Proteasome subunit alpha type

Overview
NameProteasome subunit alpha type
Smed IDSMED30015728
Length (bp)801
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Proteasome subunit alpha type (SMED30015728) t-SNE clustered cells

Violin plots show distribution of expression levels for Proteasome subunit alpha type (SMED30015728) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Proteasome subunit alpha type (SMED30015728) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Proteasome subunit alpha type (SMED30015728) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30015728

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 2

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
posterior sideSMED30015728h1SMcG0002623 dd_Smed_v4_2117_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
posterior muscle cellSMED30015728h1SMcG0002623 dd_Smed_v4_2117_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Proteasome subunit alpha type vs. Ensembl Human
Match: AC010132.3 (novel PSMA2 and C7orf25 readthrough)

HSP 1 Score: 337.806 bits (865), Expect = 1.030e-117
Identity = 167/235 (71.06%), Postives = 192/235 (81.70%), Query Frame = 2
Query:   53 MSER-YSFSLTTFSPSGKLVQIEYALKAVDGGASSVGIKACNGVVLAVEKKFNSLLIDETSIQRIQTITKNIGFVYSGLSPDYRVLVKSAQKIAQEYQLKHGDGISPEQLAKRIAAVMQEYTQSGGVRPFGVSLLIAGWDNEIVRPFLFQCDPSGTYFPWKATALGKNSGNGKSFLEKRYSDKLELEDAIHTAILTLKEGFEGVMSEENIEVGICTEKGFRILDQSEVKDYLTAI 754
            M+ER YSFSLTTFSPSGKLVQIEYAL AV GGA SVGIKA NGVVLA EKK  S+L DE S+ +++ ITK+IG VYSG+ PDYRVLV  A+K+AQ+Y L + + I   QL +R+A+VMQEYTQSGGVRPFGVSLLI GW+    RP+LFQ DPSG YF WKATA+GKN  NGK+FLEKRY++ LELEDAIHTAILTLKE FEG M+E+NIEVGIC E GFR L  +EVKDYL AI
Sbjct:    1 MAERGYSFSLTTFSPSGKLVQIEYALAAVAGGAPSVGIKAANGVVLATEKKQKSILYDERSVHKVEPITKHIGLVYSGMGPDYRVLVHRARKLAQQYYLVYQEPIPTAQLVQRVASVMQEYTQSGGVRPFGVSLLICGWNEG--RPYLFQSDPSGAYFAWKATAMGKNYVNGKTFLEKRYNEDLELEDAIHTAILTLKESFEGQMTEDNIEVGICNEAGFRRLTPTEVKDYLAAI 233          
BLAST of Proteasome subunit alpha type vs. Ensembl Human
Match: PSMA2 (proteasome 20S subunit alpha 2 [Source:HGNC Symbol;Acc:HGNC:9531])

HSP 1 Score: 337.806 bits (865), Expect = 1.030e-117
Identity = 167/235 (71.06%), Postives = 192/235 (81.70%), Query Frame = 2
Query:   53 MSER-YSFSLTTFSPSGKLVQIEYALKAVDGGASSVGIKACNGVVLAVEKKFNSLLIDETSIQRIQTITKNIGFVYSGLSPDYRVLVKSAQKIAQEYQLKHGDGISPEQLAKRIAAVMQEYTQSGGVRPFGVSLLIAGWDNEIVRPFLFQCDPSGTYFPWKATALGKNSGNGKSFLEKRYSDKLELEDAIHTAILTLKEGFEGVMSEENIEVGICTEKGFRILDQSEVKDYLTAI 754
            M+ER YSFSLTTFSPSGKLVQIEYAL AV GGA SVGIKA NGVVLA EKK  S+L DE S+ +++ ITK+IG VYSG+ PDYRVLV  A+K+AQ+Y L + + I   QL +R+A+VMQEYTQSGGVRPFGVSLLI GW+    RP+LFQ DPSG YF WKATA+GKN  NGK+FLEKRY++ LELEDAIHTAILTLKE FEG M+E+NIEVGIC E GFR L  +EVKDYL AI
Sbjct:    1 MAERGYSFSLTTFSPSGKLVQIEYALAAVAGGAPSVGIKAANGVVLATEKKQKSILYDERSVHKVEPITKHIGLVYSGMGPDYRVLVHRARKLAQQYYLVYQEPIPTAQLVQRVASVMQEYTQSGGVRPFGVSLLICGWNEG--RPYLFQSDPSGAYFAWKATAMGKNYVNGKTFLEKRYNEDLELEDAIHTAILTLKESFEGQMTEDNIEVGICNEAGFRRLTPTEVKDYLAAI 233          
BLAST of Proteasome subunit alpha type vs. Ensembl Human
Match: PSMA2 (proteasome 20S subunit alpha 2 [Source:HGNC Symbol;Acc:HGNC:9531])

HSP 1 Score: 221.09 bits (562), Expect = 1.019e-72
Identity = 108/160 (67.50%), Postives = 126/160 (78.75%), Query Frame = 2
Query:  275 YSGLSPDYRVLVKSAQKIAQEYQLKHGDGISPEQLAKRIAAVMQEYTQSGGVRPFGVSLLIAGWDNEIVRPFLFQCDPSGTYFPWKATALGKNSGNGKSFLEKRYSDKLELEDAIHTAILTLKEGFEGVMSEENIEVGICTEKGFRILDQSEVKDYLTAI 754
            YS     +RVLV  A+K+AQ+Y L + + I   QL +R+A+VMQEYTQSGGVRPFGVSLLI GW+    RP+LFQ DPSG YF WKATA+GKN  NGK+FLEKRY++ LELEDAIHTAILTLKE FEG M+E+NIEVGIC E GFR L  +EVKDYL AI
Sbjct:    6 YSFSLTTFRVLVHRARKLAQQYYLVYQEPIPTAQLVQRVASVMQEYTQSGGVRPFGVSLLICGWNEG--RPYLFQSDPSGAYFAWKATAMGKNYVNGKTFLEKRYNEDLELEDAIHTAILTLKESFEGQMTEDNIEVGICNEAGFRRLTPTEVKDYLAAI 163          
BLAST of Proteasome subunit alpha type vs. Ensembl Human
Match: PSMA8 (proteasome 20S subunit alpha 8 [Source:HGNC Symbol;Acc:HGNC:22985])

HSP 1 Score: 162.925 bits (411), Expect = 9.843e-49
Identity = 97/239 (40.59%), Postives = 148/239 (61.92%), Query Frame = 2
Query:   53 MSERYSFSLTTFSPSGKLVQIEYALKAVDGGASSVGIKACNGVVLAVEKKFNSLLIDETSIQRIQTITKNIGFVYSGLSPDYRVLVKSAQKIAQEYQLKHGDGISPEQLAKRIAAVMQEYTQSGGVRPFGVSLLIAGWDNE-IVRPFLFQCDPSGTYFPWKATALGKNSGNGKSFLEKRYSDKLELEDAIHT---AI-LTLKEGFEGVMS-EENIEVGICTE-KGFRILDQSEVKDYLT 748
            M+ RY  ++T FSP G L Q+EYA +AV  G+++VGI+  N VVL VEKK  + L DE ++++I  +  ++   ++GL+ D RV++  A+   Q ++L   D ++ E + + IA + Q+YTQS G RPFG+S LI G+D++ I R  L+Q DPSGTY  WKA A+G+++   + FLEK Y+     EDAI +   AI L +K   E V S  +NIE+ I    +  ++    EV+ Y+T
Sbjct:    1 MASRYDRAITVFSPDGHLFQVEYAQEAVKKGSTAVGIRGTNIVVLGVEKKSVAKLQDERTVRKICALDDHVCMAFAGLTADARVVINRARVECQSHKLTVEDPVTVEYITRFIATLKQKYTQSNGRRPFGISALIVGFDDDGISR--LYQTDPSGTYHAWKANAIGRSAKTVREFLEKNYT-----EDAIASDSEAIKLAIKALLEVVQSGGKNIELAIIRRNQPLKMFSAKEVELYVT 232          
BLAST of Proteasome subunit alpha type vs. Ensembl Human
Match: PSMA7 (proteasome 20S subunit alpha 7 [Source:HGNC Symbol;Acc:HGNC:9536])

HSP 1 Score: 162.155 bits (409), Expect = 1.682e-48
Identity = 89/230 (38.70%), Postives = 145/230 (63.04%), Query Frame = 2
Query:   65 YSFSLTTFSPSGKLVQIEYALKAVDGGASSVGIKACNGVVLAVEKKFNSLLIDETSIQRIQTITKNIGFVYSGLSPDYRVLVKSAQKIAQEYQLKHGDGISPEQLAKRIAAVMQEYTQSGGVRPFGVSLLIAGWDNEIVRPFLFQCDPSGTYFPWKATALGKNSGNGKSFLEKRYSDK-LELEDAIHTAILTLKEGFEGVMS-EENIEVGIC-TEKGFRILDQSEVKDYL 745
            Y  ++T FSP G L Q+EYA +AV  G+++VG++  + VVL VEKK  + L DE ++++I  +  N+   ++GL+ D R+++  A+   Q ++L   D ++ E + + IA++ Q YTQS G RPFG+S LI G+D +   P L+Q DPSGTY  WKA A+G+ + + + FLEK Y+D+ +E +D   T  L +K   E V S  +NIE+ +   ++  +IL+  E++ Y+
Sbjct:    3 YDRAITVFSPDGHLFQVEYAQEAVKKGSTAVGVRGRDIVVLGVEKKSVAKLQDERTVRKICALDDNVCMAFAGLTADARIVINRARVECQSHRLTVEDPVTVEYITRYIASLKQRYTQSNGRRPFGISALIVGFDFDGT-PRLYQTDPSGTYHAWKANAIGRGAKSVREFLEKNYTDEAIETDDL--TIKLVIKALLEVVQSGGKNIELAVMRRDQSLKILNPEEIEKYV 229          
BLAST of Proteasome subunit alpha type vs. Ensembl Celegans
Match: pas-2 (Proteasome subunit alpha type-2 [Source:UniProtKB/Swiss-Prot;Acc:Q27488])

HSP 1 Score: 287.345 bits (734), Expect = 3.459e-98
Identity = 139/231 (60.17%), Postives = 173/231 (74.89%), Query Frame = 2
Query:   53 MSERYSFSLTTFSPSGKLVQIEYALKAVDGGASSVGIKACNGVVLAVEKKFNSLLIDETSIQRIQTITKNIGFVYSGLSPDYRVLVKSAQKIAQEYQLKHGDGISPEQLAKRIAAVMQEYTQSGGVRPFGVSLLIAGWDNEIVRPFLFQCDPSGTYFPWKATALGKNSGNGKSFLEKRYSDKLELEDAIHTAILTLKEGFEGVMSEENIEVGICTEKGFRILDQSEVKDYL 745
            M + Y FSLTTFSPSGKL+QIEYAL AV  G  SVG++A +GVVLA E    S+L D+    +++ I+K+IG VYSG+ PD+R+LVK A+KIA EY++ +G+ +   QL   IAAVMQEYTQSGGVRPFG SLLIAGWD    RP LFQCDPSG YF WKATALGKN  N K+FLEKR+S+ LEL+D IHTA+LTL+E F+  M+E N+EV +C   GF  L + +V D+L
Sbjct:    1 MGDHYGFSLTTFSPSGKLMQIEYALNAVKNGQPSVGLRAKDGVVLATEN-VGSVLTDDQP--KVEQISKHIGCVYSGMGPDFRILVKKARKIAMEYEMMYGEEMPTIQLVTDIAAVMQEYTQSGGVRPFGASLLIAGWDKNPGRPLLFQCDPSGAYFAWKATALGKNDVNAKTFLEKRFSEALELDDGIHTALLTLRESFDVGMNENNVEVAVCNSTGFHRLTKQQVHDHL 228          
BLAST of Proteasome subunit alpha type vs. Ensembl Celegans
Match: pas-2 (Proteasome subunit alpha type-2 [Source:UniProtKB/Swiss-Prot;Acc:Q27488])

