Aldo-keto reductase

Overview
NameAldo-keto reductase
Smed IDSMED30015739
Length (bp)1068
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Aldo-keto reductase (SMED30015739) t-SNE clustered cells

Violin plots show distribution of expression levels for Aldo-keto reductase (SMED30015739) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Aldo-keto reductase (SMED30015739) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Aldo-keto reductase (SMED30015739) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30015739

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 13

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
nervous systemSMED30015739SMESG000081151.1 dd_Smed_v4_1044_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
epidermisSMED30015739SMESG000081151.1 dd_Smed_v4_1044_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
cephalic gangliaSMED30015739SMESG000081151.1 dd_Smed_v4_1044_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
neoblastSMED30015739SMESG000081151.1 dd_Smed_v4_1044_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
parenchymal cellSMED30015739SMESG000081151.1 dd_Smed_v4_1044_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
muscle cellSMED30015739SMESG000081151.1 dd_Smed_v4_1044_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
cilated neuronSMED30015739SMESG000081151.1 dd_Smed_v4_1044_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30015739SMESG000081151.1 Contig52637newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30015739SMESG000081151.1 Contig52637uc_Smed_v2PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30015739SMESG000081151.1 Contig55615newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30015739SMESG000081151.1 Contig55615uc_Smed_v2PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Category 2 cellSMED30015739SMESG000081151.1 dd_Smed_v6_1044_0dd_Smed_v6PMID:29674432
Plass et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
neoblastSMED30015739SMESG000081151.1 dd_Smed_v6_1044_0dd_Smed_v6PMID:29674432
Plass et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Aldo-keto reductase vs. Ensembl Human
Match: AKR1A1 (aldo-keto reductase family 1 member A1 [Source:HGNC Symbol;Acc:HGNC:380])

HSP 1 Score: 258.84 bits (660), Expect = 6.558e-84
Identity = 133/312 (42.63%), Postives = 195/312 (62.50%), Query Frame = 3
Query:   57 SKSIKLNSGYDVPNFGLGTWLSKPGEIKASLESALNLGYNHIDCAWVYCNEKEIGGVLEDYISNGK-IKREELFVTSKLWNAFHRPELVKVGFEETLSNLRLDYLDLYLIHWPISIKPG-NILPSADKFKDELDDVDLIKTWKEMEKLVDSGKIRSIGLSNFNIRQIQNILDHCKIKPAMLQIEVNIYFPNKKLVEFCLKNDIQVTAYCPLGGAPDRPGATEGEKRPLSDPTVLELAKKYNATPGVILISYIIHRGLICIPKSVSSARLEENIKALNIKLSDEDFQLLDNLNVNIRSCCPLMFKLHKNYPFD 986
            +  + L++G  +P  GLGTW S+PG++KA+++ AL++GY HIDCA +Y NE EIG  L++ +  GK + REELFVTSKLWN  H PE V+    +TL++L+L+YLDLYL+HWP + + G N  P         D     +TWK +E LV  G ++++GLSNFN RQI +IL    ++PA+LQ+E + Y    +L+  C    ++VTAY PLG + DR      E   L +P VL LA+KY  +P  IL+ + + R +ICIPKS++ +R+ +NIK  +   S E+ + L+ LN N R   P++    K  P D
Sbjct:    3 ASCVLLHTGQKMPLIGLGTWKSEPGQVKAAVKYALSVGYRHIDCAAIYGNEPEIGEALKEDVGPGKAVPREELFVTSKLWNTKHHPEDVEPALRKTLADLQLEYLDLYLMHWPYAFERGDNPFPKNADGTICYDSTHYKETWKALEALVAKGLVQALGLSNFNSRQIDDILSVASVRPAVLQVECHPYLAQNELIAHCQARGLEVTAYSPLGSS-DRAWRDPDEPVLLEEPVVLALAEKYGRSPAQILLRWQVQRKVICIPKSITPSRILQNIKVFDFTFSPEEMKQLNALNKNWRYIVPMLTVDGKRVPRD 313          
BLAST of Aldo-keto reductase vs. Ensembl Human
Match: AKR1A1 (aldo-keto reductase family 1 member A1 [Source:HGNC Symbol;Acc:HGNC:380])

HSP 1 Score: 258.84 bits (660), Expect = 6.558e-84
Identity = 133/312 (42.63%), Postives = 195/312 (62.50%), Query Frame = 3
Query:   57 SKSIKLNSGYDVPNFGLGTWLSKPGEIKASLESALNLGYNHIDCAWVYCNEKEIGGVLEDYISNGK-IKREELFVTSKLWNAFHRPELVKVGFEETLSNLRLDYLDLYLIHWPISIKPG-NILPSADKFKDELDDVDLIKTWKEMEKLVDSGKIRSIGLSNFNIRQIQNILDHCKIKPAMLQIEVNIYFPNKKLVEFCLKNDIQVTAYCPLGGAPDRPGATEGEKRPLSDPTVLELAKKYNATPGVILISYIIHRGLICIPKSVSSARLEENIKALNIKLSDEDFQLLDNLNVNIRSCCPLMFKLHKNYPFD 986
            +  + L++G  +P  GLGTW S+PG++KA+++ AL++GY HIDCA +Y NE EIG  L++ +  GK + REELFVTSKLWN  H PE V+    +TL++L+L+YLDLYL+HWP + + G N  P         D     +TWK +E LV  G ++++GLSNFN RQI +IL    ++PA+LQ+E + Y    +L+  C    ++VTAY PLG + DR      E   L +P VL LA+KY  +P  IL+ + + R +ICIPKS++ +R+ +NIK  +   S E+ + L+ LN N R   P++    K  P D
Sbjct:    3 ASCVLLHTGQKMPLIGLGTWKSEPGQVKAAVKYALSVGYRHIDCAAIYGNEPEIGEALKEDVGPGKAVPREELFVTSKLWNTKHHPEDVEPALRKTLADLQLEYLDLYLMHWPYAFERGDNPFPKNADGTICYDSTHYKETWKALEALVAKGLVQALGLSNFNSRQIDDILSVASVRPAVLQVECHPYLAQNELIAHCQARGLEVTAYSPLGSS-DRAWRDPDEPVLLEEPVVLALAEKYGRSPAQILLRWQVQRKVICIPKSITPSRILQNIKVFDFTFSPEEMKQLNALNKNWRYIVPMLTVDGKRVPRD 313          
BLAST of Aldo-keto reductase vs. Ensembl Human
Match: AKR1A1 (aldo-keto reductase family 1 member A1 [Source:HGNC Symbol;Acc:HGNC:380])

HSP 1 Score: 258.84 bits (660), Expect = 6.558e-84
Identity = 133/312 (42.63%), Postives = 195/312 (62.50%), Query Frame = 3
Query:   57 SKSIKLNSGYDVPNFGLGTWLSKPGEIKASLESALNLGYNHIDCAWVYCNEKEIGGVLEDYISNGK-IKREELFVTSKLWNAFHRPELVKVGFEETLSNLRLDYLDLYLIHWPISIKPG-NILPSADKFKDELDDVDLIKTWKEMEKLVDSGKIRSIGLSNFNIRQIQNILDHCKIKPAMLQIEVNIYFPNKKLVEFCLKNDIQVTAYCPLGGAPDRPGATEGEKRPLSDPTVLELAKKYNATPGVILISYIIHRGLICIPKSVSSARLEENIKALNIKLSDEDFQLLDNLNVNIRSCCPLMFKLHKNYPFD 986
            +  + L++G  +P  GLGTW S+PG++KA+++ AL++GY HIDCA +Y NE EIG  L++ +  GK + REELFVTSKLWN  H PE V+    +TL++L+L+YLDLYL+HWP + + G N  P         D     +TWK +E LV  G ++++GLSNFN RQI +IL    ++PA+LQ+E + Y    +L+  C    ++VTAY PLG + DR      E   L +P VL LA+KY  +P  IL+ + + R +ICIPKS++ +R+ +NIK  +   S E+ + L+ LN N R   P++    K  P D
Sbjct:    3 ASCVLLHTGQKMPLIGLGTWKSEPGQVKAAVKYALSVGYRHIDCAAIYGNEPEIGEALKEDVGPGKAVPREELFVTSKLWNTKHHPEDVEPALRKTLADLQLEYLDLYLMHWPYAFERGDNPFPKNADGTICYDSTHYKETWKALEALVAKGLVQALGLSNFNSRQIDDILSVASVRPAVLQVECHPYLAQNELIAHCQARGLEVTAYSPLGSS-DRAWRDPDEPVLLEEPVVLALAEKYGRSPAQILLRWQVQRKVICIPKSITPSRILQNIKVFDFTFSPEEMKQLNALNKNWRYIVPMLTVDGKRVPRD 313          
BLAST of Aldo-keto reductase vs. Ensembl Human
Match: AKR1B10 (aldo-keto reductase family 1 member B10 [Source:HGNC Symbol;Acc:HGNC:382])

HSP 1 Score: 254.218 bits (648), Expect = 3.574e-82
Identity = 129/316 (40.82%), Postives = 195/316 (61.71%), Query Frame = 3
Query:   54 MSKSIKLNSGYDVPNFGLGTWLSKPGEIKASLESALNLGYNHIDCAWVYCNEKEIGGVLEDYISNGKIKREELFVTSKLWNAFHRPELVKVGFEETLSNLRLDYLDLYLIHWPISIKPG-NILPSADKFKDELDDVDLIKTWKEMEKLVDSGKIRSIGLSNFNIRQIQNILDH--CKIKPAMLQIEVNIYFPNKKLVEFCLKNDIQVTAYCPLGGAPDRPGATEGEKRPLSDPTVLELAKKYNATPGVILISYIIHRGLICIPKSVSSARLEENIKALNIKLSDEDFQLLDNLNVNIRSCCPLMFKLHKNYPFDED 992
            M+  ++L++   +P  GLGTW S  G++K +++ A++ GY HIDCA+VY NE E+G  +++ I    +KRE+LF+ SKLW  F    LV+  FE+TL +L+L YLD+YLIHWP   K G ++ P  DK          +  W+ ME+LVD G ++++G+SNF+  QI+ +L+    K KP   Q+E + Y   +KL+++C    I VTAY PL G+PDRP A   +   L DP + E+A K+  T   +LI + I R +I IPKSV+ AR+ ENI+  + KLSDE+   + + N N R+C  L     ++YPF+ +
Sbjct:    1 MATFVELSTKAKMPIVGLGTWKSPLGKVKEAVKVAIDAGYRHIDCAYVYQNEHEVGEAIQEKIQEKAVKREDLFIVSKLWPTFFERPLVRKAFEKTLKDLKLSYLDVYLIHWPQGFKSGDDLFPKDDKGNAIGGKATFLDAWEAMEELVDEGLVKALGVSNFSHFQIEKLLNKPGLKYKPVTNQVECHPYLTQEKLIQYCHSKGITVTAYSPL-GSPDRPWAKPEDPSLLEDPKIKEIAAKHKKTAAQVLIRFHIQRNVIVIPKSVTPARIVENIQVFDFKLSDEEMATILSFNRNWRACNVLQSSHLEDYPFNAE 315          
BLAST of Aldo-keto reductase vs. Ensembl Human
Match: AKR1C2 (aldo-keto reductase family 1 member C2 [Source:HGNC Symbol;Acc:HGNC:385])

HSP 1 Score: 246.128 bits (627), Expect = 7.056e-79
Identity = 129/319 (40.44%), Postives = 195/319 (61.13%), Query Frame = 3
Query:   60 KSIKLNSGYDVPNFGLGTWLSKPGEIKAS--LES---ALNLGYNHIDCAWVYCNEKEIGGVLEDYISNGKIKREELFVTSKLWNAFHRPELVKVGFEETLSNLRLDYLDLYLIHWPISIKPG-NILPSADKFKDELDDVDLIKTWKEMEKLVDSGKIRSIGLSNFNIRQIQNILDH--CKIKPAMLQIEVNIYFPNKKLVEFCLKNDIQVTAYCPLGGAPDRPGATEGEKRPLSDPTVLELAKKYNATPGVILISYIIHRGLICIPKSVSSARLEENIKALNIKLSDEDFQLLDNLNVNIRSCCPLMFKLHKNYPFDED 992
            + +KLN G+ +P  G GT+   P E+  S  LE+   A+  G++HID A VY NE+++G  +   I++G +KRE++F TSKLW+  HRPELV+   E +L NL+LDY+DLYLIH+P+S+KPG  ++P  +  K   D VDL  TW+ MEK  D+G  +SIG+SNFN R ++ IL+    K KP   Q+E + YF  +KL++FC   DI + AY  LG   + P         L DP +  LAKK+  TP +I + Y + RG++ + KS +  R+ +N++    +L+ E+ + +D LN N+R     +F    NYPF ++
Sbjct:    6 QCVKLNDGHFMPVLGFGTY--APAEVPKSKALEAVKLAIEAGFHHIDSAHVYNNEEQVGLAIRSKIADGSVKREDIFYTSKLWSNSHRPELVRPALERSLKNLQLDYVDLYLIHFPVSVKPGEEVIPKDENGKILFDTVDLCATWEAMEKCKDAGLAKSIGVSNFNHRLLEMILNKPGLKYKPVCNQVECHPYFNQRKLLDFCKSKDIVLVAYSALGSHREEPWVDPNSPVLLEDPVLCALAKKHKRTPALIALRYQLQRGVVVLAKSYNEQRIRQNVQVFEFQLTSEEMKAIDGLNRNVRYLTLDIFAGPPNYPFSDE 322          
BLAST of Aldo-keto reductase vs. Ensembl Celegans
Match: Y39G8B.1 (pep chromosome:WBcel235:II:13970584:13972970:-1 gene:WBGene00012722.1 transcript:Y39G8B.1b.1 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:Y39G8B.1)

HSP 1 Score: 259.225 bits (661), Expect = 1.488e-84
Identity = 136/315 (43.17%), Postives = 191/315 (60.63%), Query Frame = 3
Query:   54 MSKSIKLNSGYDVPNFGLGTWLSKPGEIKASLESALNLGYNHIDCAWVYCNEKEIGGVLEDYISNGKIKREELFVTSKLWNAFHRPELVKVGFEETLSNLRLDYLDLYLIHWPISIKPG-NILPSADKFKDELDDVDLIKTWKEMEKLVDSGKIRSIGLSNFNIRQIQNILDHCKIKPAMLQIEVNIYFPNKKLVEFCLKNDIQVTAYCPLGGAPDRPGATEGEKRPLSDPTVLELAKKYNATPGVILISYIIHRGLICIPKSVSSARLEENIKALNIKLSDEDFQLLDNLNVNIRSCCPLMFKL-HKNYPFDED 992
            M +S+KLNSGY +P  GLGTW SKPGE+ A++++A+  GY HIDCA VY N+KE+G  L++ +  GK+KREELF+TSK+WN FH         +  LS+L+L Y+DL LIHWP     G  + P+ +  K    DVD ++TWK  E    +GK RSIGLSNF   QIQ + D  ++KPA LQ+E++ YF   KL EFC +  I V  Y PLG         +G+   L++  V  +AK +  TP  I++ + +  GL  IPKSV+  R+ ENI  ++ +LS E+ Q +D +N   R   P      HK + F+E+
Sbjct:    1 MVQSLKLNSGYSIPAIGLGTWQSKPGEVAAAIKTAVAAGYRHIDCAHVYQNQKEVGEALKEILDEGKVKREELFITSKVWNTFHSEAKAHENIDIILSDLQLSYVDLMLIHWPQGYAEGAELFPAGENGKMRYSDVDYLETWKAFEAAQKAGKCRSIGLSNFTHSQIQRVWDAAEVKPACLQVELHPYFTQVKLREFCKEKGIVVVGYSPLGNPGSAFFRKDGDPNVLTNEVVAGIAKAHGKTPAQIILRWFVDSGLSAIPKSVTPQRIIENISVIDFQLSAEEIQAIDGVNRGWRLVDPSPRDGDHKYFGFNEE 315          
BLAST of Aldo-keto reductase vs. Ensembl Celegans
Match: Y39G8B.1 (pep chromosome:WBcel235:II:13970789:13972970:-1 gene:WBGene00012722.1 transcript:Y39G8B.1a.1 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:Y39G8B.1)

HSP 1 Score: 255.758 bits (652), Expect = 3.409e-83
Identity = 129/296 (43.58%), Postives = 182/296 (61.49%), Query Frame = 3
Query:   54 MSKSIKLNSGYDVPNFGLGTWLSKPGEIKASLESALNLGYNHIDCAWVYCNEKEIGGVLEDYISNGKIKREELFVTSKLWNAFHRPELVKVGFEETLSNLRLDYLDLYLIHWPISIKPG-NILPSADKFKDELDDVDLIKTWKEMEKLVDSGKIRSIGLSNFNIRQIQNILDHCKIKPAMLQIEVNIYFPNKKLVEFCLKNDIQVTAYCPLGGAPDRPGATEGEKRPLSDPTVLELAKKYNATPGVILISYIIHRGLICIPKSVSSARLEENIKALNIKLSDEDFQLLDNLNVNIR 938
            M +S+KLNSGY +P  GLGTW SKPGE+ A++++A+  GY HIDCA VY N+KE+G  L++ +  GK+KREELF+TSK+WN FH         +  LS+L+L Y+DL LIHWP     G  + P+ +  K    DVD ++TWK  E    +GK RSIGLSNF   QIQ + D  ++KPA LQ+E++ YF   KL EFC +  I V  Y PLG         +G+   L++  V  +AK +  TP  I++ + +  GL  IPKSV+  R+ EN+   + +L+ E+   +D +N N R
Sbjct:    1 MVQSLKLNSGYSIPAIGLGTWQSKPGEVAAAIKTAVAAGYRHIDCAHVYQNQKEVGEALKEILDEGKVKREELFITSKVWNTFHSEAKAHENIDIILSDLQLSYVDLMLIHWPQGYAEGAELFPAGENGKMRYSDVDYLETWKAFEAAQKAGKCRSIGLSNFTHSQIQRVWDAAEVKPACLQVELHPYFTQVKLREFCKEKGIVVVGYSPLGNPGSAFFRKDGDPNVLTNEVVAGIAKAHGKTPAQIILRWFVDSGLSAIPKSVTPQRISENLAVFDFQLTAEEISKIDGINKNWR 296          
BLAST of Aldo-keto reductase vs. Ensembl Celegans
Match: T08H10.1 (pep chromosome:WBcel235:V:4483459:4486543:1 gene:WBGene00020369.1 transcript:T08H10.1.1 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:T08H10.1)

HSP 1 Score: 237.654 bits (605), Expect = 7.348e-76
Identity = 132/315 (41.90%), Postives = 184/315 (58.41%), Query Frame = 3
Query:   63 SIKLNSGYDVPNFGLGTWLSK-PGEIKASLESALNLGYNHIDCAWVYCNEKEIGGVLEDYISNGKIKREELFVTSKLWNAFHRPELVKVGFEETLSNLRLDYLDLYLIHWPISIK--PGNILPSADKFKDELDDVDLIKTWKEMEKLVDSGKIRSIGLSNFNIRQIQNILDHCKIKPAMLQIEVNIYFPNKKLVEFCLKNDIQVTAYCPLGGA---PDRPGATEGEKRPLSDPTVLELAKKYNATPGVILISYIIHRGLICIPKSVSSARLEENIKALNIKLSDEDFQLLDNLNVNIRSCCPLMFKLHKNYPFDE 989
            SI LN+G  +P FGLGTW  K   E+  +L +AL+ GY  ID A +Y NE  IG VL +YIS+GK+KRE++FVTSKL    H PE V    E  L  L+L+Y+DLYLIH P   K   G+  P  +  +  + ++  I TW+ +EKL   GK++++G+SNF+  Q+Q + D  ++KPA  Q+E +IY+P ++L   C K  + VTAY PLG       RP     E  PL +P V +LA KY+ T   ILI ++   G+  IPKSVS  R+ ENI   + KLSDED   L+++    R         H  +P D+
Sbjct:    5 SIPLNTGAQLPLFGLGTWQVKDEAELTVALRAALDAGYRLIDTAHLYQNEHIIGKVLHEYISSGKLKREDIFVTSKLPFTAHAPEDVPKCVESQLKALQLEYIDLYLIHCPFPFKHQEGSFAPLMENGELAVTEIAHIDTWRALEKLYKEGKLKALGVSNFSCNQLQALYDAAEVKPANQQVECHIYWPQQELRALCKKLGVTVTAYAPLGSPGRKAARPDGVWPEGDPLLEPIVKQLAAKYHKTAAQILIRHLTQHGISTIPKSVSPDRIVENISTFDFKLSDEDMHTLNSIETRTRLFIADFAVKHPFFPHDD 319          
BLAST of Aldo-keto reductase vs. Ensembl Celegans
Match: C07D8.6 (pep chromosome:WBcel235:X:7341509:7342780:1 gene:WBGene00015565.1 transcript:C07D8.6.1 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:C07D8.6)

