTHL  +  I +LV+ SE  + KG+ RI A+TG +A++A +    +  EV  L    T  ++   + ++ L   +  +   ++   I  W K   + RL++L++  ++   T ++L       +A  +++     NK  LV    D  +  SI+   + + K  +    SL +L   +   S ++ C   V K       +A  W   V   +GG +GGS+  A+  G A      L  LH  EE A+
Sbjct:   34 TSQSARQTFIQFFTEQHEHRPVPSAPVRPRGDPSLLFVNAGMNQFKPILLGCADPRSEMASYRRVVNSQKCVRAGGKHNDLEDVGRDVYHHTFFEMLGNWSFGDYFKVEACSMAWRLLTEVYEIPAERLYVSYFSGDAASGLPADEETRHIWLSLGVHPDHVLPFGMRDNFWEMGETGPCGPCTEIHYDHVGNRNAAALVNADNPDVVEIWNLVFMQHNREADGGLQALPQVSVDTGMGLERLLTVLQNKRSNYDTDLFTPLLSAIHQHSKAPPYRGRTGQADGGRVDMAYRVVADHIRTLCVCIADGVYPGMTGPELVLRRILRRAVRFSTEVLQAPEGMLASLVPTVTHILGDAYPELHTETGRIMELINVNEAQFLSSLKQGRRVINRTL---SKMNRDSVEFPASVAWSLHQNLGFPLDLIDLMLEEHNMTVNKDGLEQLAAENKKLQSQTEGGAGER---GLHMDLQSLAELQSRGVPYTNDSLKYDYSLRQDGTYVFPPCSASVLALYCGQSL-VREVCEGQRCGVVLDQTCFYAEQGGQTHDQGYFTKNGLQDVLFPVDCVRLAGGYVVHEITAAE-TLRTGDQIQLHVDETQRLACMVKHTATHVLNFALRELLGSGVVQRGSHVTAERIRFDFSSEASLSVSQLQEVETMVQAIIQQNEEIHTQEIPVARANQIAGLRTV-DEVYPDPVRVVSVGVPVPELLSGHAFKR----TSIELCCGTHLLQTGGIGDLVVVSERQMVKGMSRIIAVTGNDAKQAREAGQSLLQEVESLTARITADRSPSLATVQRLSKEVGLLTDAVEGTPIPQWQKREFQTRLKALQRNANT---TIRKLEIKEAAAKAKVLLKRHA--NKAVLV----DTVEADSISVVMKTVNKLSELAPDSLIMLLSHLQ-PSGRVLCACQVPKG--EGGVSASEWALAVCSNLGGNAGGSETVAKGVGTAGNTADLLKTLHWAEEFAH 985          
BLAST of alanine--tRNA ligase, cytoplasmic vs. Ensembl Cavefish
Match: aars2 (alanyl-tRNA synthetase 2, mitochondrial [Source:NCBI gene;Acc:103031244])

HSP 1 Score: 726.472 bits (1874), Expect = 0.000e+0
Identity = 401/977 (41.04%), Postives = 592/977 (60.59%), Query Frame = 2
Query:   83 NSSTIRREFVDFFKEK-SHLNIHSSSTIPLNDPTLLFSNAGMNQFKKIFLGTADPNSDMAKWKRVANSQKCIRAGGKHNDLDDVGKDVYHHTFFEMLGNWSFGDYFKKEAISWAWELLTKVWGLPKDRFYVTYFGGNTELGLESDEEAKDIWLSMGIDASRVLPFGMKDNFWEMGETGPCGPCSEIHFDRIGNRDASELVNADDPDVLEVWNLVFIQYNRELDRSLKSLPHKHVDTGMGFERIVSVIQNKSSNYDTDLFQPLFDRIQAETNCRSYQGKLGDDDEGGIDMAYRVLADHARTLTIALSDGGQPQNTGRGYVLRRILRRAVRYAVDKLHAKPGMFSNLVDTVVDLLGEAFPEIKHSKENVKQIINEEESQFMKTLKRGKKMFDKSLEDFKQIKTGQTFLPGRIAWMLYDTYGYPLDLTALMCDESGIKINMEEYETC----RKLAQETSQGSGDTVYLSVDLDVHDIDKLQTKKLQPTDDIPKFKYNADENGNYQLECHQATVLAIKIKEGFXXXXXXXXXXXGLVMDSTNFYAESGGQMYDTGSMVLNDVEQTEFEVATVKLCGGFVLHIGRVLNGSLKVGDRLKLEVDDARRKCLMQNHTGTHVLNYALREIVGD-VDQKGSLVAPDKLRFDFSAKGQVDNEQLRKVETICKSIINEKKQVYVKEVALSIAKEIQGIRAVFGETYPDPVRVVSIGVPVDDLINSINEPKPSLNASVEFCGGTHLTNSHHISELVITSESAISKGVRRIFALTGAEAEKACKIASQMECEVGKLEN--TFSKTMEDSRIRDLLNSIKDMKRELDEALISYWFKNSLRARLESLRKELDSLEKTKKELLQANLMEQAWPVIENAVSHNKKFLVIRFLDGADQTSINKAFREIQKKHK----SLSLLGYSVDVTSNKIECKASVAKEMVTASFNAKNWIEKVTEIVGGKSGGSDQSAQVTGVA------LMNLHGLEEMAN 2959
             S + R+ F+ FF E+  H  + S+   P  DP+LLF NAGMNQFK I LG ADP S+MA ++RV NSQKC+RAGGKHNDL+DVG+DVYHHTFFEMLGNWSFGDYFK EA S AW LLT+V+ +P +R YV+YF G+   GL +DEE + IWLS+G+    VLPFGM+DNFWEMGETGPCGPC+EIH+D +GNR+A+ LVNAD+PDV+E+WNLVF+Q+NRE D  L++LP   VDTGMG ER+++V+QNK SNYDTDLF PL   I   +    Y+G+ G  D G +DMAYRV+ADH RTL + ++DG  P  TG   VLRRILRRAVR++ + L A  GM ++LV TV  +L             + ++IN  E+QF+ +LK+G+++ +++L    ++       P  +AW L+   G+PLDL  LM +E  + +N +  E      +KL  +T  G+G+     + +D+  + +LQ++ +  T+D  K+ Y+  ++G Y      A+VLA+   +             G+V+D T FYAE GGQ +D G    N ++   F V  V+L GG+V+H       +L+ GD+++L VD+ +R   M  HT THVLN+ALRE++G  V Q+GS V  +++RFDFS++  +   QL++VET+ ++II + ++++ +E+ ++ A +I G+R V  E YPDPVRVVS+GVPV +L++     +     S+E C GTHL  +  I +LV+ SE  + KG+ RI A+TG +A++A +    +  EV  L    T  ++   + ++ L   +  +   ++   I  W K   + RL++L++  ++   T ++L       +A  +++     NK  LV    D  +  SI+   + + K  +    SL +L   +   S ++ C   V K       +A  W   V   +GG +GGS+  A+  G A      L  LH  EE A+
Sbjct:   34 TSQSARQTFIQFFTEQHEHRPVPSAPVRPRGDPSLLFVNAGMNQFKPILLGCADPRSEMASYRRVVNSQKCVRAGGKHNDLEDVGRDVYHHTFFEMLGNWSFGDYFKVEACSMAWRLLTEVYEIPAERLYVSYFSGDAASGLPADEETRHIWLSLGVHPDHVLPFGMRDNFWEMGETGPCGPCTEIHYDHVGNRNAAALVNADNPDVVEIWNLVFMQHNREADGGLQALPQVSVDTGMGLERLLTVLQNKRSNYDTDLFTPLLSAIHQHSKAPPYRGRTGQADGGRVDMAYRVVADHIRTLCVCIADGVYPGMTGPELVLRRILRRAVRFSTEVLQAPEGMLASLVPTVTHIL-------------IMELINVNEAQFLSSLKQGRRVINRTL---SKMNRDSVEFPASVAWSLHQNLGFPLDLIDLMLEEHNMTVNKDGLEQLAAENKKLQSQTEGGAGER---GLHMDLQSLAELQSRGVPYTNDSLKYDYSLRQDGTYVFPPCSASVLALYCGQSL-VREVCEGQRCGVVLDQTCFYAEQGGQTHDQGYFTKNGLQDVLFPVDCVRLAGGYVVHEITAAE-TLRTGDQIQLHVDETQRLACMVKHTATHVLNFALRELLGSGVVQRGSHVTAERIRFDFSSEASLSVSQLQEVETMVQAIIQQNEEIHTQEIPVARANQIAGLRTV-DEVYPDPVRVVSVGVPVPELLSGHAFKR----TSIELCCGTHLLQTGGIGDLVVVSERQMVKGMSRIIAVTGNDAKQAREAGQSLLQEVESLTARITADRSPSLATVQRLSKEVGLLTDAVEGTPIPQWQKREFQTRLKALQRNANT---TIRKLEIKEAAAKAKVLLKRHA--NKAVLV----DTVEADSISVVMKTVNKLSELAPDSLIMLLSHLQ-PSGRVLCACQVPKG--EGGVSASEWALAVCSNLGGNAGGSETVAKGVGTAGNTADLLKTLHWAEEFAH 972          
BLAST of alanine--tRNA ligase, cytoplasmic vs. Ensembl Sea Lamprey
Match: aars1 (alanyl-tRNA synthetase 1 [Source:ZFIN;Acc:ZDB-GENE-030131-3663])

HSP 1 Score: 917.146 bits (2369), Expect = 0.000e+0
Identity = 481/975 (49.33%), Postives = 644/975 (66.05%), Query Frame = 2
Query:   83 NSSTIRREFVDFFKEKSHLNIHSSSTIPLNDPTLLFSNAGMNQFKKIFLGTADPNSDMAKWKRVANSQKCIRAGGKHNDLDDVGKDVYHHTFFEMLGNWSFGDYFKKEAISWAWELLTKVWGLPKDRFYVTYFGGNTELGLESDEEAKDIWLSMGIDASRVLPFGMKDNFWEMGETGPCGPCSEIHFDRIGNRDASELVNADDPDVLEVWNLVFIQYNRELDR-SLKSLPHKH----VDTGMGFERIVSVIQNKSSNYDTDLFQPLFDRIQAETNCRSYQGKLGDDDEGGIDMAYRVLADHARTLTIALSDGGQPQNTGRGYVLRRILRRAVRYAVDKLHAKPGMFSNLVDTVVDLLGEAFPEIKHSKENVKQIINEEESQFMKTLKRGKKMFDKSLEDFKQIKTGQTFLPGRIAWMLYDTYGYPLDLTALMCDESGIKINMEEYETCRKLAQETSQGSGDTVYLSVDLDVHDIDKLQTKKLQPTDDIPKFKYNADENGNYQLECHQATVLAIKIKEGFXXXXXXXXXXXGLVMDSTNFYAESGGQMYDTGSMVLND--VEQTEFEVATVKLCGGFVLHIGRVLNGSLKVGDRLKLEVDDARRKCLMQNHTGTHVLNYALREIVGDVDQKGSLVAPDKLRFDFSAKGQVDNEQLRKVETICKSIINEKKQVYVKEVALSIAKEIQGIRAVFGETYPDPVRVVSIGVPVDDLINSINEPKPSLNASVEFCGGTHLTNSHHISELVITSESAISKGVRRIFALTGAEAEKACKIASQMECEVGKLENTFSKTMEDSRIRDLLNSIKDMKRELDEALISYWFKNSLRARLESLRKELDSLEKTKKELLQANLMEQAWPVIENAVSHNKKFLVIRFLDGADQ--TSINKAFREIQKKHKSLSLLGYSVDVTSNKIECKASVAKEMVTASFNAKNWIEKVTEIVGGKSGGSDQSAQVTGVALMNLHGLEEMANKFANMNI 2980
            ++S +R++F+DFFK+  H  +HSSSTIP +DPTLLF+NAGMNQFK IFL T DP+  MA+  R AN+QKCIRAGGKHNDLDDVGKDVYHHTFFEMLG+WSFGDYFKKEA   A  LL     LP +R YVTYFGG+ +  L+ D E K IWL +G+   RVLP  MKDNFWEMG+TGPCGPC+EIHFDRIG RDA+ LVN DDPDVLE+WNLVFIQ+NR     ++  LP +     + T +       V++    N+  DL Q   D++   T  R+Y G +G +D  GIDMAYRVLADHARTLTIALSDGG+P N GRGYVLRRILRRAVRYA +K++AK G FS LVD VV+ LG+AFPE+K   + V+ +INEEE QF+KTL RG+++ ++ +++          LPG  AW+LYDTYG+P+DLT L+ +E G+ I+ME +E  +K AQ  SQ  G      + LD+H ID+L+ + L PT+D PK+ Y+AD NGNY  E   A VLA++  + F    +S     G++++ T FYAE GGQ+YD G MV  D   ++TEF V   ++ GG+VLHIG +L G++KVGD++ L VD+ARR+ +M NHT THVLN+ALR ++G+ DQ+GSLVAPD+LRFDF+A+G +  +Q++K E I   II + K VY  +V L+ AK I G+RAVF ETYPDPVRVVS+GVPV +L+   + P  +L+ S+EFCGGTHL NS H    VI +E AI+KG+RRI A+TG EA KA + A  ++  V  L       +E    +DL   I D+   L  A I  W K+ LR  L +L++ +D L++  K  LQ  +     P + +   H+  +    F  G  +  + + K  R         S + ++VD  + K+ C   VA+E V +   A  W++ VT ++GG+ GG D SAQ +G    ++     +A +FA + +
Sbjct:    6 SASEVRQKFIDFFKKNEHAYVHSSSTIPGDDPTLLFANAGMNQFKPIFLNTIDPSHPMAQLHRAANTQKCIRAGGKHNDLDDVGKDVYHHTFFEMLGSWSFGDYFKKEACEMAMALLVGDLQLPLERLYVTYFGGDQKAQLQPDLECKQIWLDLGVPEERVLPGSMKDNFWEMGDTGPCGPCTEIHFDRIGGRDAAHLVNQDDPDVLEIWNLVFIQFNRCCTLVAVSMLPERCLYYLICTALSMGTKKFVLEKHFDNFVLDLMQLALDKVNQGTGARAYTGHVGKEDADGIDMAYRVLADHARTLTIALSDGGRPDNVGRGYVLRRILRRAVRYAHEKMNAKKGFFSTLVDVVVETLGDAFPELKKDPQAVRDVINEEEEQFLKTLSRGRRILERKIQNIN-----DNVLPGDTAWLLYDTYGFPVDLTGLIAEEKGLTIDMESFEQEKKAAQLKSQARGFGDEDLIMLDIHAIDELRERGLLPTNDAPKYNYSADANGNYDFERVVAEVLALRRNKQF-VDEASSGKECGILLNQTCFYAEQGGQVYDVGYMVKEDDSEDKTEFTVKNTQVRGGYVLHIG-MLYGNIKVGDKVTLYVDEARRRPIMSNHTSTHVLNFALRAVLGEADQRGSLVAPDRLRFDFTARGAMTTDQIQKTEEIANDIIRQAKPVYTADVPLAEAKAIAGLRAVFDETYPDPVRVVSVGVPVPELLADPSGPGGALH-SIEFCGGTHLQNSGHAGSFVIVTEEAIAKGIRRIVAVTGTEATKATRKAGAIQEAVAALAEKVK--VETVPNKDLQKEIADLVEVLGPATIPQWRKDKLRENLTALKRTMDDLDRASKADLQKKV-----PGLFSQHHHHLHY----FCQGGCESLSKLGKLLRHYCSLSPQTSTMLFAVDNDAGKVTCLCQVAEEAVHSGLKASAWVQHVTPLLGGRGGGKDVSAQASGTNTTSIPEAISLAQEFARLKL 961          
BLAST of alanine--tRNA ligase, cytoplasmic vs. Ensembl Sea Lamprey
Match: aars1 (alanyl-tRNA synthetase 1 [Source:ZFIN;Acc:ZDB-GENE-030131-3663])