HSP 1 Score: 287.345 bits (734), Expect = 3.459e-98
Identity = 139/231 (60.17%), Postives = 173/231 (74.89%), Query Frame = 2
Query:   53 MSERYSFSLTTFSPSGKLVQIEYALKAVDGGASSVGIKACNGVVLAVEKKFNSLLIDETSIQRIQTITKNIGFVYSGLSPDYRVLVKSAQKIAQEYQLKHGDGISPEQLAKRIAAVMQEYTQSGGVRPFGVSLLIAGWDNEIVRPFLFQCDPSGTYFPWKATALGKNSGNGKSFLEKRYSDKLELEDAIHTAILTLKEGFEGVMSEENIEVGICTEKGFRILDQSEVKDYL 745
            M + Y FSLTTFSPSGKL+QIEYAL AV  G  SVG++A +GVVLA E    S+L D+    +++ I+K+IG VYSG+ PD+R+LVK A+KIA EY++ +G+ +   QL   IAAVMQEYTQSGGVRPFG SLLIAGWD    RP LFQCDPSG YF WKATALGKN  N K+FLEKR+S+ LEL+D IHTA+LTL+E F+  M+E N+EV +C   GF  L + +V D+L
Sbjct:    1 MGDHYGFSLTTFSPSGKLMQIEYALNAVKNGQPSVGLRAKDGVVLATEN-VGSVLTDDQP--KVEQISKHIGCVYSGMGPDFRILVKKARKIAMEYEMMYGEEMPTIQLVTDIAAVMQEYTQSGGVRPFGASLLIAGWDKNPGRPLLFQCDPSGAYFAWKATALGKNDVNAKTFLEKRFSEALELDDGIHTALLTLRESFDVGMNENNVEVAVCNSTGFHRLTKQQVHDHL 228          
BLAST of Proteasome subunit alpha type vs. Ensembl Celegans
Match: pas-3 (Proteasome subunit alpha type-4 [Source:UniProtKB/Swiss-Prot;Acc:Q9N599])

HSP 1 Score: 143.665 bits (361), Expect = 1.272e-41
Identity = 79/231 (34.20%), Postives = 127/231 (54.98%), Query Frame = 2
Query:   53 MSERYSFSLTTFSPSGKLVQIEYALKAVDGGASSVGIKACNGVVLAVEKK-FNSLLIDETSIQRIQTITKNIGFVYSGLSPDYRVLVKSAQKIAQEYQLKHGDGISPEQLAKRIAAVMQEYTQSGGVRPFGVSLLIAGWDNEIVRPFLFQCDPSGTYFPWKATALGKNSGNGKSFLEKRYSDKLELEDAIHTAILTLKEGFEGVMSEENIEVGICTEK-GFRILDQSEVKD 739
            M+ RY    T FSP G+L Q+EYA++A+    + +GI +  G+V+A E+K  + LL D    +++  ++ NI    +G++ D  +L+   +  A  Y+  +G+ +  EQL + +    Q YTQ GG RPFGVSLL  GWD       L+Q DPSG Y  WKAT +G N     + L++ Y     LE+A   AI  L +  +  ++ E +E+ + T + G  +L++   K+
Sbjct:    1 MARRYDSRTTIFSPEGRLYQVEYAMEAISHAGTCLGILSSEGIVVAAERKNVHKLLDDSVMTEKVYRLSDNISCTVAGITADANILINHLRWWAASYRNSYGEEMPVEQLVQNLCNEKQRYTQIGGKRPFGVSLLYIGWDKHYGYQ-LYQSDPSGNYTGWKATCIGSNHQAAVTLLKQEYKSP-NLEEAKQLAIKVLWKTLDVKLASEKVEMAVLTRRDGKTVLEELTTKE 229          
BLAST of Proteasome subunit alpha type vs. Ensembl Celegans
Match: pas-3 (Proteasome subunit alpha type-4 [Source:UniProtKB/Swiss-Prot;Acc:Q9N599])

HSP 1 Score: 143.665 bits (361), Expect = 1.272e-41
Identity = 79/231 (34.20%), Postives = 127/231 (54.98%), Query Frame = 2
Query:   53 MSERYSFSLTTFSPSGKLVQIEYALKAVDGGASSVGIKACNGVVLAVEKK-FNSLLIDETSIQRIQTITKNIGFVYSGLSPDYRVLVKSAQKIAQEYQLKHGDGISPEQLAKRIAAVMQEYTQSGGVRPFGVSLLIAGWDNEIVRPFLFQCDPSGTYFPWKATALGKNSGNGKSFLEKRYSDKLELEDAIHTAILTLKEGFEGVMSEENIEVGICTEK-GFRILDQSEVKD 739
            M+ RY    T FSP G+L Q+EYA++A+    + +GI +  G+V+A E+K  + LL D    +++  ++ NI    +G++ D  +L+   +  A  Y+  +G+ +  EQL + +    Q YTQ GG RPFGVSLL  GWD       L+Q DPSG Y  WKAT +G N     + L++ Y     LE+A   AI  L +  +  ++ E +E+ + T + G  +L++   K+
Sbjct:    1 MARRYDSRTTIFSPEGRLYQVEYAMEAISHAGTCLGILSSEGIVVAAERKNVHKLLDDSVMTEKVYRLSDNISCTVAGITADANILINHLRWWAASYRNSYGEEMPVEQLVQNLCNEKQRYTQIGGKRPFGVSLLYIGWDKHYGYQ-LYQSDPSGNYTGWKATCIGSNHQAAVTLLKQEYKSP-NLEEAKQLAIKVLWKTLDVKLASEKVEMAVLTRRDGKTVLEELTTKE 229          
BLAST of Proteasome subunit alpha type vs. Ensembl Celegans
Match: pas-4 (Proteasome subunit alpha type-7 [Source:UniProtKB/Swiss-Prot;Acc:Q95005])

HSP 1 Score: 143.665 bits (361), Expect = 1.277e-41
Identity = 83/236 (35.17%), Postives = 139/236 (58.90%), Query Frame = 2
Query:   62 RYSFSLTTFSPSGKLVQIEYALKAVDGGASSVGIKACNGVVLAVEKKFNSLLIDETSIQRIQTITKNIGFVYSGLSPDYRVLVKSAQKIAQEYQLKHGDGISPEQLAKRIAAVMQEYTQSGGVRPFGVSLLIAGWDNEIVRPFLFQCDPSGTYFPWKATALGKNSGNGKSFLEKRYSDKLELEDAIHTAILTLKEGFEGVMS-EENIEVGICT----EKGFRILDQSEVKDYLTAI 754
            RY  ++T FSP G L Q+EYA +AV  G+++VG++  + +V+ VEKK    L D+ +I++I  I  ++   ++GLS D RVLV  A+   Q Y+L   D ++   +++ IA   Q +TQS G RPFG+S+LI G+D++   P LF+ +PSG Y+ + A A G+     + +LE++YS++  +++A  T  L +K   + V    +NIE+ +      E   R+L   E++  L  +
Sbjct:    3 RYDRAITIFSPDGHLFQVEYAQEAVKKGSTAVGVRGKDCIVIGVEKKSIPALQDDRTIRKIHMIDDHVMLAFAGLSADARVLVDRARIECQSYKLTLEDPVTVAYISRYIANTKQRFTQSPGRRPFGISMLIGGFDHDGT-PRLFKTEPSGAYYEYVANATGRGEKPVREYLEEQYSEENTVDEAT-TLKLVVKSLAQVVPPGSQNIEIAVMKKVNDELQQRVLSTEEIEALLKVV 236          
BLAST of Proteasome subunit alpha type vs. Ensembl Fly
Match: Prosalpha2 (gene:FBgn0086134 transcript:FBtr0082590)

HSP 1 Score: 330.102 bits (845), Expect = 7.228e-115
Identity = 155/234 (66.24%), Postives = 189/234 (80.77%), Query Frame = 2
Query:   56 SERYSFSLTTFSPSGKLVQIEYALKAVDGGASSVGIKACNGVVLAVEKKFNSLLIDETSIQRIQTITKNIGFVYSGLSPDYRVLVKSAQKIAQEYQLKHGDGISPEQLAKRIAAVMQEYTQSGGVRPFGVSLLIAGWDNEIVRPFLFQCDPSGTYFPWKATALGKNSGNGKSFLEKRYSDKLELEDAIHTAILTLKEGFEGVMSEENIEVGICTEKGFRILDQSEVKDYLTAIP 757
            +ERYSFSLTTFSPSGKLVQ+EYAL AV GGA SVGI A NGVV+A E K  S L ++ S+ R++ I  +IG VYSG+ PDYR+LVK A+KIAQ Y L + + I   QL +R+A +MQEYTQSGGVRPFGVSLLI GWDN+  RP+L+Q DPSG YF WKATA+GKN+ NGK+FLEKRYS+ LEL+DA+HTAILTLKEGFEG M+ +NIE+GIC + GF+ LD + +KDYL +IP
Sbjct:    3 TERYSFSLTTFSPSGKLVQLEYALAAVSGGAPSVGIIASNGVVIATENKHKSPLYEQHSVHRVEMIYNHIGMVYSGMGPDYRLLVKQARKIAQTYYLTYKEPIPVSQLVQRVATLMQEYTQSGGVRPFGVSLLICGWDND--RPYLYQSDPSGAYFAWKATAMGKNAVNGKTFLEKRYSEDLELDDAVHTAILTLKEGFEGKMTADNIEIGICDQNGFQRLDPASIKDYLASIP 234          
BLAST of Proteasome subunit alpha type vs. Ensembl Fly
Match: Prosalpha4 (gene:FBgn0004066 transcript:FBtr0074210)

HSP 1 Score: 150.599 bits (379), Expect = 2.552e-44
Identity = 83/233 (35.62%), Postives = 139/233 (59.66%), Query Frame = 2
Query:   53 MSERYSFSLTTFSPSGKLVQIEYALKAVDGGASSVGIKACNGVVLAVEKKFNSLLIDETSIQRIQTITKNIGFVYSGLSPDYRVLVKSAQKIAQEYQLKHGDGISPEQLAKRIAAVMQEYTQSGGVRPFGVSLLIAGWDNEIVRPFLFQCDPSGTYFPWKATALGKNSGNGKSFLEKRYSDKLELEDAIHTAILTLKEGFEGVMS-EENIEVGICTE-KGFRILDQSEVKDYL 745
            MS RY  ++T FSP G L+Q+EYA +AV  G+++VG++  N VVL VEKK  + L ++  +++I  +  ++   ++GL+ D R+++  AQ   Q ++L   D ++ E + + IA + Q+YTQS G RPFG+S LI G+D +     LFQ +PSG ++ +KA A G+++   + F EK Y ++ E+ +      L ++   E   S + N+EV I    K  ++LD   + DY+
Sbjct:    1 MSSRYDRAVTIFSPDGHLLQVEYAQEAVRKGSTAVGVRGANCVVLGVEKKSVAQLQEDRKVRKICMLDNHVVMAFAGLTADARIMINRAQVECQSHRLNVEDPVTLEYITRFIAQLKQKYTQSNGRRPFGISCLIGGFDAD-GSAHLFQTEPSGIFYEYKANATGRSAKVVREFFEKSYREE-EVANEHGAVKLAIRALLEVAQSGQNNLEVAIMENGKPLKMLDTDVITDYV 231          
BLAST of Proteasome subunit alpha type vs. Ensembl Fly
Match: Prosalpha4T1 (gene:FBgn0265606 transcript:FBtr0083928)