HSP 1 Score: 186.037 bits (471), Expect = 4.837e-56
Identity = 103/298 (34.56%), Postives = 168/298 (56.38%), Query Frame = 3
Query:   51 TMSKSIKLNSGYDVPNFGLGTWLSKPGEIKASLESALNLGYNHIDCAWVYCNEKEIGGVLEDYISNGKIKREELFVTSKLWNAFHRPELVKVGFEETLSNLRLDYLDLYLIHWPISIKPGNILPSADKFKDELDDVDLIKTWKEMEKLVDSGKIRSIGLSNFNIRQIQNILDHCKIKPAMLQIEVNIYFPNKKLVEFCLKNDIQVTAYCPLGGAPDRPGAT--EGEK-------RPLSDPTVLELAKKYNATPGVILISYIIHRGLICIPKSVSSARLEENIKALNIKLSDEDFQLLD 917
            + + SIKL++G ++P  GLGTW S P E+  ++++A+  GY  ID A VY NE+ IG  +++ +  G +KREELF+T+K W     P  ++ G  E+L  L+L+Y+DLYL H P +         ++     ++DV     W++ + +  +G  +++G+SN+N  QI   L          Q+E+++YFP    V+FC K++I VT+Y  L G+P R   T   G+K         L D  VL LA+K + TP  +L+ Y + RG   +PKS+   R++EN +  +  L++ED   L+
Sbjct:    3 SATASIKLSNGVEMPVIGLGTWQSSPAEVITAVKTAVKAGYRLIDTASVYQNEEAIGTAIKELLEEGVVKREELFITTKAWTHELAPGKLEGGLRESLKKLQLEYVDLYLAHMPAAFNDD----MSEHIASPVEDV-----WRQFDAVYKAGLAKAVGVSNWNNDQISRALALGLTPVHNSQVELHLYFPQHDHVDFCKKHNISVTSYATL-GSPGRVNFTLPTGQKLDWAPAPSDLQDQNVLALAEKTHKTPAQVLLRYALDRGCAILPKSIQENRIKENFEVFDFSLTEEDIAKLE 290          
BLAST of Aldo-keto reductase vs. Ensembl Celegans
Match: Y39G8B.2 (pep chromosome:WBcel235:II:13973690:13976221:-1 gene:WBGene00012723.1 transcript:Y39G8B.2.1 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:Y39G8B.2)

HSP 1 Score: 182.185 bits (461), Expect = 2.072e-54
Identity = 103/323 (31.89%), Postives = 168/323 (52.01%), Query Frame = 3
Query:   48 LTMSKSIKLNSGYDVPNFGLGTWLSKPGEIKASLESALNLGYNHIDCAWVYCNEKEIGGVLEDYISNGKIKREELFVTSKLWNAFHRPELVKVGFEETLSNLRLDYLDLYLIHWPISIK----PG--NILPSADKFKDELDDVDLIKTWKEMEKLVDSGKIRSIGLSNFNIRQIQNILDHCKIKPAMLQIEVNIYFPNKKLVEFCLKNDIQVTAYCPLGGAPDRPGATEGEKRP----LSDPTVLELAKKYNATPGVILISYIIHRGLICIPKSVSSARLEENIKALNIKLSDEDFQLLDNLNVNIRSCCPLMFKL-HKNYPF 983
            + ++ ++ LNSGY++P  G GTW          +  AL  GY HID A  + N++E+   ++D+    K++REELF++SK+WN +H         +E L      Y+DL +IHWP        PG   + P     K    DVD ++TWK +E    SGKIRSIGL+NFNI Q++ +     IKPA+LQ+E+N +   +++ +FC +  I +TA+   G     PG+    K      L + T+  +AK +  +   +L+ + I      + KS  S R+ +NI     +L+ ++   +  LN++ R   PL+    H  +P+
Sbjct:    1 MPIADTVTLNSGYEMPVIGYGTWQLPKNLAAERVRDALEAGYRHIDSALSFKNQEEVAAGIKDWCKIRKVRREELFLSSKIWNTYHSRNRCMQQIDEMLEIFETTYMDLIVIHWPFGWAEDEPPGERGLWPRGANGKMRYSDVDYLETWKALEDAHRSGKIRSIGLANFNIGQVEQVWTKGLIKPAVLQVEMNPFLDQEEIRQFCREKGIILTAFMLTGN----PGSALYRKHEDPNLLYNETLQSIAKGHGKSVVQVLVRWAIDLRTTALVKSSESKRIRQNINIFKFRLTSQEIARIKALNIDFRILNPLLGNYDHPYFPW 319          
BLAST of Aldo-keto reductase vs. Ensembl Fly
Match: CG6084 (gene:FBgn0086254 transcript:FBtr0331547)

HSP 1 Score: 249.595 bits (636), Expect = 1.181e-80
Identity = 145/313 (46.33%), Postives = 203/313 (64.86%), Query Frame = 3
Query:   63 SIKLNSGYDVPNFGLGTWLSKPGEIKASLESALNLGYNHIDCAWVYCNEKEIGGVLEDYISNGKIKREELFVTSKLWNAFHRPELVKVGFEETLSNLRLDYLDLYLIHWPISIKPG-NILPSADKFKDELDDVDLIKTWKEMEKLVDSGKIRSIGLSNFNIRQIQNILDHCKIKPAMLQIEVNIYFPNKKLVEFCLKNDIQVTAYCPLGGAPDRPGATEGEKRPLSDPTVLELAKKYNATPGVILISYIIHRGLICIPKSVSSARLEENIKALNIKLSDEDFQLLDNLNVNIRSCCPLM--FKLHKNYPFDED 992
            ++K N+G +VP  GLGTW S  G++  +++ A++ GY HIDCA+VY NE E+G  +E  I  G +KRE+LF+TSKLWN FHRP+LVK   E TLS+L+L YLDLYLIHWP+  K G ++ P+    K     VD + TWK MEKLV+ G ++SIG+SNFN RQI+ +L+   I P   QIE + Y   KKL++FC   DI +TAY PL G+P+RP A  G+   L +  + E+A K   TPG ILI Y + R  I IPKSV+  R+E N +  + +L+ E+ +++++   N R   PL+     HK YPF ++
Sbjct:    5 NVKFNNGKEVPIIGLGTWGSPKGQVTEAVKVAIDAGYRHIDCAYVYQNEDEVGDGVEAKIKEGVVKREDLFITSKLWNTFHRPDLVKSALENTLSSLKLKYLDLYLIHWPMGYKEGCDLFPTDKDGKTLYSPVDYVDTWKAMEKLVEEGLVKSIGVSNFNRRQIERVLEVATIPPVTNQIECHPYLTQKKLIDFCKSKDITITAYSPL-GSPNRPWAKAGDPVILEEAKIKEIAAKKKKTPGQILIRYQVQRANIVIPKSVTKDRIESNFQVFDFELTPEEIEIIESFECNGR-LVPLLKDAGTHKYYPFHDE 315          
BLAST of Aldo-keto reductase vs. Ensembl Fly
Match: CG6084 (gene:FBgn0086254 transcript:FBtr0076139)

HSP 1 Score: 249.21 bits (635), Expect = 1.435e-80
Identity = 144/312 (46.15%), Postives = 205/312 (65.71%), Query Frame = 3
Query:   63 SIKLNSGYDVPNFGLGTWLSKPGEIKASLESALNLGYNHIDCAWVYCNEKEIGGVLEDYISNGKIKREELFVTSKLWNAFHRPELVKVGFEETLSNLRLDYLDLYLIHWPISIKPG-NILPSADKFKDELDDVDLIKTWKEMEKLVDSGKIRSIGLSNFNIRQIQNILDHCKIKPAMLQIEVNIYFPNKKLVEFCLKNDIQVTAYCPLGGAPDRPGATEGEKRPLSDPTVLELAKKYNATPGVILISYIIHRGLICIPKSVSSARLEENIKALNIKLSDEDFQLLDNLNVNIRSCCPLMFKL-HKNYPFDED 992
            ++K N+G +VP  GLGTW S  G++  +++ A++ GY HIDCA+VY NE E+G  +E  I  G +KRE+LF+TSKLWN FHRP+LVK   E TLS+L+L YLDLYLIHWP+  K G ++ P+    K     VD + TWK MEKLV+ G ++SIG+SNFN RQI+ +L+   I P   QIE + Y   KKL++FC   DI +TAY PL G+P+RP A  G+   L +  + E+A K   TPG ILI Y + R  I IPKSV+  R+E N +  + +L+ E+ +++++   N R   PL+ +  H ++PF++D
Sbjct:    5 NVKFNNGKEVPIIGLGTWGSPKGQVTEAVKVAIDAGYRHIDCAYVYQNEDEVGDGVEAKIKEGVVKREDLFITSKLWNTFHRPDLVKSALENTLSSLKLKYLDLYLIHWPMGYKEGCDLFPTDKDGKTLYSPVDYVDTWKAMEKLVEEGLVKSIGVSNFNRRQIERVLEVATIPPVTNQIECHPYLTQKKLIDFCKSKDITITAYSPL-GSPNRPWAKAGDPVILEEAKIKEIAAKKKKTPGQILIRYQVQRANIVIPKSVTKDRIESNFQVFDFELTPEEIEIIESFECNGR-LVPLLNQYGHPHHPFEKD 314          
BLAST of Aldo-keto reductase vs. Ensembl Fly
Match: CG10863 (gene:FBgn0027552 transcript:FBtr0073171)

HSP 1 Score: 241.891 bits (616), Expect = 9.890e-78
Identity = 128/311 (41.16%), Postives = 189/311 (60.77%), Query Frame = 3
Query:   66 IKLNSGYDVPNFGLGTWLSKPGEIKASLESALNLGYNHIDCAWVYCNEKEIGGVLEDYISNGKIKREELFVTSKLWNAFHRPELVKVGFEETLSNLRLDYLDLYLIHWPIS-IKPGN--ILPSADKFKDELDDVDLIKTWKEMEKLVDSGKIRSIGLSNFNIRQIQNILDHCKIKPAMLQIEVNIYFPNKKLVEFCLKNDIQVTAYCPLGGAPDRPGATEGEKRPLSDPTVLELAKKYNATPGVILISYIIHRGLICIPKSVSSARLEENIKALNIKLSDEDFQLLDNLNVNIRSCCPLMFKL-HKNYPFD 986
            +K N+G  + + GLGT+ S  G+ + +   A+++GY HID A+ Y NE E+G  ++  I+ G IKRE++ +T+KLW  FH P+ V+    +TL N  L Y+DLYL+HWP S +  G+  ++P+  K + EL+D+D + TW+EMEKLV+ G  +SIG+SNFN  Q+  +L +CKIKP   QIE +     KKL+  C KNDI VTAYCPLG    RP   E     + D  V  +  KY  +   +++ Y+I  G I +PKS +  R+EEN +  + +L  ED  +LD+ N   R   P+   +  KNYPF+
Sbjct:    8 VKHNNGTQIQSIGLGTYTSLGGDCERATLHAIDVGYRHIDTAYFYENENEVGAAVQRKIAEGVIKREDIHITTKLWCHFHEPKRVEYACRKTLQNFGLQYVDLYLMHWPYSYVYRGDNEMMPTDAKGEVELNDIDYLDTWREMEKLVELGLTKSIGVSNFNSEQLTRLLANCKIKPIHNQIECHPALNQKKLIALCKKNDIVVTAYCPLG----RPNPAEKTPNYIYDAKVQAIGDKYKKSTAQVVLRYLIEIGTIPLPKSSNPKRIEENFQIFDFQLDAEDHAILDSYNTGER-LIPMTHAIKSKNYPFN 313          
BLAST of Aldo-keto reductase vs. Ensembl Fly
Match: CG6083 (gene:FBgn0036183 transcript:FBtr0076137)

HSP 1 Score: 238.81 bits (608), Expect = 1.996e-76
Identity = 120/309 (38.83%), Postives = 186/309 (60.19%), Query Frame = 3
Query:   72 LNSGYDVPNFGLGTWLSKPGEIKASLESALNLGYNHIDCAWVYCNEKEIGGVLEDYISNGKIKREELFVTSKLWNAFHRPELVKVGFEETLSNLRLDYLDLYLIHWPISIKPG--NILPSA-DKFKDELDDVDLIKTWKEMEKLVDSGKIRSIGLSNFNIRQIQNILDHCKIKPAMLQIEVNIYFPNKKLVEFCLKNDIQVTAYCPLGGAPDRPGATEGEKRPLSDPTVLELAKKYNATPGVILISYIIHRGLICIPKSVSSARLEENIKAL-NIKLSDEDFQLLDNLNVNIRSCCPLMFKLHKNYPFD 986
            L++G ++P  GLGTW S P  +  +++ A+++GY H DCA +Y NE ++G  L + +  G + R+ELF+TSKLWN  H+P+LV+   E ++ NL + YL+LYL+HWP++ K G  N+ P+  D  K   +D+D + TW+ ME LVD G  ++IG+SNFN +Q+  +L   K+KP +LQIE + Y   K L+  C  N I VTAY  LG     P    G    L  PT+L +A+KY  T   +L+ +    G+I IP+SVS   + +N K + + +L+ +D Q ++ L+ N R         H ++PF+
Sbjct:    8 LSNGKNMPMLGLGTWRSPPEVVTQAVKDAIDIGYRHFDCAHIYGNEAQVGAALREKMDEGVVTRDELFITSKLWNTHHKPDLVRPACETSIRNLGVKYLNLYLMHWPMAYKSGSDNLYPTCPDTNKAAFEDIDYVDTWRAMENLVDEGLCQAIGVSNFNEQQMNRLLSVAKLKPVVLQIECHPYLSQKPLITLCYDNAIAVTAYSCLGSG-HTPYEKPGAYPLLQHPTILAIAEKYERTAAQVLLRFQTQSGIIVIPRSVSKQHMLDNFKRIWDFELAVDDIQAINELDCNGRFMTMKAAYGHPHHPFE 315          
BLAST of Aldo-keto reductase vs. Ensembl Fly
Match: CG6084 (gene:FBgn0086254 transcript:FBtr0331546)

HSP 1 Score: 239.195 bits (609), Expect = 3.096e-76
Identity = 140/306 (45.75%), Postives = 200/306 (65.36%), Query Frame = 3
Query:   81 GYDVPNFGLGTWLSKPGEIKASLESALNLGYNHIDCAWVYCNEKEIGGVLEDYISNGKIKREELFVTSKLWNAFHRPELVKVGFEETLSNLRLDYLDLYLIHWPISIKPG-NILPSADKFKDELDDVDLIKTWKEMEKLVDSGKIRSIGLSNFNIRQIQNILDHCKIKPAMLQIEVNIYFPNKKLVEFCLKNDIQVTAYCPLGGAPDRPGATEGEKRPLSDPTVLELAKKYNATPGVILISYIIHRGLICIPKSVSSARLEENIKALNIKLSDEDFQLLDNLNVNIRSCCPLMFKL-HKNYPFDED 992
            G ++P  GLGT+ S  G++  +++ A++ GY HIDCA+VY NE E+G  +E  I  G +KRE+LF+TSKLWN FHRP+LVK   E TLS+L+L YLDLYLIHWP+  K G ++ P+    K     VD + TWK MEKLV+ G ++SIG+SNFN RQI+ +L+   I P   QIE + Y   KKL++FC   DI +TAY PL G+P+RP A  G+   L +  + E+A K   TPG ILI Y + R  I IPKSV+  R+E N +  + +L+ E+ +++++   N R   PL+ +  H ++PF++D
Sbjct:   45 GNEIPVIGLGTFNSPKGQVTEAVKVAIDAGYRHIDCAYVYQNEDEVGDGVEAKIKEGVVKREDLFITSKLWNTFHRPDLVKSALENTLSSLKLKYLDLYLIHWPMGYKEGCDLFPTDKDGKTLYSPVDYVDTWKAMEKLVEEGLVKSIGVSNFNRRQIERVLEVATIPPVTNQIECHPYLTQKKLIDFCKSKDITITAYSPL-GSPNRPWAKAGDPVILEEAKIKEIAAKKKKTPGQILIRYQVQRANIVIPKSVTKDRIESNFQVFDFELTPEEIEIIESFECNGR-LVPLLNQYGHPHHPFEKD 348          
BLAST of Aldo-keto reductase vs. Ensembl Zebrafish
Match: akr1a1a (aldo-keto reductase family 1, member A1a (aldehyde reductase) [Source:NCBI gene;Acc:445326])

HSP 1 Score: 286.574 bits (732), Expect = 5.280e-95
Identity = 144/323 (44.58%), Postives = 206/323 (63.78%), Query Frame = 3
Query:   54 MSKSIKLNSGYDVPNFGLGTWLSKPGEIKASLESALNLGYNHIDCAWVYCNEKEIGGVLEDYISNGK-IKREELFVTSKLWNAFHRPELVKVGFEETLSNLRLDYLDLYLIHWPISIKPGN-ILPSADKFKDELDDVDLIKTWKEMEKLVDSGKIRSIGLSNFNIRQIQNILDHCKIKPAMLQIEVNIYFPNKKLVEFCLKNDIQVTAYCPLGGAPDRPGATEGEKRPLSDPTVLELAKKYNATPGVILISYIIHRGLICIPKSVSSARLEENIKALNIKLSDEDFQLLDNLNVNIRSCCPLMFK---------LHKNYPFDE 989
            M+ +I L++G  +P  GLGTW S PG++K ++ +AL+ GY HIDCA  Y NE+E+G  L + +  GK ++R+++FVTSKLWN  H P+ V+     +LS+LRL YLDLYLIHWP++   G+ ++P       + DD     TW  MEKLVD G  ++IGLSNFN +QI +IL   K KP + Q+E + Y    +LV  C   ++ VTAY PLG +PDRP  T GE   L DP V+ +AK YN TP  ++I + I RG++CIPKSV+ +R+++NI+  + KLSDED +L+++ N N R   P + K          H ++PF E
Sbjct:    1 MTATITLSTGQRMPTVGLGTWKSAPGQVKQAVLAALDCGYRHIDCAAAYSNEREVGEALTERLGPGKSLRRDDIFVTSKLWNTKHHPDDVEEACRRSLSDLRLSYLDLYLIHWPMAFGRGDELIPRHPDGTIQYDDTHYRDTWAAMEKLVDQGLAKAIGLSNFNAKQIDDILSIAKHKPVVNQVECHPYLVQAELVSHCWSRNLTVTAYSPLG-SPDRPWVTPGEALLLDDPRVVGIAKSYNKTPAQVIIRWHIQRGVVCIPKSVTPSRIKQNIEVFDFKLSDEDMRLIESFNRNERFIIPTVIKDGQKIWRDAKHPHFPFIE 322          
BLAST of Aldo-keto reductase vs. Ensembl Zebrafish
Match: akr1a1a (aldo-keto reductase family 1, member A1a (aldehyde reductase) [Source:NCBI gene;Acc:445326])

HSP 1 Score: 286.189 bits (731), Expect = 8.065e-95
Identity = 144/323 (44.58%), Postives = 206/323 (63.78%), Query Frame = 3
Query:   54 MSKSIKLNSGYDVPNFGLGTWLSKPGEIKASLESALNLGYNHIDCAWVYCNEKEIGGVLEDYISNGK-IKREELFVTSKLWNAFHRPELVKVGFEETLSNLRLDYLDLYLIHWPISIKPGN-ILPSADKFKDELDDVDLIKTWKEMEKLVDSGKIRSIGLSNFNIRQIQNILDHCKIKPAMLQIEVNIYFPNKKLVEFCLKNDIQVTAYCPLGGAPDRPGATEGEKRPLSDPTVLELAKKYNATPGVILISYIIHRGLICIPKSVSSARLEENIKALNIKLSDEDFQLLDNLNVNIRSCCPLMFKL---------HKNYPFDE 989
            M+ +I L++G  +P  GLGTW S PG++K ++ +AL+ GY HIDCA  Y NE+E+G  L + +  GK ++R+++FVTSKLWN  H P+ V+     +LS+LRL YLDLYLIHWP++   G+ ++P       + DD     TW  MEKLVD G  ++IGLSNFN +QI +IL   K KP + Q+E + Y    +LV  C   ++ VTAY PLG +PDRP  T GE   L DP V+ +AK YN TP  ++I + I RG++CIPKSV+ +R+++NI+  + KLSDED +L+++ N N R   P + K          H ++PF E
Sbjct:    1 MTATITLSTGQRMPTVGLGTWKSAPGQVKQAVLAALDCGYRHIDCAAAYSNEREVGEALTERLGPGKSLRRDDIFVTSKLWNTKHHPDDVEEACRRSLSDLRLSYLDLYLIHWPMAFGRGDELIPRHPDGTIQYDDTHYRDTWAAMEKLVDQGLAKAIGLSNFNAKQIDDILSIAKHKPVVNQVECHPYLVQAELVSHCWSRNLTVTAYSPLG-SPDRPWVTPGEALLLDDPRVVGIAKSYNKTPAQVIIRWHIQRGVVCIPKSVTPSRIKQNIEVFDFKLSDEDMRLIESFNRNERFIIPTVIKDGQKIWRDANHPHFPFIE 322          
BLAST of Aldo-keto reductase vs. Ensembl Zebrafish
Match: akr1b1.2 (aldo-keto reductase family 1, member B1 (aldose reductase), tandem duplicate 2 [Source:ZFIN;Acc:ZDB-GENE-041210-132])

HSP 1 Score: 251.521 bits (641), Expect = 5.056e-81
Identity = 143/321 (44.55%), Postives = 207/321 (64.49%), Query Frame = 3
Query:   42 LKLTMSKSIKLNSGYDVPNFGLGTWLSKPGEIKASLESALNLGYNHIDCAWVYCNEKEIGGVLEDYISNGKIKREELFVTSKLWNAFHRPELVKVGFEETLSNLRLDYLDLYLIHWPISIKPGN-ILPSADKFKDELDDVDLIKTWKEMEKLVDSGKIRSIGLSNFNIRQIQNILDH--CKIKPAMLQIEVNIYFPNKKLVEFCLKNDIQVTAYCPLGGAPDRPGATEGEKRPLSDPTVLELAKKYNATPGVILISYIIHRGLICIPKSVSSARLEENIKALNIKLSDEDFQLLDNLNVNIRSCCPLMFKL-HKNYPFDED 992
            L  TMSKS+KLN+G D+P  GLGTW S PG++  ++++A+  GY HID A VY NE E+G  ++  I +G +KREELFV SKLW  FH   LVK   ++TLS+L LDYLDLYLIHWP+  K G+   P   +     DD   + TW+ ME+LVD+G +++IG+SNFN  QI+ IL+    K KPA  Q+E + Y    KL+ +C    I VTAY PL G+PDRP A   +   L DP +  +A+K+  T   +LI + I R +I IPKS++  R++EN +  + +LS++D + + + N N R+ CP+ + + H++YPF+ +
Sbjct:   25 LSFTMSKSVKLNTGADMPILGLGTWKSPPGKVTEAVKAAIAAGYRHIDGAAVYNNETEVGEGIKAMIKDGVVKREELFVVSKLWCTFHEKALVKGACQKTLSDLNLDYLDLYLIHWPMGFKSGSEQFPLDSEGLTIGDDSSFLDTWEAMEELVDAGLVKAIGISNFNREQIEAILNKPGLKYKPANNQVECHPYLTQDKLISYCQSKGITVTAYSPL-GSPDRPWAKPEDPSLLDDPNIKAIAEKHKKTTAQVLIRFQIQRNVIVIPKSITPQRIQENFQVFDFELSEQDMKTILSFNRNFRA-CPMHWGVKHRDYPFNAE 343          
BLAST of Aldo-keto reductase vs. Ensembl Zebrafish
Match: akr1b1.1 (aldo-keto reductase family 1, member B1 (aldose reductase), tandem duplicate 1 [Source:ZFIN;Acc:ZDB-GENE-040625-7])

