sh3bp2

Overview
Namesh3bp2 (AGS83419.1)
Smed IDSMED30015735
Length (bp)1378
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of sh3bp2 (SMED30015735) t-SNE clustered cells

Violin plots show distribution of expression levels for sh3bp2 (SMED30015735) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of sh3bp2 (SMED30015735) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for sh3bp2 (SMED30015735) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30015735

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 5

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
headSMED30015735SMESG000006104.1 SMESG000006094.1 SMESG000006092.1 SmedASXL_018150SmedAsxl_ww_GCZZ01PMID:27034770
Currie et al., 2016
whole organism asexual adult RNA-sequencing evidence
epidermal cellSMED30015735SMESG000006104.1 SMESG000006094.1 SMESG000006092.1 dd_Smed_v4_5899_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
headSMED30015735SMESG000006104.1 SMESG000006094.1 SMESG000006092.1 KF134122smed_ncbi_20200123PMID:23903188
Currie et al., 2013
whole organism asexual adult colorimetric in situ hybridization evidence
epidermisSMED30015735SMESG000006104.1 SMESG000006094.1 SMESG000006092.1 dd_Smed_v4_5899_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
dorsal region of the epidermisSMED30015735SMESG000006104.1 SMESG000006094.1 SMESG000006092.1 dd_Smed_v4_5899_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of sh3bp2 vs. TrEMBL
Match: S5WMZ9 (Sh3bp2 OS=Schmidtea mediterranea OX=79327 PE=2 SV=1)

HSP 1 Score: 600.127 bits (1546), Expect = 0.000e+0
Identity = 307/315 (97.46%), Postives = 308/315 (97.78%), Query Frame = 1
Query:   88 MLKEPAQSLLRKPNITFSGILETSKTSKMSLHKWVKCYVIVFEGNIYIYENCFSESPKSTNVLSKFKEFHVLKNRKKSPLWVFILQPIDNANSQLSFAAPSEQEMLYVIGKFKEGMMHSQSQLSAPNVNFTXXXXXXXXXXXXXATLNFQSNLPPIPKGIHPNERLMENCIETNNEKILKIDNRNSVCAPPYPNINALTLERRDDLPPIPSESHSEEICMRDFIFNGTREEAAAVLSKVQQIGGYLIRVQGDRQVLSVQTERGIVKYVLDKNPLTERVSIQGSGNEFYNLTDLVKHYYTNNIPNYTCRLKCPYGS 1032
            MLKEPAQSLLRKPNITFSGILETSKTSKMSLHKWVKCYVIVFEGNIYIYENC SESPKSTNVLSKF EFHVLKNRKKSPLWVFILQPIDNANSQLSFAAPSEQEMLYVIGKFKEGMMHSQSQLSAPNVNFTNPEIYPPYPIINNA LNFQSNLPPIPKGIHPNERLMENCIETNNEKILK DNRNSVCAPPYPNINALTL+RRDDLPPIPSESHSEEICMRDFIFNGTREEAAAVLSKVQQIGGYLIRVQGDRQVLSVQTERGIVKY L KNPLTERVSIQG GNEFYNLTDLVKHYYTNNIPNYTCRLKCPYGS
Sbjct:    1 MLKEPAQSLLRKPNITFSGILETSKTSKMSLHKWVKCYVIVFEGNIYIYENCLSESPKSTNVLSKFNEFHVLKNRKKSPLWVFILQPIDNANSQLSFAAPSEQEMLYVIGKFKEGMMHSQSQLSAPNVNFTNPEIYPPYPIINNANLNFQSNLPPIPKGIHPNERLMENCIETNNEKILKFDNRNSVCAPPYPNINALTLDRRDDLPPIPSESHSEEICMRDFIFNGTREEAAAVLSKVQQIGGYLIRVQGDRQVLSVQTERGIVKYKLYKNPLTERVSIQGFGNEFYNLTDLVKHYYTNNIPNYTCRLKCPYGS 315          
BLAST of sh3bp2 vs. Planmine SMEST
Match: SMESG000006104.1 (SMESG000006104.1)