HSP 1 Score: 146.362 bits (368), Expect = 1.308e-42
Identity = 83/227 (36.56%), Postives = 134/227 (59.03%), Query Frame = 2
Query:   53 MSERYSFSLTTFSPSGKLVQIEYALKAVDGGASSVGIKACNGVVLAVEKKFNSLLIDETSIQRIQTITKNIGFVYSGLSPDYRVLVKSAQKIAQEYQLKHGDGISPEQLAKRIAAVMQEYTQSGGVRPFGVSLLIAGWDNEIVRPFLFQCDPSGTYFPWKATALGKNSGNGKSFLEKRYSDKLELE---DAIHTAILTLKEGFEGVMSEENIEVGICTE-KGFRILD 721
            MS RY  +LT FSP G L+Q+EYA +AV  G+++VG++  N VVL VEK   S + ++ ++++I  + +++   ++GL+ D R+L+   Q   Q ++L   + ++ E + + +A + Q+YTQ  G RPFG+S LI G D +     LF  +PSG +  +KATA G+ +   + F EK YSD  E+    DAI  A+  L E  +  MS+  +EV +    K  ++LD
Sbjct:    1 MSSRYGRALTIFSPDGHLLQVEYAQEAVRKGSTAVGVRGANCVVLGVEKSSVSEMQEDRTVRKISMLDRHVALAFAGLTADARILINRGQVECQSHRLNFENQVTLEYITRYLAQLKQKYTQCNGRRPFGISCLIGGIDAD-GSARLFHTEPSGIFHEYKATATGRWANTVREFFEKAYSDH-EVTTKCDAIKLAMRALLEVTQ--MSQMRLEVAVLENGKPMKMLD 223          
BLAST of Proteasome subunit alpha type vs. Ensembl Fly
Match: Prosalpha3 (gene:FBgn0261394 transcript:FBtr0071522)

HSP 1 Score: 145.976 bits (367), Expect = 2.411e-42
Identity = 85/218 (38.99%), Postives = 120/218 (55.05%), Query Frame = 2
Query:   53 MSERYSFSLTTFSPSGKLVQIEYALKAVDGGASSVGIKACNGVVLAVE-KKFNSLLIDETSIQRIQTITKNIGFVYSGLSPDYRVLVKSAQKIAQEYQLKHGDGISPEQLAKRIAAVMQEYTQSGGVRPFGVSLLIAGWDNEIVRPFLFQCDPSGTYFPWKATALGKNSGNGKSFLEKRYSD----KLELEDAIHTAILTLKEGFEGV-MSEENIEVG 688
            M+ RY    T FSP G+L Q+EYA++A+    + +GI A +G++LA E +  N LL      ++I  +  N+    +G++ D  VL    + IAQ YQ  +G+ I  EQL   +  + Q YTQ GG RPFGVSLL  GWDN+     L+Q DPSG Y  WKAT +G N G   S L++  +D    KL L DA   AI  L    +   ++ E +E+ 
Sbjct:    1 MARRYDSRTTIFSPEGRLYQVEYAMEAISHAGTCLGILAEDGILLAAECRSTNKLLDSAIPSEKIYRLNDNMVCSVAGITSDANVLTSELRLIAQRYQFSYGEVIPCEQLVSHLCDIKQAYTQYGGKRPFGVSLLYMGWDNKYGYQ-LYQSDPSGNYGGWKATCIGNNFGAAISMLKQELADKENVKLTLADAKDLAIKVLSMTLDTTKLTPEKVEMA 217          
BLAST of Proteasome subunit alpha type vs. Ensembl Fly
Match: Prosalpha4T2 (gene:FBgn0017556 transcript:FBtr0072350)

HSP 1 Score: 144.821 bits (364), Expect = 5.410e-42
Identity = 78/233 (33.48%), Postives = 133/233 (57.08%), Query Frame = 2
Query:   53 MSERYSFSLTTFSPSGKLVQIEYALKAVDGGASSVGIKACNGVVLAVEKKFNSLLIDETSIQRIQTITKNIGFVYSGLSPDYRVLVKSAQKIAQEYQLKHGDGISPEQLAKRIAAVMQEYTQSGGVRPFGVSLLIAGWDNEIVRPFLFQCDPSGTYFPWKATALGKNSGNGKSFLEKRYSDKLELED---AIHTAILTLKEGFEGVMSEENIEVGICT-EKGFRILDQSEVKD 739
            M++RY  ++T +SP G L+Q+EYA +AV  G++ +G++  N +V+ VEK+    L +E  +++I  +  ++   +SGL+ D R+LV  AQ  AQ ++L      + E + + IA + Q YTQS G RPFG+S L+ G+D +   P LFQ DPSG ++ W+A   G++S   + ++EK   + L + D   AI   + TL       ++   +EV +    +  R++D   + D
Sbjct:    1 MAQRYDRAVTIYSPDGHLLQVEYAQEAVRRGSTVMGLRTNNAIVIGVEKRSVGDLQEERMVRKICMLDDHVVMTFSGLTADARILVSRAQMEAQSHRLNFEKPTTVEYITRYIAQLKQNYTQSNGRRPFGLSCLVGGFDEDGT-PHLFQTDPSGIFYEWRANTTGRSSQPVRDYMEKHADEILTIADEAAAIKHIVRTLVSV--SSLNHTQMEVAVLKYRQPLRMIDHQVLAD 230          
BLAST of Proteasome subunit alpha type vs. Ensembl Zebrafish
Match: si:rp71-45k5.4 (si:rp71-45k5.4 [Source:ZFIN;Acc:ZDB-GENE-060503-941])

HSP 1 Score: 327.02 bits (837), Expect = 1.270e-113
Identity = 168/235 (71.49%), Postives = 194/235 (82.55%), Query Frame = 2
Query:   53 MSER-YSFSLTTFSPSGKLVQIEYALKAVDGGASSVGIKACNGVVLAVEKKFNSLLIDETSIQRIQTITKNIGFVYSGLSPDYRVLVKSAQKIAQEYQLKHGDGISPEQLAKRIAAVMQEYTQSGGVRPFGVSLLIAGWDNEIVRPFLFQCDPSGTYFPWKATALGKNSGNGKSFLEKRYSDKLELEDAIHTAILTLKEGFEGVMSEENIEVGICTEKGFRILDQSEVKDYLTAI 754
            M+ER YSFSLTTFSPSGKLVQIEYAL AV  GA SVGIKA NGVVLA EKK  S+L DE S+ +++ ITK+IG VYSG+ PDYRVLV+ A+K+AQ+Y L + + I   QL +R+A+VMQEYTQSGGVRPFGVSLLIAGWD +  RP+LFQ DPSG YF WKATA+GKN  NGK+FLEKRY++ LELEDAIHTAILTLKE FEG M+E+NIEVGIC E GFR L  +EVKDYL AI
Sbjct:    1 MAERGYSFSLTTFSPSGKLVQIEYALAAVAAGAPSVGIKASNGVVLATEKKQKSILYDEQSVHKVEPITKHIGMVYSGMGPDYRVLVRRARKLAQQYFLVYQEPIPTGQLVQRVASVMQEYTQSGGVRPFGVSLLIAGWDED--RPYLFQSDPSGAYFAWKATAMGKNYVNGKTFLEKRYNEDLELEDAIHTAILTLKESFEGQMTEDNIEVGICNEAGFRRLSPAEVKDYLAAI 233          
BLAST of Proteasome subunit alpha type vs. Ensembl Zebrafish
Match: psma2 (proteasome 20S subunit alpha 2 [Source:ZFIN;Acc:ZDB-GENE-050522-479])

HSP 1 Score: 327.02 bits (837), Expect = 1.530e-113
Identity = 168/235 (71.49%), Postives = 194/235 (82.55%), Query Frame = 2
Query:   53 MSER-YSFSLTTFSPSGKLVQIEYALKAVDGGASSVGIKACNGVVLAVEKKFNSLLIDETSIQRIQTITKNIGFVYSGLSPDYRVLVKSAQKIAQEYQLKHGDGISPEQLAKRIAAVMQEYTQSGGVRPFGVSLLIAGWDNEIVRPFLFQCDPSGTYFPWKATALGKNSGNGKSFLEKRYSDKLELEDAIHTAILTLKEGFEGVMSEENIEVGICTEKGFRILDQSEVKDYLTAI 754
            M+ER YSFSLTTFSPSGKLVQIEYAL AV  GA SVGIKA NGVVLA EKK  S+L DE S+ +++ ITK+IG VYSG+ PDYRVLV+ A+K+AQ+Y L + + I   QL +R+A+VMQEYTQSGGVRPFGVSLLIAGWD +  RP+LFQ DPSG YF WKATA+GKN  NGK+FLEKRY++ LELEDAIHTAILTLKE FEG M+E+NIEVGIC E GFR L  +EVKDYL AI
Sbjct:    1 MAERGYSFSLTTFSPSGKLVQIEYALAAVAAGAPSVGIKASNGVVLATEKKQKSILYDEQSVHKVEPITKHIGMVYSGMGPDYRVLVRRARKLAQQYFLVYQEPIPTGQLVQRVASVMQEYTQSGGVRPFGVSLLIAGWDED--RPYLFQSDPSGAYFAWKATAMGKNYVNGKTFLEKRYNEDLELEDAIHTAILTLKESFEGQMTEDNIEVGICNEAGFRRLTPAEVKDYLAAI 233          
BLAST of Proteasome subunit alpha type vs. Ensembl Zebrafish
Match: si:rp71-45k5.4 (si:rp71-45k5.4 [Source:ZFIN;Acc:ZDB-GENE-060503-941])

HSP 1 Score: 275.404 bits (703), Expect = 1.498e-93
Identity = 142/199 (71.36%), Postives = 166/199 (83.42%), Query Frame = 2
Query:   50 QMSER-YSFSLTTFSPSGKLVQIEYALKAVDGGASSVGIKACNGVVLAVEKKFNSLLIDETSIQRIQTITKNIGFVYSGLSPDYRVLVKSAQKIAQEYQLKHGDGISPEQLAKRIAAVMQEYTQSGGVRPFGVSLLIAGWDNEIVRPFLFQCDPSGTYFPWKATALGKNSGNGKSFLEKRYSDKLELEDAIHTAILTLK 643
            +M+ER YSFSLTTFSPSGKLVQIEYAL AV  GA SVGIKA NGVVLA EKK  S+L DE S+ +++ ITK+IG VYSG+ PDYRVLV+ A+K+AQ+Y L + + I   QL +R+A+VMQEYTQSGGVRPFGVSLLIAGWD +  RP+LFQ DPSG YF WKATA+GKN  NGK+FLEKRY++ LELEDAIHTAILTLK
Sbjct:   12 KMAERGYSFSLTTFSPSGKLVQIEYALAAVAAGAPSVGIKASNGVVLATEKKQKSILYDEQSVHKVEPITKHIGMVYSGMGPDYRVLVRRARKLAQQYFLVYQEPIPTGQLVQRVASVMQEYTQSGGVRPFGVSLLIAGWDED--RPYLFQSDPSGAYFAWKATAMGKNYVNGKTFLEKRYNEDLELEDAIHTAILTLK 208          
BLAST of Proteasome subunit alpha type vs. Ensembl Zebrafish
Match: psma8 (proteasome 20S subunit alpha 8 [Source:ZFIN;Acc:ZDB-GENE-040426-2194])