HSP 1 Score: 249.98 bits (637), Expect = 8.204e-81
Identity = 132/313 (42.17%), Postives = 197/313 (62.94%), Query Frame = 3
Query:   63 SIKLNSGYDVPNFGLGTWLSKPGEIKASLESALNLGYNHIDCAWVYCNEKEIGGVLEDYISNGKIKREELFVTSKLWNAFHRPELVKVGFEETLSNLRLDYLDLYLIHWPISIKPGNILPSADKFKDEL-DDVDLIKTWKEMEKLVDSGKIRSIGLSNFNIRQIQNILDH--CKIKPAMLQIEVNIYFPNKKLVEFCLKNDIQVTAYCPLGGAPDRPGATEGEKRPLSDPTVLELAKKYNATPGVILISYIIHRGLICIPKSVSSARLEENIKALNIKLSDEDFQLLDNLNVNIRSCCPLMFKLHKNYPFDED 992
            S+ LN+G  +P  GLGTW S PGE+  +++SA+  GY HID A VY NE E+G  +   I+ G +KR++LF+ SKLW  FH   LV+   E+TLS+L+LDY+DLYL+H+P+  KPG  L   DK    + D+ + ++TW+ ME+LVD+G +++IG+SNFN  QI+ IL+    K KPA  QIE + Y   +KL+ +C    I VTAY PL G+P+RP A   E   L DP +  +A K+  T   +LI + I R ++ IPKSV+ +R++EN +  + +LS E+   + + N N R+        HK++P + +
Sbjct:    3 SVTLNNGAKMPIVGLGTWRSPPGEVTEAVKSAILSGYRHIDGAHVYENENEVGDGICAMINQGVVKRKDLFIVSKLWCTFHEKHLVRGACEKTLSDLKLDYVDLYLMHFPMGTKPGKDLFPLDKDGHVIPDNSNFLETWEAMEELVDAGLVKAIGISNFNRDQIEAILNKPGLKYKPANNQIECHPYLTQEKLINYCQSKGITVTAYSPL-GSPNRPWAQADEPSLLEDPKIKAIADKHGKTTAQVLIHFHIQRNVVVIPKSVTPSRIKENFEVFDFELSKEEMNTILSFNRNFRAFGLEWASKHKDFPLNAE 314          
BLAST of Aldo-keto reductase vs. Ensembl Zebrafish
Match: akr1b1.1 (aldo-keto reductase family 1, member B1 (aldose reductase), tandem duplicate 1 [Source:ZFIN;Acc:ZDB-GENE-040625-7])

HSP 1 Score: 246.128 bits (627), Expect = 1.788e-79
Identity = 129/296 (43.58%), Postives = 190/296 (64.19%), Query Frame = 3
Query:   63 SIKLNSGYDVPNFGLGTWLSKPGEIKASLESALNLGYNHIDCAWVYCNEKEIGGVLEDYISNGKIKREELFVTSKLWNAFHRPELVKVGFEETLSNLRLDYLDLYLIHWPISIKPGNILPSADKFKDEL-DDVDLIKTWKEMEKLVDSGKIRSIGLSNFNIRQIQNILDH--CKIKPAMLQIEVNIYFPNKKLVEFCLKNDIQVTAYCPLGGAPDRPGATEGEKRPLSDPTVLELAKKYNATPGVILISYIIHRGLICIPKSVSSARLEENIKALNIKLSDEDFQLLDNLNVNIRS 941
            S+ LN+G  +P  GLGTW S PGE+  +++SA+  GY HID A VY NE E+G  +   I+ G +KR++LF+ SKLW  FH   LV+   E+TLS+L+LDY+DLYL+H+P+  KPG  L   DK    + D+ + ++TW+ ME+LVD+G +++IG+SNFN  QI+ IL+    K KPA  QIE + Y   +KL+ +C    I VTAY PL G+P+RP A   E   L DP +  +A K+  T   +LI + I R ++ IPKSV+ +R++EN +  + +LS E+   + + N N R+
Sbjct:    3 SVTLNNGAKMPIVGLGTWRSPPGEVTEAVKSAILSGYRHIDGAHVYENENEVGDGICAMINQGVVKRKDLFIVSKLWCTFHEKHLVRGACEKTLSDLKLDYVDLYLMHFPMGTKPGKDLFPLDKDGHVIPDNSNFLETWEAMEELVDAGLVKAIGISNFNRDQIEAILNKPGLKYKPANNQIECHPYLTQEKLINYCQSKGITVTAYSPL-GSPNRPWAQADEPSLLEDPKIKAIADKHGKTTAQVLIHFHIQRNVVVIPKSVTPSRIKENFEVFDFELSKEEMNTILSFNRNFRA 297          
BLAST of Aldo-keto reductase vs. Ensembl Xenopus
Match: akr1b1 (aldo-keto reductase family 1, member B1 (aldose reductase) [Source:NCBI gene;Acc:496546])

HSP 1 Score: 242.276 bits (617), Expect = 1.729e-77
Identity = 135/309 (43.69%), Postives = 197/309 (63.75%), Query Frame = 3
Query:   66 IKLNSGYDVPNFGLGTWLSKPGEIKASLESALNLGYNHIDCAWVYCNEKEIGGVLEDYISNGKIKREELFVTSKLWNAFHRPELVKVGFEETLSNLRLDYLDLYLIHWPISIKPGNILPSADKFKDEL-DDVDLIKTWKEMEKLVDSGKIRSIGLSNFNIRQIQNILDH--CKIKPAMLQIEVNIYFPNKKLVEFCLKNDIQVTAYCPLGGAPDRPGATEGEKRPLSDPTVLELAKKYNATPGVILISYIIHRGLICIPKSVSSARLEENIKALNIKLSDEDFQLLDNLNVNIRSCCPLMFKLHKNYPF 983
            ++L +G  +P  GLGTW S+PG++ A++  A+ +GY H+DCA+VY NE E+G  ++  I  G +KRE+LFV SKLW+ FH   +VK   ++TLS+L+LDYLDLYL+HWP   + G+ L   D     +  +   + TW+ ME+LVD+G +++IG+SNFN  QI+ +L+    K KPA+ Q E + Y   KKL++ C    I VTAY PL G+PDRP A   +   L +P + E+AKKYN T   +LI + I R ++ IPKSV+ AR+EEN +  + +LS ED + + +     R C     K HK+YPF
Sbjct:    7 VQLYTGAQMPIVGLGTWKSEPGKVTAAVAKAIEVGYRHLDCAYVYQNENEVGEGIQQKIKEGLVKREDLFVVSKLWSTFHDKSMVKGACQKTLSDLKLDYLDLYLVHWPTGFQAGDALFPLDNEGCVIHSNTHFLDTWEGMEELVDAGLVKAIGISNFNREQIEQLLNKPGLKHKPAVHQFECHPYLTQKKLIDLCQSKGIVVTAYSPL-GSPDRPWAKPEDPSLLEEPKIKEIAKKYNKTSAQVLIRFHIQRNVVVIPKSVTPARIEENFQVFDFELSPEDTEAIFSFERGWRVCALSSAKKHKDYPF 314          
BLAST of Aldo-keto reductase vs. Ensembl Xenopus
Match: tm4sf5 (transmembrane 4 L six family member 5 [Source:Xenbase;Acc:XB-GENE-969431])

HSP 1 Score: 236.113 bits (601), Expect = 4.415e-75
Identity = 125/317 (39.43%), Postives = 191/317 (60.25%), Query Frame = 3
Query:   66 IKLNSGYDVPNFGLGTWLSKPGEIKASLES-----ALNLGYNHIDCAWVYCNEKEIGGVLEDYISNGKIKREELFVTSKLWNAFHRPELVKVGFEETLSNLRLDYLDLYLIHWPISIKPGN-ILPSADKFKDELDDVDLIKTWKEMEKLVDSGKIRSIGLSNFNIRQIQNILDH--CKIKPAMLQIEVNIYFPNKKLVEFCLKNDIQVTAYCPLGGAPDRPGATEGEKRPLSDPTVLELAKKYNATPGVILISYIIHRGLICIPKSVSSARLEENIKALNIKLSDEDFQLLDNLNVNIRSCCPLMFKLHKNYPFDED 992
            + LN G+ +P  G GT++  PG++  SL       A+++GY HID A+ Y NE E+G  +   I++G +KRE++F T KLW  FH PE V+V  +++L +L+LDYLDL++IH P+  KPG+  LP  +  K    + DL  TWK +EK  D+G +RSIG+SNFN +Q++ IL+    K KP   Q+E +IY    KL+EFC   DI + AY  LG   D+    +     L +  +  +AKK+N TP  + + Y++ RG++ + KS + AR++EN K  N +L DED + +D +N ++R      +  H  YPF E+
Sbjct:    9 VVLNDGHKMPVLGFGTFV--PGKLPKSLAEEGTKVAIDVGYRHIDSAFFYGNEVEVGRAIRAKIADGTVKREDVFYTGKLWCTFHTPERVRVCLDKSLKDLQLDYLDLFIIHIPVEFKPGDDPLPVDENGKCIFHNTDLRDTWKALEKCKDAGLVRSIGVSNFNHKQLELILNMPGLKYKPVCNQVECHIYLNQSKLLEFCKSKDIVLVAYGVLGSTRDKKWIDQSTPFLLENAVLNAIAKKHNCTPAHVAMRYLLQRGVVVLAKSFNPARIKENFKVFNFQLDDEDMKTIDEINRDLRYLDITAWSDHPKYPFHEE 323          
BLAST of Aldo-keto reductase vs. Ensembl Xenopus
Match: akr1c8p (aldo-keto reductase family 1, member C8, pseudogene [Source:NCBI gene;Acc:448368])

HSP 1 Score: 233.417 bits (594), Expect = 5.014e-74
Identity = 123/325 (37.85%), Postives = 193/325 (59.38%), Query Frame = 3
Query:   42 LKLTMSKSIKLNSGYDVPNFGLGTWLSKPGEIKASLES-----ALNLGYNHIDCAWVYCNEKEIGGVLEDYISNGKIKREELFVTSKLWNAFHRPELVKVGFEETLSNLRLDYLDLYLIHWPISIKPG-NILPSADKFKDELDDVDLIKTWKEMEKLVDSGKIRSIGLSNFNIRQIQNILDH--CKIKPAMLQIEVNIYFPNKKLVEFCLKNDIQVTAYCPLGGAPDRPGATEGEKRPLSDPTVLELAKKYNATPGVILISYIIHRGLICIPKSVSSARLEENIKALNIKLSDEDFQLLDNLNVNIRSCCPLMFKLHKNYPFDED 992
            + L     I+LN G+ +P  G GT+   P +   SL       A+++GY HID A+ Y NE E+G  +   I++G +KRE++F T KLW+ FH PE V+   E++L++L+LDY+DL++IH P+ +KPG + LP  +  K    + D+  TWK +EK  D+G +RSIG+SNFN +Q++ IL+    K KP   Q+E ++Y    KL+EFC   DI + A+  LG + D           L DP +  +AKK+N TP  + + Y++ RG++ + KS + AR+++N +  N+ L  ED + +D +N N+R     M+  H  YPF E+
Sbjct:    1 MALHKDSCIELNDGHKMPVLGFGTY--APQKFPKSLAEEGTKVAIDVGYRHIDSAFFYGNEVEVGRAIRAKIADGTVKREDVFYTGKLWSTFHTPERVRPALEKSLNDLQLDYMDLFIIHIPVELKPGDDPLPLDENGKFIYHNTDIRDTWKALEKCKDAGLVRSIGVSNFNHKQLELILNMPGLKYKPVCNQVECHVYLNQSKLLEFCKSKDIVLVAFGVLGSSRDESWIDPNLPVLLEDPVLNAIAKKHNCTPAQVAMRYLLQRGVVVLVKSFTPARIQQNFQVFNVHLDAEDMRNVDGINRNLRYDYAPMWSDHPKYPFHEE 323          
BLAST of Aldo-keto reductase vs. Ensembl Xenopus
Match: akr1c2 (aldo-keto reductase family 1, member C2 [Source:NCBI gene;Acc:779650])

HSP 1 Score: 233.032 bits (593), Expect = 8.150e-74
Identity = 123/323 (38.08%), Postives = 188/323 (58.20%), Query Frame = 3
Query:   42 LKLTMSKSIKLNSGYDVPNFGLGTWLSK--PGEI-KASLESALNLGYNHIDCAWVYCNEKEIGGVLEDYISNGKIKREELFVTSKLWNAFHRPELVKVGFEETLSNLRLDYLDLYLIHWPISIKP-GNILPSADKFKDELDDVDLIKTWKEMEKLVDSGKIRSIGLSNFNIRQIQNILDH--CKIKPAMLQIEVNIYFPNKKLVEFCLKNDIQVTAYCPLGGAPDRPGATEGEKRPLSDPTVLELAKKYNATPGVILISYIIHRGLICIPKSVSSARLEENIKALNIKLSDEDFQLLDNLNVNIRSCCPLMFKLHKNYPFDED 992
            + L     + LN G  +P  G GT+  +  P  + +   + A+++GY HID A++Y NE E+G  +   I++G +KRE+LF T KLW++FH PE V+ GFE++L +L+LDY+DL++IH P+  KP  N  P  +  K    + DL  TWK ME L D G ++SIG+SNFN RQ++ IL     K KP   Q+E +IY    KL+EFC   DI +  Y  LG + D     +     L DP +  +AKK N TP  + + Y++ RG++ + KS + AR+++N +  + +L+ E+ + LD +N N+R         H  YPF +D
Sbjct:    1 MALHKDSYVLLNDGNRMPVIGYGTYAPQNVPKHLAEEGAKVAIDVGYRHIDSAFMYLNEAEVGRAINAKIADGTVKREDLFYTGKLWSSFHTPERVRQGFEKSLKDLQLDYMDLFIIHLPVEFKPEDNPFPVDENGKFLYHNTDLRDTWKAMEALKDEGLVKSIGVSNFNKRQLELILSMPGLKYKPVCNQVECHIYLNQSKLLEFCKSKDIVLVGYSVLGSSRDEQWIDQNSPVVLEDPVLNAIAKKLNRTPAQVAMRYLLQRGVVILAKSFTPARIQQNFQIFDFQLNAEEMKTLDGVNKNLRYLDLKQLADHPKYPFADD 323          
BLAST of Aldo-keto reductase vs. Ensembl Xenopus
Match: nudt2 (nudix hydrolase 2 [Source:Xenbase;Acc:XB-GENE-1008721])

HSP 1 Score: 228.794 bits (582), Expect = 1.542e-72
Identity = 112/282 (39.72%), Postives = 176/282 (62.41%), Query Frame = 3
Query:  156 ALNLGYNHIDCAWVYCNEKEIGGVLEDYISNGKIKREELFVTSKLWNAFHRPELVKVGFEETLSNLRLDYLDLYLIHWPISIKPG-NILPSADKFKDELDDVDLIKTWKEMEKLVDSGKIRSIGLSNFNIRQIQNILDH--CKIKPAMLQIEVNIYFPNKKLVEFCLKNDIQVTAYCPLGGAPDRPGATEGEKRPLSDPTVLELAKKYNATPGVILISYIIHRGLICIPKSVSSARLEENIKALNIKLSDEDFQLLDNLNVNIRSCCPLMFKLHKNYPFDED 992
            A+++GY HIDCA++Y +E E+G  +   I++G +KRE++F T KLW+ FH PE V+V  E++L +L+LDY+DL++IH P+  KPG ++ P+ +  K    + DL  TWK +EK  D+G +RSIG+SNFN +Q++ IL+    K KP   Q+E ++Y    KL+EFC   DI +  Y  LG + D           L DPT+ E+AKK+N TP  + + Y + RG++ + KS + AR+++N +  + +L  ED + +D LN N+R      +  H  YP+ E+
Sbjct:   15 AIDVGYRHIDCAFIYGSEVEVGRAIGAKIADGTVKREDVFYTGKLWSTFHTPERVRVCLEKSLKDLQLDYMDLFIIHNPMEFKPGDDLFPADENGKFIYHNTDLRDTWKALEKCKDAGLVRSIGVSNFNHKQLELILNMPGLKYKPVCNQVECHVYLNQSKLLEFCKSKDIVLVGYSVLGSSRDERWIEASAPVLLEDPTLTEIAKKHNRTPAQVAMRYHLQRGVVVLAKSFTPARIQQNFQVFDFQLDAEDMRSIDGLNRNMRYIDTSRWSDHPKYPYSEE 296          
BLAST of Aldo-keto reductase vs. Ensembl Mouse
Match: Akr1a1 (aldo-keto reductase family 1, member A1 (aldehyde reductase) [Source:MGI Symbol;Acc:MGI:1929955])

HSP 1 Score: 262.307 bits (669), Expect = 2.214e-85
Identity = 133/312 (42.63%), Postives = 196/312 (62.82%), Query Frame = 3
Query:   57 SKSIKLNSGYDVPNFGLGTWLSKPGEIKASLESALNLGYNHIDCAWVYCNEKEIGGVLEDYISNGK-IKREELFVTSKLWNAFHRPELVKVGFEETLSNLRLDYLDLYLIHWPISIKPG-NILPSADKFKDELDDVDLIKTWKEMEKLVDSGKIRSIGLSNFNIRQIQNILDHCKIKPAMLQIEVNIYFPNKKLVEFCLKNDIQVTAYCPLGGAPDRPGATEGEKRPLSDPTVLELAKKYNATPGVILISYIIHRGLICIPKSVSSARLEENIKALNIKLSDEDFQLLDNLNVNIRSCCPLMFKLHKNYPFD 986
            + S+ L++G  +P  GLGTW S+PG++KA+++ AL+ GY HIDCA VY NE EIG  L++ + +GK + REELFVTSKLWN  H PE V+    +TL++L+L+YLDLYL+HWP + + G N  P         D     +TWK +E LV  G ++++GLSNFN RQI ++L    ++PA+LQ+E + Y    +L+  C    ++VTAY PLG + DR      E   L +P VL LA+K+  +P  IL+ + + R +ICIPKS++ +R+ +NI+  +   S E+ + LD LN N R   P++    K  P D
Sbjct:    3 ASSVLLHTGQKMPLIGLGTWKSEPGQVKAAIKHALSAGYRHIDCASVYGNETEIGEALKESVGSGKAVPREELFVTSKLWNTKHHPEDVEPALRKTLADLQLEYLDLYLMHWPYAFERGDNPFPKNADGTVRYDSTHYKETWKALEVLVAKGLVKALGLSNFNSRQIDDVLSVASVRPAVLQVECHPYLAQNELIAHCHARGLEVTAYSPLGSS-DRAWRHPDEPVLLEEPVVLALAEKHGRSPAQILLRWQVQRKVICIPKSINPSRILQNIQVFDFTFSPEEMKQLDALNKNWRYIVPMITVDGKRVPRD 313          
BLAST of Aldo-keto reductase vs. Ensembl Mouse
Match: Akr1b3 (aldo-keto reductase family 1, member B3 (aldose reductase) [Source:MGI Symbol;Acc:MGI:1353494])

HSP 1 Score: 258.07 bits (658), Expect = 8.174e-84
Identity = 145/325 (44.62%), Postives = 202/325 (62.15%), Query Frame = 3
Query:   54 MSKSIKLNSGYDVPNFGLGTWLSKPGEIKASLESALNLGYNHIDCAWVYCNEKEIGGVLEDYISNGKIKREELFVTSKLWNAFHRPELVKVGFEETLSNLRLDYLDLYLIHWPISIKP----------GNILPSADKFKDELDDVDLIKTWKEMEKLVDSGKIRSIGLSNFNIRQIQNILDH--CKIKPAMLQIEVNIYFPNKKLVEFCLKNDIQVTAYCPLGGAPDRPGATEGEKRPLSDPTVLELAKKYNATPGVILISYIIHRGLICIPKSVSSARLEENIKALNIKLSDEDFQLLDNLNVNIRSCCPLMFKLHKNYPFDED 992
            M+  ++LN+G  +P  GLGTW S PG++  +++ A++LGY HIDCA VY NEKE+G  L++ +    +KR++LF+ SKLW  FH   +VK  F++TLS+L+LDYLDLYLIHWP   KP          GN++PS         D D + TW  ME+LVD G +++IG+SNFN  QI+ IL+    K KPA+ QIE + Y   +KL+E+C    I VTAY PL G+PDRP A   +   L DP +  +A KYN T   +LI + I R L+ IPKSV+  R+ EN+K  + ++S ED   L + N N R C  +    HK+YPF  +
Sbjct:    1 MASHLELNNGTKMPTLGLGTWKSPPGQVTEAVKVAIDLGYRHIDCAQVYQNEKEVGVALQEKLKEQVVKRQDLFIVSKLWCTFHDKSMVKGAFQKTLSDLQLDYLDLYLIHWPTGFKPGPDYFPLDASGNVIPS---------DTDFVDTWTAMEQLVDEGLVKTIGVSNFNPLQIERILNKPGLKYKPAVNQIECHPYLTQEKLIEYCHSKGIVVTAYSPL-GSPDRPWAKPEDPSLLEDPRIKAIAAKYNKTTAQVLIRFPIQRNLVVIPKSVTPVRIAENLKVFDFEVSSEDMATLLSYNRNWRVCALMSCAKHKDYPFHAE 315          
BLAST of Aldo-keto reductase vs. Ensembl Mouse
Match: Akr1c18 (aldo-keto reductase family 1, member C18 [Source:MGI Symbol;Acc:MGI:2145420])