HSP 1 Score: 600.512 bits (1547), Expect = 0.000e+0
Identity = 307/318 (96.54%), Postives = 308/318 (96.86%), Query Frame = 1
Query:   79 MSVMLKEPAQSLLRKPNITFSGILETSKTSKMSLHKWVKCYVIVFEGNIYIYENCFSESPKSTNVLSKFKEFHVLKNRKKSPLWVFILQPIDNANSQLSFAAPSEQEMLYVIGKFKEGMMHSQSQLSAPNVNFTXXXXXXXXXXXXXATLNFQSNLPPIPKGIHPNERLMENCIETNNEKILKIDNRNSVCAPPYPNINALTLERRDDLPPIPSESHSEEICMRDFIFNGTREEAAAVLSKVQQIGGYLIRVQGDRQVLSVQTERGIVKYVLDKNPLTERVSIQGSGNEFYNLTDLVKHYYTNNIPNYTCRLKCPYGS 1032
            MSVMLKEPAQSLLRKPNITFSGILETSKTSKMSLHKWVK YVIVFEGNIYIYENC SESPKSTNVLSKFKEFHVLKNRKKSPLWVFILQPIDN  SQLSFAAPSEQEMLYVIGKFKEGMMHSQSQLSAPNVNFTNP IYPPYPIINNA LNFQSNLPPIPKGIHPNERLMENCIETNNEKIL IDNRNSVCAPPYPNINALTLERRDDLPPIPSESHSEEICMRDFIFNGTREEAAAVLSKVQQIGGYLIRVQGDRQVLSVQTERGIVKY L KNPLTERVS+QG GNEFYNLTDLVKHYYTNNIPNYTCRLKCPYGS
Sbjct:    1 MSVMLKEPAQSLLRKPNITFSGILETSKTSKMSLHKWVKYYVIVFEGNIYIYENCLSESPKSTNVLSKFKEFHVLKNRKKSPLWVFILQPIDNETSQLSFAAPSEQEMLYVIGKFKEGMMHSQSQLSAPNVNFTNPGIYPPYPIINNANLNFQSNLPPIPKGIHPNERLMENCIETNNEKILTIDNRNSVCAPPYPNINALTLERRDDLPPIPSESHSEEICMRDFIFNGTREEAAAVLSKVQQIGGYLIRVQGDRQVLSVQTERGIVKYKLYKNPLTERVSVQGFGNEFYNLTDLVKHYYTNNIPNYTCRLKCPYGS 318          
BLAST of sh3bp2 vs. Planmine SMEST
Match: SMESG000006092.1 (SMESG000006092.1)