HSP 1 Score: 160.614 bits (405), Expect = 4.825e-48
Identity = 88/231 (38.10%), Postives = 142/231 (61.47%), Query Frame = 2
Query:   53 MSERYSFSLTTFSPSGKLVQIEYALKAVDGGASSVGIKACNGVVLAVEKKFNSLLIDETSIQRIQTITKNIGFVYSGLSPDYRVLVKSAQKIAQEYQLKHGDGISPEQLAKRIAAVMQEYTQSGGVRPFGVSLLIAGWDNEIVRPFLFQCDPSGTYFPWKATALGKNSGNGKSFLEKRYSDK--LELEDAIHTAILTLKEGFEGVMSEENIEVGICTE-KGFRILDQSEVK 736
            M+ RY  ++T FSP G L Q+EYA +AV  G+++VGI+  + VVL VEKK  + L +E ++++I  + +++   ++GL+ D R+++  A+   Q ++L   D ++ E + + IA + Q YTQS G RPFG+S LI G+D +   P L+Q DPSGTY  WKA A+G+++   + FLEK Y+D+      DAI  AI  L E  +     +NIE+ +    +  +IL+  E++
Sbjct:    1 MAARYDRAITVFSPDGHLFQVEYAQEAVKKGSTAVGIRGKDIVVLGVEKKSVAKLQEERTVRKICALDEHVCMAFAGLTADARIVINRARVECQSHRLTVEDPVTVEYITRYIATLKQRYTQSNGRRPFGISALIVGFDYDGT-PRLYQTDPSGTYHAWKANAIGRSAKTVREFLEKNYTDEAIASDNDAIKLAIKALLEVVQS--GGKNIELAVIRRNQPLKILESKEIE 228          
BLAST of Proteasome subunit alpha type vs. Ensembl Zebrafish
Match: psma6b (proteasome 20S subunit alpha 6b [Source:ZFIN;Acc:ZDB-GENE-040718-329])

HSP 1 Score: 154.066 bits (388), Expect = 1.461e-45
Identity = 86/231 (37.23%), Postives = 135/231 (58.44%), Query Frame = 2
Query:   77 LTTFSPSGKLVQIEYALKAVD-GGASSVGIKACNGVVLAVEKKFNSLLIDETSIQRIQTITKNIGFVYSGLSPDYRVLVKSAQKIAQEYQLKHGDGISPEQLAKRIAAVMQEYTQSGGVRPFGVSLLIAGWDNEIVRPFLFQCDPSGTYFPWKATALGKNSGNGKSFLEKRYSDKLE--LEDAIHTAILTLKEGFEGVMSEENIEVGICT--EKGFRILDQSEVKDYLTAI 754
            +T FSP G+L Q+EYA KA++ GG +SV ++  +  ++  +KK    L+D +++  +  IT+NIG V SG++ D R  V+ A+  A  ++ K+G  I  + L KRIA + Q YTQ+  +RP G  +++ G D E+  P +++CDP+G Y  +KATA G       SFLEK+   KL+   E A+ TAI  L            +E+G+ T  +  FRIL +SEV  +L ++
Sbjct:   13 ITIFSPEGRLYQVEYAFKAINQGGLTSVAVRGKDCAIVVTQKKVPDKLLDSSTVTHLFRITENIGCVMSGMTADSRSQVQRARYEAANWKYKYGYEIPVDMLCKRIADISQVYTQNAEMRPLGCCMIVIGLDEEL-GPQVYKCDPAGYYCGFKATAAGVKQTEATSFLEKKVKKKLDWTFEQAVETAITCLTTVLSIDFKPSELEIGVITAEDPKFRILSESEVDTHLVSL 242          
BLAST of Proteasome subunit alpha type vs. Ensembl Xenopus
Match: sgta (small glutamine-rich tetratricopeptide repeat (TPR)-containing, alpha [Source:Xenbase;Acc:XB-GENE-962231])

HSP 1 Score: 324.324 bits (830), Expect = 2.613e-112
Identity = 167/235 (71.06%), Postives = 192/235 (81.70%), Query Frame = 2
Query:   53 MSER-YSFSLTTFSPSGKLVQIEYALKAVDGGASSVGIKACNGVVLAVEKKFNSLLIDETSIQRIQTITKNIGFVYSGLSPDYRVLVKSAQKIAQEYQLKHGDGISPEQLAKRIAAVMQEYTQSGGVRPFGVSLLIAGWDNEIVRPFLFQCDPSGTYFPWKATALGKNSGNGKSFLEKRYSDKLELEDAIHTAILTLKEGFEGVMSEENIEVGICTEKGFRILDQSEVKDYLTAI 754
            M+ER YSFSLTTFSPSGKLVQIEYAL AV  GA SVGIKA NGVVLA EKK  S+L DE S  +++ ITK+IG VYSG+ PDYRVLV+ A+K+AQ+Y L + + I   QL +R+A+VMQEYTQSGGVRPFGVSLLIAGWD    RP+LFQ DPSG YF WKATA+GKN  NGK+FLEKRY++ LELEDAIHTAILTLKE FEG M+E+NIEVGIC E GF+ L  +EVKDYL AI
Sbjct:    1 MAERGYSFSLTTFSPSGKLVQIEYALAAVAAGAPSVGIKATNGVVLATEKKQKSILYDEQSAHKVEPITKHIGMVYSGMGPDYRVLVRRARKLAQQYYLVYQEPIPTAQLVQRVASVMQEYTQSGGVRPFGVSLLIAGWDEG--RPYLFQSDPSGAYFAWKATAMGKNYVNGKTFLEKRYNEDLELEDAIHTAILTLKESFEGQMTEDNIEVGICNEAGFKRLTPAEVKDYLAAI 233          
BLAST of Proteasome subunit alpha type vs. Ensembl Xenopus
Match: itih5 (inter-alpha-trypsin inhibitor heavy chain family member 5 [Source:Xenbase;Acc:XB-GENE-1010496])

HSP 1 Score: 163.696 bits (413), Expect = 5.263e-49
Identity = 91/234 (38.89%), Postives = 147/234 (62.82%), Query Frame = 2
Query:   53 MSERYSFSLTTFSPSGKLVQIEYALKAVDGGASSVGIKACNGVVLAVEKKFNSLLIDETSIQRIQTITKNIGFVYSGLSPDYRVLVKSAQKIAQEYQLKHGDGISPEQLAKRIAAVMQEYTQSGGVRPFGVSLLIAGWDNEIVRPFLFQCDPSGTYFPWKATALGKNSGNGKSFLEKRYSDK-LELEDAIHTAILTLKEGFEGVMS-EENIEVGIC-TEKGFRILDQSEVKDYL 745
            MS  Y  ++T FSP G L Q+EYA +AV  G+++VG++    VVL VEKK  + L DE ++++I  + +N+   ++GL+ D R+++  A+   Q ++L   D ++ E + + IA++ Q YTQS G RPFG+S LI G+D +   P L+Q DPSGTY  WKA A+G+ + + + FLEK Y+D+ +E +D   T  L +K   E V S  +NIE+ +   ++  +IL+  E++ Y+
Sbjct:    1 MSALYDRAITVFSPDGHLFQVEYAQEAVKKGSTAVGVRGKEIVVLGVEKKSVAKLQDERTVRKICALDENVFMAFAGLTADARIVINRARVECQSHRLTVEDPVTVEYITRYIASLKQRYTQSNGRRPFGISALIVGFDFDGT-PRLYQTDPSGTYHAWKANAIGRGAKSVREFLEKHYTDEAIETDDL--TIKLVIKALLEVVQSGGKNIELAVMRRDQPLKILNPEEIERYV 231          
BLAST of Proteasome subunit alpha type vs. Ensembl Xenopus
Match: itih5 (inter-alpha-trypsin inhibitor heavy chain family member 5 [Source:Xenbase;Acc:XB-GENE-1010496])

HSP 1 Score: 160.999 bits (406), Expect = 4.933e-48
Identity = 89/230 (38.70%), Postives = 145/230 (63.04%), Query Frame = 2
Query:   65 YSFSLTTFSPSGKLVQIEYALKAVDGGASSVGIKACNGVVLAVEKKFNSLLIDETSIQRIQTITKNIGFVYSGLSPDYRVLVKSAQKIAQEYQLKHGDGISPEQLAKRIAAVMQEYTQSGGVRPFGVSLLIAGWDNEIVRPFLFQCDPSGTYFPWKATALGKNSGNGKSFLEKRYSDK-LELEDAIHTAILTLKEGFEGVMS-EENIEVGIC-TEKGFRILDQSEVKDYL 745
            Y  ++T FSP G L Q+EYA +AV  G+++VG++    VVL VEKK  + L DE ++++I  + +N+   ++GL+ D R+++  A+   Q ++L   D ++ E + + IA++ Q YTQS G RPFG+S LI G+D +   P L+Q DPSGTY  WKA A+G+ + + + FLEK Y+D+ +E +D   T  L +K   E V S  +NIE+ +   ++  +IL+  E++ Y+
Sbjct:    3 YDRAITVFSPDGHLFQVEYAQEAVKKGSTAVGVRGKEIVVLGVEKKSVAKLQDERTVRKICALDENVFMAFAGLTADARIVINRARVECQSHRLTVEDPVTVEYITRYIASLKQRYTQSNGRRPFGISALIVGFDFDGT-PRLYQTDPSGTYHAWKANAIGRGAKSVREFLEKHYTDEAIETDDL--TIKLVIKALLEVVQSGGKNIELAVMRRDQPLKILNPEEIERYV 229          
BLAST of Proteasome subunit alpha type vs. Ensembl Xenopus
Match: gdpd1 (glycerophosphodiester phosphodiesterase domain containing 1 [Source:Xenbase;Acc:XB-GENE-5612387])

HSP 1 Score: 148.288 bits (373), Expect = 5.455e-43
Identity = 87/238 (36.55%), Postives = 132/238 (55.46%), Query Frame = 2
Query:   53 MSERYSFSLTTFSPSGKLVQIEYALKAVDGGASSVGIKACNGVVLAVEKKFNSLLIDETSI-QRIQTITKNIGFVYSGLSPDYRVLVKSAQKIAQEYQLKHGDGISPEQLAKRIAAVMQEYTQSGGVRPFGVSLLIAGWDNEIVRPFLFQCDPSGTYFPWKATALGKNSGNGKSFLEKRYSD-KLELEDAIHTAILTLKEGFE-GVMSEENIEVGICTEKG----FRILDQSEVKDYL 745
            MS RY    T FSP G+L Q+EYA++A+    + +GI A +GV+LA E++    L+DE    ++I  +  ++    +G++ D  VL    + IAQ Y L++ + I  EQL   +  + Q YTQ GG RPFGVSLL  GWD       L+Q DPSG Y  WKAT +G NS    S L++ Y +  + L+ A+  A+  L +  +   +S E +E+   T +      R+L Q EV++ +
Sbjct:    1 MSRRYDSRTTIFSPEGRLYQVEYAMEAIGHAGTCLGILANDGVLLAAERRNIHKLLDEVFFSEKIYKLNDDMACSVAGITSDANVLTNELRLIAQRYLLQYQEPIPCEQLVTALCDIKQAYTQFGGKRPFGVSLLYIGWDKHYGFQ-LYQSDPSGNYGGWKATCIGNNSAAAVSMLKQDYKEGDMTLKSALALAVKVLNKTMDVSKLSAEKVEIATLTRENGKTKIRVLKQKEVEELI 237          
BLAST of Proteasome subunit alpha type vs. Ensembl Xenopus
Match: fkbp9 (FKBP prolyl isomerase 9 [Source:Xenbase;Acc:XB-GENE-1019523])