HSP 1 Score: 907.131 bits (2343), Expect = 0.000e+0
Identity = 477/973 (49.02%), Postives = 645/973 (66.29%), Query Frame = 2
Query:   83 NSSTIRREFVDFFKEKSHLNIHSSSTIPLNDPTLLFSNAGMNQFKKIFLGTADPNSDMAKWKRVANSQKCIRAGGKHNDLDDVGKDVYHHTFFEMLGNWSFGDYFKKEAISWAWELLTKVWGLPKDRFYVTYFGGNTELGLESDEEAKDIWLSMGIDASRVLPFGMKDNFWEMGETGPCGPCSEIHFDRIGNRDASELVNADDPDVLEVWNLVFIQYNRELDR-SLKSLPHKH----VDTGMGFERIVSVIQNKSSNYDTDLFQPLFDRIQAETNCRSYQGKLGDDDEGGIDMAYRVLADHARTLTIALSDGGQPQNTGRGYVLRRILRRAVRYAVDKLHAKPGMFSNLVDTVVDLLGEAFPEIKHSKENVKQIINEEESQFMKTLKRGKKMFDKSLEDFKQIKTGQTFLPGRIAWMLYDTYGYPLDLTALMCDESGIKINMEEYETCRKLAQETSQGSGDTVYLSVDLDVHDIDKLQTKKLQPTDDIPKFKYNADENGNYQLECHQATVLAIKIKEGFXXXXXXXXXXXGLVMDSTNFYAESGGQMYDTGSMVLNDVEQTEFEVATVKLCGGFVLHIGRVLNGSLKVGDRLKLEVDDARRKCLMQNHTGTHVLNYALREIVGDVDQKGSLVAPDKLRFDFSAKGQVDNEQLRKVETICKSIINEKKQVYVKEVALSIAKEIQGIRAVFGETYPDPVRVVSIGVPVDDLINSINEPKPSLNASVEFCGGTHLTNSHHISELVITSESAISKGVRRIFALTGAEAEKACKIASQ-MECEVGKL-ENTFSKTMEDSRIRDLLNSIKDMKRELDEALISYWFKNSLRARLESLRKELDSLEKTKKELLQANLMEQAWPVIENAVSHNKKFLVIRFLDGADQTSINKAFREIQKKHKSLSLLGYSVDVTSNKIECKASVAKEMVTASFNAKNWIEKVTEIVGGKSGGSDQSAQVTGVALMNLHGLEEMANKFANMNI 2980
            ++S +R++F+DFFK+  H  +HSSSTIP +DPTLLF+NAGMNQFK IFL T DP+  MA+  R AN+QKCIRAGGKHNDLDDVGKDVYHHTFFEMLG+WSFGDYFKKEA   A  LL     LP +R YVTYFGG+ +  L+ D E K IWL +G+   RVLP  MKDNFWEMG+TGPCGPC+EIHFDRIG RDA+ LVN DDPDVLE+WNLVFIQ+NR     ++  LP +     + T +       V++    N+  DL Q   D +   T  R+Y G +G +D  GIDMAYRVLADHARTLTIALSDGG+P N GRGYVLRRILRRAVRYA +K++AK G FS LVD VV+ LG+AFPE+K   + V+ +INEEE QF+KTL RG+++ ++ +++          LPG  AW+LYDTYG+P+DLT L+ +E G+ I+ME +E  +K AQ  SQ  G      + LD+H ID+L+ + L PT+D PK          Y  E   A VLA++  + F    +S     G++++ T FYAE GGQ+YD G MV    ++TEF V   ++ GG+VLHIG +L G++KVGD++ L VD+ARR+ +M NHT THVLN+ALR ++G+ DQ+GSLVAPD+LRFDF+A+G +  +Q++K E I   II + K VY  +V L+ AK I G+RAVF ETYPDPVRVVS+GVPV +L+   + P  +L+ S+EFCGGTHL NS H    VI +E AI+KG+RRI A+TG EA K   + ++ ++ E+  L E +F           L +S+  M   L  A I  W K+ LR  L +L++ +D L++  K  LQ  ++E+   +IEN  S NK  +++   +GA   ++N+A +  +      S + ++VD  + K+ C   VA+E V +   A  W++ VT ++GG+ GG D SAQ +G    ++     +A +FA + +
Sbjct:   15 SASEVRQKFIDFFKKNEHAYVHSSSTIPGDDPTLLFANAGMNQFKPIFLNTIDPSHPMAQLHRAANTQKCIRAGGKHNDLDDVGKDVYHHTFFEMLGSWSFGDYFKKEACEMAMALLVGDLQLPLERLYVTYFGGDQKAQLQPDLECKQIWLDLGVPEERVLPGSMKDNFWEMGDTGPCGPCTEIHFDRIGGRDAAHLVNQDDPDVLEIWNLVFIQFNRCCTLVAVSMLPERCLYYLICTALSMGTKKFVLEKHFDNFVLDLMQLALDEVNQGTGARAYTGHVGKEDADGIDMAYRVLADHARTLTIALSDGGRPDNVGRGYVLRRILRRAVRYAHEKMNAKKGFFSTLVDVVVETLGDAFPELKKDPQAVRDVINEEEEQFLKTLSRGRRILERKIQNIN-----DNVLPGDTAWLLYDTYGFPVDLTGLIAEEKGLTIDMESFEQEKKAAQLKSQARGFGDEDLIMLDIHAIDELRERGLLPTNDAPK----------YNFERVVAEVLALRRNKQF-VDEASSGKECGILLNQTCFYAEQGGQVYDVGYMVNLQGQKTEFTVKNTQVRGGYVLHIG-MLYGNIKVGDKVTLYVDEARRRPIMSNHTSTHVLNFALRAVLGEADQRGSLVAPDRLRFDFTARGAMTTDQIQKTEEIANDIIRQAKPVYTADVPLAEAKAIAGLRAVFDETYPDPVRVVSVGVPVPELLADPSGPGGALH-SIEFCGGTHLQNSGHAGSFVIVTEEAIAKGIRRIVAVTGTEATKVETVPNKDLQKEIADLVEVSFG----------LADSLGKMV--LGPATIPQWRKDKLRENLTALKRTMDDLDRASKADLQKKVLEKTKQLIEN--SPNKPLVIMEMDNGASAKALNEALKLFKSLSPQTSTMLFAVDNDAGKVTCLCQVAEEAVHSGLKASAWVQHVTPLLGGRGGGKDVSAQASGTNTTSIPEAISLAQEFARLKL 955          
BLAST of alanine--tRNA ligase, cytoplasmic vs. Ensembl Sea Lamprey
Match: aars1 (alanyl-tRNA synthetase 1 [Source:ZFIN;Acc:ZDB-GENE-030131-3663])