HSP 1 Score: 592.423 bits (1526), Expect = 0.000e+0
Identity = 302/318 (94.97%), Postives = 308/318 (96.86%), Query Frame = 1
Query:   79 MSVMLKEPAQSLLRKPNITFSGILETSKTSKMSLHKWVKCYVIVFEGNIYIYENCFSESPKSTNVLSKFKEFHVLKNRKKSPLWVFILQPIDNANSQLSFAAPSEQEMLYVIGKFKEGMMHSQSQLSAPNVNFTXXXXXXXXXXXXXATLNFQSNLPPIPKGIHPNERLMENCIETNNEKILKIDNRNSVCAPPYPNINALTLERRDDLPPIPSESHSEEICMRDFIFNGTREEAAAVLSKVQQIGGYLIRVQGDRQVLSVQTERGIVKYVLDKNPLTERVSIQGSGNEFYNLTDLVKHYYTNNIPNYTCRLKCPYGS 1032
            MSVMLKEPAQSLLRKPNITFSGILE +K SKMS H WV+CYVIVFEGNIYIYENCFSESPKSTNVLSKFKEFHVLKNRKKSPLWVFILQPIDN  SQLSFAAPSEQEMLYVIGKFKEGMMHSQS LSAPNVNFTNP IYPPYPIIN+ATLNFQSNLPPIPKGIHPNERLMENCIETNN+K+L IDNRNSVCAP YPNINALTLERR+DLPPIPSESHSEEICMRDFIFNGTREEAAAVLSKVQQIGGYLIRVQGDRQVLSVQTERGIVKYVLDKNPLTERVSIQGSGNEFYNLTDLVKHYYTNNIPNYTCRLKCPYGS
Sbjct:    1 MSVMLKEPAQSLLRKPNITFSGILE-NKISKMSFHIWVRCYVIVFEGNIYIYENCFSESPKSTNVLSKFKEFHVLKNRKKSPLWVFILQPIDNETSQLSFAAPSEQEMLYVIGKFKEGMMHSQSHLSAPNVNFTNPGIYPPYPIINSATLNFQSNLPPIPKGIHPNERLMENCIETNNKKVLTIDNRNSVCAPLYPNINALTLERRNDLPPIPSESHSEEICMRDFIFNGTREEAAAVLSKVQQIGGYLIRVQGDRQVLSVQTERGIVKYVLDKNPLTERVSIQGSGNEFYNLTDLVKHYYTNNIPNYTCRLKCPYGS 317          
BLAST of sh3bp2 vs. Planmine SMEST
Match: SMESG000006094.1 (SMESG000006094.1)

HSP 1 Score: 403.29 bits (1035), Expect = 6.973e-138
Identity = 212/234 (90.60%), Postives = 220/234 (94.02%), Query Frame = 1
Query:   79 MSVMLKEPAQSLLRKPNITFSGILETSKTSKMSLHKWVKCYVIVFEGNIYIYENCFSESPKSTNVLSKFKEFHVLKNRKKSPLWVFILQPIDNANSQLSFAAPSEQEMLYVIGKFKEGMMHSQSQLSAPNVNFTXXXXXXXXXXXXXATLNFQSNLPPIPKGIHPNERLMENCIETNNEKILKIDNRNSVCAPPYPNINALTLERRDDLPPIPSESHSEEICMRDFIFNGTREE 780
            MSVMLKEPAQSLLRKPNITFSGILE +K SKMS H WV+CYVIVFEGNIYIYENCFSESPKSTNVLS+FKEFHVLKNRKKSPLWVFILQPI+ AN+QLSFAAPSEQEMLYVIGKFKEGMMHSQS LSA NVNFTNP IYPPYPIINNA LNFQSNLPPIPKGIHPNERLMENC ETNNE++L IDNRN VCAPPYPNINALTLERR+DLPPIPSESHSEEIC  DFIFNGTREE
Sbjct:    1 MSVMLKEPAQSLLRKPNITFSGILE-NKISKMSFHIWVRCYVIVFEGNIYIYENCFSESPKSTNVLSEFKEFHVLKNRKKSPLWVFILQPINKANAQLSFAAPSEQEMLYVIGKFKEGMMHSQSHLSAQNVNFTNPGIYPPYPIINNANLNFQSNLPPIPKGIHPNERLMENCRETNNEEVLTIDNRNFVCAPPYPNINALTLERRNDLPPIPSESHSEEICKSDFIFNGTREE 233          