HSP 1 Score: 142.51 bits (358), Expect = 6.261e-41
Identity = 82/231 (35.50%), Postives = 131/231 (56.71%), Query Frame = 2
Query:   77 LTTFSPSGKLVQIEYALKAVD-GGASSVGIKACNGVVLAVEKKFNSLLIDETSIQRIQTITKNIGFVYSGLSPDYRVLVKSAQKIAQEYQLKHGDGISPEQLAKRIAAVMQEYTQSGGVRPFGVSLLIAGWDNEIVRPFLFQCDPSGTYFPWKATALGKNSGNGKSFLEKRYSDKLE--LEDAIHTAILTLKEGFEGVMSEENIEVGICT--EKGFRILDQSEVKDYLTAI 754
            +T FSP G+L Q+EYA KA++ GG +SV ++  +  V+  ++K    L+D  ++  +  IT++IG V +G++ D R  V+ A+  A  ++ K+G  I  + L KRIA + Q YTQ+  +RP G  +++ G D E   P +F+CDP+G Y  +KAT  G       SFLEK+   KL+   E  + TAI  L            +EVG+ T  +  FR+L ++E+  +L A+
Sbjct:   13 ITIFSPEGRLYQVEYAFKAINQGGLTSVAVRGKDCAVVVTQRKVPDKLLDSNTVTHLFRITESIGCVMTGMTADSRSQVQRARYEAANWKYKYGYEIPVDMLCKRIADISQVYTQNAEMRPLGCCMILIGVDEE-NGPQVFKCDPAGYYCGFKATTAGVKQTEATSFLEKKVKKKLDWTYEQTLETAISCLSTVLSIDFKPSELEVGVVTVEDPKFRVLTEAEIDVHLVAL 242          
BLAST of Proteasome subunit alpha type vs. Ensembl Mouse
Match: Psma2 (proteasome (prosome, macropain) subunit, alpha type 2 [Source:MGI Symbol;Acc:MGI:104885])

HSP 1 Score: 337.035 bits (863), Expect = 1.505e-117
Identity = 166/235 (70.64%), Postives = 192/235 (81.70%), Query Frame = 2
Query:   53 MSER-YSFSLTTFSPSGKLVQIEYALKAVDGGASSVGIKACNGVVLAVEKKFNSLLIDETSIQRIQTITKNIGFVYSGLSPDYRVLVKSAQKIAQEYQLKHGDGISPEQLAKRIAAVMQEYTQSGGVRPFGVSLLIAGWDNEIVRPFLFQCDPSGTYFPWKATALGKNSGNGKSFLEKRYSDKLELEDAIHTAILTLKEGFEGVMSEENIEVGICTEKGFRILDQSEVKDYLTAI 754
            M+ER YSFSLTTFSPSGKLVQIEYAL AV GGA SVGIKA NGVVLA EKK  S+L DE S+ +++ ITK+IG VYSG+ PDYRVLV  A+K+AQ+Y L + + I   QL +R+A+VMQEYTQSGGVRPFGVSLLI GW+    RP+LFQ DPSG YF WKATA+GKN  NGK+FLEKRY++ LELEDAIHTAILTLKE FEG M+E+NIEVGIC E GFR L  +EV+DYL AI
Sbjct:    1 MAERGYSFSLTTFSPSGKLVQIEYALAAVAGGAPSVGIKAANGVVLATEKKQKSILYDERSVHKVEPITKHIGLVYSGMGPDYRVLVHRARKLAQQYYLVYQEPIPTAQLVQRVASVMQEYTQSGGVRPFGVSLLICGWNEG--RPYLFQSDPSGAYFAWKATAMGKNYVNGKTFLEKRYNEDLELEDAIHTAILTLKESFEGQMTEDNIEVGICNEAGFRRLTPTEVRDYLAAI 233          
BLAST of Proteasome subunit alpha type vs. Ensembl Mouse
Match: Psma2 (proteasome (prosome, macropain) subunit, alpha type 2 [Source:MGI Symbol;Acc:MGI:104885])

HSP 1 Score: 258.455 bits (659), Expect = 2.904e-87
Identity = 122/182 (67.03%), Postives = 147/182 (80.77%), Query Frame = 2
Query:  209 SLLIDETSIQRIQTITKNIGFVYSGLSPDYRVLVKSAQKIAQEYQLKHGDGISPEQLAKRIAAVMQEYTQSGGVRPFGVSLLIAGWDNEIVRPFLFQCDPSGTYFPWKATALGKNSGNGKSFLEKRYSDKLELEDAIHTAILTLKEGFEGVMSEENIEVGICTEKGFRILDQSEVKDYLTAI 754
            S+L DE S+ +++ ITK+IG VYSG+ PDYRVLV  A+K+AQ+Y L + + I   QL +R+A+VMQEYTQSGGVRPFGVSLLI GW+    RP+LFQ DPSG YF WKATA+GKN  NGK+FLEKRY++ LELEDAIHTAILTLKE FEG M+E+NIEVGIC E GFR L  +EV+DYL AI
Sbjct:    3 SILYDERSVHKVEPITKHIGLVYSGMGPDYRVLVHRARKLAQQYYLVYQEPIPTAQLVQRVASVMQEYTQSGGVRPFGVSLLICGWNEG--RPYLFQSDPSGAYFAWKATAMGKNYVNGKTFLEKRYNEDLELEDAIHTAILTLKESFEGQMTEDNIEVGICNEAGFRRLTPTEVRDYLAAI 182          
BLAST of Proteasome subunit alpha type vs. Ensembl Mouse
Match: Psma8 (proteasome (prosome, macropain) subunit, alpha type, 8 [Source:MGI Symbol;Acc:MGI:1920927])

HSP 1 Score: 164.081 bits (414), Expect = 2.326e-49
Identity = 92/218 (42.20%), Postives = 138/218 (63.30%), Query Frame = 2
Query:   53 MSERYSFSLTTFSPSGKLVQIEYALKAVDGGASSVGIKACNGVVLAVEKKFNSLLIDETSIQRIQTITKNIGFVYSGLSPDYRVLVKSAQKIAQEYQLKHGDGISPEQLAKRIAAVMQEYTQSGGVRPFGVSLLIAGWDNEIVRPFLFQCDPSGTYFPWKATALGKNSGNGKSFLEKRYSDKLELEDAIHT---AI-LTLKEGFEGVMS-EENIEVGI 691
            M+ RY  ++T FSP G L Q+EYA +AV  G+++VGI+  N VVL VEKK  + L DE ++++I  +  ++   ++GL+ D RV++  A+   Q ++L   D ++ E + + IA + Q+YTQS G RPFG+S LI G+D++ + P L+Q DPSGTY  WKA A+G+++   + FLEK Y+     EDAI     AI L +K   E V S  +NIE+ I
Sbjct:    1 MASRYDRAITVFSPDGHLFQVEYAQEAVKKGSTAVGIRGTNIVVLGVEKKSVAKLQDERTVRKICALDDHVCMAFAGLTADARVVISRARVECQSHKLTVEDPVTVEYITRFIATLKQKYTQSNGRRPFGISALIVGFDDDGI-PRLYQTDPSGTYHAWKANAIGRSAKTVREFLEKNYT-----EDAISNDKEAIKLAIKALLEVVQSGGKNIELAI 212          
BLAST of Proteasome subunit alpha type vs. Ensembl Mouse
Match: Psma7 (proteasome (prosome, macropain) subunit, alpha type 7 [Source:MGI Symbol;Acc:MGI:1347070])

HSP 1 Score: 163.31 bits (412), Expect = 5.260e-49
Identity = 88/233 (37.77%), Postives = 144/233 (61.80%), Query Frame = 2
Query:   65 YSFSLTTFSPSGKLVQIEYALKAVDGGASSVGIKACNGVVLAVEKKFNSLLIDETSIQRIQTITKNIGFVYSGLSPDYRVLVKSAQKIAQEYQLKHGDGISPEQLAKRIAAVMQEYTQSGGVRPFGVSLLIAGWDNEIVRPFLFQCDPSGTYFPWKATALGKNSGNGKSFLEKRYSDKLELEDAIHTAILTLKEGFEGVMSE-----ENIEVGIC-TEKGFRILDQSEVKDYL 745
            Y  ++T FSP G L Q+EYA +AV  G+++VG++  + VVL VEKK  + L DE ++++I  +  N+   ++GL+ D R+++  A+   Q ++L   D ++ E + + IA++ Q YTQS G RPFG+S LI G+D +   P L+Q DPSGTY  WKA A+G+ + + + FLEK Y+D     DAI T  LT+K   + ++       +NIE+ +   ++  +IL+  E++ Y+
Sbjct:    3 YDRAITVFSPDGHLFQVEYAQEAVKKGSTAVGVRGKDIVVLGVEKKSVAKLQDERTVRKICALDDNVCMAFAGLTADARIVINRARVECQSHRLTVEDPVTVEYITRYIASLKQRYTQSNGRRPFGISALIVGFDFDGT-PRLYQTDPSGTYHAWKANAIGRGAKSVREFLEKNYTD-----DAIETDDLTIKLVIKALLEVVQSGGKNIELAVMRRDQPLKILNPEEIEKYV 229          
BLAST of Proteasome subunit alpha type vs. Ensembl Mouse
Match: Psma7 (proteasome (prosome, macropain) subunit, alpha type 7 [Source:MGI Symbol;Acc:MGI:1347070])

HSP 1 Score: 158.688 bits (400), Expect = 1.578e-47
Identity = 81/193 (41.97%), Postives = 124/193 (64.25%), Query Frame = 2
Query:   65 YSFSLTTFSPSGKLVQIEYALKAVDGGASSVGIKACNGVVLAVEKKFNSLLIDETSIQRIQTITKNIGFVYSGLSPDYRVLVKSAQKIAQEYQLKHGDGISPEQLAKRIAAVMQEYTQSGGVRPFGVSLLIAGWDNEIVRPFLFQCDPSGTYFPWKATALGKNSGNGKSFLEKRYSDKLELEDAIHTAILTLK 643
            Y  ++T FSP G L Q+EYA +AV  G+++VG++  + VVL VEKK  + L DE ++++I  +  N+   ++GL+ D R+++  A+   Q ++L   D ++ E + + IA++ Q YTQS G RPFG+S LI G+D +   P L+Q DPSGTY  WKA A+G+ + + + FLEK Y+D     DAI T  LT+K
Sbjct:    3 YDRAITVFSPDGHLFQVEYAQEAVKKGSTAVGVRGKDIVVLGVEKKSVAKLQDERTVRKICALDDNVCMAFAGLTADARIVINRARVECQSHRLTVEDPVTVEYITRYIASLKQRYTQSNGRRPFGISALIVGFDFDGT-PRLYQTDPSGTYHAWKANAIGRGAKSVREFLEKNYTD-----DAIETDDLTIK 189          
BLAST of Proteasome subunit alpha type vs. UniProt/SwissProt
Match: sp|P25787|PSA2_HUMAN (Proteasome subunit alpha type-2 OS=Homo sapiens OX=9606 GN=PSMA2 PE=1 SV=2)