HSP 1 Score: 883.248 bits (2281), Expect = 0.000e+0
Identity = 467/970 (48.14%), Postives = 635/970 (65.46%), Query Frame = 2
Query:   83 NSSTIRREFVDFFKEKSHLNIHSSSTIPLNDPTLLFSNAGMNQFKKIFLGTADPNSDMAKWKRVANSQKCIRAGGKHNDLDDVGKDVYHHTFFEMLGNWSFGDYFKKEAISWAWELLTKVWGLPKDRFYVTYFGGNTELGLESDEEAKDIWLSMGIDASRVLPFGMKDNFWEMGETGPCGPCSEIHFDRIGNRDASELVNADDPDVLEVWNLVFIQYNRELDR-SLKSLPHKHVDTGMGFERIVSVIQNKSSNYDTDLFQPLFDRIQA--ETNCRSYQGKLGDDDEGGIDMAYRVLADHARTLTIALSDGGQPQNTGRGYVLRRILRRAVRYAVDKLHAKPGMFSNLVDTVVDLLGEAFPEIKHSKENVKQIINEEESQFMKTLKRGKKMFDKSLEDFKQIKTGQTFLPGRIAWMLYDTYGYPLDLTALMCDESGIKINMEEYETCRKLAQETSQGSGDTVYLSVDLDVHDIDKLQTKKLQPTDDIPKFKYNADENGNYQLECHQATVLAIKIKEGFXXXXXXXXXXXGLVMDSTNFYAESGGQMYDTGSMVLNDVEQTEFEVATVKLCGGFVLHIGRVLNGSLKVGDRLKLEVDDARRKCLMQNHTGTHVLNYALREIVGDVDQKGSLVAPDKLRFDFSAKGQVDNEQLRKVETICKSIINEKKQVYVKEVALSIAKEIQGIRAVFGETYPDPVRVVSIGVPVDDLINSINEPKPSLNASVEFCGGTHLTNSHHISELVITSESAISKGVRRIFALTGAEAEKACKIASQMECEVGKLENTFSKTMEDSRIRDLLNSIKDMKRELDEALISYWFKNSLRARLESLRKELDSLEKTKKELLQANLMEQAWPVIENAVSHNKKFLVIRFLDG-ADQTSINKAFREIQKKHKSLSLLGYSVDVTSNKIECKASVAKEMVTASFNAKNWIEKVTEIVGGKSGGSDQSAQVTGVALMNLHGLEEMANKFANMNI 2980
            ++S +R++F+DFFK+  H  +HSSSTIP +DPTLLF+NAGMNQFK IFL T DP+  MA+  R AN+QKCIRAGGKHNDLDDVGKDVYHHTFFEMLG+WSFGDYFKKEA   A  LL     LP +R YVTYFGG+ +  L+ D E K IWL +G+   RVLP  MKDNFWEMG+TGPCGPC+EIHFDRIG RDA+ LVN DDPDVLE+WNLVFIQ+NR     ++  LP +     + +    ++      N+  DL Q   D ++    T  R+Y G +G +D  GIDMAYRVLADHARTLTIALSDGG+P N GRGYVLRRILRRAVRYA +K++AK G FS LVD VV+ LG+AFPE+K   + V+ +INEEE QF+KTL RG+++ ++ +++          LPG  AW+LYDTYG+P+DLT L+ +E G+ I+ME +E  +K AQ  SQ  G      + LD+H ID+L+ + L PT+D PK+ Y+AD NGNY +  ++  V             +S     G++++ T FYAE GGQ+YD G MV     +TEF V   ++ GG+VLHIG +L G++KVGD++ L VD+ARR+ +M NHT THVLN+ALR ++G+ DQ+GSLVAPD+LRFDF+A+G +  +Q++K E I   II + K VY  +V L+ AK I G+RAVF ETYPDPVRVVS+GVPV +L+   + P  +L+ S+EFCGGTHL NS H    VI +E AI+KG+RRI A+TG EA KA + A  ++  V  L       +E    +DL   I D+   L  A I  W K+ LR  L +L++ +D L++  K  LQ  +     P + +   H+  +     L+   D T++ +  +++ +   +  L+   +D     ++   +  +E V +   A  W++ VT ++GG+ GG D SAQ +G    ++     +A +FA + +
Sbjct:    6 SASEVRQKFIDFFKKNEHAYVHSSSTIPGDDPTLLFANAGMNQFKPIFLNTIDPSHPMAQLHRAANTQKCIRAGGKHNDLDDVGKDVYHHTFFEMLGSWSFGDYFKKEACEMAMALLVGDLQLPLERLYVTYFGGDQKAQLQPDLECKQIWLDLGVPEERVLPGSMKDNFWEMGDTGPCGPCTEIHFDRIGGRDAAHLVNQDDPDVLEIWNLVFIQFNRCCTLVAVSMLPER----CLYYLICTALSMGNFDNFVLDLMQLALDSLRGWQGTGARAYTGHVGKEDADGIDMAYRVLADHARTLTIALSDGGRPDNVGRGYVLRRILRRAVRYAHEKMNAKKGFFSTLVDVVVETLGDAFPELKKDPQAVRDVINEEEEQFLKTLSRGRRILERKIQNIN-----DNVLPGDTAWLLYDTYGFPVDLTGLIAEEKGLTIDMESFEQEKKAAQLKSQARGFGDEDLIMLDIHAIDELRERGLLPTNDAPKYNYSADANGNYVVYLNKQFV-----------DEASSGKECGILLNQTCFYAEQGGQVYDVGYMVNVVGTKTEFTVKNTQVRGGYVLHIG-MLYGNIKVGDKVTLYVDEARRRPIMSNHTSTHVLNFALRAVLGEADQRGSLVAPDRLRFDFTARGAMTTDQIQKTEEIANDIIRQAKPVYTADVPLAEAKAIAGLRAVFDETYPDPVRVVSVGVPVPELLADPSGPGGALH-SIEFCGGTHLQNSGHAGSFVIVTEEAIAKGIRRIVAVTGTEATKATRKAGAIQEAVAALAEKVK--VETVPNKDLQKEIADLVEVLGPATIPQWRKDKLRENLTALKRTMDDLDRASKADLQKKV-----PGLFSQHHHHLHYFCQGELESYCDITAVLEKTKQLIENSPNKPLVIMEMD-NGASVKLAYACVQEAVHSGLKASAWVQHVTPLLGGRGGGKDVSAQASGTNTTSIPEAISLAQEFARLKL 945          
BLAST of alanine--tRNA ligase, cytoplasmic vs. Ensembl Sea Lamprey
Match: ENSPMAT00000000146.1 (pep scaffold:Pmarinus_7.0:GL476617:429487:443008:-1 gene:ENSPMAG00000000127.1 transcript:ENSPMAT00000000146.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 715.301 bits (1845), Expect = 0.000e+0
Identity = 362/766 (47.26%), Postives = 497/766 (64.88%), Query Frame = 2
Query:   95 IRREFVDFFKEK-SHLNIHSSSTIPLNDPTLLFSNAGMNQFKKIFLGTADPNSDMAKWKRVANSQKCIRAGGKHNDLDDVGKDVYHHTFFEMLGNWSFGDYFKK----EAISWAWELLTKVWGLPKDRFYVTYFGGNTELGLESDEEAKDIWLSMGIDASRVLPFGMKDNFWEMGETGPCGPCSEIHFDRIGNRDASELVNADDPDVLEVWNLVFIQYNRELDRSLKSLPHKHVDTGMGFERIVSVIQNKSSNYDTDLFQPLFDRIQAETNCRSYQGKLGDDDEGGIDMAYRVLADHARTLTIALSDGGQPQNTGRGYVLRRILRRAVRYAVDKLHAKPGMFSNLVDTVVDLLGEAFPEIKHSKENVKQIINEEESQFMKTLKRGKKMFDKSLEDFKQIKTGQTFLPGRIAWMLYDTYGYPLDLTALMCDESGIKINMEEYETCRKLAQETSQGSGDTVYLSVDLDVHDIDKLQTKKLQPTDDIPKFKYNADENGNYQLECHQATVLAIKIKEGFXXXXXXXXXXXGLVMDSTNFYAESGGQMYDTGSMVLNDVEQTEFEVAT---VKLCGGFVLHIGRVLNGSLKVGDRLKLEVDDARRKCLMQNHTGTHVLNYALREIVGDVD-QKGSLVAPDKLRFDFSAKGQVDNEQLRKVETICKSIINEKKQVYVKEVALSIAKEIQGIRAVFGETYPDPVRVVSIGVPVDDLINSINEPKPSLNASVEFCGGTHLTNSHHISELVITSESAISKGVRRIFALTGAEAEK 2365
            +R  FV FF EK  H  + SS+  P  DP+LLF NAGMNQFK + LG+ DP S++A+  R  NSQKC+RAGGKHNDL+DVG+DVYHHTFFEMLGNWSFGDYFKK    E    AWELLT+V+ +PK+R YV+YFGG+  LGL++DEE ++IWL +G+ A  VLPFG K+N WEMGE GPCGPCSEIH+D +G RDAS LVNA  PDV+E+WNLVF+QYNR       S    +VD GMG ER+++V+Q K SNYDTDLF P+   I   T  R Y+G +G+ DEG +D AYRVLADH RTL + ++DG  P  TG   VLR+ILRRA R+AV+ L A+PG+ ++LV TVVD+LG+ +PE+    + V  +INE E+ F+ +L RG+++ ++++    ++ T     P  +AW L+   G+P DL  LM DE G+ ++   +    +  QE  +G       S+ LDVH +D+L+++ +  TDD  K+ Y    NG Y+     A V+A+  + G  D V + +    LV+D+T FY+E GGQ  DTG ++  D    +  VA    V++CGGFVLH   V   +++VGDRL L +++ RR   M  HT TH+L+ ALR+++GD   Q+GS VA  +LRFDFS +  V  +QLR VE     +++  ++V+V E  L+ A+ I  +R V  E YP+ VRVVS+G P + L+    +       SVE C GTHL  +  I + VI SE A+ KG+ R+ A+T  EA +
Sbjct:   34 VRETFVRFFGEKHGHAFVPSSNVKPRADPSLLFVNAGMNQFKPLLLGSVDPRSELARCTRAVNSQKCVRAGGKHNDLEDVGRDVYHHTFFEMLGNWSFGDYFKKHTQKEVCQMAWELLTEVYRIPKERLYVSYFGGSQALGLKADEECREIWLQLGVPAPHVLPFGEKENLWEMGEVGPCGPCSEIHYDHVGGRDASGLVNAGHPDVVEIWNLVFMQYNRRRTEVSASCRAHNVDCGMGLERLLAVLQGKRSNYDTDLFTPIMSAIHKGTGAREYRGLVGEADEGHVDTAYRVLADHVRTLAVCIADGVYPGMTGAELVLRQILRRATRFAVETLRAQPGLLASLVPTVVDILGDTYPELNREAQVVMDVINENEAAFLTSLSRGRRLLERTV---AKMGTATASFPVDVAWSLHRGLGFPFDLIHLMLDERGLSLDTVAFNELERAEQEGEKGEAPG-RESLLLDVHALDELRSRGVPATDDAAKYAYELRPNGRYEFARCLARVVAVWRRPGLSDVVGAGERCS-LVLDATCFYSEQGGQDGDTGVVLAVDAAGQQDIVAMVEDVQVCGGFVLH-HVVTRDTVRVGDRLLLAINEERRLGCMIKHTATHLLSQALRDVLGDATRQRGSHVAAGRLRFDFSTRAPVSVDQLRSVEAAVCRLVSADERVFVTEAPLASARRIPHLRCV-DEDYPEDVRVVSVGTPAEQLLLQQQQQHTERAGSVELCCGTHLQRTGLIEDFVIVSERAMVKGLSRVVAVTDREARE 792          
BLAST of alanine--tRNA ligase, cytoplasmic vs. Ensembl Yeast
Match: ALA1 (Cytoplasmic and mitochondrial alanyl-tRNA synthetase; required for protein synthesis; point mutation (cdc64-1 allele) causes cell cycle arrest at G1; lethality of null mutation is functionally complemented by human homolog AARS; mutations in human homolog AARS are associated with autoimmune disease polymyositis/dermatomyositis [Source:SGD;Acc:S000005862])

HSP 1 Score: 855.899 bits (2210), Expect = 0.000e+0
Identity = 447/908 (49.23%), Postives = 593/908 (65.31%), Query Frame = 2
Query:   68 NKMDRNSSTIRREFVDFFKEKSHLNIHSSSTIPLNDPTLLFSNAGMNQFKKIFLGTADPNSDMAKWKRVANSQKCIRAGGKHNDLDDVGKDVYHHTFFEMLGNWSFGDYFKKEAISWAWELLTKVWGLPKDRFYVTYFGGNTELGLESDEEAKDIWLSMGIDASRVLPFGMKDNFWEMGETGPCGPCSEIHFDRIGNRDASELVNADDPDVLEVWNLVFIQYNRELDRSLKSLPHKHVDTGMGFERIVSVIQNKSSNYDTDLFQPLFDRIQAETNCRSYQGKLGDDDEGGIDMAYRVLADHARTLTIALSDGGQPQNTGRGYVLRRILRRAVRYAVDKLHAKPG-MFSNLVDTVVDLLGEAFPEIKHSKENVKQIINEEESQFMKTLKRGKKMFDKSLEDFKQIKTGQTFLPGRIAWMLYDTYGYPLDLTALMCDESGIKINMEEYETCRKLAQETSQ--GSGDTVYLSVDLDVHDIDKLQTKKLQPTDDIPKFKYNADENGNYQLECHQATVLAIKIKEGFXXXXXXXXXXXGLVMDSTNFYAESGGQMYDTGSMVLNDVEQTEFEVATVKLCGGFVLHIGRVLNGSLKVGDRLKLEVDDARRKCLMQNHTGTHVLNYALREIVG-DVDQKGSLVAPDKLRFDFSAKGQVDNEQLRKVETICKSIINEKKQVYVKEVALSIAKEIQGIRAVFGETYPDPVRVVSIGVPVDDLI-NSINEPKPSLNASVEFCGGTHLTNSHHISELVITSESAISKGVRRIFALTGAEAEKACKIASQMECEVGKLEN-TFSKTMEDSRIRDLLNSIKDMKRELDEALISYWFKNSLRARLESLRKELDSLEKTKKELLQANLMEQAWPVIENAVSHNKKFLVIRFLD-GADQTSINKAFREIQK----KHKSLSLLG 2758
            +K    ++ +R  F+D+FK K H  + SS  +P +DPTLLF+NAGMNQ+K IFLGT DP SD    KR  NSQKCIRAGGKHNDL+DVGKD YHHTFFEMLGNWSFGDYFKKEAI+++W LLT+V+G+PKDR YVTYF G+ +LGLE D EA+++W ++G+    +LP   KDNFWEMG+ GPCGPCSEIH+DRIG R+A+ LVN DDPDVLEVWNLVFIQ+NRE D SLK LP KH+DTGMGFER+VSV+Q+  SNYDTD+F PLF+RIQ  T+ R Y G  G++D+ GID AYRVLADH RTLT AL+DGG P N GRGYVLRRILRR  RYA   ++   G  FS L  T++  + + FPE+      + +I++EEE+ F KTL RG+++F+K        KT    L G+  W LYDTYG+P+DLT LM +E G+KI+   +E  ++ + E S+  G  D   L + L+VH++ +L   K+  T+D  +FKY +       L+ H  T    +I E             G+++D T FYAE GGQ YDTG +V++D    EF V  V+L  GFV H G +  G L VGD++    D+ RR  +  NHTGTH+LN+AL+E +G DVDQKGSLVAP+KLRFDFS K  V NE+L+KVE IC   I E  QV+ KE+ L +AK I G+RAVFGETYPDPVRVVS+G P+++L+ N  NE       S+EFCGGTH+  +  I   VI  ES I+KG+RRI A+TG EA +A ++A Q   ++   +   FS   E          +K++  +L +  IS   KN L+ +   + K +    K++ +      +++     E   + N  +LV +F+D   +  +I +A   ++     K KS+ LL 
Sbjct:    5 DKQKWTATNVRNTFLDYFKSKEHKFVKSSPVVPFDDPTLLFANAGMNQYKPIFLGTVDPASDFYTLKRAYNSQKCIRAGGKHNDLEDVGKDSYHHTFFEMLGNWSFGDYFKKEAITYSWTLLTEVYGIPKDRLYVTYFEGDEKLGLEPDTEARELWKNVGVPDDHILPGNAKDNFWEMGDQGPCGPCSEIHYDRIGGRNAASLVNMDDPDVLEVWNLVFIQFNREQDGSLKPLPAKHIDTGMGFERLVSVLQDVRSNYDTDVFTPLFERIQEITSVRPYSGNFGENDKDGIDTAYRVLADHVRTLTFALADGGVPNNEGRGYVLRRILRRGARYARKYMNYPIGNFFSTLAPTLISQVQDIFPELAKDPAFLFEILDEEEASFAKTLDRGERLFEKYAS--AASKTESKTLDGKQVWRLYDTYGFPVDLTELMAEEQGLKIDGPGFEKAKQESYEASKRGGKKDQSDL-IKLNVHELSELNDAKVPKTND--EFKYGSANVEGTILKLHDGTNFVDEITE--------PGKKYGIILDKTCFYAEQGGQEYDTGKIVIDDA--AEFNVENVQLYNGFVFHTGSLEEGKLSVGDKIIASFDELRRFPIKNNHTGTHILNFALKETLGNDVDQKGSLVAPEKLRFDFSHKKAVSNEELKKVEDICNEQIKENLQVFYKEIPLDLAKSIDGVRAVFGETYPDPVRVVSVGKPIEELLANPANEEWTKY--SIEFCGGTHVNKTGDIKYFVILEESGIAKGIRRIVAVTGTEAFEAQRLAEQFAADLDAADKLPFSPIKE--------KKLKELGVKLGQLSISVITKNELKQKFNKIEKAVKDEVKSRAKKENKQTLDEVKTFFE--TNENAPYLV-KFIDISPNAKAITEAINYMKSNDSVKDKSIYLLA 884          
BLAST of alanine--tRNA ligase, cytoplasmic vs. Ensembl Yeast
Match: YNL040W_mRNA (Protein of unknown function; has strong similarity to alanyl-tRNA synthases from Eubacteria; null mutant displays decreased translation rate and increased readthrough of premature stop codons; green fluorescent protein (GFP)-fusion protein localizes to the cytoplasm; YNL040W is not an essential gene [Source:SGD;Acc:S000004985])