HSP 2 Score: 327.791 bits (839), Expect = 2.233e-108
Identity = 159/171 (92.98%), Postives = 162/171 (94.74%), Query Frame = 1
Query:  520 ATLNFQSNLPPIPKGIHPNERLMENCIETNNEKILKIDNRNSVCAPPYPNINALTLERRDDLPPIPSESHSEEICMRDFIFNGTREEAAAVLSKVQQIGGYLIRVQGDRQVLSVQTERGIVKYVLDKNPLTERVSIQGSGNEFYNLTDLVKHYYTNNIPNYTCRLKCPYGS 1032
            ATLNFQSNLPPIPKGIHPNERLMENCIETNNEKIL IDNRNSVCAPPYPNINA TL RRD+L PIPSESHSE+ICMRDFIFNGTREEAAAVLSKVQQIGGYLIRVQGDRQVLSVQTER IVKY L +NPLTERVSI GS NEFYNLTDLVKHYYTNNIPNYTCRLKCPYGS
Sbjct:  249 ATLNFQSNLPPIPKGIHPNERLMENCIETNNEKILTIDNRNSVCAPPYPNINAHTLVRRDNLHPIPSESHSEKICMRDFIFNGTREEAAAVLSKVQQIGGYLIRVQGDRQVLSVQTERAIVKYELYENPLTERVSIPGSRNEFYNLTDLVKHYYTNNIPNYTCRLKCPYGS 419          
BLAST of sh3bp2 vs. Planmine SMEST
Match: SMESG000072396.1 (SMESG000072396.1)

HSP 1 Score: 172.17 bits (435), Expect = 9.640e-50
Identity = 108/315 (34.29%), Postives = 174/315 (55.24%), Query Frame = 1
Query:   85 VMLKEPAQSLLRKPNITFSGILETSKTSKMSLHKWVKCYVIVFEGNIYIYENCFSESPKSTNVLSKFKEFHVLKNRKKSPLWVFILQPIDNANSQLSFAAPSEQEMLYVIGKFKEGMMHSQ-SQLSAPNVNFTXXXXXXXXXXXXXATLNFQSNLPPIPKGIHPNERLMENCIETNNEKILKIDNRNSVCAPPYPNINALTLERRDDLPPIPSESHSEEICMRDFIFNGTREEAAAVLSKVQQIGGYLIRVQGDRQVLSVQTERGIVKYVLDKNPLTERVSIQGSGNEFYNLTDLVKHYYTNNIPNYTCRLKCPY 1026
            V  K PAQ LL+  ++TFSG LE  K + +S   W+KCYV++  GNIYIY +  S  P    +L  F +  ++KNR + P WVF L+P+ ++  +L FAA SE+EM + I +FK G++ S+ +QL   +   ++            +T++ ++ +  +   +H ++    N  E  ++ I +I+  N    P YP     TL + D+L  + S++  E +     IF GTREEA + L K   +G YL+R    RQ+L+V+ E  IVKY L  +P T+R+ I G    F N+  L+ +Y+ + +PN  C+L  P+
Sbjct:    6 VFHKLPAQILLQDSSVTFSGYLE-RKITMLSFKHWIKCYVVISNGNIYIYSSSTSPKPVLVCILGAFHQIQIIKNRIQPPFWVFTLKPLIDSVPELKFAAASEREMNFWISEFKLGIILSKNTQLKDDSERISSQSCKNNMEGSIYSTVSERNEI--VDTLLHSDKI---NIYEEPDDLIFQINPVNPTAPPLYP-----TLTQFDNL-SLKSDTSDENV--EYVIFYGTREEAFSELLKRPYLGSYLVRQDNGRQILTVKCESNIVKYCLLSDPKTDRIHIAGQKESFENVYHLLSYYHEHYLPNQNCKLLIPF 306          
BLAST of sh3bp2 vs. Planmine SMEST
Match: SMESG000072391.1 (SMESG000072391.1)