HSP 1 Score: 337.806 bits (865), Expect = 4.948e-117
Identity = 167/235 (71.06%), Postives = 192/235 (81.70%), Query Frame = 2
Query:   53 MSER-YSFSLTTFSPSGKLVQIEYALKAVDGGASSVGIKACNGVVLAVEKKFNSLLIDETSIQRIQTITKNIGFVYSGLSPDYRVLVKSAQKIAQEYQLKHGDGISPEQLAKRIAAVMQEYTQSGGVRPFGVSLLIAGWDNEIVRPFLFQCDPSGTYFPWKATALGKNSGNGKSFLEKRYSDKLELEDAIHTAILTLKEGFEGVMSEENIEVGICTEKGFRILDQSEVKDYLTAI 754
            M+ER YSFSLTTFSPSGKLVQIEYAL AV GGA SVGIKA NGVVLA EKK  S+L DE S+ +++ ITK+IG VYSG+ PDYRVLV  A+K+AQ+Y L + + I   QL +R+A+VMQEYTQSGGVRPFGVSLLI GW+    RP+LFQ DPSG YF WKATA+GKN  NGK+FLEKRY++ LELEDAIHTAILTLKE FEG M+E+NIEVGIC E GFR L  +EVKDYL AI
Sbjct:    1 MAERGYSFSLTTFSPSGKLVQIEYALAAVAGGAPSVGIKAANGVVLATEKKQKSILYDERSVHKVEPITKHIGLVYSGMGPDYRVLVHRARKLAQQYYLVYQEPIPTAQLVQRVASVMQEYTQSGGVRPFGVSLLICGWNEG--RPYLFQSDPSGAYFAWKATAMGKNYVNGKTFLEKRYNEDLELEDAIHTAILTLKESFEGQMTEDNIEVGICNEAGFRRLTPTEVKDYLAAI 233          
BLAST of Proteasome subunit alpha type vs. UniProt/SwissProt
Match: sp|Q3T0Y5|PSA2_BOVIN (Proteasome subunit alpha type-2 OS=Bos taurus OX=9913 GN=PSMA2 PE=1 SV=3)

HSP 1 Score: 337.806 bits (865), Expect = 4.948e-117
Identity = 167/235 (71.06%), Postives = 192/235 (81.70%), Query Frame = 2
Query:   53 MSER-YSFSLTTFSPSGKLVQIEYALKAVDGGASSVGIKACNGVVLAVEKKFNSLLIDETSIQRIQTITKNIGFVYSGLSPDYRVLVKSAQKIAQEYQLKHGDGISPEQLAKRIAAVMQEYTQSGGVRPFGVSLLIAGWDNEIVRPFLFQCDPSGTYFPWKATALGKNSGNGKSFLEKRYSDKLELEDAIHTAILTLKEGFEGVMSEENIEVGICTEKGFRILDQSEVKDYLTAI 754
            M+ER YSFSLTTFSPSGKLVQIEYAL AV GGA SVGIKA NGVVLA EKK  S+L DE S+ +++ ITK+IG VYSG+ PDYRVLV  A+K+AQ+Y L + + I   QL +R+A+VMQEYTQSGGVRPFGVSLLI GW+    RP+LFQ DPSG YF WKATA+GKN  NGK+FLEKRY++ LELEDAIHTAILTLKE FEG M+E+NIEVGIC E GFR L  +EVKDYL AI
Sbjct:    1 MAERGYSFSLTTFSPSGKLVQIEYALAAVAGGAPSVGIKAANGVVLATEKKQKSILYDERSVHKVEPITKHIGLVYSGMGPDYRVLVHRARKLAQQYYLVYQEPIPTAQLVQRVASVMQEYTQSGGVRPFGVSLLICGWNEG--RPYLFQSDPSGAYFAWKATAMGKNYVNGKTFLEKRYNEDLELEDAIHTAILTLKESFEGQMTEDNIEVGICNEAGFRRLTPTEVKDYLAAI 233          
BLAST of Proteasome subunit alpha type vs. UniProt/SwissProt
Match: sp|P17220|PSA2_RAT (Proteasome subunit alpha type-2 OS=Rattus norvegicus OX=10116 GN=Psma2 PE=1 SV=3)

HSP 1 Score: 337.035 bits (863), Expect = 1.053e-116
Identity = 166/235 (70.64%), Postives = 192/235 (81.70%), Query Frame = 2
Query:   53 MSER-YSFSLTTFSPSGKLVQIEYALKAVDGGASSVGIKACNGVVLAVEKKFNSLLIDETSIQRIQTITKNIGFVYSGLSPDYRVLVKSAQKIAQEYQLKHGDGISPEQLAKRIAAVMQEYTQSGGVRPFGVSLLIAGWDNEIVRPFLFQCDPSGTYFPWKATALGKNSGNGKSFLEKRYSDKLELEDAIHTAILTLKEGFEGVMSEENIEVGICTEKGFRILDQSEVKDYLTAI 754
            M+ER YSFSLTTFSPSGKLVQIEYAL AV GGA SVGIKA NGVVLA EKK  S+L DE S+ +++ ITK+IG VYSG+ PDYRVLV  A+K+AQ+Y L + + I   QL +R+A+VMQEYTQSGGVRPFGVSLLI GW+    RP+LFQ DPSG YF WKATA+GKN  NGK+FLEKRY++ LELEDAIHTAILTLKE FEG M+E+NIEVGIC E GFR L  +EV+DYL AI
Sbjct:    1 MAERGYSFSLTTFSPSGKLVQIEYALAAVAGGAPSVGIKAANGVVLATEKKQKSILYDERSVHKVEPITKHIGLVYSGMGPDYRVLVHRARKLAQQYYLVYQEPIPTAQLVQRVASVMQEYTQSGGVRPFGVSLLICGWNEG--RPYLFQSDPSGAYFAWKATAMGKNYVNGKTFLEKRYNEDLELEDAIHTAILTLKESFEGQMTEDNIEVGICNEAGFRRLTPTEVRDYLAAI 233          
BLAST of Proteasome subunit alpha type vs. UniProt/SwissProt
Match: sp|P49722|PSA2_MOUSE (Proteasome subunit alpha type-2 OS=Mus musculus OX=10090 GN=Psma2 PE=1 SV=3)

HSP 1 Score: 337.035 bits (863), Expect = 1.053e-116
Identity = 166/235 (70.64%), Postives = 192/235 (81.70%), Query Frame = 2
Query:   53 MSER-YSFSLTTFSPSGKLVQIEYALKAVDGGASSVGIKACNGVVLAVEKKFNSLLIDETSIQRIQTITKNIGFVYSGLSPDYRVLVKSAQKIAQEYQLKHGDGISPEQLAKRIAAVMQEYTQSGGVRPFGVSLLIAGWDNEIVRPFLFQCDPSGTYFPWKATALGKNSGNGKSFLEKRYSDKLELEDAIHTAILTLKEGFEGVMSEENIEVGICTEKGFRILDQSEVKDYLTAI 754
            M+ER YSFSLTTFSPSGKLVQIEYAL AV GGA SVGIKA NGVVLA EKK  S+L DE S+ +++ ITK+IG VYSG+ PDYRVLV  A+K+AQ+Y L + + I   QL +R+A+VMQEYTQSGGVRPFGVSLLI GW+    RP+LFQ DPSG YF WKATA+GKN  NGK+FLEKRY++ LELEDAIHTAILTLKE FEG M+E+NIEVGIC E GFR L  +EV+DYL AI
Sbjct:    1 MAERGYSFSLTTFSPSGKLVQIEYALAAVAGGAPSVGIKAANGVVLATEKKQKSILYDERSVHKVEPITKHIGLVYSGMGPDYRVLVHRARKLAQQYYLVYQEPIPTAQLVQRVASVMQEYTQSGGVRPFGVSLLICGWNEG--RPYLFQSDPSGAYFAWKATAMGKNYVNGKTFLEKRYNEDLELEDAIHTAILTLKESFEGQMTEDNIEVGICNEAGFRRLTPTEVRDYLAAI 233          
BLAST of Proteasome subunit alpha type vs. UniProt/SwissProt
Match: sp|P40301|PSA2_DROME (Proteasome subunit alpha type-2 OS=Drosophila melanogaster OX=7227 GN=Prosalpha2 PE=1 SV=1)

HSP 1 Score: 330.102 bits (845), Expect = 7.246e-114
Identity = 155/234 (66.24%), Postives = 189/234 (80.77%), Query Frame = 2
Query:   56 SERYSFSLTTFSPSGKLVQIEYALKAVDGGASSVGIKACNGVVLAVEKKFNSLLIDETSIQRIQTITKNIGFVYSGLSPDYRVLVKSAQKIAQEYQLKHGDGISPEQLAKRIAAVMQEYTQSGGVRPFGVSLLIAGWDNEIVRPFLFQCDPSGTYFPWKATALGKNSGNGKSFLEKRYSDKLELEDAIHTAILTLKEGFEGVMSEENIEVGICTEKGFRILDQSEVKDYLTAIP 757
            +ERYSFSLTTFSPSGKLVQ+EYAL AV GGA SVGI A NGVV+A E K  S L ++ S+ R++ I  +IG VYSG+ PDYR+LVK A+KIAQ Y L + + I   QL +R+A +MQEYTQSGGVRPFGVSLLI GWDN+  RP+L+Q DPSG YF WKATA+GKN+ NGK+FLEKRYS+ LEL+DA+HTAILTLKEGFEG M+ +NIE+GIC + GF+ LD + +KDYL +IP
Sbjct:    3 TERYSFSLTTFSPSGKLVQLEYALAAVSGGAPSVGIIASNGVVIATENKHKSPLYEQHSVHRVEMIYNHIGMVYSGMGPDYRLLVKQARKIAQTYYLTYKEPIPVSQLVQRVATLMQEYTQSGGVRPFGVSLLICGWDND--RPYLYQSDPSGAYFAWKATAMGKNAVNGKTFLEKRYSEDLELDDAVHTAILTLKEGFEGKMTADNIEIGICDQNGFQRLDPASIKDYLASIP 234          
BLAST of Proteasome subunit alpha type vs. TrEMBL
Match: A0A0X3PI24 (Proteasome subunit alpha type OS=Schistocephalus solidus OX=70667 GN=PSA2 PE=3 SV=1)