HSP 1 Score: 50.447 bits (119), Expect = 9.429e-7
Identity = 81/338 (23.96%), Postives = 147/338 (43.49%), Query Frame = 2
Query: 1667 MDSTNFYAESGGQMYDTG--SMVLNDVEQTEFEVATVKLCGGFVLHIGRVLNGSLKVGDRLKLEVDDARRKCLMQNHTGTHVL------NYALREIV----GDVDQKGSLVAPDKLRFDFSAKGQVDNEQLRKV-ETICKSIINEKKQVYVKEVALSIAKEIQGIRAVFGETYPDPVRVVSIGVPVDDLINSINEPKPSLNASVEFCGGTHLTNSHHI-SELVITSESAISKGVRRIFALTGAEAEKACKIASQMECEVGKLENTFSKTMEDSRIRDLLNSIKDM-KRELDEALISYWFKNSLRARLESLRKELDSLEKTKKELLQANLMEQAWPVIE 2635
            +  T  + E GGQ  D+G   +V  +   ++ E   V     F LH    +N  ++ G  +++ VD+ +R   MQ HTG H+L      NY +  +     G + +K  ++ P           ++  +++  V + I + IIN  +++ V+E    I +E   +  V     PD    +S GV     I  I+   P        C GTHL  +  I S L+++++SA+     R++ + G       K  +++  +   L +  S+T    +I      I+ + KRE       YW K   R   E L   +++L+ + K+  +A  ME+ +  +E
Sbjct:   49 LQDTILFPEGGGQPSDSGFLKIVEGNRNSSKIEKILVSHVSRFGLHAKHHVNDYIEPGTTVEVAVDEQKRMDYMQQHTGQHLLSAILERNYKVDTVSWSMGGIITKKKPVLEPSDYFNYIELNRKLTLDEITNVSDEINQLIINFPQEIIVEE---RIGEET--VDEVSTSKIPDDYD-LSKGVLRTIHIGDIDS-NP--------CCGTHLKCTSQIGSILILSNQSAVRGSNSRLYFMCGKRVSLYAKSVNKILLDSKNLLSC-SETQISEKITRQTKQIQQLNKRE------QYWIKRLARTASEEL---MNTLKASGKK--RAYFMEEEYGTLE 359          
BLAST of alanine--tRNA ligase, cytoplasmic vs. Ensembl Nematostella
Match: EDO36689 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SHU9])

HSP 1 Score: 971.074 bits (2509), Expect = 0.000e+0
Identity = 484/965 (50.16%), Postives = 656/965 (67.98%), Query Frame = 2
Query:   95 IRREFVDFFKEK-SHLNIHSSSTIPLNDPTLLFSNAGMNQFKKIFLGTADPNSDMAKWKRVANSQKCIRAGGKHNDLDDVGKDVYHHTFFEMLGNWSFGDYFKKEAISWAWELLTKVWGLPKDRFYVTYFGGNTELGLESDEEAKDIWLSMGIDASRVLPFGMKDNFWEMGETGPCGPCSEIHFDRIGNRDASELVNADDPDVLEVWNLVFIQYNRELDRSLKSLPHKHVDTGMGFERIVSVIQNKSSNYDTDLFQPLFDRIQAETNCRSYQGKLGDDDEGGIDMAYRVLADHARTLTIALSDGGQPQNTGRGYVLRRILRRAVRYAVDKLHAKPGMFSNLVDTVVDLLGEAFPEIKHSKENVKQIINEEESQFMKTLKRGKKMFDKSLEDFKQIKTGQTFLPGRIAWMLYDTYGYPLDLTALMCDESGIKINMEEYETCRKLAQETSQGSGDTVYLSVDLDVHDIDKLQ-TKKLQPTDDIPKFKYNADENGNYQLECHQATVLAIKIKEGFXXXXXXXXXXXGLVMDSTNFYAESGGQMYDTGSMVLNDVEQTEFEVATVKLCGGFVLHIGRVLNGSLKVGDRLKLEVDDARRKCLMQNHTGTHVLNYALREIVGDVDQKGSLVAPDKLRFDFSAKGQVDNEQLRKVETICKSIINEKKQVYVKEVALSIAKEIQGIRAVFGETYPDPVRVVSIGVPVDDLINSINEPKPSLNASVEFCGGTHLTNSHHISELVITSESAISKGVRRIFALTGAEAEKACKIASQMECEVGKLENTFSKTMEDSRIRDLLNSIKDMKRELDEALISYWFKNSLRARLESLRKELDSLEKTKKELLQANLMEQAWPVIENAVSHNKKFLVIRFLD-GADQTSINKAFREIQKKHKSLSLLGYSVDVTSNKIECKASVAKEMVTASFNAKNWIEKVTEIVGGKSGGSDQSAQVTGVALMNLHGLEEMANKFANMNI 2980
            IRR+F+DFF EK +H  + SSS IP  DPTLLF+NAGMNQ+K IFLGT DPNSDM+K KR  NSQKCIRAGGKHNDL+DVGKDVYHHTFFEMLGNWSFGD+FKK AI +AWE LT+V  +PK+R YVTYFGG    G+E D E KD W+  G+D SRVLPFGM DNFWEMG+TGPCGPCSEIH+DRIG RDA  LVN DDP VLE+WNLVFIQ+NRE D +LK+LP +HVDTGMG ER+VS+IQ K SNYDTDLF P FD+I   T  + Y G++G  D+ GIDMAYRV+ADH RTLT+A+SDGG+P N GRGYVLRRILRR +RY+++KL+A PG  ++LV  V+D LGE FPE+    + V  +INEEE QF+KTL RG+++F+++       K     +PG +AW LYDTYG+P+DLT LM +E G++++ME+YE  ++ AQE ++G       ++ LDVH +DKLQ    L PT D+PK+ Y++D  G+Y  +    T+ A+  ++ F  +     +  G+++D T+FYAE GGQ+YD G M     E  EF V  V++ GG+VLH+G  L G+++VGD +   +D+ RR+  M NHT TH+LN+ALR  +G+ DQ+GSLVAP++LRFDF+AKG +  EQ++  E   K I+     V+ KEVAL+ AK++QG+RA+F E YPDPVRVVSIG   D+L  +   P+     S+EFCGGTHL  S H+   V+ SE AISKG+RRI ALTG E  KA K    +E  V K+        ++ R+++    I  +  +++ A+IS W K  +R  L+ ++K +D+  K  +  L  +  ++A  +I    +   + +V+   D G++Q  ++ A ++ +      ++L  SVD  + KI C + V K++      A  W   + +I+GGKSGG + SAQ +G  + ++      A +FANM +
Sbjct:   10 IRRKFIDFFVEKHNHTFVPSSSVIPHEDPTLLFANAGMNQYKSIFLGTVDPNSDMSKLKRAVNSQKCIRAGGKHNDLEDVGKDVYHHTFFEMLGNWSFGDFFKKGAIDFAWEFLTEVLKVPKERLYVTYFGGCD--GVECDNETKDYWIGKGLDPSRVLPFGMSDNFWEMGDTGPCGPCSEIHYDRIGGRDAKALVNMDDPTVLEIWNLVFIQFNRENDGTLKTLPSQHVDTGMGLERLVSIIQGKMSNYDTDLFTPFFDKIHQATGVQPYGGQVGLADQNGIDMAYRVVADHIRTLTVAMSDGGKPDNVGRGYVLRRILRRCIRYSIEKLNASPGFTASLVSVVIDTLGEFFPELNKDPQQVMDVINEEEVQFLKTLARGRRLFERTAS-----KITDGTIPGDVAWRLYDTYGFPVDLTELMAEERGLRVDMEKYEEAKRRAQEIARGKDSASDDAITLDVHLLDKLQNVMNLPPTIDLPKYSYSSDALGSYVFQPVSGTIKALLHEKEF-VNEVPGGEHCGIILDQTSFYAEQGGQIYDEGFMTKEGDEDVEFRVINVQVHGGYVLHVG-ALEGAIRVGDTMNCLIDEDRRRQCMNNHTATHILNFALRRTLGEADQRGSLVAPNRLRFDFTAKGAMTPEQVKSTELFSKEIVTSDLPVFAKEVALAQAKDVQGLRAIFDEVYPDPVRVVSIGASFDELQPN---PQAGYKYSIEFCGGTHLQRSSHMETFVLVSEEAISKGIRRIVALTGPEGLKAEKHCEALEARVEKIRKEVEAESKNLRVKEAGQEITRLIEDINAAVISAWKKEEMRQTLKKVKKIVDNASKAMQAALMTSAADKAKAMI---TAEPDRTVVVELFDAGSNQKVLDAAMKQFKNLSPLTAVLLLSVDQENKKIICLSQVPKDVTKKGLKADEWTGAIADILGGKSGGKEMSAQASGPNVGSIDKALSEAKQFANMKL 959          
BLAST of alanine--tRNA ligase, cytoplasmic vs. Ensembl Medaka
Match: aars1 (alanyl-tRNA synthetase 1 [Source:NCBI gene;Acc:101155026])