HSP 1 Score: 97.0561 bits (240), Expect = 2.772e-22
Identity = 91/318 (28.62%), Postives = 137/318 (43.08%), Query Frame = 1
Query:  103 AQSLLRKPNITFSGILETSKTSKMSLHKWVKCYVIVFEGNIYIYENCFSESPKSTNVLSKFKEFHVLKNRKKSPLWVFILQPIDNANS--QLSFAAPSEQEMLYVIGKFKEGMMHSQSQLSAPNVNFTXXXXXXXXXXXXXATLNFQSNLPPIPKGIHPNERLMENCIETNNEKILKIDNRNSVCAPPYPNINALTLERRDDLPPIPS--------ESHSEEICMRDFIFNGTREEAAAVLSKVQQIGGYLIRVQGDRQVLSVQTERGIVKYVLDKNPLTERVSIQGSGNEFYNLTDLVKHYYTNNIPNYTCRLKCPY 1026
            AQ+L       F+G L   K S +    WVK Y I+F+G+ Y+Y N  ++ PK   +L+   +  +  NRK   +  F +    N NS  QL F   S++ +  ++  F E +          N  FT+ E             +F+ +L  +    H      EN +   NE++   D       P  P I         DL    S        +S +  I + D IF GT  EA   L K    G YL+R + + + L+VQT   ++KYVL  N     V IQ    +F +L DL+ +Y+ N+IP   C+L  PY
Sbjct:    8 AQTLRATDEKRFAGDL-FHKVSHLGSKTWVKVYTILFKGSFYVYSNVDAKQPKMVVILTASSKVEITSNRKNRYMLSFTVFSNSNDNSIRQLKFGTYSQEILSTLMKSFNESINR------GANNYFTSNEPN-----------DFKMSLNRVNSNTH-----FENNV---NEELFIYD------MPERPVIGFKNGMPDFDLSETSSQNSIYLSIDSETYNINLDDVIFKGTSYEAYQELEKNVCYGAYLVREENNAKRLTVQTRDEVLKYVLITNTNNNFVQIQNQEMKFNSLQDLLAYYHKNDIPGRKCKLVIPY 293          
The following BLAST results are available for this feature:
BLAST of sh3bp2 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of sh3bp2 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of sh3bp2 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of sh3bp2 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of sh3bp2 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of sh3bp2 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of sh3bp2 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of sh3bp2 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 1
Match NameE-valueIdentityDescription
S5WMZ90.000e+097.46Sh3bp2 OS=Schmidtea mediterranea OX=79327 PE=2 SV=... [more]
back to top
BLAST of sh3bp2 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of sh3bp2 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of sh3bp2 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of sh3bp2 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of sh3bp2 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of sh3bp2 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000006104.10.000e+096.54SMESG000006104.1[more]
SMESG000006092.10.000e+094.97SMESG000006092.1[more]
SMESG000006094.16.973e-13890.60SMESG000006094.1[more]
SMESG000072396.19.640e-5034.29SMESG000072396.1[more]
SMESG000072391.12.772e-2228.62SMESG000072391.1[more]
back to top
Cross References
External references for this transcript
DatabaseAccession
SmedGD GBrowseSMED30015735
GenBankAGS83419.1
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30015735 ID=SMED30015735|Name=sh3bp2|organism=Schmidtea mediterranea sexual|type=transcript|length=1378bp
TACGCAAATGACGCAGATTAAGGTTACGTTAAAATGAACTAAATTTAAAA
CCAATTTCACTACAATTTTGTTTAAATAATGAGCGTCATGTTAAAGGAAC
CTGCTCAGAGTTTATTAAGAAAACCAAACATAACGTTTTCAGGAATTCTA
GAAACTTCTAAAACTTCAAAAATGTCATTACATAAATGGGTGAAATGTTA
CGTAATCGTATTCGAGGGAAATATTTATATTTATGAAAATTGTTTTTCTG
AAAGCCCAAAATCAACAAATGTCCTTTCAAAATTCAAGGAATTTCATGTT
CTCAAAAACAGAAAAAAGTCTCCTCTTTGGGTTTTTATTTTACAACCAAT
TGATAATGCGAATTCTCAATTGTCATTTGCCGCTCCATCGGAACAGGAAA
TGTTGTATGTCATTGGAAAATTCAAGGAGGGCATGATGCATTCTCAAAGT
CAGCTTTCGGCACCAAATGTAAATTTCACAAATCCAGAAATTTATCCACC
ATATCCGATTATTAATAACGCTACCTTAAATTTTCAAAGTAATTTACCTC
CGATTCCAAAGGGAATTCATCCAAATGAAAGGTTAATGGAAAATTGCATA
GAAACAAACAATGAAAAGATTTTGAAAATTGATAACAGAAATTCTGTGTG
TGCTCCACCGTATCCGAATATTAATGCTCTTACTCTAGAACGCAGAGATG
ATTTGCCCCCGATTCCGAGCGAGAGTCATTCAGAAGAAATTTGTATGCGT
GATTTTATATTCAATGGAACAAGAGAAGAAGCTGCTGCTGTATTGTCGAA
AGTTCAACAAATTGGTGGGTATTTAATCCGCGTCCAAGGTGATAGACAAG
TCCTTTCAGTTCAAACCGAACGGGGAATTGTGAAATATGTATTAGACAAA
AATCCATTGACAGAGCGAGTCTCTATTCAAGGATCCGGGAATGAATTTTA
CAATTTGACGGATTTAGTTAAACATTATTACACAAATAACATTCCTAATT
ATACATGTAGATTAAAATGCCCATATGGATCAGTTTTACACAAATGACAA
GTTCTTGTTTTAAAGTTAGTTTTGAAGAAATAAAATTACAATTTCAAATC
GTTTATAATTTTGATCACTTTTGATCTGTTTATTCTGATATTTCATTTAT
TTTCATTTTGACAAAAGATTCAAAAATGTGTGTTGCGTAGAATTAAATTT
TTGAATCTTTGTCAAAATGACAGTAAATGACAACATGTCGATTTGCTTCC
GGTTGCTGGAAACTGTGCCAGTGAAACTGGGAATATAATTTCTCCTTTCC
GAGTAATTTTATTTCACATCCAATCTAATTGACATCCGAAAATAAATTAT
TCGTTCAGCATATAAACACAGATCGGAA
back to top