HSP 1 Score: 256.144 bits (653), Expect = 5.453e-83
Identity = 132/314 (42.04%), Postives = 196/314 (62.42%), Query Frame = 3
Query:   60 KSIKLNSGYDVPNFGLGTWLSKPGEIKASLES---ALNLGYNHIDCAWVYCNEKEIGGVLEDYISNGKIKREELFVTSKLWNAFHRPELVKVGFEETLSNLRLDYLDLYLIHWPISIKPGN-ILPSADKFKDELDDVDLIKTWKEMEKLVDSGKIRSIGLSNFNIRQIQNILDH--CKIKPAMLQIEVNIYFPNKKLVEFCLKNDIQVTAYCPLGGAPDRPGATEGEKRPLSDPTVLELAKKYNATPGVILISYIIHRGLICIPKSVSSARLEENIKALNIKLSDEDFQLLDNLNVNIRSCCPLMFKLHKNYPF 983
            + I+LN G+ +P  G GT+ ++    K S+ES   A+++G+ HIDC+ +Y NE+EIG  +   I +G +KRE++F TSKLW+  HRPELV+   E +L  L LDY+DLYLIH+P+S+KPGN +LP  +      D VDL  TW+ MEK  D+G  +SIG+SNFN RQ++ IL+    K KP   Q+E ++Y    KL+ +C  NDI + AY  LG    +    E     L DP +  +AKKY  TP +I + Y + RG++ + KS +  R+ EN++  + +L+ +D ++LD L+ N+R     MFK H N+PF
Sbjct:    6 QKIELNDGHSIPVLGFGTYATEEHLKKKSMESTKIAIDVGFCHIDCSHLYQNEEEIGQAILSKIEDGTVKREDIFYTSKLWSTSHRPELVRPSLENSLRKLNLDYVDLYLIHFPVSLKPGNELLPKDEHGNLIFDTVDLCDTWEAMEKCKDAGLAKSIGVSNFNRRQLEMILNKPGLKYKPVCNQVECHLYLNQSKLLAYCKMNDIVLVAYGALGTQRYKYCINEDTPVLLDDPVLCAMAKKYKRTPALIALRYQLDRGIVALAKSFNEERIRENMQVFDFQLASDDMKILDGLDRNLRYFPADMFKAHPNFPF 319          
BLAST of Aldo-keto reductase vs. Ensembl Mouse
Match: Akr1c6 (aldo-keto reductase family 1, member C6 [Source:MGI Symbol;Acc:MGI:1933427])

HSP 1 Score: 253.447 bits (646), Expect = 5.970e-82
Identity = 130/319 (40.75%), Postives = 198/319 (62.07%), Query Frame = 3
Query:   51 TMSKSIKLNSGYDVPNFGLGTWLSKPGEIKASLES-----ALNLGYNHIDCAWVYCNEKEIGGVLEDYISNGKIKREELFVTSKLWNAFHRPELVKVGFEETLSNLRLDYLDLYLIHWPISIKPG-NILPSADKFKDELDDVDLIKTWKEMEKLVDSGKIRSIGLSNFNIRQIQNILDH--CKIKPAMLQIEVNIYFPNKKLVEFCLKNDIQVTAYCPLGGAPDRPGATEGEKRPLSDPTVLELAKKYNATPGVILISYIIHRGLICIPKSVSSARLEENIKALNIKLSDEDFQLLDNLNVNIRSCCPLMFKLHKNYPF 983
            +  ++++L+ G+ +P  G GT+   P E+  S  +     A++ G+ HID A +Y NEKE+G  +   I++G +KRE++F TSK+W  FHRPELV+V  E++L  L+LDY+DLYLIH+P+++KPG N LP  +  K   D VD+  TW+ MEK  D+G  +SIG+SNFN RQ++ IL     K KP   Q+E + Y    KL++FC   DI + AY  LG   ++    +     L +P +  +AKKYN TP +I + Y + RG++ + KS S  R++EN++    +L+ ED ++LD+LN NIR      FK H ++PF
Sbjct:    3 SKQQTVRLSDGHFIPILGFGTY--APQEVPKSKATEATKIAIDAGFRHIDSASMYQNEKEVGLAIRSKIADGTVKREDIFYTSKVWCTFHRPELVRVCLEQSLKQLQLDYVDLYLIHFPMAMKPGENYLPKDENGKLIYDAVDICDTWEAMEKCKDAGLAKSIGVSNFNRRQLEKILKKPGLKYKPVCNQVECHPYLNQGKLLDFCRSKDIVLVAYSALGSHREKQWVDQSSPVLLDNPVLGSMAKKYNRTPALIALRYQLQRGVVVLAKSFSEKRIKENMQVFEFQLTSEDMKVLDDLNKNIRYISGSSFKDHPDFPF 319          
BLAST of Aldo-keto reductase vs. Ensembl Mouse
Match: Akr1c20 (aldo-keto reductase family 1, member C20 [Source:MGI Symbol;Acc:MGI:2151104])

HSP 1 Score: 248.44 bits (633), Expect = 5.388e-80
Identity = 130/319 (40.75%), Postives = 193/319 (60.50%), Query Frame = 3
Query:   51 TMSKSIKLNSGYDVPNFGLGTWLSKPGEIKASLES-----ALNLGYNHIDCAWVYCNEKEIGGVLEDYISNGKIKREELFVTSKLWNAFHRPELVKVGFEETLSNLRLDYLDLYLIHWPISIKPG-NILPSADKFKDELDDVDLIKTWKEMEKLVDSGKIRSIGLSNFNIRQIQNILDH--CKIKPAMLQIEVNIYFPNKKLVEFCLKNDIQVTAYCPLGGAPDRPGATEGEKRPLSDPTVLELAKKYNATPGVILISYIIHRGLICIPKSVSSARLEENIKALNIKLSDEDFQLLDNLNVNIRSCCPLMFKLHKNYPF 983
            +  +++ LN G+ +P  G GT  S P E+  S  +     A++ G+ HIDCA VY NEKE+G  +   I +G +KRE++F TSK+W  FHRPELV+V  E++L  L+LDY+DLYLIH+PI++KPG N  P  +  K   D VD+  TW+ MEK  D+G  +SIG+ NFN RQ++ IL     K KP   Q+E + Y   +KL++FC   DI + A+  LG   D+    +     L DP +  +AKKYN TP +I + Y + RG++ + KS    R++EN++    +L+  D ++LD LN NIR     + + H ++PF
Sbjct:    3 SKQQTVLLNDGHFIPILGFGT--SAPQEVPRSKATEATKIAIDAGFRHIDCAAVYQNEKEVGLAIRSKIVDGTVKREDIFCTSKVWQTFHRPELVQVCLEQSLKQLQLDYVDLYLIHFPIAMKPGENYFPKDENGKFIYDAVDICDTWEAMEKCKDAGLAKSIGVCNFNRRQLEKILSKPGLKYKPVCNQVECHPYLNQRKLLDFCRSKDIVLVAHSALGSNRDKEWVDKSFPVLLDDPVLGSMAKKYNRTPALIALRYQVQRGVVVLAKSFIEKRIKENMQVFEFQLTSVDMKVLDGLNKNIRYIGSSISEDHPDFPF 319          
BLAST of Aldo-keto reductase vs. UniProt/SwissProt
Match: sp|Q6AZW2|A1A1A_DANRE (Aldo-keto reductase family 1 member A1-A OS=Danio rerio OX=7955 GN=akr1a1a PE=2 SV=2)

HSP 1 Score: 286.574 bits (732), Expect = 3.986e-94
Identity = 144/323 (44.58%), Postives = 206/323 (63.78%), Query Frame = 3
Query:   54 MSKSIKLNSGYDVPNFGLGTWLSKPGEIKASLESALNLGYNHIDCAWVYCNEKEIGGVLEDYISNGK-IKREELFVTSKLWNAFHRPELVKVGFEETLSNLRLDYLDLYLIHWPISIKPGN-ILPSADKFKDELDDVDLIKTWKEMEKLVDSGKIRSIGLSNFNIRQIQNILDHCKIKPAMLQIEVNIYFPNKKLVEFCLKNDIQVTAYCPLGGAPDRPGATEGEKRPLSDPTVLELAKKYNATPGVILISYIIHRGLICIPKSVSSARLEENIKALNIKLSDEDFQLLDNLNVNIRSCCPLMFK---------LHKNYPFDE 989
            M+ +I L++G  +P  GLGTW S PG++K ++ +AL+ GY HIDCA  Y NE+E+G  L + +  GK ++R+++FVTSKLWN  H P+ V+     +LS+LRL YLDLYLIHWP++   G+ ++P       + DD     TW  MEKLVD G  ++IGLSNFN +QI +IL   K KP + Q+E + Y    +LV  C   ++ VTAY PLG +PDRP  T GE   L DP V+ +AK YN TP  ++I + I RG++CIPKSV+ +R+++NI+  + KLSDED +L+++ N N R   P + K          H ++PF E
Sbjct:    1 MTATITLSTGQRMPTVGLGTWKSAPGQVKQAVLAALDCGYRHIDCAAAYSNEREVGEALTERLGPGKSLRRDDIFVTSKLWNTKHHPDDVEEACRRSLSDLRLSYLDLYLIHWPMAFGRGDELIPRHPDGTIQYDDTHYRDTWAAMEKLVDQGLAKAIGLSNFNAKQIDDILSIAKHKPVVNQVECHPYLVQAELVSHCWSRNLTVTAYSPLG-SPDRPWVTPGEALLLDDPRVVGIAKSYNKTPAQVIIRWHIQRGVVCIPKSVTPSRIKQNIEVFDFKLSDEDMRLIESFNRNERFIIPTVIKDGQKIWRDAKHPHFPFIE 322          
BLAST of Aldo-keto reductase vs. UniProt/SwissProt
Match: sp|O70473|AK1A1_CRIGR (Aldo-keto reductase family 1 member A1 OS=Cricetulus griseus OX=10029 GN=AKR1A1 PE=2 SV=2)

HSP 1 Score: 263.462 bits (672), Expect = 4.557e-85
Identity = 133/313 (42.49%), Postives = 197/313 (62.94%), Query Frame = 3
Query:   54 MSKSIKLNSGYDVPNFGLGTWLSKPGEIKASLESALNLGYNHIDCAWVYCNEKEIGGVLEDYISNGK-IKREELFVTSKLWNAFHRPELVKVGFEETLSNLRLDYLDLYLIHWPISIKPG-NILPSADKFKDELDDVDLIKTWKEMEKLVDSGKIRSIGLSNFNIRQIQNILDHCKIKPAMLQIEVNIYFPNKKLVEFCLKNDIQVTAYCPLGGAPDRPGATEGEKRPLSDPTVLELAKKYNATPGVILISYIIHRGLICIPKSVSSARLEENIKALNIKLSDEDFQLLDNLNVNIRSCCPLMFKLHKNYPFD 986
            M+  + L++G  +P  GLGTW S PG++KA+++ AL++GY HIDCA VY NE EIG  L++ +  GK + REELFVTSKLWN  H PE V+    +TL++L+L+YLDLYL+HWP + + G N  P  D      D     +TWK +E LV  G ++++GLSNFN RQI +IL    ++PA+LQ+E + Y    +L+  C    ++VTAY PLG + DR      E   L +P VL LA+K+  +P  IL+ + + R ++CIPKS++ +R+ +NI+  +   S E+ + LD LN + R   P++    K+ P D
Sbjct:    1 MASCVLLHTGQKMPLIGLGTWKSNPGQVKAAIKYALSVGYRHIDCAAVYGNEIEIGEALKENVGPGKAVPREELFVTSKLWNTKHHPEDVEAALRKTLADLQLEYLDLYLMHWPYAFERGDNPFPKNDDGTIRYDSTHYKETWKALEALVAKGLVKALGLSNFNSRQIDDILSVASVRPAVLQVECHPYLAQNELIAHCQARGLEVTAYSPLGSS-DRAWRHPDEPVLLEEPVVLALAEKHGRSPAQILLRWQVQRKVVCIPKSITPSRILQNIQVFDFTFSPEEMKQLDALNKHWRYIVPMITVDGKSVPRD 312          
BLAST of Aldo-keto reductase vs. UniProt/SwissProt
Match: sp|P50578|AK1A1_PIG (Aldo-keto reductase family 1 member A1 OS=Sus scrofa OX=9823 GN=AKR1A1 PE=1 SV=3)

HSP 1 Score: 263.077 bits (671), Expect = 7.022e-85
Identity = 133/312 (42.63%), Postives = 194/312 (62.18%), Query Frame = 3
Query:   57 SKSIKLNSGYDVPNFGLGTWLSKPGEIKASLESALNLGYNHIDCAWVYCNEKEIGGVLEDYISNGK-IKREELFVTSKLWNAFHRPELVKVGFEETLSNLRLDYLDLYLIHWPISIKPG-NILPSADKFKDELDDVDLIKTWKEMEKLVDSGKIRSIGLSNFNIRQIQNILDHCKIKPAMLQIEVNIYFPNKKLVEFCLKNDIQVTAYCPLGGAPDRPGATEGEKRPLSDPTVLELAKKYNATPGVILISYIIHRGLICIPKSVSSARLEENIKALNIKLSDEDFQLLDNLNVNIRSCCPLMFKLHKNYPFD 986
            +  + L++G  +P  GLGTW S+PG++KA+++ AL +GY HIDCA +Y NE EIG  L++ +  GK + REELFVTSKLWN  H PE V+    +TL++L+L+YLDLYL+HWP + + G N  P         D      TWK +E LV  G +R++GLSNF+ RQI ++L    ++PA+LQ+E + Y    +L+  C    ++VTAY PLG + DR      E   L +P V  LA+KYN +P  IL+ + + R +ICIPKSV+ +R+ +NI+  +   S E+ + LD LN N+R   P++    K  P D
Sbjct:    3 ASCVLLHTGQKMPLIGLGTWKSEPGQVKAAIKYALTVGYRHIDCAAIYGNELEIGEALQETVGPGKAVPREELFVTSKLWNTKHHPEDVEPALRKTLADLQLEYLDLYLMHWPYAFERGDNPFPKNADGTIRYDATHYKDTWKALEALVAKGLVRALGLSNFSSRQIDDVLSVASVRPAVLQVECHPYLAQNELIAHCQARGLEVTAYSPLGSS-DRAWRDPNEPVLLEEPVVQALAEKYNRSPAQILLRWQVQRKVICIPKSVTPSRILQNIQVFDFTFSPEEMKQLDALNKNLRFIVPMLTVDGKRVPRD 313          
BLAST of Aldo-keto reductase vs. UniProt/SwissProt
Match: sp|Q9JII6|AK1A1_MOUSE (Aldo-keto reductase family 1 member A1 OS=Mus musculus OX=10090 GN=Akr1a1 PE=1 SV=3)

HSP 1 Score: 262.307 bits (669), Expect = 1.549e-84
Identity = 133/312 (42.63%), Postives = 196/312 (62.82%), Query Frame = 3
Query:   57 SKSIKLNSGYDVPNFGLGTWLSKPGEIKASLESALNLGYNHIDCAWVYCNEKEIGGVLEDYISNGK-IKREELFVTSKLWNAFHRPELVKVGFEETLSNLRLDYLDLYLIHWPISIKPG-NILPSADKFKDELDDVDLIKTWKEMEKLVDSGKIRSIGLSNFNIRQIQNILDHCKIKPAMLQIEVNIYFPNKKLVEFCLKNDIQVTAYCPLGGAPDRPGATEGEKRPLSDPTVLELAKKYNATPGVILISYIIHRGLICIPKSVSSARLEENIKALNIKLSDEDFQLLDNLNVNIRSCCPLMFKLHKNYPFD 986
            + S+ L++G  +P  GLGTW S+PG++KA+++ AL+ GY HIDCA VY NE EIG  L++ + +GK + REELFVTSKLWN  H PE V+    +TL++L+L+YLDLYL+HWP + + G N  P         D     +TWK +E LV  G ++++GLSNFN RQI ++L    ++PA+LQ+E + Y    +L+  C    ++VTAY PLG + DR      E   L +P VL LA+K+  +P  IL+ + + R +ICIPKS++ +R+ +NI+  +   S E+ + LD LN N R   P++    K  P D
Sbjct:    3 ASSVLLHTGQKMPLIGLGTWKSEPGQVKAAIKHALSAGYRHIDCASVYGNETEIGEALKESVGSGKAVPREELFVTSKLWNTKHHPEDVEPALRKTLADLQLEYLDLYLMHWPYAFERGDNPFPKNADGTVRYDSTHYKETWKALEVLVAKGLVKALGLSNFNSRQIDDVLSVASVRPAVLQVECHPYLAQNELIAHCHARGLEVTAYSPLGSS-DRAWRHPDEPVLLEEPVVLALAEKHGRSPAQILLRWQVQRKVICIPKSINPSRILQNIQVFDFTFSPEEMKQLDALNKNWRYIVPMITVDGKRVPRD 313          
BLAST of Aldo-keto reductase vs. UniProt/SwissProt
Match: sp|P51635|AK1A1_RAT (Aldo-keto reductase family 1 member A1 OS=Rattus norvegicus OX=10116 GN=Akr1a1 PE=1 SV=2)

HSP 1 Score: 261.536 bits (667), Expect = 2.578e-84
Identity = 132/312 (42.31%), Postives = 197/312 (63.14%), Query Frame = 3
Query:   57 SKSIKLNSGYDVPNFGLGTWLSKPGEIKASLESALNLGYNHIDCAWVYCNEKEIGGVLEDYISNGK-IKREELFVTSKLWNAFHRPELVKVGFEETLSNLRLDYLDLYLIHWPISIKPG-NILPSADKFKDELDDVDLIKTWKEMEKLVDSGKIRSIGLSNFNIRQIQNILDHCKIKPAMLQIEVNIYFPNKKLVEFCLKNDIQVTAYCPLGGAPDRPGATEGEKRPLSDPTVLELAKKYNATPGVILISYIIHRGLICIPKSVSSARLEENIKALNIKLSDEDFQLLDNLNVNIRSCCPLMFKLHKNYPFD 986
            + S+ L++G  +P  GLGTW S+PG++KA+++ AL++GY HIDCA VY NE EIG  L++ +  GK + REELFVTSKLWN  H PE V+    +TL++L+L+YLDLYL+HWP + + G N  P       + D     +TWK +E LV  G ++++GLSNF+ RQI ++L    ++PA+LQ+E + Y    +L+  C    ++VTAY PLG + DR      E   L +P VL LA+K+  +P  IL+ + + R +ICIPKS++ +R+ +NI+  +   S E+ + LD LN N R   P++    K  P D
Sbjct:    3 ASSVLLHTGQKMPLIGLGTWKSEPGQVKAAIKYALSVGYRHIDCASVYGNETEIGEALKESVGAGKAVPREELFVTSKLWNTKHHPEDVEPAVRKTLADLQLEYLDLYLMHWPYAFERGDNPFPKNADGTVKYDSTHYKETWKALEALVAKGLVKALGLSNFSSRQIDDVLSVASVRPAVLQVECHPYLAQNELIAHCQARGLEVTAYSPLGSS-DRAWRHPDEPVLLEEPVVLALAEKHGRSPAQILLRWQVQRKVICIPKSITPSRILQNIQVFDFTFSPEEMKQLDALNKNWRYIVPMITVDGKRVPRD 313          
BLAST of Aldo-keto reductase vs. TrEMBL
Match: A0A0A9W9J7 (Aldose reductase OS=Lygus hesperus OX=30085 GN=AKR1B1_1 PE=4 SV=1)

HSP 1 Score: 317.775 bits (813), Expect = 6.517e-104
Identity = 157/310 (50.65%), Postives = 207/310 (66.77%), Query Frame = 3
Query:   63 SIKLNSGYDVPNFGLGTWLSKPGEIKASLESALNLGYNHIDCAWVYCNEKEIGGVLEDYISNGKIKREELFVTSKLWNAFHRPELVKVGFEETLSNLRLDYLDLYLIHWPISIKPG-NILPSADKFKDELDDVDLIKTWKEMEKLVDSGKIRSIGLSNFNIRQIQNILDHCKIKPAMLQIEVNIYFPNKKLVEFCLKNDIQVTAYCPLGGAPDRPGATEGEKRPLSDPTVLELAKKYNATPGVILISYIIHRGLICIPKSVSSARLEENIKALNIKLSDEDFQLLDNLN--VNIRSCCPLMFKLHKNYPF 983
            S+KLNSG+++P FGLGTW SKPGE+ A+++ A++ GY H DCA +Y NEKEIG  L+D I +G + REELF+TSKLWN FHR +LV+   E TLSNL+LDY+DLYLIHWP+  K    + P     K +  DVD + TWKE+E     GKIRSIGLSNFN  QIQ ++    IKPA+LQ+E + Y P KKL+EFC   +I VTAY PL G+PDRP A  G+   L +P +  +A +Y    G +LI Y I RG+I IPKS + +R++ NI+  +  LSD+D + L+ L+  VN R         H +YPF
Sbjct:    8 SVKLNSGFEIPIFGLGTWKSKPGEVGAAVKDAIDAGYRHFDCAHIYGNEKEIGTALQDKIQDGTVTREELFITSKLWNTFHRKDLVRGAIETTLSNLQLDYIDLYLIHWPMGYKEDVELFPRDANGKVQYSDVDYVDTWKEIEAACRDGKIRSIGLSNFNKNQIQRVIGVADIKPAVLQVECHPYLPQKKLIEFCKSQEIAVTAYSPL-GSPDRPMAKPGDPELLKEPVLATIADQYGKGVGHVLIRYQIQRGVIVIPKSTNKSRIQSNIEVFDFTLSDDDMKTLNGLDKGVNGRMVALKDISDHPHYPF 316          
BLAST of Aldo-keto reductase vs. TrEMBL
Match: Q5DD64 (Aldo-keto reductase family 1 member B10 isoform 2 OS=Schistosoma japonicum OX=6182 GN=Akr1b4 PE=1 SV=1)