HSP 1 Score: 389.808 bits (1000), Expect = 4.751e-135
Identity = 182/235 (77.45%), Postives = 207/235 (88.09%), Query Frame = 2
Query:   53 MSERYSFSLTTFSPSGKLVQIEYALKAVDGGASSVGIKACNGVVLAVEKKFNSLLIDETSIQRIQTITKNIGFVYSGLSPDYRVLVKSAQKIAQEYQLKHGDGISPEQLAKRIAAVMQEYTQSGGVRPFGVSLLIAGWDNEIVRPFLFQCDPSGTYFPWKATALGKNSGNGKSFLEKRYSDKLELEDAIHTAILTLKEGFEGVMSEENIEVGICTEKGFRILDQSEVKDYLTAIP 757
            M+ERYSFSLTTFSPSGKL+QIEYALKA D GA SVGIKA NGVVLAVEKKF S LIDE+++ RI+ +TKN+G VYSGLSPDYRVLVK A+K+AQ YQL + D ISPEQL  RIAAVMQEYTQSGGVRPFGVSLL+AGWD++  RP+L+QCDPSGT+FPWKATALGKNS NGK+FLEKR+SDKLELEDA+H AILTLKE FEG M+E NIE+ +C EKGFRIL+ SE+KDYL  IP
Sbjct:    1 MTERYSFSLTTFSPSGKLLQIEYALKAADYGAPSVGIKAANGVVLAVEKKFTSELIDESTVSRIEPVTKNVGMVYSGLSPDYRVLVKQARKLAQGYQLAYDDSISPEQLVIRIAAVMQEYTQSGGVRPFGVSLLVAGWDHDANRPYLYQCDPSGTFFPWKATALGKNSMNGKAFLEKRHSDKLELEDAVHAAILTLKESFEGQMTENNIEIAVCNEKGFRILEPSEIKDYLATIP 235          
BLAST of Proteasome subunit alpha type vs. TrEMBL
Match: A0A4S2LRC8 (Proteasome subunit alpha type OS=Opisthorchis felineus OX=147828 GN=CRM22_006992 PE=3 SV=1)

HSP 1 Score: 384.8 bits (987), Expect = 4.198e-133
Identity = 182/234 (77.78%), Postives = 203/234 (86.75%), Query Frame = 2
Query:   53 MSERYSFSLTTFSPSGKLVQIEYALKAVDGGASSVGIKACNGVVLAVEKKFNSLLIDETSIQRIQTITKNIGFVYSGLSPDYRVLVKSAQKIAQEYQLKHGDGISPEQLAKRIAAVMQEYTQSGGVRPFGVSLLIAGWDNEIVRPFLFQCDPSGTYFPWKATALGKNSGNGKSFLEKRYSDKLELEDAIHTAILTLKEGFEGVMSEENIEVGICTEKGFRILDQSEVKDYLTAI 754
            MSERYSFSLTTFSPSGKLVQIEYALKAV+ GA SVGI+A NGVVLAVEKKF S LIDE++I +I+ ++KNIG VYSGLSPDYRVLVK A+K AQ Y++ +GD ISPEQL  R AAVMQEYTQSGGVRPFGVSLLIAGWD E  RP+L+QCDPSGTYFPWKATALG NS NGKSFLEKRY+  LEL+DA+H AILTLKE FEG M+E NIE+GIC E+GFR+L  SEVKDYL AI
Sbjct:    1 MSERYSFSLTTFSPSGKLVQIEYALKAVEAGAPSVGIRATNGVVLAVEKKFTSKLIDESTIHKIENVSKNIGMVYSGLSPDYRVLVKQARKSAQAYEMAYGDTISPEQLVVRTAAVMQEYTQSGGVRPFGVSLLIAGWDYEAKRPYLYQCDPSGTYFPWKATALGHNSQNGKSFLEKRYNKDLELDDAVHAAILTLKESFEGQMTENNIEIGICNERGFRVLTPSEVKDYLAAI 234          
BLAST of Proteasome subunit alpha type vs. TrEMBL
Match: A0A074Z6K9 (Proteasome subunit alpha type OS=Opisthorchis viverrini OX=6198 GN=T265_12114 PE=3 SV=1)

HSP 1 Score: 384.8 bits (987), Expect = 4.198e-133
Identity = 182/234 (77.78%), Postives = 203/234 (86.75%), Query Frame = 2
Query:   53 MSERYSFSLTTFSPSGKLVQIEYALKAVDGGASSVGIKACNGVVLAVEKKFNSLLIDETSIQRIQTITKNIGFVYSGLSPDYRVLVKSAQKIAQEYQLKHGDGISPEQLAKRIAAVMQEYTQSGGVRPFGVSLLIAGWDNEIVRPFLFQCDPSGTYFPWKATALGKNSGNGKSFLEKRYSDKLELEDAIHTAILTLKEGFEGVMSEENIEVGICTEKGFRILDQSEVKDYLTAI 754
            MSERYSFSLTTFSPSGKLVQIEYALKAV+ GA SVGI+A NGVVLAVEKKF S LIDE++I +I+ ++KNIG VYSGLSPDYRVLVK A+K AQ Y++ +GD ISPEQL  R AAVMQEYTQSGGVRPFGVSLLIAGWD E  RP+L+QCDPSGTYFPWKATALG NS NGKSFLEKRY+  LEL+DA+H AILTLKE FEG M+E NIE+GIC E+GFR+L  SEVKDYL AI
Sbjct:    1 MSERYSFSLTTFSPSGKLVQIEYALKAVEAGAPSVGIRATNGVVLAVEKKFTSKLIDESTIHKIENVSKNIGMVYSGLSPDYRVLVKQARKSAQAYEMAYGDTISPEQLVVRTAAVMQEYTQSGGVRPFGVSLLIAGWDYEAKRPYLYQCDPSGTYFPWKATALGHNSQNGKSFLEKRYNKDLELDDAVHAAILTLKESFEGQMTENNIEIGICNERGFRVLTPSEVKDYLAAI 234          
BLAST of Proteasome subunit alpha type vs. TrEMBL
Match: E4W3S2 (Proteasome subunit alpha type OS=Clonorchis sinensis OX=79923 GN=PSMA2 PE=2 SV=1)

HSP 1 Score: 384.8 bits (987), Expect = 4.198e-133
Identity = 182/234 (77.78%), Postives = 203/234 (86.75%), Query Frame = 2
Query:   53 MSERYSFSLTTFSPSGKLVQIEYALKAVDGGASSVGIKACNGVVLAVEKKFNSLLIDETSIQRIQTITKNIGFVYSGLSPDYRVLVKSAQKIAQEYQLKHGDGISPEQLAKRIAAVMQEYTQSGGVRPFGVSLLIAGWDNEIVRPFLFQCDPSGTYFPWKATALGKNSGNGKSFLEKRYSDKLELEDAIHTAILTLKEGFEGVMSEENIEVGICTEKGFRILDQSEVKDYLTAI 754
            MSERYSFSLTTFSPSGKLVQIEYALKAV+ GA SVGI+A NGVVLAVEKKF S LIDE++I +I+ ++KNIG VYSGLSPDYRVLVK A+K AQ Y++ +GD ISPEQL  R AAVMQEYTQSGGVRPFGVSLLIAGWD E  RP+L+QCDPSGTYFPWKATALG NS NGKSFLEKRY+  LEL+DA+H AILTLKE FEG M+E NIE+GIC E+GFR+L  SEVKDYL AI
Sbjct:    1 MSERYSFSLTTFSPSGKLVQIEYALKAVEAGAPSVGIRATNGVVLAVEKKFTSKLIDESTIHKIENVSKNIGMVYSGLSPDYRVLVKQARKSAQAYEMAYGDTISPEQLVVRTAAVMQEYTQSGGVRPFGVSLLIAGWDYEAKRPYLYQCDPSGTYFPWKATALGHNSQNGKSFLEKRYNKDLELDDAVHAAILTLKESFEGQMTENNIEIGICNERGFRVLTPSEVKDYLAAI 234          
BLAST of Proteasome subunit alpha type vs. TrEMBL
Match: A0A0R3WJA0 (Proteasome subunit alpha type OS=Hydatigena taeniaeformis OX=6205 GN=TTAC_LOCUS737 PE=3 SV=1)

HSP 1 Score: 382.489 bits (981), Expect = 4.100e-132
Identity = 181/235 (77.02%), Postives = 202/235 (85.96%), Query Frame = 2
Query:   53 MSERYSFSLTTFSPSGKLVQIEYALKAVDGGASSVGIKACNGVVLAVEKKFNSLLIDETSIQRIQTITKNIGFVYSGLSPDYRVLVKSAQKIAQEYQLKHGDGISPEQLAKRIAAVMQEYTQSGGVRPFGVSLLIAGWDNEIVRPFLFQCDPSGTYFPWKATALGKNSGNGKSFLEKRYSDKLELEDAIHTAILTLKEGFEGVMSEENIEVGICTEKGFRILDQSEVKDYLTAIP 757
            M+ERYSFSLTTFSPSGKL+QIEYALKA + GA SVGI+A NGVVLAVEKKFNS LIDE SI RI+ +TK++G VYSGLSPDYRVLVK A+K AQ YQL + + ISPEQL  RIAAVMQEYTQSGGVRPFGVSLLIAGWD    R +L+QCDPSGTYFPWKATALGKNS NGK+FLEKRY+DKLELEDA+H AILTLKE FEG M+E NIE+ +C EKGFR+L  SE+KDYL  IP
Sbjct:    1 MTERYSFSLTTFSPSGKLLQIEYALKAAECGAPSVGIRASNGVVLAVEKKFNSELIDEASISRIEPVTKSVGMVYSGLSPDYRVLVKQARKSAQAYQLAYNESISPEQLVTRIAAVMQEYTQSGGVRPFGVSLLIAGWDYNSNRAYLYQCDPSGTYFPWKATALGKNSLNGKNFLEKRYNDKLELEDAVHAAILTLKESFEGQMTENNIEIAVCNEKGFRVLQPSEIKDYLATIP 235          
BLAST of Proteasome subunit alpha type vs. Ensembl Cavefish
Match: psma2 (proteasome 20S subunit alpha 2 [Source:NCBI gene;Acc:103045926])