HSP 1 Score: 1054.28 bits (2725), Expect = 0.000e+0
Identity = 511/969 (52.73%), Postives = 686/969 (70.79%), Query Frame = 2
Query:   83 NSSTIRREFVDFFKEKSHLNIHSSSTIPLNDPTLLFSNAGMNQFKKIFLGTADPNSDMAKWKRVANSQKCIRAGGKHNDLDDVGKDVYHHTFFEMLGNWSFGDYFKKEAISWAWELLTKVWGLPKDRFYVTYFGGNTELGLESDEEAKDIWLSMGIDASRVLPFGMKDNFWEMGETGPCGPCSEIHFDRIGNRDASELVNADDPDVLEVWNLVFIQYNRELDRSLKSLPHKHVDTGMGFERIVSVIQNKSSNYDTDLFQPLFDRIQAETNCRSYQGKLGDDDEGGIDMAYRVLADHARTLTIALSDGGQPQNTGRGYVLRRILRRAVRYAVDKLHAKPGMFSNLVDTVVDLLGEAFPEIKHSKENVKQIINEEESQFMKTLKRGKKMFDKSLEDFKQIKTGQTFLPGRIAWMLYDTYGYPLDLTALMCDESGIKINMEEYETCRKLAQETSQGSGDTVYLSVDLDVHDIDKLQTKKLQPTDDIPKFKYNADENGNYQLECHQATVLAIKIKEGFXXXXXXXXXXXGLVMDSTNFYAESGGQMYDTGSMVL---NDVEQTEFEVATVKLCGGFVLHIGRVLNGSLKVGDRLKLEVDDARRKCLMQNHTGTHVLNYALREIVGDVDQKGSLVAPDKLRFDFSAKGQVDNEQLRKVETICKSIINEKKQVYVKEVALSIAKEIQGIRAVFGETYPDPVRVVSIGVPVDDLINSINEPKPSLNASVEFCGGTHLTNSHHISELVITSESAISKGVRRIFALTGAEAEKACKIASQMECEVGKLENTFSKTMEDSRIRDLLNSIKDMKRELDEALISYWFKNSLRARLESLRKELDSLEKTKKELLQANLMEQAWPVIENAVSHNKKFLVIRFLDGADQTSINKAFREIQKKHKSLSLLGYSVDVTSNKIECKASVAKEMVTASFNAKNWIEKVTEIVGGKSGGSDQSAQVTGVALMNLHGLEEMANKFANMNI 2980
            +++ IR++F+DFF    H  +HSSSTIPL+DPTLLF+NAGMNQ+K IFL T DP+  MAK +R AN+QKCIRAGGKHNDLDDVGKDVYHHTFFEMLG+WSFGDYFK+ A   A ELLT+ +G+  DR YVTYFGGN + GLE D E K IW+ +G++ +R+LP  MKDNFWEMG+TGPCGPCSEIH+DRIG RDAS LVN DDP+VLE+WNLVFIQ+NRE +  LK LP K +DTGMG ER+VSV+QNK SNYDTDLF P F+ IQ  T  R Y GK+G +D  GIDMAYRVLADHART+TIALSDGG+P NTGRGYVLRRILRRAVRY+ +KL A+ G F++LVD VVD LG+AFPE+K   + VK +INEEE+QF+KTL RG+++ D+ +      KT    LPG  AW+LYDTYG+PLDLT+L+ +E G+++++  +E  +K AQ  SQG G      + LD++ I++L+ K + PTDD PK+ Y +DENGNY+ +   ATVLA++    F     +     G+V+D T+FYAE GGQ YD G M+    N  ++ EF V   ++ GG+VLHIG V  G+L+VGDR+ L +D+ARR+ +M NHT TH+LN+ALR ++G+ DQ+GSLVAPD+LRFDF+AKG +  +++ + E I  ++I + K VY KE +L+ AK IQG+RAVF ETYPDPVRVVSIGVPV +L++  N P  SL  S+EFCGGTHL NS H +  VI SE AI+KG+RRI A+TGAEA+KA + A  +   +  L +   +  + S  +D+   I DM   L  A+IS W K+ +R  L+ L+K +D L+++ K  +Q  ++E+   VIE+  + N+  L++    GA   ++N++ + ++ +    + +  +VD  + KI C   V +E+      A  W++++  ++ GK GG D SAQ TG     L    +MAN+FA + +
Sbjct:    6 SAAQIRQKFIDFFLRYEHQYVHSSSTIPLDDPTLLFANAGMNQYKPIFLNTIDPSHPMAKLRRAANTQKCIRAGGKHNDLDDVGKDVYHHTFFEMLGSWSFGDYFKQLACKMALELLTEEFGISIDRLYVTYFGGNPDAGLEPDLECKQIWMDLGVEEARILPGSMKDNFWEMGDTGPCGPCSEIHYDRIGGRDASHLVNMDDPNVLEIWNLVFIQFNRESETELKPLPKKSIDTGMGLERLVSVLQNKMSNYDTDLFVPYFEAIQKGTGARPYSGKVGAEDVDGIDMAYRVLADHARTITIALSDGGRPDNTGRGYVLRRILRRAVRYSHEKLGAQRGFFASLVDVVVDSLGDAFPELKKDPDMVKDVINEEEAQFLKTLSRGRRILDRKIMSLGDCKT----LPGDTAWLLYDTYGFPLDLTSLIAEEKGMEVDLAGFEEEKKAAQLKSQGKGAGDVDHIMLDIYAIEELRNKHVPPTDDSPKYVYTSDENGNYEFQQASATVLALRCDRAF-CEEVTTGQECGVVLDQTSFYAEQGGQTYDEGYMLRENDNTDDRMEFTVKNTQVRGGYVLHIGTVY-GTLRVGDRVSLCIDEARRRPIMSNHTATHILNFALRGVLGEADQRGSLVAPDRLRFDFTAKGALKTDEIHRTEDIACAMIRDAKPVYAKEASLAEAKAIQGLRAVFDETYPDPVRVVSIGVPVQELLDDPNSPAGSLT-SIEFCGGTHLQNSSHAAPFVIVSEEAIAKGIRRIVAVTGAEAQKAQRKADALRQSLSALGDKVKQ--QASPNKDIQKEIADMTESLGTAVISQWQKDEMRETLKGLKKTMDDLDRSYKADIQKRVLEKTKEVIES--NPNQPLLIMEMETGASAKALNESLKLLKAQSPHTATMLLTVDPDAGKITCLCQVPQEVAGRGLKASEWVQELCPLLDGKGGGKDTSAQATGRNTQCLQEALQMANEFARLKL 963          
BLAST of alanine--tRNA ligase, cytoplasmic vs. Ensembl Medaka
Match: aars2 (alanyl-tRNA synthetase 2, mitochondrial [Source:NCBI gene;Acc:101164533])

HSP 1 Score: 770.77 bits (1989), Expect = 0.000e+0
Identity = 405/962 (42.10%), Postives = 586/962 (60.91%), Query Frame = 2
Query:   86 SSTIRREFVDFFKEK-SHLNIHSSSTIPLNDPTLLFSNAGMNQFKKIFLGTADPNSDMAKWKRVANSQKCIRAGGKHNDLDDVGKDVYHHTFFEMLGNWSFGDYFKKEAISWAWELLTKVWGLPKDRFYVTYFGGNTELGLESDEEAKDIWLSMGIDASRVLPFGMKDNFWEMGETGPCGPCSEIHFDRIGNRDASELVNADDPDVLEVWNLVFIQYNRELDRSLKSLPHKHVDTGMGFERIVSVIQNKSSNYDTDLFQPLFDRIQAETNCRSYQGKLGDDDEGGIDMAYRVLADHARTLTIALSDGGQPQNTGRGYVLRRILRRAVRYAVDKLHAKPGMFSNLVDTVVDLLGEAFPEIKHSKENVKQIINEEESQFMKTLKRGKKMFDKSLEDFKQIKTGQTFLPGRIAWMLYDTYGYPLDLTALMCDESGIKINMEEYETC----RKLAQETSQGSGDTVYLSVDLDVHDIDKLQTKKLQPTDDIPKFKYNADENGNYQLECHQATVLAI--------KIKEGFXXXXXXXXXXXGLVMDSTNFYAESGGQMYDTGSMVLNDVEQTEFEVATVKLCGGFVLHIGRVLNGSLKVGDRLKLEVDDARRKCLMQNHTGTHVLNYALREIVG-DVDQKGSLVAPDKLRFDFSAKGQVDNEQLRKVETICKSIINEKKQVYVKEVALSIAKEIQGIRAVFGETYPDPVRVVSIGVPVDDLINSINEPKPSLNASVEFCGGTHLTNSHHISELVITSESAISKGVRRIFALTGAEAEKACKIASQMECEVGKLENTF--SKTMEDSRIRDLLNSIKDMKRELDEALISYWFKNSLRARLESLRKELDSLEKTKKELLQANLMEQAWPVIENAVSHNKKFLVIRFLDGADQTSINKAFREIQKKHKSLSLLGYSVDVTSNKIECKASVAKEMVTASFNAKNWIEKVTEIVGGKSGGSDQSAQVTGVA 2923
            ++ +R  F+DFF+ +  HL + SS   P  DP+LLF NAGMNQFK +FLGT DP S MA ++RV NSQKC+RAGGKHNDL+DVG+D+YHHTFFEMLGNWSFGDYFK EA   AW LLT+ +G+P DR YV+YFGG+   GL  DEE ++IWL +G+   R+LPFG++DNFWEMG++GPCGPC+EIHFD +G RDA+ LVNA  PDV+E+WNLVFIQYNRE DRSL+ LP   VDTGMG ER+VSV+Q K SNYDTDLF PL D I   +    Y G+ G ++   +D+AYRV+ADH RTL+I ++DG  P  +G   VLRRILRRAVR+ +  L A  G  ++LV T+  LLG+A+PE+K  ++ +  IINE E+QF+ +L++G ++  ++L       +G    P  +AW L+   G+PLDL  +M +E G+++N ++ +      +K+A E   G    ++  V LD+H + +LQ  K+  TDD  K++Y  +++  Y      ATVLA+        ++ EG             +++D T FY+E GGQ +D G +  + ++   F V  +   GG+V+H     +  LK GD+++L +D A R   M  HT TH+LN+ALR+++G  V Q+GS V+ D+LRFDFS KG +   QL++VE     I+   + V+  E+ +  AK I+G+R V  E YPDPVRVVS+ VPV +L++S     P  + SVE C GTHL  +  I +LVI SE  + KG+ R+ A+TG +A +A +    +  EV  L      S        + L      +   +D   I  W +  L+ RL++L +  +S  + K EL +A    QA  ++E    + +K L++ F++    + + K   ++        ++  +    S K+ C   V K+  + +  A +W   V   +GG +GGS   A+ TG +
Sbjct:   36 AAHVRSSFLDFFRRRHGHLLVPSSPVRPRADPSLLFVNAGMNQFKPVFLGTVDPRSQMASYRRVVNSQKCVRAGGKHNDLEDVGRDIYHHTFFEMLGNWSFGDYFKVEACQMAWSLLTEHYGIPADRLYVSYFGGDAASGLPPDEETRNIWLDLGVSPGRILPFGLEDNFWEMGDSGPCGPCTEIHFDHMGVRDAAFLVNAGSPDVVEIWNLVFIQYNREPDRSLRLLPRFSVDTGMGLERLVSVLQGKRSNYDTDLFTPLMDAIHQRSGVGPYTGRTGTEEGSQVDLAYRVVADHIRTLSICIADGIHPGMSGAELVLRRILRRAVRFCIQVLQAPQGALASLVPTITQLLGDAYPELKQEEDRIVDIINENEAQFLASLQQGSRIIQRTLSKKDCKHSG---FPASLAWTLHRDLGFPLDLVDMMLEERGVQVNRQDLDRLLLENQKVASEKRAG----LWSHVMLDLHILAELQRLKVPHTDDSLKYQYGLEKD-RYVFPACSATVLALCNGQTLVQEVSEG---------QRCAVILDRTCFYSEQGGQSHDRGYLTCSRLQDVVFPVDGLLQVGGYVVHQVTATD-RLKTGDQVQLHLDQAHRLSCMVKHTATHILNFALRKVLGPSVHQRGSHVSADRLRFDFSVKGSLSIPQLQQVERCVHDIVTANQMVHTMELPMQRAKSIRGLRTV-DEVYPDPVRVVSLHVPVSELLDS----PPDKDTSVELCCGTHLLRTGAIEDLVIVSEKQMVKGISRVVAVTGRDAAQAREAGQALSQEVDSLSARLSGSSPSSIDSAQRLSKEASILSDAVDNTPIPQWQRRELQDRLKTLLRTSNSAIR-KMELREAAQKAQA--ILEK---NGRKTLLVDFVEAESLSVLVKTVNQLSSAAPFSHVMLLTRHAHSGKVLCACQVPKD--SPTLAASDWAVAVCGYLGGSAGGSTLVAKGTGTS 966          
BLAST of alanine--tRNA ligase, cytoplasmic vs. Ensembl Medaka
Match: aars2 (alanyl-tRNA synthetase 2, mitochondrial [Source:NCBI gene;Acc:101164533])