HSP 1 Score: 316.62 bits (810), Expect = 1.232e-103
Identity = 155/310 (50.00%), Postives = 215/310 (69.35%), Query Frame = 3
Query:   66 IKLNSGYDVPNFGLGTWLSKPGEIKASLESALNLGYNHIDCAWVYCNEKEIGGVLEDYISNGKIKREELFVTSKLWNAFHRPELVKVGFEETLSNLRLDYLDLYLIHWPISIKP-GNILPSADKFKDELDDVDLIKTWKEMEKLVDSGKIRSIGLSNFNIRQIQNILDHCKIKPAMLQIEVNIYFPNKKLVEFCLKNDIQVTAYCPLGGAPDRPGATEGEKRPLSDPTVLELAKKYNATPGVILISYIIHRGLICIPKSVSSARLEENIKALNIKLSDEDFQLLDNLNVNIRSCCPLMFKLHKNYPFDED 992
            +K+N+G  +P  GLGTW S PGE+ A+++ AL +GY H+DCA+VY NE EIG  LE+ +++ ++KRE++F+TSKLWN F RPE V+   EETL NLRL+YLDLYLIHWP+ +K  G++ P+    +  LD+V    TWKEMEKLVD G ++SIGLSNFN RQIQNIL+HC+IKPA LQIE++  FPN KLVE+     + VTAY PLG     P  + G+   L+ P VLE+A ++  TP  +L+ Y++ R LI +PKSV+  R+EEN +  + +LS+E+   L+  ++N R    L    H+ YPF E+
Sbjct:    4 LKMNNGRSIPVIGLGTWNSPPGEVGAAVKKALEIGYRHLDCAYVYRNEAEIGEALENALNSLRLKREDIFITSKLWNTFFRPEHVRKACEETLKNLRLNYLDLYLIHWPVPLKHGGDLFPTDSNGQLCLDNVPHEDTWKEMEKLVDEGLVKSIGLSNFNKRQIQNILEHCRIKPANLQIEIHANFPNIKLVEYAQSVGLTVTAYAPLGS----PAHSPGKVNLLTKPCVLEIAHRHKKTPAQVLLRYLLQRKLIVVPKSVTFKRIEENFQVFDFQLSNEEMHELNTESLNERQFTLLQMSGHQEYPFKEE 309          
BLAST of Aldo-keto reductase vs. TrEMBL
Match: C1LRF3 (Aldo-keto reductase family 1, member B4 (Aldose reductase) OS=Schistosoma japonicum OX=6182 GN=Akr1b4 PE=2 SV=1)

HSP 1 Score: 316.235 bits (809), Expect = 2.010e-103
Identity = 155/310 (50.00%), Postives = 215/310 (69.35%), Query Frame = 3
Query:   66 IKLNSGYDVPNFGLGTWLSKPGEIKASLESALNLGYNHIDCAWVYCNEKEIGGVLEDYISNGKIKREELFVTSKLWNAFHRPELVKVGFEETLSNLRLDYLDLYLIHWPISIKP-GNILPSADKFKDELDDVDLIKTWKEMEKLVDSGKIRSIGLSNFNIRQIQNILDHCKIKPAMLQIEVNIYFPNKKLVEFCLKNDIQVTAYCPLGGAPDRPGATEGEKRPLSDPTVLELAKKYNATPGVILISYIIHRGLICIPKSVSSARLEENIKALNIKLSDEDFQLLDNLNVNIRSCCPLMFKLHKNYPFDED 992
            +K+N+G  +P  GLGTW S PGE+ A+++ AL +GY H+DCA+VY NE EIG  LE+ +++ ++KRE++F+TSKLWN F RPE V+   EETL NLRL+YLDLYLIHWP+ +K  G++ P+    +  LD+V    TWKEMEKLVD G ++SIGLSNFN RQIQNIL+HC+IKPA LQIE++  FPN KLVE+     + VTAY PLG     P  + G+   L+ P VLE+A ++  TP  +L+ Y++ R LI +PKSV+  R+EEN +  + +LS+E+   L+  ++N R    L    H+ YPF E+
Sbjct:    4 LKMNNGRSIPVIGLGTWNSPPGEVGAAVKKALEIGYRHLDCAYVYRNEAEIGEALENALNSLRLKREDIFITSKLWNTFFRPEHVRKACEETLKNLRLNYLDLYLIHWPVPLKHGGDLFPTDSNGQLCLDNVPHEDTWKEMEKLVDEGLVKSIGLSNFNKRQIQNILEHCRIKPANLQIEIHANFPNIKLVEYAHSVGLTVTAYAPLGS----PAHSPGKVNLLTKPCVLEIAHRHKKTPAQVLLRYLLQRKLIVVPKSVTFKRIEENFQVFDFQLSNEEMHELNTESLNERQFTLLQMSGHQEYPFKEE 309          
BLAST of Aldo-keto reductase vs. TrEMBL
Match: C1LRF4 (Aldo-keto reductase family 1, member B4 (Aldose reductase) OS=Schistosoma japonicum OX=6182 GN=Akr1b4 PE=2 SV=1)

HSP 1 Score: 313.538 bits (802), Expect = 2.067e-102
Identity = 154/310 (49.68%), Postives = 214/310 (69.03%), Query Frame = 3
Query:   66 IKLNSGYDVPNFGLGTWLSKPGEIKASLESALNLGYNHIDCAWVYCNEKEIGGVLEDYISNGKIKREELFVTSKLWNAFHRPELVKVGFEETLSNLRLDYLDLYLIHWPISIKP-GNILPSADKFKDELDDVDLIKTWKEMEKLVDSGKIRSIGLSNFNIRQIQNILDHCKIKPAMLQIEVNIYFPNKKLVEFCLKNDIQVTAYCPLGGAPDRPGATEGEKRPLSDPTVLELAKKYNATPGVILISYIIHRGLICIPKSVSSARLEENIKALNIKLSDEDFQLLDNLNVNIRSCCPLMFKLHKNYPFDED 992
            +K+N+G  +P  GLGTW S PGE+ A+++ AL +GY H+DCA+VY NE EIG  LE+ +++ ++KRE++F+TSKLWN F R E V+   EETL NLRL+YLDLYLIHWP+ +K  G++ P+    +  LD+V    TWKEMEKLVD G ++SIGLSNFN RQIQNIL+HC+IKPA LQIE++  FPN KLVE+     + VTAY PLG     P  + G+   L+ P VLE+A ++  TP  +L+ Y++ R LI +PKSV+  R+EEN +  + +LS+E+   L+  ++N R    L    H+ YPF E+
Sbjct:    4 LKMNNGRSIPVIGLGTWNSPPGEVGAAVKKALEIGYRHLDCAYVYRNEAEIGEALENALNSLRLKREDIFITSKLWNTFFRSEHVRKACEETLKNLRLNYLDLYLIHWPVPLKHGGDLFPTDSNGQLCLDNVPHEDTWKEMEKLVDEGLVKSIGLSNFNKRQIQNILEHCRIKPANLQIEIHANFPNIKLVEYAQSVGLTVTAYAPLGS----PAHSPGKVNLLTKPCVLEIAHRHKKTPAQVLLRYLLQRKLIVVPKSVTFKRIEENFQVFDFQLSNEEMHELNTESLNERQFTLLQMSGHQEYPFKEE 309          
BLAST of Aldo-keto reductase vs. TrEMBL
Match: A0A226F456 (Aldose reductase OS=Folsomia candida OX=158441 GN=Fcan01_03959 PE=4 SV=1)

HSP 1 Score: 310.842 bits (795), Expect = 7.093e-101
Identity = 154/325 (47.38%), Postives = 215/325 (66.15%), Query Frame = 3
Query:   24 FY*IKLLKLTMSK---SIKLNSGYDVPNFGLGTWLSKPGEIKASLESALNLGYNHIDCAWVYCNEKEIGGVLEDYISNGKIKREELFVTSKLWNAFHRPELVKVGFEETLSNLRLDYLDLYLIHWPISIKP-GNILPSADKFKDELDDVDLIKTWKEMEKLVDSGKIRSIGLSNFNIRQIQNILDHCKIKPAMLQIEVNIYFPNKKLVEFCLKNDIQVTAYCPLGGAPDRPGATEGEKRPLSDPTVLELAKKYNATPGVILISYIIHRGLICIPKSVSSARLEENIKALNIKLSDEDFQLLDNLNVNIRSCCPLMFKLHKNYPFD 986
            F+  +   +TM+    ++KLN+G ++P FGLGTW SKPGE++A++E+A+++GY  IDCA  Y NE E+G  +   I  G +KRE+LFVT KLWN FHRP+LV +G ++TL++L LDY+DLYLIHWP+  K  G + P     K    DVD + TWKEME  V +G+ ++IG SNFN  Q++ +L    IKPAMLQ+E + Y    KL+E+C   DI VTAY PL G+PDRP A   +   L+DP +  +AKKY  +   I++ +   RGLI IPK+VS ARLEENI   + KL+ ED +L+++ + N R C     K HK +PF+
Sbjct:   13 FFIFQRFFVTMAAKVPTVKLNNGAEIPAFGLGTWKSKPGEVRAAVENAIDVGYRMIDCALAYQNENEVGQAIATKIKEGVVKREDLFVTGKLWNTFHRPDLVPIGIKKTLTDLGLDYVDLYLIHWPMGYKEDGELFPKDADGKFMYSDVDYLDTWKEMEAAVRAGQTKAIGFSNFNSDQVERVLQKGTIKPAMLQVECHPYLNQSKLIEWCQGKDIPVTAYSPL-GSPDRPWAKPTDPNLLTDPKLEAIAKKYGKSTAQIILRWNAQRGLIIIPKTVSKARLEENISIFDFKLTHEDMELINSFDCNGRGCHLDWVKDHKYWPFN 336          
BLAST of Aldo-keto reductase vs. Ensembl Cavefish
Match: ENSAMXT00000039994.1 (aldose reductase-like [Source:NCBI gene;Acc:103040561])

HSP 1 Score: 266.159 bits (679), Expect = 4.079e-87
Identity = 134/316 (42.41%), Postives = 201/316 (63.61%), Query Frame = 3
Query:   54 MSKSIKLNSGYDVPNFGLGTWLSKPGEIKASLESALNLGYNHIDCAWVYCNEKEIGGVLEDYISNGKIKREELFVTSKLWNAFHRPELVKVGFEETLSNLRLDYLDLYLIHWPISIKPG-NILPSADKFKDELDDVDLIKTWKEMEKLVDSGKIRSIGLSNFNIRQIQNILDH--CKIKPAMLQIEVNIYFPNKKLVEFCLKNDIQVTAYCPLGGAPDRPGATEGEKRPLSDPTVLELAKKYNATPGVILISYIIHRGLICIPKSVSSARLEENIKALNIKLSDEDFQLLDNLNVNIRSCCPLMFKLHKNYPFDED 992
            M+ SI LN+G  +P  GLGTW S PG+++ ++++A+  GY HID A+VY NEKE+G  +   I+   +KRE+LF+ SKLW  FH   LV+   E+TLS+L L YLDLYL+H P+  +PG N+ P   + +   D  + + TW+EMEKLVD+G +++IG+SNFN  QI+ IL+    K KPA+ Q+E + Y    +L+ +C    I VTAY PL G+PDRP A  G+   L DP +  +A K+  +P  +LI + I R ++ IPKS ++ R++EN +  + KLS ++ Q + + N N R+C       HK+YP + +
Sbjct:    1 MATSITLNTGARMPLVGLGTWKSTPGQVEEAVKAAIMAGYRHIDGAYVYENEKEVGAAVHAMINQKVVKREDLFIVSKLWCTFHERHLVRGACEKTLSDLNLPYLDLYLVHLPVGFQPGDNLFPFDTEGQAIPDKSNFLDTWEEMEKLVDAGLVKAIGISNFNHFQIEAILNKPGLKYKPAINQVECHPYLTQVRLINYCHSKGIAVTAYSPL-GSPDRPWAKPGDPSLLDDPNIKAIADKHKKSPAQVLIRFHIERNVVVIPKSANAKRIKENFQVFDFKLSPQEMQTILSFNRNWRTCPFEWATKHKDYPLNAE 315          
BLAST of Aldo-keto reductase vs. Ensembl Cavefish
Match: akr1b1.2 (aldose reductase-like [Source:NCBI gene;Acc:103035339])

HSP 1 Score: 262.692 bits (670), Expect = 7.961e-86
Identity = 145/317 (45.74%), Postives = 213/317 (67.19%), Query Frame = 3
Query:   54 MSKSIKLNSGYDVPNFGLGTWLSKPGEIKASLESALNLGYNHIDCAWVYCNEKEIGGVLEDYISNGKIKREELFVTSKLWNAFHRPELVKVGFEETLSNLRLDYLDLYLIHWPISIKPGN-ILPSADKFKDELDDVDLIKTWKEMEKLVDSGKIRSIGLSNFNIRQIQNILDH--CKIKPAMLQIEVNIYFPNKKLVEFCLKNDIQVTAYCPLGGAPDRPGATEGEKRPLSDPTVLELAKKYNATPGVILISYIIHRGLICIPKSVSSARLEENIKALNIKLSDEDFQLLDNLNVNIRSCCPLMFKL-HKNYPFDED 992
            M+ S+KL++G D+P  GLGTW S PG++  ++++A++ GY HID A+VY NEKE+G  ++  I  G +KREELF+ SKLW  FH+   VK   ++TLS+L+LDYLDLYL+HWP+  + G  +LP  ++     DD + + TW+ ME+LVD+G ++SIG+SNFN  QI+ IL+    K KPA  QIE + Y   +KLV+FCL   I VTAY PL G+PDRP A   +   L DP +  +A+KYN T   +LI + I R +I IPKS++ +R++EN +  + KL+DE+ + +   N N R  CP+ + + HK+YPF+ +
Sbjct:    1 MATSVKLSTGADMPILGLGTWKSAPGKVTEAVKAAISAGYRHIDGAFVYQNEKEVGEGIQAMIKEGAVKREELFIVSKLWCTFHKKSAVKGACQKTLSDLQLDYLDLYLVHWPMGFQAGTELLPLDNEGLTINDDTNFLDTWEGMEELVDAGLVKSIGISNFNREQIEAILNKPGLKYKPANNQIECHPYLTQEKLVDFCLSKGISVTAYSPL-GSPDRPWAKPEDPSLLDDPNIKAIAQKYNKTTAQVLIRFHIERNIIVIPKSITPSRIQENFQVFDFKLTDEEMKTILGFNKNFR-VCPMQWSVKHKDYPFNAE 315          
BLAST of Aldo-keto reductase vs. Ensembl Cavefish
Match: ENSAMXT00000046832.1 (aldose reductase-like [Source:NCBI gene;Acc:103040561])

HSP 1 Score: 257.684 bits (657), Expect = 6.776e-84
Identity = 135/316 (42.72%), Postives = 196/316 (62.03%), Query Frame = 3
Query:   54 MSKSIKLNSGYDVPNFGLGTWLSKPGEIKASLESALNLGYNHIDCAWVYCNEKEIGGVLEDYISNGKIKREELFVTSKLWNAFHRPELVKVGFEETLSNLRLDYLDLYLIHWPISIKPG-NILPSADKFKDELDDVDLIKTWKEMEKLVDSGKIRSIGLSNFNIRQIQNILDH--CKIKPAMLQIEVNIYFPNKKLVEFCLKNDIQVTAYCPLGGAPDRPGATEGEKRPLSDPTVLELAKKYNATPGVILISYIIHRGLICIPKSVSSARLEENIKALNIKLSDEDFQLLDNLNVNIRSCCPLMFKLHKNYPFDED 992
            M+ SI LN+G  +P  GLGTW S PG+++ ++++A+  GY HID A+ Y NEKE+G  +   I+   +KRE+LF+ SKLW+ FH   LV+   E TLS+L L Y+DLYL+H P+  KPG ++LP     +   D+ + + TW+EMEKLVD+G +++IG+SNFN  QI+ +L+    K KP   QIE + Y    KL++FC    I +TAY PL G+PDRP A  G+   L DP +  +A K+  T   +LI + I R +  IPKSV+ AR++ENI+  + KLS E+   + + N N R         HK+YP   +
Sbjct:    1 MASSIPLNNGARMPTVGLGTWKSTPGQVEEAVKAAILAGYRHIDGAYAYRNEKEVGAAVHAMINQKVVKREDLFIVSKLWSTFHERHLVRGACETTLSDLNLPYIDLYLMHCPMGFKPGEDLLPFDADGECIPDNSNFLDTWEEMEKLVDAGLVKAIGISNFNRAQIEALLNKPGLKYKPVTNQIECHPYLTQVKLIDFCHSKGITITAYSPL-GSPDRPWAKPGDPSLLDDPKIKAIADKHKKTTAQVLIRFHIERNVAVIPKSVNPARIKENIQVFDFKLSPEEMSTIMSFNRNWRIAHFEWATKHKDYPLHAE 315          
BLAST of Aldo-keto reductase vs. Ensembl Cavefish
Match: ENSAMXT00000052600.1 (aldose reductase-like [Source:NCBI gene;Acc:103040561])

HSP 1 Score: 253.832 bits (647), Expect = 1.793e-82
Identity = 131/298 (43.96%), Postives = 190/298 (63.76%), Query Frame = 3
Query:   54 MSKSIKLNSGYDVPNFGLGTWLSKPGEIKASLESALNLGYNHIDCAWVYCNEKEIGGVLEDYISNGKIKREELFVTSKLWNAFHRPELVKVGFEETLSNLRLDYLDLYLIHWPISIKPG-NILPSADKFKDELDDVDLIKTWKEMEKLVDSGKIRSIGLSNFNIRQIQNILDH--CKIKPAMLQIEVNIYFPNKKLVEFCLKNDIQVTAYCPLGGAPDRPGATEGEKRPLSDPTVLELAKKYNATPGVILISYIIHRGLICIPKSVSSARLEENIKALNIKLSDEDFQLLDNLNVNIR 938
            M+ SI LN+G  +P  GLGTW S PG+++ ++++A+  GY HID A+ Y NEKE+G  +   I+   +KRE+LF+ SKLW+ FH   LV+   E TLS+L L Y+DLYL+H P+  KPG ++LP     +   D+ + + TW+EMEKLVD+G +++IG+SNFN  QI+ +L+    K KP   QIE + Y    KL++FC    I +TAY PL G+PDRP A  G+   L DP +  +A K+  T   +LI + I R +  IPKSV+ AR++ENI+  + KLS E+   + + N N R
Sbjct:    1 MASSIPLNNGARMPTVGLGTWKSTPGQVEEAVKAAILAGYRHIDGAYAYRNEKEVGAAVHAMINQKVVKREDLFIVSKLWSTFHERHLVRGACETTLSDLNLPYIDLYLMHCPMGFKPGEDLLPFDADGECIPDNSNFLDTWEEMEKLVDAGLVKAIGISNFNRAQIEALLNKPGLKYKPVTNQIECHPYLTQVKLIDFCHSKGITITAYSPL-GSPDRPWAKPGDPSLLDDPKIKAIADKHKKTTAQVLIRFHIERNVAVIPKSVNPARIKENIQVFDFKLSPEEMSTIMSFNRNWR 297          
BLAST of Aldo-keto reductase vs. Ensembl Cavefish
Match: AKR1B1 (aldo-keto reductase family 1 member B [Source:HGNC Symbol;Acc:HGNC:381])

HSP 1 Score: 249.21 bits (635), Expect = 1.605e-80
Identity = 131/316 (41.46%), Postives = 197/316 (62.34%), Query Frame = 3
Query:   54 MSKSIKLNSGYDVPNFGLGTWLSKPGEIKASLESALNLGYNHIDCAWVYCNEKEIGGVLEDYISNGKIKREELFVTSKLWNAFHRPELVKVGFEETLSNLRLDYLDLYLIHWPISIKPG-NILPSADKFKDELDDVDLIKTWKEMEKLVDSGKIRSIGLSNFNIRQIQNILDH--CKIKPAMLQIEVNIYFPNKKLVEFCLKNDIQVTAYCPLGGAPDRPGATEGEKRPLSDPTVLELAKKYNATPGVILISYIIHRGLICIPKSVSSARLEENIKALNIKLSDEDFQLLDNLNVNIRSCCPLMFKLHKNYPFDED 992
            M+ +I LN+G  +P  GLGTW + PG+++ ++++A+  GY HID A++Y NEKE+G  +   I  G +KRE+LF+ SKLW+ FH   LV+   E TL +L L YLDLYLIH P+  KPG    P   + +   D+ + ++TW+EMEKLVD+G +++IG+SNFN  QI+ +L+    K KPA  QIE + Y    KL+ +C    I VTAY PL G+PDRP A  GE   L +P +  +A K++ T   +LI + I R +  IPKS +  R++EN +  + KL++E+   + + N N R   P+    HK++P + +
Sbjct:    1 MASTITLNTGARMPILGLGTWKASPGQVEEAVKAAILAGYRHIDGAYLYENEKEVGAGVHAMIDQGVVKREDLFIVSKLWSTFHERHLVRGACETTLRDLNLPYLDLYLIHLPMGFKPGEESFPFDAEGQVIPDNSNFLETWEEMEKLVDAGLVKAIGVSNFNRAQIEALLNKPGLKYKPANNQIECHPYLTQVKLINYCQSKGISVTAYSPL-GSPDRPWAKAGEPSLLDEPKIKAIAAKHHKT--TVLIRFHIERNVAVIPKSANPKRIKENFQVFDFKLNNEEMNTILSFNRNWR-ILPMEATKHKDFPLNTE 312          
BLAST of Aldo-keto reductase vs. Ensembl Sea Lamprey
Match: akr1a1b (aldo-keto reductase family 1, member A1b (aldehyde reductase) [Source:NCBI gene;Acc:799805])