protein sequence of SMED30015735-orf-1

>SMED30015735-orf-1 ID=SMED30015735-orf-1|Name=SMED30015735-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=323bp
MSVMLKEPAQSLLRKPNITFSGILETSKTSKMSLHKWVKCYVIVFEGNIY
IYENCFSESPKSTNVLSKFKEFHVLKNRKKSPLWVFILQPIDNANSQLSF
AAPSEQEMLYVIGKFKEGMMHSQSQLSAPNVNFTNPEIYPPYPIINNATL
NFQSNLPPIPKGIHPNERLMENCIETNNEKILKIDNRNSVCAPPYPNINA
LTLERRDDLPPIPSESHSEEICMRDFIFNGTREEAAAVLSKVQQIGGYLI
RVQGDRQVLSVQTERGIVKYVLDKNPLTERVSIQGSGNEFYNLTDLVKHY
YTNNIPNYTCRLKCPYGSVLHK*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: molecular function
TermDefinition
GO:0005070SH3/SH2 adaptor activity
GO:0005515protein binding
Vocabulary: biological process
TermDefinition
GO:0007165signal transduction
GO:0009967positive regulation of signal transduction
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000034epidermis
PLANA:0000054dorsal region of the epidermis
PLANA:0000418head
PLANA:0002032epidermal cell
Vocabulary: INTERPRO
TermDefinition
IPR036860SH2_dom_sf
IPR035848SH3BP2
IPR001627Semap_dom
IPR000980SH2
IPR011993PH-like_dom_sf
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR011993PH-like domain superfamilyGENE3DG3DSA:2.30.29.30coord: 6..117
e-value: 2.0E-6
score: 29.7
IPR036860SH2 domain superfamilyGENE3DG3DSA:3.30.505.10coord: 225..319
e-value: 4.0E-9
score: 38.2
IPR036860SH2 domain superfamilySUPERFAMILYSSF55550SH2 domaincoord: 228..316
IPR035848SH3 domain-binding protein 2PANTHERPTHR15126SH3-BINDINGcoord: 4..127
coord: 229..318
NoneNo IPR availableCDDcd00173SH2coord: 231..300
e-value: 1.82167E-7
score: 45.9095
NoneNo IPR availableSUPERFAMILYSSF50729PH domain-likecoord: 15..120