HSP 1 Score: 754.207 bits (1946), Expect = 0.000e+0
Identity = 396/942 (42.04%), Postives = 572/942 (60.72%), Query Frame = 2
Query:   86 SSTIRREFVDFFKEK-SHLNIHSSSTIPLNDPTLLFSNAGMNQFKKIFLGTADPNSDMAKWKRVANSQKCIRAGGKHNDLDDVGKDVYHHTFFEMLGNWSFGDYFKKEAISWAWELLTKVWGLPKDRFYVTYFGGNTELGLESDEEAKDIWLSMGIDASRVLPFGMKDNFWEMGETGPCGPCSEIHFDRIGNRDASELVNADDPDVLEVWNLVFIQYNRELDRSLKSLPHKHVDTGMGFERIVSVIQNKSSNYDTDLFQPLFDRIQAETNCRSYQGKLGDDDEGGIDMAYRVLADHARTLTIALSDGGQPQNTGRGYVLRRILRRAVRYAVDKLHAKPGMFSNLVDTVVDLLGEAFPEIKHSKENVKQIINEEESQFMKTLKRGKKMFDKSLEDFKQIKTGQTFLPGRIAWMLYDTYGYPLDLTALMCDESGIKINMEEYETC----RKLAQETSQGSGDTVYLSVDLDVHDIDKLQTKKLQPTDDIPKFKYNADENGNYQLECHQATVLAI--------KIKEGFXXXXXXXXXXXGLVMDSTNFYAESGGQMYDTGSMVLNDVEQTEFEVATVKLCGGFVLHIGRVLNGSLKVGDRLKLEVDDARRKCLMQNHTGTHVLNYALREIVG-DVDQKGSLVAPDKLRFDFSAKGQVDNEQLRKVETICKSIINEKKQVYVKEVALSIAKEIQGIRAVFGETYPDPVRVVSIGVPVDDLINSINEPKPSLNASVEFCGGTHLTNSHHISELVITSESAISKGVRRIFALTGAEAEKACKIASQMECEVGKLENTF--SKTMEDSRIRDLLNSIKDMKRELDEALISYWFKNSLRARLESLRKELDSLEKTKKELLQANLMEQAWPVIENAVSHNKKFLVIRFLDGADQTSINKAFREIQKKHKSLSLLGYSVDVTSNKIECKASVAKEM-----VTASFNAKNW 2848
            ++ +R  F+DFF+ +  HL + SS   P  DP+LLF NAGMNQFK +FLGT DP S MA ++RV NSQKC+RAGGKHNDL+DVG+D+YHHTFFEMLGNWSFGDYFK EA   AW LLT+ +G+P DR YV+YFGG+   GL  DEE ++IWL +G+   R+LPFG++DNFWEMG++GPCGPC+EIHFD +G RDA+ LVNA  PDV+E+WNLVFIQYNRE DRSL+ LP   VDTGMG ER+VSV+Q K SNYDTDLF PL D I   +    Y G+ G ++   +D+AYRV+ADH RTL+I ++DG  P  +G   VLRRILRRAVR+ +  L A  G  ++LV T+  LLG+A+PE+K  ++ +  IINE E+QF+ +L++G ++  ++L       +G    P  +AW L+   G+PLDL  +M +E G+++N ++ +      +K+A E   G    ++  V LD+H + +LQ  K+  TDD  K++Y  +++  Y      ATVLA+        ++ EG             +++D T FY+E GGQ +D G +  + ++   F V  +   GG+V+H        LK GD+++L +D A R   M  HT TH+LN+ALR+++G  V Q+GS V+ D+LRFDFS KG +   QL++VE     I+   + V+  E+ +  AK I+G+R V  E YPDPVRVVS+ VPV +L++S     P  + SVE C GTHL  +  I +LVI SE  + KG+ R+ A+TG +A +A +    +  EV  L      S        + L      +   +D   I  W +  L+ RL++L +  +S  + K EL +A    QA  ++E    + +K L++ F++    + + K   ++        ++  +    S K+ C   V K +     ++    A +W
Sbjct:   36 AAHVRSSFLDFFRRRHGHLLVPSSPVRPRADPSLLFVNAGMNQFKPVFLGTVDPRSQMASYRRVVNSQKCVRAGGKHNDLEDVGRDIYHHTFFEMLGNWSFGDYFKVEACQMAWSLLTEHYGIPADRLYVSYFGGDAASGLPPDEETRNIWLDLGVSPGRILPFGLEDNFWEMGDSGPCGPCTEIHFDHMGVRDAAFLVNAGSPDVVEIWNLVFIQYNREPDRSLRLLPRFSVDTGMGLERLVSVLQGKRSNYDTDLFTPLMDAIHQRSGVGPYTGRTGTEEGSQVDLAYRVVADHIRTLSICIADGIHPGMSGAELVLRRILRRAVRFCIQVLQAPQGALASLVPTITQLLGDAYPELKQEEDRIVDIINENEAQFLASLQQGSRIIQRTLSKKDCKHSG---FPASLAWTLHRDLGFPLDLVDMMLEERGVQVNRQDLDRLLLENQKVASEKRAG----LWSHVMLDLHILAELQRLKVPHTDDSLKYQYGLEKD-RYVFPACSATVLALCNGQTLVQEVSEG---------QRCAVILDRTCFYSEQGGQSHDRGYLTCSRLQDVVFPVDGLLQVGGYVVH-QVTATDRLKTGDQVQLHLDQAHRLSCMVKHTATHILNFALRKVLGPSVHQRGSHVSADRLRFDFSVKGSLSIPQLQQVERCVHDIVTANQMVHTMELPMQRAKSIRGLRTV-DEVYPDPVRVVSLHVPVSELLDS----PPDKDTSVELCCGTHLLRTGAIEDLVIVSEKQMVKGISRVVAVTGRDAAQAREAGQALSQEVDSLSARLSGSSPSSIDSAQRLSKEASILSDAVDNTPIPQWQRRELQDRLKTLLRTSNSAIR-KMELREAAQKAQA--ILEK---NGRKTLLVDFVEAESLSVLVKTVNQLSSAAPFSHVMLLTRHAHSGKVLCACQVPKVVPPPSSISQGMAAADW 948          
BLAST of alanine--tRNA ligase, cytoplasmic vs. Planmine SMEST
Match: SMESG000001618.1 (SMESG000001618.1)

HSP 1 Score: 1979.14 bits (5126), Expect = 0.000e+0
Identity = 962/969 (99.28%), Postives = 967/969 (99.79%), Query Frame = 2
Query:   74 MDRNSSTIRREFVDFFKEKSHLNIHSSSTIPLNDPTLLFSNAGMNQFKKIFLGTADPNSDMAKWKRVANSQKCIRAGGKHNDLDDVGKDVYHHTFFEMLGNWSFGDYFKKEAISWAWELLTKVWGLPKDRFYVTYFGGNTELGLESDEEAKDIWLSMGIDASRVLPFGMKDNFWEMGETGPCGPCSEIHFDRIGNRDASELVNADDPDVLEVWNLVFIQYNRELDRSLKSLPHKHVDTGMGFERIVSVIQNKSSNYDTDLFQPLFDRIQAETNCRSYQGKLGDDDEGGIDMAYRVLADHARTLTIALSDGGQPQNTGRGYVLRRILRRAVRYAVDKLHAKPGMFSNLVDTVVDLLGEAFPEIKHSKENVKQIINEEESQFMKTLKRGKKMFDKSLEDFKQIKTGQTFLPGRIAWMLYDTYGYPLDLTALMCDESGIKINMEEYETCRKLAQETSQGSGDTVYLSVDLDVHDIDKLQTKKLQPTDDIPKFKYNADENGNYQLECHQATVLAIKIKEGFXXXXXXXXXXXGLVMDSTNFYAESGGQMYDTGSMVLNDVEQTEFEVATVKLCGGFVLHIGRVLNGSLKVGDRLKLEVDDARRKCLMQNHTGTHVLNYALREIVGDVDQKGSLVAPDKLRFDFSAKGQVDNEQLRKVETICKSIINEKKQVYVKEVALSIAKEIQGIRAVFGETYPDPVRVVSIGVPVDDLINSINEPKPSLNASVEFCGGTHLTNSHHISELVITSESAISKGVRRIFALTGAEAEKACKIASQMECEVGKLENTFSKTMEDSRIRDLLNSIKDMKRELDEALISYWFKNSLRARLESLRKELDSLEKTKKELLQANLMEQAWPVIENAVSHNKKFLVIRFLDGADQTSINKAFREIQKKHKSLSLLGYSVDVTSNKIECKASVAKEMVTASFNAKNWIEKVTEIVGGKSGGSDQSAQVTGVALMNLHGLEEMANKFANMNI 2980
            MDRNSSTIRREFVDFFKEKSHLNIHSSSTIPLNDPTLLFSNAGMNQFKKIFLGTADPNSDMAKW RVANSQKCIRAGGKHNDLDDVGKDVYHHTFFEMLGNWSFGDYFKKEAISWAWELLTKVWGLPKDRFYVTYFGGNTELGLESDEEAKDIWLSMGIDASRVLPFGMKDNFWEMGETGPCGPCSEIHFDRIGNRDASELVNADDPDVLEVWNLVFIQYNRELDRSLKSLPHKHVDTGMGFERIVSVIQNK SNYDTDLFQPLFD+IQAETNCRSYQGKLG+DDEGGIDMAYRVLADHARTLTIALSDGGQPQNTGRGYVLRRILRRAVRYAVDKLHAKPGMFSNLVDTVVDLLGEAFPEIKHSKENVKQIINEEESQFMKTLKRGKKMFDKSLEDFKQIKTGQTFLPGRIAWMLYDTYGYPLDLTALMCDESGIKINMEEYETCRKLAQETSQGSGDTVYLSVDLDVHDIDKLQTKKLQPTDDIPKFKYNADENGNYQLECHQATVLAIKIKEGFVDSVSSRDDVVGLVMDSTNFYAESGGQMYDTGSMVLNDVEQTEFEVATVKLCGGFVLHIGRVLNGSLKVGDRLKLEVDDARRKCLMQNHTGTHVLNYALREIVGDVDQKGSLVAPDKLRFDFSAKGQVDNEQLRKVETICKSIINEKKQVYVKEVALSIAKEIQGIRAVFGETYPDPVRVVSIGVPVDDLIN+INEPKPSLNASVEFCGGTHLTNSHHISELVIT+ESAISKGVRRIFALTGAEAEKACKIASQMECEVGKLENTFSKTMEDSRIRDLLNSIKDMKRELDEALISYWFKNSLRARLESLRKELDSLEKTKKELLQANLMEQAWPVIENAVSHN+KFLVIRFLDGADQTSINKAFREIQKKHKSLSLLGYSVDVTSNKIECKASVAKEMVTASFNAKNWIEKVTEIVGGKSGGSDQSAQVTGVALMNLHGLEEMANKFANMNI
Sbjct:    1 MDRNSSTIRREFVDFFKEKSHLNIHSSSTIPLNDPTLLFSNAGMNQFKKIFLGTADPNSDMAKWTRVANSQKCIRAGGKHNDLDDVGKDVYHHTFFEMLGNWSFGDYFKKEAISWAWELLTKVWGLPKDRFYVTYFGGNTELGLESDEEAKDIWLSMGIDASRVLPFGMKDNFWEMGETGPCGPCSEIHFDRIGNRDASELVNADDPDVLEVWNLVFIQYNRELDRSLKSLPHKHVDTGMGFERIVSVIQNKFSNYDTDLFQPLFDKIQAETNCRSYQGKLGEDDEGGIDMAYRVLADHARTLTIALSDGGQPQNTGRGYVLRRILRRAVRYAVDKLHAKPGMFSNLVDTVVDLLGEAFPEIKHSKENVKQIINEEESQFMKTLKRGKKMFDKSLEDFKQIKTGQTFLPGRIAWMLYDTYGYPLDLTALMCDESGIKINMEEYETCRKLAQETSQGSGDTVYLSVDLDVHDIDKLQTKKLQPTDDIPKFKYNADENGNYQLECHQATVLAIKIKEGFVDSVSSRDDVVGLVMDSTNFYAESGGQMYDTGSMVLNDVEQTEFEVATVKLCGGFVLHIGRVLNGSLKVGDRLKLEVDDARRKCLMQNHTGTHVLNYALREIVGDVDQKGSLVAPDKLRFDFSAKGQVDNEQLRKVETICKSIINEKKQVYVKEVALSIAKEIQGIRAVFGETYPDPVRVVSIGVPVDDLINAINEPKPSLNASVEFCGGTHLTNSHHISELVITAESAISKGVRRIFALTGAEAEKACKIASQMECEVGKLENTFSKTMEDSRIRDLLNSIKDMKRELDEALISYWFKNSLRARLESLRKELDSLEKTKKELLQANLMEQAWPVIENAVSHNRKFLVIRFLDGADQTSINKAFREIQKKHKSLSLLGYSVDVTSNKIECKASVAKEMVTASFNAKNWIEKVTEIVGGKSGGSDQSAQVTGVALMNLHGLEEMANKFANMNI 969          
BLAST of alanine--tRNA ligase, cytoplasmic vs. Planmine SMEST
Match: SMESG000077060.1 (SMESG000077060.1)

HSP 1 Score: 196.823 bits (499), Expect = 3.184e-57
Identity = 99/200 (49.50%), Postives = 126/200 (63.00%), Query Frame = 2
Query:  269 RVANSQKCIRAGGKHNDLDDVGKDVYHHTFFEMLGNWSFGDYFKKEAISWAWELLTKVWGLPKDRFYVTYFGGNTELGLESDEEAKDIWLSMGIDASRVLPFGMKDNFWEMGE---TGPCGPCSEIHFDRIGN-------RDASELVNADDPDVLEVWNLVFIQYN-RELDRSLKSLPHKHVDTGMGFERIVSVIQNKSS 835
            +  NSQ+CIR GGK  DL+++G D  H ++FEMLGNWSF  Y K  A    W+ LT    LP    YVTYFGG  ELGL SDEE +DIW ++G+  +++L FGMKDNFWEMG+      CGPC+EIH+D +         R A   VN+  P+++E+WN VF+QY   E    L  LP   VDTGMG ER+ SVIQ + S
Sbjct:   12 KAVNSQRCIRLGGKTCDLENIGYDSTHLSYFEMLGNWSFRMYDKATACKLMWDYLTICLQLPSSHLYVTYFGGCEELGLPSDEETRDIWFNLGVKDNKILQFGMKDNFWEMGDRITNSICGPCTEIHWDYLATIGDSKEPRCARCFVNSGSPELVELWNCVFMQYRWTENGSKLMKLPGLVVDTGMGLERLTSVIQVRVS 211          
BLAST of alanine--tRNA ligase, cytoplasmic vs. Planmine SMEST
Match: SMESG000077059.1 (SMESG000077059.1)