HSP 1 Score: 216.468 bits (550), Expect = 1.385e-68
Identity = 112/250 (44.80%), Postives = 158/250 (63.20%), Query Frame = 3
Query:  132 EIKASLESALNLGYNHIDCAWVYCNEKEIGGVLEDYISNGK-IKREELFVTSKLWNAFHRPELVKVGFEETLSNLRLDYLDLYLIHWPISIKPGNI-LPSADKFKDELDDVDLIKTWKEMEKLVDSGKIRSIGLSNFNIRQIQNILDHCKIKPAMLQIEVNIYFPNKKLVEFCLKNDIQVTAYCPLGGAPDRPGATEGEKRPLSDPTVLELAKKYNATPGVILISYI-IHRGLICIPKSVSSARLEENIK 872
            ++KA++ SALN GY HIDCA VY NE E+G  L +    GK I RE++FVTSKLWN  H PE V+    ++L +L+LD+LDLYLIHWP   + G+I  P  +      D  D  +TW+ ME+LV+ G +R+IGLSNFN RQ+  I+    +KPA+LQ+E + Y   K L+  C    + +TAY PL G+PDR      E   L +P +  LA KY  +P  ++I +  + RG++ IPKSV+ +R+ ENI+
Sbjct:    1 QVKAAVVSALNSGYRHIDCAAVYGNEAEVGEALTECFGAGKPIAREDVFVTSKLWNTKHHPEDVEPSCRKSLQDLKLDFLDLYLIHWPHGFERGDIPFPKNEDGTVRYDYTDYRETWRAMERLVEGGLVRAIGLSNFNSRQVDEIIAIATVKPAILQVESHPYLSQKALLTHCTARGVALTAYSPL-GSPDRAWRQSHEPVVLEEPAIRSLADKYGKSPAQVIIRWWQVQRGVLVIPKSVTPSRIVENIQ 249          
BLAST of Aldo-keto reductase vs. Ensembl Sea Lamprey
Match: ENSPMAT00000005212.1 (pep scaffold:Pmarinus_7.0:GL480334:1640:10257:1 gene:ENSPMAG00000004669.1 transcript:ENSPMAT00000005212.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 191.045 bits (484), Expect = 9.369e-59
Identity = 121/298 (40.60%), Postives = 179/298 (60.07%), Query Frame = 3
Query:  120 SKPGEIKASLESALNLGYNHIDCAWVYCNEKEIGGVLEDYISNGKIKREELFVTSKLWNAFHRPELVKVGFEETLSNLRLDYLDLYLIHWPISIK--PGNILPSADKFKDELDDVDLIKTWKEMEKLVDSGKIRSIGLSNFNIRQIQNILDHCKIKPAMLQIEVNIYFPNKKLVEFCLKNDIQVTAYCPLGGAPDRPGATEGEKRP---LSDPTVLELAKKYNATPGVILISYIIHRGLICIPKSVSSARLEENIKALNIKLSDEDFQLLDNLNVNIRSCCPLMFKL--HKNYPFDED 992
            SKP ++  ++E+A+  GY H+D A+VY NE E+G  +   I+ G + R++LF+ SKLW  FH P  VK  F +TL++L LDYLDLYL+H P+  +     + P+ D  +    DVD + TWK ME LV  G ++S+G+SNFNI Q+  +L    IKP + Q+E++ Y    KLV+FC    I +TAY P  G+PDRP   + +K P   L DP V ++AKK++ + G IL+ Y I   ++ IPKSV+ A + +N K  +  L +ED + L  L+        L  KL  HK +P ++D
Sbjct:    2 SKPQQVCKAVEAAIEAGYRHVDGAYVYQNEDEVGAGVRACIAKGIVSRDQLFIVSKLWGKFHAPADVKQCFMKTLTDLGLDYLDLYLMHSPMGYQNVGEELYPTMDG-RLLCSDVDYLDTWKAMEDLVKEGLVKSLGVSNFNIPQLNRLLSSASIKPVVNQVELHPYNAQPKLVQFCKSQGIVLTAYSPF-GSPDRP--RKLDKDPGNLLQDPVVADIAKKHSKSSGQILLRYHIENNIVVIPKSVTPANIIQNSKVFDFSLDEEDLKKLAQLDRGWSLANSLFTKLKDHKYFPVNDD 295          
BLAST of Aldo-keto reductase vs. Ensembl Sea Lamprey
Match: zgc:110782 (zgc:110782 [Source:ZFIN;Acc:ZDB-GENE-050320-51])

HSP 1 Score: 177.178 bits (448), Expect = 1.481e-53
Identity = 100/298 (33.56%), Postives = 159/298 (53.36%), Query Frame = 3
Query:   57 SKSIKLNSGYDVPNFGLGTWLSKPGEI-KASLESALNLGYNHIDCAWVYCNEKEIGGVLEDYISNGKIKREELFVTSKLWNAFHRPELVKVGFEETLSNLR-LDYLDLYLIHWPISIKPGNILPSADKFKDELDDVDLIKTWKEMEKLVDSGKIRSIGLSNFNIRQIQNILDHCKIKPAMLQIEVNIYFPNKKLVEFCLKNDIQVTAYCPLGGAPDRPGATEGEKRPLSDPTVLELAKKYNATPGVILISYIIHRGLICIPKSVSSARLEENIKALNIKLSDEDFQLLDNLNVNIRSC 944
            ++S+KLNSG  +P  GLGT+     E+   +L +AL  GY  +D A VY NE ++   L + +    + R ++F+TSKL      P       + +L NL    YLDLYL+HWP +      LP  D    EL      ++W+ +EKL   GK+R+IG+SN+ +R ++ +L  C IKP++LQ+E + +   K+L+E+C  + I + AY  LG               L + TV E+A ++  TP  +L+ + + RG+  IPKS    R+  N    + KL+ ED + LD ++  +  C
Sbjct:    8 AQSVKLNSGTAMPLLGLGTFKMHGYEVVYGALAAALEHGYRAVDTAAVYSNEADVARALRELLPRHGLTRADVFITSKLAPRDQGPGAAAAALK-SLENLDPGGYLDLYLVHWPGT----QGLPGEDPRNQELRQ----ESWRLLEKLHGEGKLRAIGVSNYTVRHLEELLATCSIKPSVLQVEYHPHLVQKELLEYCQAHGIHMQAYSSLGMG-----------HLLGEVTVQEVASRHGRTPAQVLLRWALERGVGVIPKSTGVERVASNAAVFDFKLAQEDIETLDGMDKQLHYC 285          
BLAST of Aldo-keto reductase vs. Ensembl Sea Lamprey
Match: ENSPMAT00000009052.1 (pep scaffold:Pmarinus_7.0:GL484886:6662:24104:-1 gene:ENSPMAG00000008170.1 transcript:ENSPMAT00000009052.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 171.4 bits (433), Expect = 5.466e-52
Identity = 90/223 (40.36%), Postives = 134/223 (60.09%), Query Frame = 3
Query:  285 KLWNAFHRPELVKVGFEETLSNLRLDYLDLYLIHWPISIK-PGNILPSADKFKDELDDVDLIKTWKEMEKLVDSGKIRSIGLSNFNIRQIQNILDHCKIKPAMLQIEVNIYFPNKKLVEFCLKNDIQVTAYCPLGGAPDRPGATEGEK--RPLSDPTVLELAKKYNATPGVILISYIIHRGLICIPKSVSSARLEENIKALNIKLSDEDFQLLDNLNVNIRSC 944
            +LW  +H P  VK+GF +TL++L+LDYLDL+L+H P++ K  G+ L      K    DVD + TWK ME LV  G ++SIG+SNFNI Q+Q +L    IKPA+ Q+E++ Y P  +L+EFC  N++ +TAY P  G+PDR    E       L DP V  +  K+  T   +L+ Y   R ++ IPKS++ +R+ +N ++    L  ED + L  L  + R+C
Sbjct:    2 QLWGKYHAPADVKIGFMKTLTDLKLDYLDLFLMHSPMAFKNEGDDLWPIKDGKILAADVDYVDTWKAMEVLVKEGLVKSIGVSNFNIAQLQRLLSVATIKPAVNQVELHPYLPQPELIEFCQSNNVVLTAYSPF-GSPDREFKNEKNDPCNLLQDPVVEAIGSKHGKTSAQVLLRYHTQRNIVVIPKSITPSRIVQNAQSFGFTLDGEDTKKLQGLRRDWRAC 223          
BLAST of Aldo-keto reductase vs. Ensembl Sea Lamprey
Match: akr1b1.1 (aldo-keto reductase family 1, member B1 (aldose reductase), tandem duplicate 1 [Source:ZFIN;Acc:ZDB-GENE-040625-7])

HSP 1 Score: 110.538 bits (275), Expect = 3.882e-29
Identity = 71/210 (33.81%), Postives = 114/210 (54.29%), Query Frame = 3
Query:  399 IKPG-NILPSADKFKDELDDVDLIKTWKEMEKLVDSGKIRSIGLSNFNIRQIQNILDH--CKIKPAM--------LQIEVNIYFPNKKLVEFCLKNDIQVTAYCPLGGAPDRPGATEGEKRPLSDPTVLELAKKYNATPGVILISYIIHRGLICIPKSVSSARLEENIKALNIKLSDEDFQLLDNLNVNIRSCCPLMFKL-HKNYPFDED 992
            ++PG ++ P  +  K   D  D + TW+ ME LVD+G IR++GLSNFN  QI+ IL+    K KP +        L +  N+Y      +  C K +     Y      P +  A  G K  L  P+V  ++  ++     +LI + + RG++ IPKSV+ AR+ ENI+  + +L+ +D + L +LN N R+ CP+ + + HK+YPF+ D
Sbjct:    1 LQPGEDLFPLDENDKVITDGTDFLDTWEAMEALVDAGVIRALGLSNFNRDQIRKILNKPGLKHKPVVNQQYSLHHLHLSANVY------ISKCYKKNHSACLYSKYHTCPLQWNAL-GNKSFLKFPSVKSISNSHSLIGSEVLIRFHVQRGVMVIPKSVTKARIHENIQVFDFELTADDMKSLTSLNKNWRA-CPMQWAVDHKDYPFNTD 202          
BLAST of Aldo-keto reductase vs. Ensembl Yeast
Match: GCY1 (Glycerol dehydrogenase; involved in an alternative pathway for glycerol catabolism used under microaerobic conditions; also has mRNA binding activity; member of the aldo-keto reductase (AKR) family; human homolog AKR1B1 can complement yeast null mutant; protein abundance increases in response to DNA replication stress; GCY1 has a paralog, YPR1, that arose from the whole genome duplication [Source:SGD;Acc:S000005646])

HSP 1 Score: 200.675 bits (509), Expect = 1.460e-62
Identity = 116/302 (38.41%), Postives = 176/302 (58.28%), Query Frame = 3
Query:   57 SKSIKLNSGYDVPNFGLGTWLSKPGEIKASLESALNLGYNHIDCAWVYCNEKEIGGVLEDYISNGKIKREELFVTSKLW-NAFHRPELVKVGFEETLSNLRLDYLDLYLIHWPISIKPGNI----LPSADKFKDELDDVDL-----IKTWKEMEKLVDSGKIRSIGLSNFNIRQIQNIL--DHCKIKPAMLQIEVNIYFPNKKLVEFCLKNDIQVTAYCPLGGAPDRPGATEGEKRPLSDPTVLELAKKYNATPGVILISYIIHRGLICIPKSVSSARLEENIKALNIKLSDEDFQLLDNLN 926
            +K + LN+G  +P  GLGTW SK  +   ++ +AL  GY HID A +Y NE ++G  ++D      + REE+FVT+KLW    H PE   V  +++L  L LDY+DLYL+HWP  + P  I    + S    KD    VD+     IKTW+ M++L  +GK +++G+SNF+I  ++++L     K+ PA  Q+E++   P  +L+ FC    I V AY PLG   D P         L +P +LE+AKK N  PG ++IS+ + RG + +PKSV+  R++ N K     LS EDF+ ++N++
Sbjct:    9 TKILSLNTGAQIPQIGLGTWQSKENDAYKAVLTALKDGYRHIDTAAIYRNEDQVGQAIKD----SGVPREEIFVTTKLWCTQHHEPE---VALDQSLKRLGLDYVDLYLMHWPARLDPAYIKNEDILSVPTKKDGSRAVDITNWNFIKTWELMQELPKTGKTKAVGVSNFSINNLKDLLASQGNKLTPAANQVEIHPLLPQDELINFCKSKGIVVEAYSPLGST-DAPL--------LKEPVILEIAKKNNVQPGHVVISWHVQRGYVVLPKSVNPDRIKTNRKIFT--LSTEDFEAINNIS 292          
BLAST of Aldo-keto reductase vs. Ensembl Yeast
Match: GRE3 (Aldose reductase; involved in methylglyoxal, d-xylose, arabinose, and galactose metabolism; stress induced (osmotic, ionic, oxidative, heat shock, starvation and heavy metals); regulated by the HOG pathway; protein abundance increases in response to DNA replication stress [Source:SGD;Acc:S000001146])

HSP 1 Score: 187.578 bits (475), Expect = 2.899e-57
Identity = 118/314 (37.58%), Postives = 172/314 (54.78%), Query Frame = 3
Query:   54 MSKSIKLNSGYDVPNFGLGTWLSKPGEIKASLESALNLGYNHIDCAWVYCNEKEIGGVLEDYISNGKIKREELFVTSKLWNAFHRPELVKVGFEETLSNLRLDYLDLYLIHWPISIK---------PGNILPSADKFKDELDD--VDLIKTWKEMEKLVDSGKIRSIGLSNFNIRQIQNILDHCKIKPAMLQIEVNIYFPNKKLVEFCLKNDIQVTAYCPLGGAPDRPGATEGEKRPLSDPTVLE--LAKKYN-----ATPGVILISYIIHRGLICIPKSVSSARLEENIK-ALNIKLSDEDFQLLDNLNVNIR 938
            MS  + LN+G  +P  GLG W          +  A+ LGY   D A  Y NEKE+G  +   IS G + R+++FV SKLWN FH P+ VK+  ++TLS++ LDYLDLY IH+PI+ K         PG    + D+ K  + +  V +I T++ +E+ VD G I+SIG+SNF    IQ++L  C+IKP  LQIE + Y   + LVEFC  +DIQV AY   G         +  K   + PT+ E  + KK +     +T   +L+ +   RG+  IPKS    RL  N++      L++++ + +  LN NIR
Sbjct:    1 MSSLVTLNNGLKMPLVGLGCWKIDKKVCANQIYEAIKLGYRLFDGACDYGNEKEVGEGIRKAISEGLVSRKDIFVVSKLWNNFHHPDHVKLALKKTLSDMGLDYLDLYYIHFPIAFKYVPFEEKYPPGFYTGADDEKKGHITEAHVPIIDTYRALEECVDEGLIKSIGVSNFQGSLIQDLLRGCRIKPVALQIEHHPYLTQEHLVEFCKLHDIQVVAYSSFGPQSFIEMDLQLAK---TTPTLFENDVIKKVSQNHPGSTTSQVLLRWATQRGIAVIPKSSKKERLLGNLEIEKKFTLTEQELKDISALNANIR 311          
BLAST of Aldo-keto reductase vs. Ensembl Yeast
Match: YPR1 (NADPH-dependent aldo-keto reductase; reduces multiple substrates including 2-methylbutyraldehyde and D,L-glyceraldehyde, expression is induced by osmotic and oxidative stress; functionally redundant with other aldo-keto reductases; protein abundance increases in response to DNA replication stress; YPR1 has a paralog, GCY1, that arose from the whole genome duplication; human homolog AKR1B1 can complement yeast null mutant [Source:SGD;Acc:S000002776])

HSP 1 Score: 186.422 bits (472), Expect = 4.291e-57
Identity = 108/302 (35.76%), Postives = 173/302 (57.28%), Query Frame = 3
Query:   57 SKSIKLNSGYDVPNFGLGTWLSKPGEIKASLESALNLGYNHIDCAWVYCNEKEIGGVLEDYISNGKIKREELFVTSKLWNAFHR-PELVKVGFEETLSNLRLDYLDLYLIHWPISIKP-----GNIL--PSADKFKDELD--DVDLIKTWKEMEKLVDSGKIRSIGLSNFNIRQIQNILD--HCKIKPAMLQIEVNIYFPNKKLVEFCLKNDIQVTAYCPLGGAPDRPGATEGEKRPLSDPTVLELAKKYNATPGVILISYIIHRGLICIPKSVSSARLEENIKALNIKLSDEDFQLLDNLN 926
            S ++KLN+G  +P  G GTW S       S+ +AL  GY HID A +Y NE+E+G  ++D      + REE+F+T+KLW    R PE       ++L  L LDY+DLYL+HWP+ +K      GN+L  P+ +    ++D  + + IKTW+ M++L  +GK +++G+SNF+I  I+ +L+  + K+ PA  QIE++   P  +L+ FC +  I V AY P G A             L +  ++++AKK+   P  ++IS+ I RG + + KSV+  R+  N K     L ++DF+ + NL+
Sbjct:    9 SATLKLNTGASIPVLGFGTWRSVDNNGYHSVIAALKAGYRHIDAAAIYLNEEEVGRAIKD----SGVPREEIFITTKLWGTEQRDPE---AALNKSLKRLGLDYVDLYLMHWPVPLKTDRVTDGNVLCIPTLEDGTVDIDTKEWNFIKTWELMQELPKTGKTKAVGVSNFSINNIKELLESPNNKVVPATNQIEIHPLLPQDELIAFCKEKGIVVEAYSPFGSA---------NAPLLKEQAIIDMAKKHGVEPAQLIISWSIQRGYVVLAKSVNPERIVSNFKIFT--LPEDDFKTISNLS 292          
BLAST of Aldo-keto reductase vs. Ensembl Yeast
Match: ARA1 (NADP+ dependent arabinose dehydrogenase; involved in carbohydrate metabolism; purified as homodimer; naturally occurs with a N-terminus degradation product [Source:SGD;Acc:S000000353])

HSP 1 Score: 174.481 bits (441), Expect = 3.942e-52
Identity = 106/301 (35.22%), Postives = 172/301 (57.14%), Query Frame = 3
Query:   72 LNSGYDVPNFGLGTW--LSKPGEIKASLESALNLGYNHIDCAWVYCNEKEIGGVLEDYISNGKIKREELFVTSKLWNAFHRPELVKVGFEETLSNLRLDYLDLYLIHWPISIK----PGNI-----LPSADKFKDELD-DVDLIKTWKEMEKLV---DSGKIRSIGLSNFNIRQIQNILDHCKIKPAMLQIEVNIYFPNKKLVEFCLKNDIQVTAYCPLG--GAPDRPGATEGEKRPLSDPTVLELAKKYNATPGVILISYIIHRGLICIPKSVSSARLEENIKALNIKLSDEDFQLLDNL 923
            LN+G  +P  GLGT     K  E K ++++A+  GY HID AW Y  E  +G  +++ + +G IKRE+LF+T+K+W      + V     E+L  L L+Y+DL L HWP+  +    P  I      P  D  K     D D ++T+K++EK+    +  ++R+IG+SNF+I  ++ ++  C++KP + Q+E + + P  +L +FC  +DI +TAY PLG  GAP+           L  P V +LA+KYN T   +LISY I +G I IP+S++  R+  +I+  +  L+ ++ Q L++ 
Sbjct:   27 LNNGVRIPALGLGTANPHEKLAETKQAVKAAIKAGYRHIDTAWAYETEPFVGEAIKELLEDGSIKREDLFITTKVWPVLW--DEVDRSLNESLKALGLEYVDLLLQHWPLCFEKIKDPKGISGLVKTPVDDSGKTMYAADGDYLETYKQLEKIYLDPNDHRVRAIGVSNFSIEYLERLIKECRVKPTVNQVETHPHLPQMELRKFCFMHDILLTAYSPLGSHGAPN-----------LKIPLVKKLAEKYNVTGNDLLISYHIRQGTIVIPRSLNPVRISSSIEFAS--LTKDELQELNDF 312          
BLAST of Aldo-keto reductase vs. Ensembl Yeast
Match: YJR096W_mRNA (Xylose and arabinose reductase; member of the aldo-keto reductase (AKR) family; GFP-fusion protein is induced in response to the DNA-damaging agent MMS [Source:SGD;Acc:S000003857])

HSP 1 Score: 146.747 bits (369), Expect = 4.035e-42
Identity = 90/294 (30.61%), Postives = 158/294 (53.74%), Query Frame = 3
Query:   54 MSKSIKLNSGYDVPNFGLGTWLSKPGEIKASLESALNLGYNHIDCAWVYCNEKEIGGVLEDYISN--GKIKREELFVTSKLWNAFHRPELVKVGFEETLSNLR-LDYLDLYLIHWPISIKPGNILPSADKFKDELDDVDLIKTWKEMEKLVDSGKIRSIGLSNFNIRQIQNILD--HCKIKPAMLQIEVNIYFPNKKLVEFCLKNDIQVTAYCPLGGAPDRPGATEGEKRPLSDPTVLELAKKYNATPGVILISYIIHRGLICIPKSVSSARLEENIKALNIKLSDEDFQLLDN 920
            + K  KL++G+ +P+  LGT+     +    +   +  GY H D A +Y NEKE+G  +  +++   G  KREE+F T+KLWN+ +  +  K    + L+ +  L Y+DL LIH P+            K +        ++TW+ M++ VD G ++SIG+SN+  + I  +L+    K KP + QIE++ +   ++L ++C    + V A+ PL           G K  +++P +L++ K+ +  PG +LI + +  G + +PK+ +  RLE N+ A N +LSDE  + LD+
Sbjct:    2 VPKFYKLSNGFKIPSIALGTYDIPRSQTAEIVYEGVKCGYRHFDTAVLYGNEKEVGDGIIKWLNEDPGNHKREEIFYTTKLWNSQNGYKRAKAAIRQCLNEVSGLQYIDLLLIHSPLE---------GSKLR--------LETWRAMQEAVDEGLVKSIGVSNYGKKHIDELLNWPELKHKPVVNQIEISPWIMRQELADYCKSKGLVVEAFAPL---------CHGYK--MTNPDLLKVCKEVDRNPGQVLIRWSLQHGYLPLPKTKTVKRLEGNLAAYNFELSDEQMKFLDH 267          
BLAST of Aldo-keto reductase vs. Ensembl Nematostella
Match: EDO45157 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RTW5])