HSP 1 Score: 117.472 bits (293), Expect = 7.657e-27
Identity = 136/506 (26.88%), Postives = 225/506 (44.47%), Query Frame = 2
Query:  941 DMAYRVLADHARTLTIALSDGGQPQNTGRGYV---LRRILRRAVRYAVDKLHAKPGMFSNLVDTVVDLLGEAFPEIKHSKENVKQIINEEESQFMKTLKRGKKMFDKSLEDFKQIKTGQTFLPGRIAWMLYDTY---GYPLDLTALMCDESGIKIN-----MEEYETCRKLAQETSQGSGDTVYLSVDLDVHDIDKLQTKKLQPTDD---IPKFKYNADENGNYQLECHQATVLAI-----KIKEGFXXXXXXXXXXXGLVMDSTNFYAESGGQMYDTGSMVLNDVEQTEFEVATVKLCGGFVLHIGRVLNGS---LKVGDRLKLEVDDARRKCLMQNHTGTHVLNYALREIVGDVDQKGSLVAPDKLRFDFS---AKGQV----DNEQLRKVETICKSIINEKKQVYVKEVALSIAKEIQGIRAVFGET--YPDPVRVVSIGVPVDDLINSINEPKPSLNASVEFCGGTHLTNSHHISELVITSESAISKGVRRIFALTGAEAEK 2365
            D AYR++ADH RTL IA+ DG  P   GR +    +R +L RA+R +   L    G+ S ++DTV D L          ++ +K+I+  EE++F   L++ +  F+K L    Q ++ +  +      +L D Y      LD+   M  ++G +IN     + E +   KL +       ++V L   L  ++I         PT +   I  + YN D    Y+ E     VLAI      I+    +     + V GLV  STN Y   GGQ  D G ++L+D        + ++   G V+H   ++N +   L    ++K  VD   R     +HT  H+L   +  ++G V Q  S +  D+ +F FS   +KG      D   +  ++  C + I +K+     +  +  +  +Q I   + E    P  V++VSIG                   + E C GTH  NS H+ +++ITS S + + +  I  +TG  A++
Sbjct:   39 DTAYRIIADHLRTLCIAIYDGILP---GRQFAELKVRHLLHRALRQSKYGLGMACGL-SPVIDTVCDTLQAQIRVDSKMRDAIKRIVQTEENKFFPRLEKFETTFEKFL---NQRQSNEQVINESEVKLLMDGYFGEEINLDIIRAMAKDAGFQINAILGDISEPKIVNKLKK------ANSVSLEEYLTNNNI---------PTTNSSFIYNYSYN-DSKKLYETEEIATEVLAIVYRSDSIENVITEIRPINNTVFGLVTSSTNMYPLKGGQDSDKGVVILDDKLIANVN-SVIETDAGHVVHWCELVNSANLPLNKFTKIKFRVDAHHRTGTTLHHTAHHILFEGINNLLGKVYQTSSSIKFDEGKFGFSVDLSKGDSTVLEDPNFISNLQGFCNN-IIKKRIPIKIQKDVEFSSLLQDINVRYSEANRLPTKVQIVSIG------------------ETGEVCCGTHAYNSGHLEDIIITSFSKVKQAISYIEFVTGQCAKE 501          
BLAST of alanine--tRNA ligase, cytoplasmic vs. Planmine SMEST
Match: SMESG000077059.1 (SMESG000077059.1)

HSP 1 Score: 117.472 bits (293), Expect = 9.977e-27
Identity = 136/506 (26.88%), Postives = 225/506 (44.47%), Query Frame = 2
Query:  941 DMAYRVLADHARTLTIALSDGGQPQNTGRGYV---LRRILRRAVRYAVDKLHAKPGMFSNLVDTVVDLLGEAFPEIKHSKENVKQIINEEESQFMKTLKRGKKMFDKSLEDFKQIKTGQTFLPGRIAWMLYDTY---GYPLDLTALMCDESGIKIN-----MEEYETCRKLAQETSQGSGDTVYLSVDLDVHDIDKLQTKKLQPTDD---IPKFKYNADENGNYQLECHQATVLAI-----KIKEGFXXXXXXXXXXXGLVMDSTNFYAESGGQMYDTGSMVLNDVEQTEFEVATVKLCGGFVLHIGRVLNGS---LKVGDRLKLEVDDARRKCLMQNHTGTHVLNYALREIVGDVDQKGSLVAPDKLRFDFS---AKGQV----DNEQLRKVETICKSIINEKKQVYVKEVALSIAKEIQGIRAVFGET--YPDPVRVVSIGVPVDDLINSINEPKPSLNASVEFCGGTHLTNSHHISELVITSESAISKGVRRIFALTGAEAEK 2365
            D AYR++ADH RTL IA+ DG  P   GR +    +R +L RA+R +   L    G+ S ++DTV D L          ++ +K+I+  EE++F   L++ +  F+K L    Q ++ +  +      +L D Y      LD+   M  ++G +IN     + E +   KL +       ++V L   L  ++I         PT +   I  + YN D    Y+ E     VLAI      I+    +     + V GLV  STN Y   GGQ  D G ++L+D        + ++   G V+H   ++N +   L    ++K  VD   R     +HT  H+L   +  ++G V Q  S +  D+ +F FS   +KG      D   +  ++  C + I +K+     +  +  +  +Q I   + E    P  V++VSIG                   + E C GTH  NS H+ +++ITS S + + +  I  +TG  A++
Sbjct:   39 DTAYRIIADHLRTLCIAIYDGILP---GRQFAELKVRHLLHRALRQSKYGLGMACGL-SPVIDTVCDTLQAQIRVDSKMRDAIKRIVQTEENKFFPRLEKFETTFEKFL---NQRQSNEQVINESEVKLLMDGYFGEEINLDIIRAMAKDAGFQINAILGDISEPKIVNKLKK------ANSVSLEEYLTNNNI---------PTTNSSFIYNYSYN-DSKKLYETEEIATEVLAIVYRSDSIENVITEIRPINNTVFGLVTSSTNMYPLKGGQDSDKGVVILDDKLIANVN-SVIETDAGHVVHWCELVNSANLPLNKFTKIKFRVDAHHRTGTTLHHTAHHILFEGINNLLGKVYQTSSSIKFDEGKFGFSVDLSKGDSTVLEDPNFISNLQGFCNN-IIKKRIPIKIQKDVEFSSLLQDINVRYSEANRLPTKVQIVSIG------------------ETGEVCCGTHAYNSGHLEDIIITSFSKVKQAISYIEFVTGQCAKE 501          
The following BLAST results are available for this feature:
BLAST of alanine--tRNA ligase, cytoplasmic vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 3
Match NameE-valueIdentityDescription
AARS10.000e+052.12alanyl-tRNA synthetase 1 [Source:HGNC Symbol;Acc:H... [more]
AARS20.000e+041.41alanyl-tRNA synthetase 2, mitochondrial [Source:HG... [more]
AARS11.151e-7650.40alanyl-tRNA synthetase 1 [Source:HGNC Symbol;Acc:H... [more]
back to top
BLAST of alanine--tRNA ligase, cytoplasmic vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
aars-20.000e+048.92Alanine--tRNA ligase, cytoplasmic [Source:UniProt... [more]
aars-20.000e+048.92Alanine--tRNA ligase, cytoplasmic [Source:UniProt... [more]
aars-20.000e+048.92Alanine--tRNA ligase, cytoplasmic [Source:UniProt... [more]
aars-20.000e+048.92Alanine--tRNA ligase, cytoplasmic [Source:UniProt... [more]
aars-15.888e-17439.67Alanine--tRNA ligase, mitochondrial [Source:UniPr... [more]
back to top
BLAST of alanine--tRNA ligase, cytoplasmic vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 3
Match NameE-valueIdentityDescription
AlaRS0.000e+053.00gene:FBgn0027094 transcript:FBtr0079722[more]
AlaRS0.000e+053.00gene:FBgn0027094 transcript:FBtr0079721[more]
AlaRS-m3.071e-16533.60gene:FBgn0028962 transcript:FBtr0077168[more]
back to top
BLAST of alanine--tRNA ligase, cytoplasmic vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
aars10.000e+051.96alanyl-tRNA synthetase 1 [Source:ZFIN;Acc:ZDB-GENE... [more]
aars10.000e+051.96alanyl-tRNA synthetase 1 [Source:ZFIN;Acc:ZDB-GENE... [more]
aars10.000e+051.96alanyl-tRNA synthetase 1 [Source:ZFIN;Acc:ZDB-GENE... [more]
aars10.000e+051.75alanyl-tRNA synthetase 1 [Source:ZFIN;Acc:ZDB-GENE... [more]
aars20.000e+044.11alanyl-tRNA synthetase 2, mitochondrial (putative)... [more]
back to top
BLAST of alanine--tRNA ligase, cytoplasmic vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 4
Match NameE-valueIdentityDescription
kmt5b0.000e+052.53lysine methyltransferase 5B [Source:Xenbase;Acc:XB... [more]
kmt5b0.000e+052.01lysine methyltransferase 5B [Source:Xenbase;Acc:XB... [more]
kmt5b0.000e+051.80lysine methyltransferase 5B [Source:Xenbase;Acc:XB... [more]
kmt5b0.000e+051.31lysine methyltransferase 5B [Source:Xenbase;Acc:XB... [more]
back to top
BLAST of alanine--tRNA ligase, cytoplasmic vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 2
Match NameE-valueIdentityDescription
Aars0.000e+051.92alanyl-tRNA synthetase [Source:MGI Symbol;Acc:MGI:... [more]
Aars20.000e+041.07alanyl-tRNA synthetase 2, mitochondrial [Source:MG... [more]
back to top
BLAST of alanine--tRNA ligase, cytoplasmic vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q9VLM8|SYAC_DROME0.000e+053.00Alanine--tRNA ligase, cytoplasmic OS=Drosophila me... [more]
sp|Q8BGQ7|SYAC_MOUSE0.000e+051.92Alanine--tRNA ligase, cytoplasmic OS=Mus musculus ... [more]
sp|Q5RC02|SYAC_PONAB0.000e+052.12Alanine--tRNA ligase, cytoplasmic OS=Pongo abelii ... [more]
sp|P49588|SYAC_HUMAN0.000e+052.12Alanine--tRNA ligase, cytoplasmic OS=Homo sapiens ... [more]
sp|P50475|SYAC_RAT0.000e+051.71Alanine--tRNA ligase, cytoplasmic OS=Rattus norveg... [more]
back to top
BLAST of alanine--tRNA ligase, cytoplasmic vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A1S3HSL50.000e+055.54alanine--tRNA ligase, cytoplasmic OS=Lingula ungui... [more]
A0A210PZB40.000e+054.55Alanine--tRNA ligase, cytoplasmic OS=Mizuhopecten ... [more]
V3ZQB60.000e+055.01AA_TRNA_LIGASE_II_ALA domain-containing protein OS... [more]
A0A4D5S0H80.000e+053.14Putative alanyl-trna synthetase (Fragment) OS=Ixod... [more]
A0A131Y3G40.000e+053.04Putative alanyl-trna synthetase OS=Ixodes ricinus ... [more]
back to top
BLAST of alanine--tRNA ligase, cytoplasmic vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
aars10.000e+052.42alanyl-tRNA synthetase 1 [Source:ZFIN;Acc:ZDB-GENE... [more]
aars10.000e+052.42alanyl-tRNA synthetase 1 [Source:ZFIN;Acc:ZDB-GENE... [more]
aars10.000e+052.11alanyl-tRNA synthetase 1 [Source:ZFIN;Acc:ZDB-GENE... [more]
aars20.000e+041.45alanyl-tRNA synthetase 2, mitochondrial [Source:NC... [more]
aars20.000e+041.04alanyl-tRNA synthetase 2, mitochondrial [Source:NC... [more]
back to top
BLAST of alanine--tRNA ligase, cytoplasmic vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 4
Match NameE-valueIdentityDescription
aars10.000e+049.33alanyl-tRNA synthetase 1 [Source:ZFIN;Acc:ZDB-GENE... [more]
aars10.000e+049.02alanyl-tRNA synthetase 1 [Source:ZFIN;Acc:ZDB-GENE... [more]
aars10.000e+048.14alanyl-tRNA synthetase 1 [Source:ZFIN;Acc:ZDB-GENE... [more]
ENSPMAT00000000146.10.000e+047.26pep scaffold:Pmarinus_7.0:GL476617:429487:443008:-... [more]
back to top
BLAST of alanine--tRNA ligase, cytoplasmic vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 2
Match NameE-valueIdentityDescription
ALA10.000e+049.23Cytoplasmic and mitochondrial alanyl-tRNA syntheta... [more]
YNL040W_mRNA9.429e-723.96Protein of unknown function; has strong similarity... [more]
back to top
BLAST of alanine--tRNA ligase, cytoplasmic vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 1
Match NameE-valueIdentityDescription
EDO366890.000e+050.16Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of alanine--tRNA ligase, cytoplasmic vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 3
Match NameE-valueIdentityDescription
aars10.000e+052.73alanyl-tRNA synthetase 1 [Source:NCBI gene;Acc:101... [more]
aars20.000e+042.10alanyl-tRNA synthetase 2, mitochondrial [Source:NC... [more]
aars20.000e+042.04alanyl-tRNA synthetase 2, mitochondrial [Source:NC... [more]
back to top
BLAST of alanine--tRNA ligase, cytoplasmic vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 4
Match NameE-valueIdentityDescription
SMESG000001618.10.000e+099.28SMESG000001618.1[more]
SMESG000077060.13.184e-5749.50SMESG000077060.1[more]
SMESG000077059.17.657e-2726.88SMESG000077059.1[more]
SMESG000077059.19.977e-2726.88SMESG000077059.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30015750 ID=SMED30015750|Name=alanine--tRNA ligase, cytoplasmic|organism=Schmidtea mediterranea sexual|type=transcript|length=3082bp
CAAAAAATTGTTTTAATATATATAACATTTCATCATACTTATTTTATTAA
TTTCATCATATATTTCAAATAAAATGGACAGAAACTCATCAACTATTAGA
AGAGAATTTGTGGACTTTTTTAAAGAAAAGAGTCATTTAAATATCCACTC
ATCTTCTACTATTCCTTTGAATGATCCCACATTATTATTTTCAAATGCTG
GAATGAATCAGTTCAAAAAAATATTCTTGGGCACAGCTGATCCTAATTCT
GATATGGCAAAATGGAAACGAGTAGCTAATAGTCAAAAATGCATCAGAGC
CGGCGGAAAGCATAATGATTTAGATGATGTTGGAAAAGATGTTTACCACC
ATACATTTTTTGAAATGTTGGGAAATTGGTCTTTCGGCGATTATTTCAAA
AAAGAAGCAATATCTTGGGCATGGGAATTGCTTACCAAAGTATGGGGATT
GCCAAAAGATAGATTCTATGTTACATATTTTGGTGGAAATACCGAATTGG
GTTTAGAATCAGATGAAGAAGCTAAAGATATTTGGTTAAGCATGGGAATT
GATGCCAGCCGTGTCCTACCTTTTGGAATGAAAGATAACTTTTGGGAAAT
GGGCGAAACCGGTCCATGTGGGCCTTGCTCAGAAATTCATTTTGATCGAA
TTGGCAATCGTGATGCTTCTGAACTTGTAAACGCAGATGACCCTGATGTT
TTAGAAGTTTGGAATCTAGTGTTTATTCAATATAATCGTGAACTTGATCG
ATCCTTGAAATCTTTGCCGCACAAACACGTCGATACAGGAATGGGTTTCG
AAAGAATTGTTTCTGTTATTCAAAATAAATCTTCTAATTACGATACAGAC
TTATTTCAACCGTTATTTGACAGAATTCAAGCCGAAACAAATTGTCGGTC
TTACCAAGGGAAGCTAGGAGATGATGATGAAGGCGGAATTGATATGGCAT
ATCGTGTTTTGGCTGATCATGCTCGAACTCTGACGATTGCTCTCAGTGAT
GGAGGACAACCTCAAAACACTGGTCGAGGTTATGTATTGAGAAGAATTTT
ACGTAGAGCTGTGAGATACGCAGTTGACAAGTTACATGCAAAACCTGGCA
TGTTTTCAAATCTTGTTGACACAGTTGTCGATTTATTAGGAGAAGCTTTT
CCGGAAATAAAACATAGTAAAGAAAATGTTAAACAAATTATTAATGAAGA
AGAATCACAATTTATGAAAACTCTTAAGAGAGGAAAGAAAATGTTTGACA
AATCATTGGAAGATTTCAAACAGATTAAAACAGGGCAAACATTTTTGCCG
GGTAGAATTGCATGGATGCTTTATGACACGTACGGTTATCCATTGGATTT
GACAGCATTGATGTGCGATGAAAGCGGAATAAAGATAAATATGGAAGAAT
ATGAAACATGTAGAAAGTTAGCCCAAGAAACGTCCCAAGGATCTGGGGAT
ACCGTGTATTTGTCAGTGGATCTTGATGTGCATGACATTGATAAATTACA
AACCAAAAAACTCCAACCCACTGATGACATTCCGAAATTCAAATACAACG
CCGATGAGAACGGTAATTATCAGCTTGAATGTCATCAAGCAACCGTGCTT
GCCATTAAAATCAAAGAAGGATTTGTTGATTCTGTATCAAGTCGAGACGA
TGTTGTTGGATTGGTAATGGATTCAACGAATTTCTATGCTGAATCTGGCG
GCCAAATGTACGATACCGGTTCAATGGTTCTCAATGATGTCGAACAAACG
GAATTTGAAGTGGCAACTGTGAAATTATGCGGTGGATTTGTGTTGCACAT
CGGCCGAGTGCTCAATGGATCATTGAAAGTCGGTGATAGATTAAAGCTGG
AAGTTGATGATGCTAGAAGAAAATGTCTAATGCAAAATCACACTGGAACA
CACGTATTAAATTACGCTTTGCGGGAAATTGTTGGTGACGTTGATCAGAA
AGGCTCATTAGTTGCTCCAGATAAGTTGCGATTCGATTTCTCGGCAAAAG
GCCAAGTTGATAATGAGCAATTGCGCAAAGTTGAGACTATATGCAAATCT
ATAATCAATGAGAAGAAACAAGTTTATGTGAAAGAAGTTGCTCTATCGAT
TGCTAAGGAAATTCAAGGAATTAGAGCTGTGTTTGGTGAAACTTATCCTG
ATCCAGTTCGAGTTGTGTCGATTGGGGTGCCAGTTGATGACCTGATAAAT
TCTATTAATGAACCTAAACCAAGTTTAAATGCTTCTGTGGAGTTTTGCGG
TGGAACACATCTTACTAACTCCCATCATATTTCCGAACTCGTAATCACTT
CCGAATCTGCAATCTCCAAGGGAGTCCGTAGAATTTTCGCCTTAACTGGA
GCTGAAGCAGAAAAAGCATGCAAAATTGCTTCTCAAATGGAATGCGAAGT
TGGAAAGCTTGAAAATACATTCAGCAAAACTATGGAAGACTCTCGAATAA
GAGATTTATTGAATTCCATTAAAGACATGAAAAGAGAACTCGACGAAGCT
CTGATTTCGTATTGGTTTAAAAACAGTCTCCGTGCACGTTTGGAATCGCT
GAGAAAGGAGTTGGATTCATTGGAGAAAACTAAGAAAGAATTATTGCAAG
CCAATCTGATGGAACAAGCTTGGCCTGTTATCGAAAATGCAGTCAGTCAC
AATAAGAAGTTCCTCGTTATCCGATTTCTTGACGGTGCAGATCAGACATC
GATTAACAAGGCATTTCGGGAAATACAGAAAAAGCATAAAAGTCTCTCGC
TTTTGGGGTATTCGGTTGATGTGACGTCGAATAAAATCGAGTGTAAAGCA
TCGGTTGCCAAGGAAATGGTGACTGCTAGTTTTAATGCCAAAAATTGGAT
TGAAAAAGTGACTGAAATCGTCGGTGGCAAGAGTGGAGGCAGTGACCAAT
CTGCTCAAGTCACCGGTGTCGCCTTGATGAATCTCCACGGATTGGAGGAA
ATGGCAAATAAATTTGCAAATATGAATATTTAATAAATTTTTCCTTTTCA
CTTGCATTTGTTTTGATATAAATTTAGTTTTCAGCTTTTATTTTTAAATA
TCTGTAATTCGCCAAAAATGGTGGACTTTCAC
back to top