HSP 1 Score: 227.254 bits (578), Expect = 2.687e-72
Identity = 137/326 (42.02%), Postives = 202/326 (61.96%), Query Frame = 3
Query:   63 SIKLNSGYDVPNFGLGTWLSKPGEIKASLESALNLGYNHIDCAWVYCNEKEIGGVLEDYISNGKIKREELFVTSKLWNAFHRPELVKVGFEETLSNLRLDYLDLYLIHWPISIKPGNILPSADKF--KDELDDV-----DLIKTWKEMEKLVDSGKIRSIGLSNFNIRQIQNILDHCKIKPAMLQIEVNIYFPNKKLVEFCLKNDIQVTAYCPLGGAPDRPGATEGEKRPLSDPTVLELAKKYNATPGVILISYIIHRGLICIPKSVSSARLEENIKALNIKLSDEDFQLLDNLNVNIRSCCPLMFKL-----------HKNYPFD 986
            ++KLN+G ++P  GLGTW SKPG+++ +++ A+  GY HIDCA+ Y NEKE+G  L + + +  ++R++LF+TSKLWN  H P+ V+    ++L +L LDYLDLYLIHWP+S + G      D+F  KDE  +V     D   TWK MEKLVD G +++IGLSNFN +Q+ +I    +IKP   Q+E +      KL++   K++IQ  AY PLG   DRP A   +   + DPT++ LA +Y+ T   I I + I RG++ IPKSV+  R++ N +  + +LS ED   ++ LN + R+C P M KL           H +YPF+
Sbjct:    3 TVKLNNGLEMPVLGLGTWKSKPGQVENAVKFAIKEGYRHIDCAYAYRNEKEVGDALRELLGS-VVERKDLFITSKLWNTKHNPKDVRSNCVDSLKDLGLDYLDLYLIHWPLSFRDG------DEFFPKDEQGNVLYAYHDPCDTWKAMEKLVDEGLVKAIGLSNFNSKQVDDICAIARIKPVANQVECHPLLNQAKLIDHHKKHNIQTIAYSPLGSL-DRPWAKPDDPHVMRDPTMVALADRYSRTVAQICIRFQIQRGVLVIPKSVTPERIKSNFQVFDFELSAEDMATIEGLNRDWRACLP-MKKLADGTMVPRDGEHPHYPFN 319          
BLAST of Aldo-keto reductase vs. Ensembl Nematostella
Match: EDO26953 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7TAL8])

HSP 1 Score: 226.868 bits (577), Expect = 3.714e-72
Identity = 136/326 (41.72%), Postives = 202/326 (61.96%), Query Frame = 3
Query:   63 SIKLNSGYDVPNFGLGTWLSKPGEIKASLESALNLGYNHIDCAWVYCNEKEIGGVLEDYISNGKIKREELFVTSKLWNAFHRPELVKVGFEETLSNLRLDYLDLYLIHWPISIKPGNILPSADKF--KDELDDV-----DLIKTWKEMEKLVDSGKIRSIGLSNFNIRQIQNILDHCKIKPAMLQIEVNIYFPNKKLVEFCLKNDIQVTAYCPLGGAPDRPGATEGEKRPLSDPTVLELAKKYNATPGVILISYIIHRGLICIPKSVSSARLEENIKALNIKLSDEDFQLLDNLNVNIRSCCPLMFKL-----------HKNYPFD 986
            ++KLN+G ++P  GLGTW SKPG+++ +++ A+  GY HIDCA+ Y NEKE+G  L + + +  ++R++LF+TSKLWN  H P+ V+    ++L +L LDYLDLYLIHWP+S + G      D+F  KDE  +V     D   TWK MEKLVD G +++IGLSNFN +Q+ +I    +IKP   Q+E +      KL++   K++IQ  AY PLG   DRP A   +   + DPT++ +A +Y+ T   I I + I RG++ IPKSV+  R++ N +  + +LS ED   ++ LN + R+C P M KL           H +YPF+
Sbjct:    3 TVKLNNGLEMPVLGLGTWKSKPGQVENAVKFAIKEGYRHIDCAYAYRNEKEVGDALRELLGS-VVERKDLFITSKLWNTKHNPKDVRSNCVDSLKDLGLDYLDLYLIHWPLSFRDG------DEFFPKDEQGNVLYAYHDPCDTWKAMEKLVDEGLVKAIGLSNFNSKQVDDICAIARIKPVANQVECHPLLNQAKLIDHHKKHNIQTIAYSPLGSL-DRPWAKPDDPHVMRDPTMVAMADRYSRTVAQICIRFQIQRGVLVIPKSVTPERIKSNFQVFDFELSAEDMATIEGLNRDWRACLP-MKKLADGTMVPRDGEHPHYPFN 319          
BLAST of Aldo-keto reductase vs. Ensembl Nematostella
Match: EDO36411 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SIT3])

HSP 1 Score: 198.364 bits (503), Expect = 3.707e-61
Identity = 120/294 (40.82%), Postives = 173/294 (58.84%), Query Frame = 3
Query:   69 KLNSGYDVPNFGLGTWLSKPGEIKASLESALNLGYNHIDCAWVYCNEKEIGGVLEDYISNGKIKREELFVTSKLWNAFHRPELVKVGFEETLSNLRLDYLDLYLIHWPISIKPGNILP-SADKFKDELDDVDLIKTWKEMEKLVDSGKIRSIGLSNFNIRQIQNILDHCKIKPAMLQIEVNIYFPNKKLVEFCLKNDIQVTAYCPLGGAPDR---PGATEGEKRPLSDPTVLELAKKYNATPGVILISYIIHRGLICIPKSVSSARLEENIKALNIKLSDEDFQLLDNLNVNIR 938
            KLN+G  +P   LGTW S   E+  ++  A+ LGY HIDCA +Y NE EIG  L + ++ GK+KREELFVTSKLW   H P+ V    + TL NL+LDYLDLYLIH P++ K G  LP S  +         +  TW+ ME LV  G  ++IG+SNF+++++  +L+   I PA  Q+E++ Y P +KL EFC    I +TAY PLG  P R       E E + + +P + E+A K+N +   +L+ + I RG   +PKS S   L +N  AL + L+D++   + ++    R
Sbjct:    9 KLNTGASIPAMALGTWQSSKEEVGNAVRLAIELGYRHIDCAEIYGNEGEIGEALSEVLTEGKVKREELFVTSKLWCDSHHPDDVLPACQATLKNLQLDYLDLYLIHIPVAFKKGVRLPHSIAEGIIGYTPEGVQNTWQAMEGLVAKGLCKAIGVSNFSVKRLNKLLETASIVPACNQVELHPYLPQEKLKEFCDSKGILLTAYSPLGN-PGRLVPKERLEREPKVMEEPVIKEIAAKHNCSVARVLLRWGIQRGYPVLPKSTSRDHLHDNFSALGLVLTDDEMAAIKSITTRQR 301          
BLAST of Aldo-keto reductase vs. Ensembl Nematostella
Match: EDO45940 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RRF6])

HSP 1 Score: 182.57 bits (462), Expect = 1.340e-55
Identity = 106/298 (35.57%), Postives = 159/298 (53.36%), Query Frame = 3
Query:   48 LTMSKSIKLNSGYDVPNFGLGTWLSKPGEIKASLESALNLGYNHIDCAWVYCNEKEIGGVLEDYISNGKIKREELFVTSKLWNAFHRPELVKVGFEETLSNLRLDYLDLYLIHWPISIKPGNILPSADKFKDELDDVDLIKTWKEMEKLVDSGKIRSIGLSNFNIRQIQNILDHCKIKPAMLQIEVNIYFPNKKLVEFCLKNDIQVTAYCPLGGAPDRPGATEGEKRPLSDPTVLELAKKYNATPGVILISYIIHRGLICIPKSVSSARLEENIKALNIKLSDEDFQLLDNLNVNIRS 941
            LT+S +  L+ GY +P FGLG +       K ++  AL  GY  ID A  Y NEK +G  L +      + R E+++ +K+++  H  E     ++ +LS L +DY+DLYLIH+P+   P  ++ S                W+ M +L   G  RSIG+SNFNI  ++ +  H  I P + QIEV+ Y   ++LV+FC K+ I + AY PL         T GEK  L DP +  L  KY  TP  +L+ + + +G ICI KSV  +R+ EN+   N  +S  D ++LD L  N+R+
Sbjct:    1 LTLSSTRTLSDGYKIPRFGLGLYDLDEKHTKQAVLWALENGYRMIDTAASYNNEKRVGEALRE----SAVPRSEVYLVTKVYHTDHGYEKTMKAYDRSLSALGVDYVDLYLIHFPV---PAGVVGS----------------WEAMAELQGKGLTRSIGVSNFNIHHLEALQKHSVIPPVVNQIEVHPYLQMEELVDFCRKHSIAIQAYSPL---------TRGEK--LHDPLLRSLGDKYGKTPAQVLLRWSLQKGYICISKSVQLSRIIENVDVFNFTISMADMEILDGLEENLRT 264          
BLAST of Aldo-keto reductase vs. Ensembl Nematostella
Match: EDO43648 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RY73])

HSP 1 Score: 161.77 bits (408), Expect = 1.375e-47
Identity = 96/270 (35.56%), Postives = 150/270 (55.56%), Query Frame = 3
Query:  135 IKASLESALNLGYNHIDCAWVYCNEKEIGGVLEDYISNGKIKREELFVTSKLWNAFHRPELVKVGFEETLSNLRLDYLDLYLIHWPISIKPGNILPSADKFKDELDDVDLIKTWKEMEKLVDSGKIRSIGLSNFNIRQIQNILDHCKIKPAMLQIEVNIYFPNKKLVEFCLKNDIQVTAYCPLGGAPDRPGATEGEKRPLSDPTVLELAKKYNATPGVILISYIIHRGLICIPKSVSSARLEENIKALNIKLSDEDFQLLDNLNVNIRSC 944
            I  +L++AL  GY  ID A VY NE++IG  L+   +   ++R+++F+TSKL    H  +  +    +++ NL  +YLDLYLIHWP   K         K  D  + V   ++WK +EKL  +G I SIG+SN+ I  I+ +L    + PA+LQ+E +      KL+EFC  N I + AY  L           G+ + L++  VL++A ++N TP  +L+ + +  G+  IPKS +   +  NI   +++LS ED  LLDNLN ++  C
Sbjct:   10 IYEALDAALGCGYRLIDTAAVYRNEEDIGRSLKRLYTKYGLRRKDIFITSKLAPRDHGIDKAEKACLKSIQNLGCEYLDLYLIHWPGVQKL--------KSDDPKNAVLRTESWKALEKLSFAGHISSIGISNYTIGHIEELLGFANVTPALLQVEFHPRLYQTKLLEFCQSNTITLQAYTSL-----------GQGKLLNESEVLQVACQHNVTPAQVLLKWALQHGVGVIPKSTNPKNITTNIDLSDLQLSAEDMALLDNLNSDLHFC 260          
BLAST of Aldo-keto reductase vs. Ensembl Medaka
Match: akr1a1b (aldo-keto reductase family 1 member A1 [Source:NCBI gene;Acc:101172969])

HSP 1 Score: 249.98 bits (637), Expect = 9.954e-81
Identity = 129/307 (42.02%), Postives = 188/307 (61.24%), Query Frame = 3
Query:   72 LNSGYDVPNFGLGTWLSKPGEIKASLESALNLGYNHIDCAWVYCNEKEIGGVLEDYISNGK-IKREELFVTSKLWNAFHRPELVKVGFEETLSNLRLDYLDLYLIHWPISIKPGNI-LPSADKFKDELDDVDLIKTWKEMEKLVDSGKIRSIGLSNFNIRQIQNILDHCKIKPAMLQIEVNIYFPNKKLVEFCLKNDIQVTAYCPLGGAPDRPGATEGEKRPLSDPTVLELAKKYNATPGVILISYIIHRGLICIPKSVSSARLEENIKALNIKLSDEDFQLLDNLNVNIRSCCPLMFKLHKNYPFD 986
            LN+G  +P  GLGTW S+PG++K ++  AL  GY HIDCA +Y NE EIG  L++ +   K ++RE++F+TSKLWN  H PE V+    +TL +L+L+YLDLYLIHWP   + G++  P  +      D +D   TW  MEKLV+ G +RSIGLSNFN RQ+ +IL    IKP +LQ+E + Y    +L+  C    + +TAY PL G+PDR      E   L +P V+ LA+KY  +P  IL+ +   RG++ IPKSV+ +R++ENI+  +  L  E+ + +  L+   R   P++    +  P D
Sbjct:    7 LNTGRKMPLVGLGTWKSEPGKVKQAVLWALEAGYRHIDCAAIYGNEAEIGEALKEMLGPSKPLRREDIFITSKLWNTRHHPEDVEPALLKTLKDLQLEYLDLYLIHWPHGFQRGDVPFPKKEDGSLIYDHIDYKLTWAAMEKLVEKGLVRSIGLSNFNSRQVDDILSVASIKPTVLQVESHPYLAQVELLAHCRNRGLVMTAYSPL-GSPDRAWKRPEEPVLLQEPVVISLAEKYQKSPAQILLRWQTQRGVVVIPKSVTESRIKENIQVFDFSLEAEEVKSITALDRGCRYIVPMIEVEGRRVPRD 312          
BLAST of Aldo-keto reductase vs. Ensembl Medaka
Match: akr1a1a (alcohol dehydrogenase [NADP(+)] A-like [Source:NCBI gene;Acc:101175168])

HSP 1 Score: 246.514 bits (628), Expect = 2.015e-79
Identity = 130/323 (40.25%), Postives = 190/323 (58.82%), Query Frame = 3
Query:   54 MSKSIKLNSGYDVPNFGLGTWLSKPGEIKASLESALNLGYNHIDCAWVYCNEKEIGGVLEDYISNGK-IKREELFVTSKLWNAFHRPELVKVGFEETLSNLRLDYLDLYLIHWPISIKPGN-ILPSADKFKDELDDVDLIKTWKEMEKLVDSGKIRSIGLSNFNIRQIQNILDHCKIKPAMLQIEVNIYFPNKKLVEFCLKNDIQVTAYCPLGGAPDRPGATEGEKRPLSDPTVLELAKKYNATPGVILISYIIHRGLICIPKSVSSARLEENIKALNIKLSDEDFQLLDNLNVNIRSCCPLMFK---------LHKNYPFDE 989
            M   + L+SG  +P  GLGTW S  G++K ++ +AL  GY HIDCA VY NE+EIG  L   +  GK ++REELFVTSKLWN  H PE V+     +L++L L YLDLYL+HWP++ + G  ++P  +       +     TWK ME LVD G +++IGLSNFN RQ++ I+   K KP + Q+E + Y     L+  C    I VTAY PLG   DRP A+  E   L DP +  +A++Y  +P  +++ + I RG+ CIPKSV+ +R+++N+   +  LS ED +L+++ +   R   P   K          H ++PF +
Sbjct:    1 MGTFVTLSSGQRMPMIGLGTWKSSAGQVKQAVVAALECGYRHIDCAAVYGNEQEIGEALALCVGPGKTLRREELFVTSKLWNTKHDPEDVEDACRTSLAHLGLSYLDLYLMHWPMAFQKGKELMPRRNDGTICYSNTHYRDTWKAMENLVDKGLVKAIGLSNFNARQMEEIIRVAKHKPVVNQVECHPYLSQADLLSHCQSLAICVTAYSPLGSG-DRPWASPDEPSLLEDPKLGVIAQRYQKSPAQVILRWHIQRGVACIPKSVTLSRIQQNLNVFDFNLSQEDMKLINSFSCKRRFIVPTAVKDGKTVWRDAEHPHFPFHD 322          
BLAST of Aldo-keto reductase vs. Ensembl Medaka
Match: akr1b1.1 (aldose reductase [Source:NCBI gene;Acc:101157264])

HSP 1 Score: 241.506 bits (615), Expect = 1.418e-77
Identity = 132/316 (41.77%), Postives = 204/316 (64.56%), Query Frame = 3
Query:   54 MSKSIKLNSGYDVPNFGLGTWLSKPGEIKASLESALNLGYNHIDCAWVYCNEKEIGGVLEDYISNGKIKREELFVTSKLWNAFHRPELVKVGFEETLSNLRLDYLDLYLIHWPISIKPG-NILPSADKFKDELDDVDLIKTWKEMEKLVDSGKIRSIGLSNFNIRQIQNILDH--CKIKPAMLQIEVNIYFPNKKLVEFCLKNDIQVTAYCPLGGAPDRPGATEGEKRPLSDPTVLELAKKYNATPGVILISYIIHRGLICIPKSVSSARLEENIKALNIKLSDEDFQLLDNLNVNIRSCCPLMFKLHKNYPFDED 992
            M  ++ L++G  +P  GLGTW    G++  +++ A++ GY HIDCA+VY NE+EIG  ++  I  G +KREELF+ SKLW+ FH P LVK   E+TLS+L+LDYLDLYL+H+P +++PG  + P  ++ +  LDD + + TW+ MEKLVD G +++IG+SNFN  QI+ IL+    K KP   QIE + Y   +K++ +C    I VTA+ PL G+P+RP A+  +   L +P + E+A KY  +   IL+ +   R ++ + KSV+ +R++ENI+  + +LS+ED   L ++N N R         HK+YPF+ +
Sbjct:    1 MMTTVTLSTGAKMPVVGLGTWRGGQGKVGEAVKLAISNGYRHIDCAYVYENEEEIGAAIQAMIDQGVVKREELFIVSKLWSTFHVPSLVKSACEKTLSDLKLDYLDLYLMHFPTAMRPGKELFPKDEENQTILDDTNFLDTWEAMEKLVDDGAVKAIGVSNFNKEQIEAILNKPGLKHKPVTNQIECHPYLNQEKMINYCKSKGIFVTAFAPL-GSPERPWASPEDPTLLEEPIIKEIAAKYKKSSAQILMKFHTQRSVVVLAKSVTPSRIKENIQLFDFELSEEDMAKLRSMNKNWRGFPAAWVAKHKHYPFNTE 315          
BLAST of Aldo-keto reductase vs. Ensembl Medaka
Match: akr1b1.2 (aldo-keto reductase family 1 member B10 [Source:NCBI gene;Acc:101167259])

HSP 1 Score: 238.424 bits (607), Expect = 2.384e-76
Identity = 136/317 (42.90%), Postives = 206/317 (64.98%), Query Frame = 3
Query:   54 MSKSIKLNSGYDVPNFGLGTWLSKPGEIKASLESALNLGYNHIDCAWVYCNEKEIGGVLEDYISNGKIKREELFVTSKLWNAFHRPELVKVGFEETLSNLRLDYLDLYLIHWPISIKPGN-ILPSADKFKDELDDVDLIKTWKEMEKLVDSGKIRSIGLSNFNIRQIQNILDH--CKIKPAMLQIEVNIYFPNKKLVEFCLKNDIQVTAYCPLGGAPDRPGATEGEKRPLSDPTVLELAKKYNATPGVILISYIIHRGLICIPKSVSSARLEENIKALNIKLSDEDFQLLDNLNVNIRSCCPLMFKL-HKNYPFDED 992
            M+K++KLN+G ++P  GLGTW S  G++  ++++A+  GY HID A+VY NE E+G  +   I  G +KRE+LF+ SKLW  FH   LV+   E+TLS+L+LDYLDLYL+HWP+  K G  + P     +   D+   ++TW+ ME+LVD+G +++IG+SNFN  QI+ IL+    K KPA  Q+E + Y   +KL+ +C    I VTAY PL G+PDRP A   +   L DP++  +A K+  TP  +LI + I R +I IPKS++  R++EN +  + +L+DE+ + +   N N R+ CP+ + L HK+YPF+ +
Sbjct:    1 MAKAVKLNTGVEMPIVGLGTWKSPAGKVAEAVKAAIAAGYRHIDGAYVYQNEAEVGEGVHAMIKEGVVKREDLFIVSKLWCTFHEKPLVRQACEKTLSDLKLDYLDLYLVHWPMGFKSGGELFPLNSDGETISDNTHFLETWEGMEELVDAGLVKAIGISNFNKEQIEAILNKPGLKYKPANNQVECHPYLTQEKLINYCQSQGISVTAYSPL-GSPDRPWAKPEDPSLLEDPSIKAIADKHKKTPAQVLIRFHIQRNVIVIPKSITPQRIQENFQVFDFELTDEEMKTILGFNKNWRA-CPMNWGLKHKDYPFNTE 315          
BLAST of Aldo-keto reductase vs. Ensembl Medaka
Match: AKR1D1 (3-oxo-5-beta-steroid 4-dehydrogenase [Source:NCBI gene;Acc:101170970])

HSP 1 Score: 234.572 bits (597), Expect = 1.013e-74
Identity = 127/325 (39.08%), Postives = 193/325 (59.38%), Query Frame = 3
Query:   42 LKLTMS-KSIKLNSGYDVPNFGLGTW---LSKP-GEIKASLESALNLGYNHIDCAWVYCNEKEIGGVLEDYISNGKIKREELFVTSKLWNAFHRPELVKVGFEETLSNLRLDYLDLYLIHWPISIKPGN-ILPSADKFKDELDDVDLIKTWKEMEKLVDSGKIRSIGLSNFNIRQIQNILDH--CKIKPAMLQIEVNIYFPNKKLVEFCLKNDIQVTAYCPLGGAPDRPGATEGEKRPLSDPTVLELAKKYNATPGVILISYIIHRGLICIPKSVSSARLEENIKALNIKLSDEDFQLLDNLNVNIRSCCPLMFKLHKNYPFDED 992
            ++LT +  SI L+ G  +P  GLGT+   ++ P G    +++ A+ +GY H D A VY NE E+G  + + I++G +KRE++F   KLWN FH PELV+   E+TL  L+LDY+DLY++  P + KPG+   P  +  K      DL  TW+ +E   D+G ++S+G+SNFN RQ++ IL+    K KP   Q+E + YF   KL+EFC +N+I +  Y PLG + D           L D  +  +AKKY+ T   + + + + RG++ IPKS +SAR++EN    +  LSDE+ + ++ LN NIR    LM+  H  YPF E+
Sbjct:    1 MELTATNHSIPLSDGNRIPLIGLGTYGDPITTPKGATSEAVKLAIEVGYRHFDGALVYFNEHEVGQAIREKIADGTVKREDIFYCGKLWNTFHPPELVRTALEKTLKTLQLDYVDLYIVELPTAFKPGDSFYPRDENGKYLYHTTDLCATWEALEACKDAGLVKSLGVSNFNKRQLELILNKPGLKHKPVSNQVECHPYFTQPKLLEFCRQNNIVIVGYSPLGTSRDASWVNLKCPPLLEDEVLKSVAKKYSKTTAQVCLRFNVQRGVVVIPKSFTSARIKENFDIFDFCLSDEEMKAIEGLNKNIRFVELLMWADHPEYPFHEE 325          
BLAST of Aldo-keto reductase vs. Planmine SMEST
Match: SMESG000081151.1 (SMESG000081151.1)

HSP 1 Score: 638.262 bits (1645), Expect = 0.000e+0
Identity = 313/313 (100.00%), Postives = 313/313 (100.00%), Query Frame = 3
Query:   54 MSKSIKLNSGYDVPNFGLGTWLSKPGEIKASLESALNLGYNHIDCAWVYCNEKEIGGVLEDYISNGKIKREELFVTSKLWNAFHRPELVKVGFEETLSNLRLDYLDLYLIHWPISIKPGNILPSADKFKDELDDVDLIKTWKEMEKLVDSGKIRSIGLSNFNIRQIQNILDHCKIKPAMLQIEVNIYFPNKKLVEFCLKNDIQVTAYCPLGGAPDRPGATEGEKRPLSDPTVLELAKKYNATPGVILISYIIHRGLICIPKSVSSARLEENIKALNIKLSDEDFQLLDNLNVNIRSCCPLMFKLHKNYPFDED 992
            MSKSIKLNSGYDVPNFGLGTWLSKPGEIKASLESALNLGYNHIDCAWVYCNEKEIGGVLEDYISNGKIKREELFVTSKLWNAFHRPELVKVGFEETLSNLRLDYLDLYLIHWPISIKPGNILPSADKFKDELDDVDLIKTWKEMEKLVDSGKIRSIGLSNFNIRQIQNILDHCKIKPAMLQIEVNIYFPNKKLVEFCLKNDIQVTAYCPLGGAPDRPGATEGEKRPLSDPTVLELAKKYNATPGVILISYIIHRGLICIPKSVSSARLEENIKALNIKLSDEDFQLLDNLNVNIRSCCPLMFKLHKNYPFDED
Sbjct:    1 MSKSIKLNSGYDVPNFGLGTWLSKPGEIKASLESALNLGYNHIDCAWVYCNEKEIGGVLEDYISNGKIKREELFVTSKLWNAFHRPELVKVGFEETLSNLRLDYLDLYLIHWPISIKPGNILPSADKFKDELDDVDLIKTWKEMEKLVDSGKIRSIGLSNFNIRQIQNILDHCKIKPAMLQIEVNIYFPNKKLVEFCLKNDIQVTAYCPLGGAPDRPGATEGEKRPLSDPTVLELAKKYNATPGVILISYIIHRGLICIPKSVSSARLEENIKALNIKLSDEDFQLLDNLNVNIRSCCPLMFKLHKNYPFDED 313          
BLAST of Aldo-keto reductase vs. Planmine SMEST
Match: SMESG000062723.1 (SMESG000062723.1)

HSP 1 Score: 497.664 bits (1280), Expect = 1.763e-178
Identity = 234/310 (75.48%), Postives = 270/310 (87.10%), Query Frame = 3
Query:   63 SIKLNSGYDVPNFGLGTWLSKPGEIKASLESALNLGYNHIDCAWVYCNEKEIGGVLEDYISNGKIKREELFVTSKLWNAFHRPELVKVGFEETLSNLRLDYLDLYLIHWPISIKPGNILPSADKFKDELDDVDLIKTWKEMEKLVDSGKIRSIGLSNFNIRQIQNILDHCKIKPAMLQIEVNIYFPNKKLVEFCLKNDIQVTAYCPLGGAPDRPGATEGEKRPLSDPTVLELAKKYNATPGVILISYIIHRGLICIPKSVSSARLEENIKALNIKLSDEDFQLLDNLNVNIRSCCPLMFKLHKNYPFDED 992
            ++KL SG+++P FGLGTWLSKPGE+K ++E+ALNLGY  IDCAW YCNE EIG VLE YIS GK+KREELFVTSKLWN+FHRPELVKVG EETL NL+L YLDL+LIH PIS KPGN+ P ADKFKDE++DVDL++TWK ME LVDSGK+RSIG+SNFNI+Q+QNILDH +IKPAM Q+EVNIYFPNKKLVEFCLKN +Q+TAY PLGGAP+RP   E  +RPL DP VLELA+KYNAT G ILI+Y IHRGL+ IPKSVS+ RLEENIKALNIKL+DEDFQ LD+LNVNIR C P +FK+HKNYPF ED
Sbjct:    3 TVKLKSGHEMPIFGLGTWLSKPGEVKLAVENALNLGYKLIDCAWAYCNESEIGEVLERYISGGKVKREELFVTSKLWNSFHRPELVKVGLEETLRNLKLSYLDLFLIHTPISYKPGNLFPDADKFKDEIEDVDLVETWKAMENLVDSGKVRSIGVSNFNIKQVQNILDHSRIKPAMNQVEVNIYFPNKKLVEFCLKNGVQITAYSPLGGAPNRPIEGEKLRRPLEDPKVLELAQKYNATAGQILITYTIHRGLVTIPKSVSALRLEENIKALNIKLTDEDFQKLDSLNVNIRMCNPELFKMHKNYPFGED 312          
BLAST of Aldo-keto reductase vs. Planmine SMEST
Match: SMESG000015779.1 (SMESG000015779.1)

HSP 1 Score: 150.599 bits (379), Expect = 8.213e-43
Identity = 94/294 (31.97%), Postives = 159/294 (54.08%), Query Frame = 3
Query:   66 IKLNSGYDVPNFGLGTWL-SKPGEIKASLESALNLGYNHIDCAWVYCNEKEIGGVLEDYISNGKIKREELFVTSKLWNAFHRPELVKVGFEETLSNLRLDYLDLYLIHWPISIKPGNILPSADKFKDELDDVDLIKTWKEMEKLVDSGKIRSIGLSNFNIRQIQNILDHCKIKPAMLQIEVNIYFPNKKLVEFCLKNDIQVTAYCPLGGAPDRPGATEGEKRPLSDPTVLELAKKYNATPGVILISYIIHRGLICIPKSVSSARLEENIKALNIKLSDEDFQLLDNLNVNIRSC 944
            I LN  + +P+   GT+L ++   ++  L+ AL  GY  ID A VY NE  +G +L+  +    +KRE++F+T+KL  +    E  K   + +L  L+L+YLDLYLIHWP + K    L S +  ++         +WK ME+    G IRSIG+SN+ I+ ++ + ++  I P++ Q+E + +    +LV+FC  N+I   AY  L       G T    + +   TV +LA+    +P  IL+ + I++G   +PKS +   +E+NI+  + +L+ +  + L  +N   R C
Sbjct:    2 ITLNDKFKIPSVLFGTYLINEENLLEECLDKALVSGYRGIDTAAVYRNEAFLGKILKSKLLKYNLKREDIFITTKLAPSEQGYEKAKAAIKNSLDKLQLEYLDLYLIHWPGTSKLD--LTSLEHLENRKG------SWKAMEEAKKIGLIRSIGVSNYMIKHLEEMKNYANILPSVNQVECHPFLNQHELVKFCQANNIHFQAYSSL-------GTTANHLKLIEHSTVQKLAQLLQRSPAQILLKWAINQGFSVLPKSTNLEHIEKNIQLFDWQLTVQQMKELFEMNKEERFC 280          
The following BLAST results are available for this feature:
BLAST of Aldo-keto reductase vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
AKR1A16.558e-8442.63aldo-keto reductase family 1 member A1 [Source:HGN... [more]
AKR1A16.558e-8442.63aldo-keto reductase family 1 member A1 [Source:HGN... [more]
AKR1A16.558e-8442.63aldo-keto reductase family 1 member A1 [Source:HGN... [more]
AKR1B103.574e-8240.82aldo-keto reductase family 1 member B10 [Source:HG... [more]
AKR1C27.056e-7940.44aldo-keto reductase family 1 member C2 [Source:HGN... [more]
back to top
BLAST of Aldo-keto reductase vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Y39G8B.11.488e-8443.17pep chromosome:WBcel235:II:13970584:13972970:-1 ge... [more]
Y39G8B.13.409e-8343.58pep chromosome:WBcel235:II:13970789:13972970:-1 ge... [more]
T08H10.17.348e-7641.90pep chromosome:WBcel235:V:4483459:4486543:1 gene:W... [more]
C07D8.64.837e-5634.56pep chromosome:WBcel235:X:7341509:7342780:1 gene:W... [more]
Y39G8B.22.072e-5431.89pep chromosome:WBcel235:II:13973690:13976221:-1 ge... [more]
back to top
BLAST of Aldo-keto reductase vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
CG60841.181e-8046.33gene:FBgn0086254 transcript:FBtr0331547[more]
CG60841.435e-8046.15gene:FBgn0086254 transcript:FBtr0076139[more]
CG108639.890e-7841.16gene:FBgn0027552 transcript:FBtr0073171[more]
CG60831.996e-7638.83gene:FBgn0036183 transcript:FBtr0076137[more]
CG60843.096e-7645.75gene:FBgn0086254 transcript:FBtr0331546[more]
back to top
BLAST of Aldo-keto reductase vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
akr1a1a5.280e-9544.58aldo-keto reductase family 1, member A1a (aldehyde... [more]
akr1a1a8.065e-9544.58aldo-keto reductase family 1, member A1a (aldehyde... [more]
akr1b1.25.056e-8144.55aldo-keto reductase family 1, member B1 (aldose re... [more]
akr1b1.18.204e-8142.17aldo-keto reductase family 1, member B1 (aldose re... [more]
akr1b1.11.788e-7943.58aldo-keto reductase family 1, member B1 (aldose re... [more]
back to top
BLAST of Aldo-keto reductase vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
akr1b11.729e-7743.69aldo-keto reductase family 1, member B1 (aldose re... [more]
tm4sf54.415e-7539.43transmembrane 4 L six family member 5 [Source:Xenb... [more]
akr1c8p5.014e-7437.85aldo-keto reductase family 1, member C8, pseudogen... [more]
akr1c28.150e-7438.08aldo-keto reductase family 1, member C2 [Source:NC... [more]
nudt21.542e-7239.72nudix hydrolase 2 [Source:Xenbase;Acc:XB-GENE-1008... [more]
back to top
BLAST of Aldo-keto reductase vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Akr1a12.214e-8542.63aldo-keto reductase family 1, member A1 (aldehyde ... [more]
Akr1b38.174e-8444.62aldo-keto reductase family 1, member B3 (aldose re... [more]
Akr1c185.453e-8342.04aldo-keto reductase family 1, member C18 [Source:M... [more]
Akr1c65.970e-8240.75aldo-keto reductase family 1, member C6 [Source:MG... [more]
Akr1c205.388e-8040.75aldo-keto reductase family 1, member C20 [Source:M... [more]
back to top
BLAST of Aldo-keto reductase vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q6AZW2|A1A1A_DANRE3.986e-9444.58Aldo-keto reductase family 1 member A1-A OS=Danio ... [more]
sp|O70473|AK1A1_CRIGR4.557e-8542.49Aldo-keto reductase family 1 member A1 OS=Cricetul... [more]
sp|P50578|AK1A1_PIG7.022e-8542.63Aldo-keto reductase family 1 member A1 OS=Sus scro... [more]
sp|Q9JII6|AK1A1_MOUSE1.549e-8442.63Aldo-keto reductase family 1 member A1 OS=Mus musc... [more]
sp|P51635|AK1A1_RAT2.578e-8442.31Aldo-keto reductase family 1 member A1 OS=Rattus n... [more]
back to top
BLAST of Aldo-keto reductase vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A0A9W9J76.517e-10450.65Aldose reductase OS=Lygus hesperus OX=30085 GN=AKR... [more]
Q5DD641.232e-10350.00Aldo-keto reductase family 1 member B10 isoform 2 ... [more]
C1LRF32.010e-10350.00Aldo-keto reductase family 1, member B4 (Aldose re... [more]
C1LRF42.067e-10249.68Aldo-keto reductase family 1, member B4 (Aldose re... [more]
A0A226F4567.093e-10147.38Aldose reductase OS=Folsomia candida OX=158441 GN=... [more]
back to top
BLAST of Aldo-keto reductase vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ENSAMXT00000039994.14.079e-8742.41aldose reductase-like [Source:NCBI gene;Acc:103040... [more]
akr1b1.27.961e-8645.74aldose reductase-like [Source:NCBI gene;Acc:103035... [more]
ENSAMXT00000046832.16.776e-8442.72aldose reductase-like [Source:NCBI gene;Acc:103040... [more]
ENSAMXT00000052600.11.793e-8243.96aldose reductase-like [Source:NCBI gene;Acc:103040... [more]
AKR1B11.605e-8041.46aldo-keto reductase family 1 member B [Source:HGNC... [more]
back to top
BLAST of Aldo-keto reductase vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 5
Match NameE-valueIdentityDescription
akr1a1b1.385e-6844.80aldo-keto reductase family 1, member A1b (aldehyde... [more]
ENSPMAT00000005212.19.369e-5940.60pep scaffold:Pmarinus_7.0:GL480334:1640:10257:1 ge... [more]
zgc:1107821.481e-5333.56zgc:110782 [Source:ZFIN;Acc:ZDB-GENE-050320-51][more]
ENSPMAT00000009052.15.466e-5240.36pep scaffold:Pmarinus_7.0:GL484886:6662:24104:-1 g... [more]
akr1b1.13.882e-2933.81aldo-keto reductase family 1, member B1 (aldose re... [more]
back to top
BLAST of Aldo-keto reductase vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 5
Match NameE-valueIdentityDescription
GCY11.460e-6238.41Glycerol dehydrogenase; involved in an alternative... [more]
GRE32.899e-5737.58Aldose reductase; involved in methylglyoxal, d-xyl... [more]
YPR14.291e-5735.76NADPH-dependent aldo-keto reductase; reduces multi... [more]
ARA13.942e-5235.22NADP+ dependent arabinose dehydrogenase; involved ... [more]
YJR096W_mRNA4.035e-4230.61Xylose and arabinose reductase; member of the aldo... [more]
back to top
BLAST of Aldo-keto reductase vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
EDO451572.687e-7242.02Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO269533.714e-7241.72Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO364113.707e-6140.82Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO459401.340e-5535.57Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO436481.375e-4735.56Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Aldo-keto reductase vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
akr1a1b9.954e-8142.02aldo-keto reductase family 1 member A1 [Source:NCB... [more]
akr1a1a2.015e-7940.25alcohol dehydrogenase [NADP(+)] A-like [Source:NCB... [more]
akr1b1.11.418e-7741.77aldose reductase [Source:NCBI gene;Acc:101157264][more]
akr1b1.22.384e-7642.90aldo-keto reductase family 1 member B10 [Source:NC... [more]
AKR1D11.013e-7439.083-oxo-5-beta-steroid 4-dehydrogenase [Source:NCBI ... [more]
back to top
BLAST of Aldo-keto reductase vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 3
Match NameE-valueIdentityDescription
SMESG000081151.10.000e+0100.00SMESG000081151.1[more]
SMESG000062723.11.763e-17875.48SMESG000062723.1[more]
SMESG000015779.18.213e-4331.97SMESG000015779.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30015739 ID=SMED30015739|Name=Aldo-keto reductase|organism=Schmidtea mediterranea sexual|type=transcript|length=1068bp
TATGCATCTAGTACGTATTATAGTTTTATTAAATTAAATTACTTAAATTA
ACAATGTCCAAATCTATCAAATTGAATAGCGGTTATGATGTACCAAATTT
TGGTTTAGGCACTTGGTTGTCGAAGCCAGGTGAAATTAAAGCTTCTTTAG
AAAGTGCTCTTAATTTAGGTTACAATCACATTGATTGCGCATGGGTGTAT
TGCAACGAGAAAGAAATAGGAGGGGTTTTAGAAGACTATATTTCAAATGG
TAAAATTAAACGAGAAGAATTATTCGTAACTAGCAAGCTATGGAATGCAT
TTCATCGGCCAGAACTAGTGAAAGTCGGATTTGAAGAAACACTTAGTAAT
CTCCGATTAGATTATTTAGATTTATATCTGATTCATTGGCCTATATCAAT
AAAGCCTGGAAACATCTTACCATCTGCCGATAAATTTAAAGACGAACTCG
ATGATGTCGATTTAATTAAAACTTGGAAGGAAATGGAAAAACTCGTTGAT
TCAGGAAAAATTAGATCAATCGGATTGTCTAATTTCAATATTAGACAAAT
TCAAAATATTCTTGATCATTGCAAAATTAAACCAGCAATGCTTCAAATTG
AGGTCAATATTTATTTTCCGAATAAAAAACTAGTGGAATTTTGCCTGAAA
AATGATATTCAAGTCACTGCATATTGTCCATTAGGGGGTGCACCAGATCG
ACCTGGAGCGACAGAGGGAGAAAAACGTCCTCTTAGTGATCCAACAGTTT
TAGAGTTAGCTAAAAAATATAATGCAACACCTGGAGTAATATTGATAAGC
TATATTATTCATCGGGGTTTGATCTGCATTCCTAAGAGTGTATCCTCAGC
CAGATTGGAGGAAAACATTAAAGCTCTGAATATTAAACTGTCTGACGAGG
ACTTTCAACTGCTAGACAATTTAAATGTCAACATTCGATCGTGTTGTCCC
TTAATGTTTAAATTGCACAAAAATTATCCATTTGATGAAGATTAGGTAAA
ACAAATTTGGTGAACATTTATCAACATTTAAATAATTTTGGTAATAAATT
TAGAATTTGGAAAAAAAA
back to top

protein sequence of SMED30015739-orf-1

>SMED30015739-orf-1 ID=SMED30015739-orf-1|Name=SMED30015739-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=314bp
MSKSIKLNSGYDVPNFGLGTWLSKPGEIKASLESALNLGYNHIDCAWVYC
NEKEIGGVLEDYISNGKIKREELFVTSKLWNAFHRPELVKVGFEETLSNL
RLDYLDLYLIHWPISIKPGNILPSADKFKDELDDVDLIKTWKEMEKLVDS
GKIRSIGLSNFNIRQIQNILDHCKIKPAMLQIEVNIYFPNKKLVEFCLKN
DIQVTAYCPLGGAPDRPGATEGEKRPLSDPTVLELAKKYNATPGVILISY
IIHRGLICIPKSVSSARLEENIKALNIKLSDEDFQLLDNLNVNIRSCCPL
MFKLHKNYPFDED*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000028Category 2 cell
PLANA:0000429neoblast
PLANA:0002032epidermal cell
PLANA:0003116parenchymal cell
Vocabulary: INTERPRO
TermDefinition
IPR036812NADP_OxRdtase_dom_sf
IPR020471Aldo/keto_reductase
IPR023210NADP_OxRdtase_dom
IPR018170Aldo/ket_reductase_CS
Vocabulary: molecular function
TermDefinition
GO:0016491oxidoreductase activity
GO:0004032alditol:NADP+ 1-oxidoreductase activity
Vocabulary: biological process
TermDefinition
GO:0055114oxidation-reduction process
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR020471Aldo/keto reductasePRINTSPR00069ALDKETRDTASEcoord: 226..250
score: 30.87
coord: 95..113
score: 66.44
coord: 144..161
score: 54.31
coord: 35..59
score: 48.24
coord: 178..207
score: 37.37
IPR020471Aldo/keto reductasePIRSFPIRSF000097AKRcoord: 1..313
e-value: 3.2E-104
score: 345.8
IPR020471Aldo/keto reductasePANTHERPTHR11732ALDO/KETO REDUCTASEcoord: 4..301
IPR036812NADP-dependent oxidoreductase domain superfamilyGENE3DG3DSA:3.20.20.100coord: 2..313
e-value: 2.2E-116
score: 389.9
IPR036812NADP-dependent oxidoreductase domain superfamilySUPERFAMILYSSF51430NAD(P)-linked oxidoreductasecoord: 1..310
IPR023210NADP-dependent oxidoreductase domainPFAMPF00248Aldo_ket_redcoord: 18..290
e-value: 9.5E-53
score: 179.3
IPR023210NADP-dependent oxidoreductase domainCDDcd06660Aldo_ket_redcoord: 5..290
e-value: 1.64149E-75
score: 231.294
NoneNo IPR availablePANTHERPTHR11732:SF387coord: 4..301
IPR018170Aldo/keto reductase, conserved sitePROSITEPS00062ALDOKETO_REDUCTASE_2coord: 144..161
IPR018170Aldo/keto reductase, conserved sitePROSITEPS00063ALDOKETO_REDUCTASE_3coord: 259..274