protein sequence of SMED30015750-orf-1

>SMED30015750-orf-1 ID=SMED30015750-orf-1|Name=SMED30015750-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=970bp
MDRNSSTIRREFVDFFKEKSHLNIHSSSTIPLNDPTLLFSNAGMNQFKKI
FLGTADPNSDMAKWKRVANSQKCIRAGGKHNDLDDVGKDVYHHTFFEMLG
NWSFGDYFKKEAISWAWELLTKVWGLPKDRFYVTYFGGNTELGLESDEEA
KDIWLSMGIDASRVLPFGMKDNFWEMGETGPCGPCSEIHFDRIGNRDASE
LVNADDPDVLEVWNLVFIQYNRELDRSLKSLPHKHVDTGMGFERIVSVIQ
NKSSNYDTDLFQPLFDRIQAETNCRSYQGKLGDDDEGGIDMAYRVLADHA
RTLTIALSDGGQPQNTGRGYVLRRILRRAVRYAVDKLHAKPGMFSNLVDT
VVDLLGEAFPEIKHSKENVKQIINEEESQFMKTLKRGKKMFDKSLEDFKQ
IKTGQTFLPGRIAWMLYDTYGYPLDLTALMCDESGIKINMEEYETCRKLA
QETSQGSGDTVYLSVDLDVHDIDKLQTKKLQPTDDIPKFKYNADENGNYQ
LECHQATVLAIKIKEGFVDSVSSRDDVVGLVMDSTNFYAESGGQMYDTGS
MVLNDVEQTEFEVATVKLCGGFVLHIGRVLNGSLKVGDRLKLEVDDARRK
CLMQNHTGTHVLNYALREIVGDVDQKGSLVAPDKLRFDFSAKGQVDNEQL
RKVETICKSIINEKKQVYVKEVALSIAKEIQGIRAVFGETYPDPVRVVSI
GVPVDDLINSINEPKPSLNASVEFCGGTHLTNSHHISELVITSESAISKG
VRRIFALTGAEAEKACKIASQMECEVGKLENTFSKTMEDSRIRDLLNSIK
DMKRELDEALISYWFKNSLRARLESLRKELDSLEKTKKELLQANLMEQAW
PVIENAVSHNKKFLVIRFLDGADQTSINKAFREIQKKHKSLSLLGYSVDV
TSNKIECKASVAKEMVTASFNAKNWIEKVTEIVGGKSGGSDQSAQVTGVA
LMNLHGLEEMANKFANMNI*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: molecular function
TermDefinition
GO:0008270zinc ion binding
GO:0000166nucleotide binding
GO:0005524ATP binding
GO:0016876ligase activity, forming aminoacyl-tRNA and related compounds
GO:0004813alanine-tRNA ligase activity
GO:0003676nucleic acid binding
GO:0000049tRNA binding
GO:0003723RNA binding
GO:0004812aminoacyl-tRNA ligase activity
GO:0016874ligase activity
GO:0046872metal ion binding
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000034epidermis
PLANA:0002111X2 cell
Vocabulary: INTERPRO
TermDefinition
IPR003156DHHA1_dom
IPR002318Ala-tRNA-lgiase_IIc
IPR012947tRNA_SAD
IPR018164Ala-tRNA-synth_IIc_N
IPR018165Ala-tRNA-synth_IIc_core
IPR009000Transl_B-barrel_sf
IPR018162Ala-tRNA-ligase_IIc_anticod-bd
IPR018163Thr/Ala-tRNA-synth_IIc_edit
Vocabulary: cellular component
TermDefinition
GO:0005737cytoplasm
GO:0005739mitochondrion
Vocabulary: biological process
TermDefinition
GO:0043039tRNA aminoacylation
GO:0006419alanyl-tRNA aminoacylation
GO:0006412translation
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
NoneNo IPR availableCOILSCoilCoilcoord: 816..843
NoneNo IPR availableCOILSCoilCoilcoord: 792..812
NoneNo IPR availableGENE3DG3DSA:3.30.980.10coord: 598..754
e-value: 1.2E-44
score: 153.9
NoneNo IPR availableGENE3DG3DSA:3.10.310.40coord: 857..966
e-value: 2.1E-8
score: 36.1
NoneNo IPR availableGENE3DG3DSA:2.40.30.130coord: 483..593
e-value: 8.4E-9
score: 37.3
NoneNo IPR availableGENE3DG3DSA:3.30.54.20coord: 665..736
e-value: 1.2E-44
score: 153.9
NoneNo IPR availableGENE3DG3DSA:3.30.930.10coord: 3..253
e-value: 6.3E-121
score: 404.5
NoneNo IPR availablePANTHERPTHR11777ALANYL-TRNA SYNTHETASEcoord: 4..965
NoneNo IPR availablePANTHERPTHR11777:SF9ALANINE--TRNA LIGASE, CYTOPLASMICcoord: 4..965
NoneNo IPR availableCDDcd00673AlaRS_corecoord: 5..252
e-value: 6.98129E-131
score: 392.108
NoneNo IPR availableSUPERFAMILYSSF55681Class II aaRS and biotin synthetasescoord: 4..256
IPR002318Alanine-tRNA ligase, class IIcPRINTSPR00980TRNASYNTHALAcoord: 318..331
score: 76.1
coord: 81..92
score: 58.01
coord: 237..250
score: 66.48
coord: 210..221
score: 67.95
coord: 294..310
score: 56.11
IPR002318Alanine-tRNA ligase, class IIcTIGRFAMTIGR00344TIGR00344coord: 8..946
e-value: 1.2E-254
score: 845.5
IPR012947Threonyl/alanyl tRNA synthetase, SADSMARTSM00863tRNA_SAD_4coord: 695..755
e-value: 3.9E-15
score: 66.3
IPR012947Threonyl/alanyl tRNA synthetase, SADPFAMPF07973tRNA_SADcoord: 695..754
e-value: 9.2E-14
score: 51.3
IPR003156DHHA1 domainPFAMPF02272DHHA1coord: 817..957
e-value: 4.7E-8
score: 33.6
IPR018164Alanyl-tRNA synthetase, class IIc, N-terminalPFAMPF01411tRNA-synt_2ccoord: 8..597
e-value: 4.4E-208
score: 692.3
IPR018165Alanyl-tRNA synthetase, class IIc, core domainPROSITEPS50860AA_TRNA_LIGASE_II_ALAcoord: 3..768
score: 116.059
IPR009000Translation protein, beta-barrel domain superfamilySUPERFAMILYSSF50447Translation proteinscoord: 524..594
IPR018162Alanine-tRNA ligase, class IIc, anti-codon-binding domain superfamilySUPERFAMILYSSF101353Putative anticodon-binding domain of alanyl-tRNA synthetase (AlaRS)coord: 257..468
IPR018163Threonyl/alanyl tRNA synthetase, class II-like, putative editing domain superfamilySUPERFAMILYSSF55186ThrRS/AlaRS common domaincoord: 598..762