HSP 1 Score: 325.479 bits (833), Expect = 4.320e-113
Identity = 167/235 (71.06%), Postives = 194/235 (82.55%), Query Frame = 2
Query:   53 MSER-YSFSLTTFSPSGKLVQIEYALKAVDGGASSVGIKACNGVVLAVEKKFNSLLIDETSIQRIQTITKNIGFVYSGLSPDYRVLVKSAQKIAQEYQLKHGDGISPEQLAKRIAAVMQEYTQSGGVRPFGVSLLIAGWDNEIVRPFLFQCDPSGTYFPWKATALGKNSGNGKSFLEKRYSDKLELEDAIHTAILTLKEGFEGVMSEENIEVGICTEKGFRILDQSEVKDYLTAI 754
            M++R YSFSLTTFSPSGKLVQIEYAL AV  GA SVGIKA NGVVLA EKK  S+L DE S+ +++ ITK+IG VYSG+ PDYRVLV+ A+K+AQ+Y L + + I   QL +R+A+VMQEYTQSGGVRPFGVSLLIAGWD +  RP+LFQ DPSG YF WKATA+GKN  NGK+FLEKRY++ LELEDAIHTAILTLKE FEG M+E+NIEVGIC E GFR L  +EVKDYL AI
Sbjct:    1 MADRGYSFSLTTFSPSGKLVQIEYALAAVAAGAPSVGIKASNGVVLATEKKQKSILYDEQSVHKVEPITKHIGMVYSGMGPDYRVLVRRARKLAQQYFLVYQEPIPTGQLVQRVASVMQEYTQSGGVRPFGVSLLIAGWDED--RPYLFQSDPSGAYFAWKATAMGKNYVNGKTFLEKRYNEDLELEDAIHTAILTLKESFEGQMTEDNIEVGICNEAGFRRLTPAEVKDYLAAI 233          
BLAST of Proteasome subunit alpha type vs. Ensembl Cavefish
Match: ENSAMXT00000057419.1 (pep primary_assembly:Astyanax_mexicanus-2.0:23:25877682:25880522:1 gene:ENSAMXG00000030145.1 transcript:ENSAMXT00000057419.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 308.916 bits (790), Expect = 2.252e-106
Identity = 161/236 (68.22%), Postives = 186/236 (78.81%), Query Frame = 2
Query:   65 YSFSLT------TFSPSGKLVQIEYALKAVDGGASSVGIKACNGVVLAVEKKFNSLLIDETSIQRIQTITKNIGFVYSGLSPDYRVLVKSAQKIAQEYQLKHGDGISPEQLAKRIAAVMQEYTQSGGVRPFGVSLLIAGWDNEIVRPFLFQCDPSGTYFPWKATALGKNSGNGKSFLEKRYSDKLELEDAIHTAILTLKEGFEGVMSEENIEVGICTEKGFRILDQSEVKDYLTAI 754
            Y FSL         SPSGKLVQIEYAL AV  GA SVGIKA NGVVLA EKK  S+L DE S+ +++ ITK+IG VYSG+ PDYRVLV+ A+K+AQ+Y L + + I   QL +R+A+VMQEYTQSGGVRPFGVSLLIAGWD +  RP+LFQ DPSG YF WKATA+GKN  NGK+FLEKRY++ LELEDAIHTAILTLKE FEG M+E+NIEVGIC E GFR L  +EVKDYL AI
Sbjct:    6 YCFSLLHELIIFPHSPSGKLVQIEYALAAVAAGAPSVGIKASNGVVLATEKKQKSILYDEQSVHKVEPITKHIGMVYSGMGPDYRVLVRRARKLAQQYFLVYQEPIPTGQLVQRVASVMQEYTQSGGVRPFGVSLLIAGWDED--RPYLFQSDPSGAYFAWKATAMGKNYVNGKTFLEKRYNEDLELEDAIHTAILTLKESFEGQMTEDNIEVGICNEAGFRRLSPAEVKDYLAAI 239          
BLAST of Proteasome subunit alpha type vs. Ensembl Cavefish
Match: psma2 (proteasome 20S subunit alpha 2 [Source:NCBI gene;Acc:103045926])

HSP 1 Score: 226.098 bits (575), Expect = 7.458e-75
Identity = 108/153 (70.59%), Postives = 127/153 (83.01%), Query Frame = 2
Query:  296 YRVLVKSAQKIAQEYQLKHGDGISPEQLAKRIAAVMQEYTQSGGVRPFGVSLLIAGWDNEIVRPFLFQCDPSGTYFPWKATALGKNSGNGKSFLEKRYSDKLELEDAIHTAILTLKEGFEGVMSEENIEVGICTEKGFRILDQSEVKDYLTAI 754
            +RVLV+ A+K+AQ+Y L + + I   QL +R+A+VMQEYTQSGGVRPFGVSLLIAGWD +  RP+LFQ DPSG YF WKATA+GKN  NGK+FLEKRY++ LELEDAIHTAILTLKE FEG M+E+NIEVGIC E GFR L  +EVKDYL AI
Sbjct:   13 FRVLVRRARKLAQQYFLVYQEPIPTGQLVQRVASVMQEYTQSGGVRPFGVSLLIAGWDED--RPYLFQSDPSGAYFAWKATAMGKNYVNGKTFLEKRYNEDLELEDAIHTAILTLKESFEGQMTEDNIEVGICNEAGFRRLTPAEVKDYLAAI 163          
BLAST of Proteasome subunit alpha type vs. Ensembl Cavefish
Match: psma8 (proteasome subunit alpha type-7 [Source:NCBI gene;Acc:103029839])

HSP 1 Score: 160.614 bits (405), Expect = 4.554e-48
Identity = 88/231 (38.10%), Postives = 142/231 (61.47%), Query Frame = 2
Query:   53 MSERYSFSLTTFSPSGKLVQIEYALKAVDGGASSVGIKACNGVVLAVEKKFNSLLIDETSIQRIQTITKNIGFVYSGLSPDYRVLVKSAQKIAQEYQLKHGDGISPEQLAKRIAAVMQEYTQSGGVRPFGVSLLIAGWDNEIVRPFLFQCDPSGTYFPWKATALGKNSGNGKSFLEKRYSDK--LELEDAIHTAILTLKEGFEGVMSEENIEVGICTE-KGFRILDQSEVK 736
            M+ RY  ++T FSP G L Q+EYA +AV  G+++VGI+  + VVL VEKK  + L +E ++++I  + +++   ++GL+ D R+++  A+   Q ++L   D ++ E + + IA + Q YTQS G RPFG+S LI G+D +   P L+Q DPSGTY  WKA A+G+++   + FLEK Y+D+      DAI  AI  L E  +     +NIE+ +    +  +IL+  E++
Sbjct:    1 MAARYDRAITVFSPDGHLFQVEYAQEAVKKGSTAVGIRGKDIVVLGVEKKSVAKLQEERTVRKICALDEHVCMAFAGLTADARIVINRARVECQSHRLTVEDPVTVEYITRYIATLKQRYTQSNGRRPFGISALIVGFDYDGT-PRLYQTDPSGTYHAWKANAIGRSAKTVREFLEKNYTDEALASDNDAIKLAIKALLEVVQS--GGKNIELAVIRRNQPLKILESKEIE 228          
BLAST of Proteasome subunit alpha type vs. Ensembl Cavefish
Match: PSMA7 (proteasome 20S subunit alpha 7 [Source:HGNC Symbol;Acc:HGNC:9536])

HSP 1 Score: 154.451 bits (389), Expect = 8.250e-46
Identity = 85/223 (38.12%), Postives = 130/223 (58.30%), Query Frame = 2
Query:   65 YSFSLTTFSPSGKLVQIEYALKAVDGGASSVGIKACNGVVLAVEKKFNSLLIDETSIQRIQTITKNIGFVYSGLSPDYRVLVKSAQKIAQEYQLKHGDGISPEQLAKRIAAVMQEYTQSGGVRPFGVSLLIAGWDNEIVRPFLFQCDPSGTYFPWKATALGKNSGNGKSFLEKRY------SDKLE--------LEDAIHTAILTLKEGFEGVMSEENIEVGI 691
            Y  ++T FSP G L Q+EYA +AV  G+++VG++  N V+L VEKK  ++L D+ ++++I  +  N+   ++GL+ D R+++  A+   Q ++L   D ++ E + + I+++ Q YTQS G RPFG+S LI G+D +   P L+Q DPSGTY  WKA A+G+++   + FLEK Y      SD+L         LE  IHT    L  G       ENI   I
Sbjct:    3 YDRAITVFSPDGHLFQVEYAQEAVKKGSTAVGVRGKNIVILGVEKKSAAMLQDDRTVRKICALDDNVFMAFAGLTADARIIINRARVECQSHRLTVEDPVTIEYITRYISSMKQRYTQSNGRRPFGISALIVGFDFDGT-PNLYQTDPSGTYHAWKANAIGRSAKTVREFLEKNYKEEDMESDELAIKLAVRALLEVYIHTQYQPLTSGILEPAEVENIVAAI 224          
BLAST of Proteasome subunit alpha type vs. Ensembl Sea Lamprey
Match: psma2 (proteasome 20S subunit alpha 2 [Source:ZFIN;Acc:ZDB-GENE-050522-479])

HSP 1 Score: 314.694 bits (805), Expect = 1.619e-109
Identity = 159/230 (69.13%), Postives = 185/230 (80.43%), Query Frame = 2
Query:   65 YSFSLTTFSPSGKLVQIEYALKAVDGGASSVGIKACNGVVLAVEKKFNSLLIDETSIQRIQTITKNIGFVYSGLSPDYRVLVKSAQKIAQEYQLKHGDGISPEQLAKRIAAVMQEYTQSGGVRPFGVSLLIAGWDNEIVRPFLFQCDPSGTYFPWKATALGKNSGNGKSFLEKRYSDKLELEDAIHTAILTLKEGFEGVMSEENIEVGICTEKGFRILDQSEVKDYLTAI 754
            YSFSLTTFSPSGKLVQIEYAL AV  GA SVGIKA NGVVLA EKK  S+L DE S+ +++ ITKNIG VYSG+ PD RVL++ A+K AQ Y L + + I   QL +R+A++MQEYTQSGGVRPFGVSLLIAGWD    +P+LFQ DPSG YF WKATA+GKN  NGK+FLEKRY++ LELEDA+HTAILTLKE FEG M+E+NIE+GIC E GFR L   EVKDYL +I
Sbjct:    6 YSFSLTTFSPSGKLVQIEYALAAVAAGAPSVGIKALNGVVLATEKKQKSILYDEQSVHKVEPITKNIGMVYSGMGPDCRVLIRKARKQAQNYYLTYQEQIPTAQLVQRVASLMQEYTQSGGVRPFGVSLLIAGWDEG--KPYLFQADPSGAYFAWKATAMGKNYVNGKTFLEKRYNEDLELEDAVHTAILTLKESFEGQMTEDNIEIGICNENGFRRLTPPEVKDYLASI 233          
BLAST of Proteasome subunit alpha type vs. Ensembl Sea Lamprey
Match: psma6a (proteasome 20S subunit alpha 6a [Source:ZFIN;Acc:ZDB-GENE-020326-1])

HSP 1 Score: 145.206 bits (365), Expect = 6.427e-43
Identity = 82/231 (35.50%), Postives = 130/231 (56.28%), Query Frame = 2
Query:   77 LTTFSPSGKLVQIEYALKAVD-GGASSVGIKACNGVVLAVEKKFNSLLIDETSIQRIQTITKNIGFVYSGLSPDYRVLVKSAQKIAQEYQLKHGDGISPEQLAKRIAAVMQEYTQSGGVRPFGVSLLIAGWDNEIVRPFLFQCDPSGTYFPWKATALGKNSGNGKSFLEKRYSDKLE--LEDAIHTAILTLKEGFEGVMSEENIEVGICT--EKGFRILDQSEVKDYLTAI 754
            +T FSP G+L Q+EYA KA++ GG +SVG++  +  V+  +KK    L+D +++ ++  IT  IG + +G++ D R  V+  +  A  ++ K+G  I  + L KR+A + Q YTQ+  +RP G  +++ G D E+  P L++CDP+G +  +KAT+ G       SFLEK+   K +   E  + TAI  L            IEVGI T     FR+L + E+  +L AI
Sbjct:   13 ITIFSPEGRLYQVEYAFKAINQGGLTSVGLRGKDCAVMVTQKKVPDKLLDSSTVTQLYKITNGIGCMMTGMTADGRSQVQRGRYEAANWKYKYGYDIPVDMLCKRMADISQVYTQNAEMRPLGCCMMLIGIDEEL-GPQLYKCDPAGYFCGYKATSAGVKQTEANSFLEKKLKKKPDWSFEQTVETAITCLSTIVSADFKPSEIEVGIVTVDNPKFRVLSEVEIDTHLVAI 242          
BLAST of Proteasome subunit alpha type vs. Ensembl Sea Lamprey
Match: psma4 (proteasome 20S subunit alpha 4 [Source:ZFIN;Acc:ZDB-GENE-040426-1932])

HSP 1 Score: 141.739 bits (356), Expect = 2.589e-41
Identity = 84/238 (35.29%), Postives = 130/238 (54.62%), Query Frame = 2
Query:   53 MSERYSFSLTTFSPSGKLVQIEYALKAVDGGASSVGIKACNGVVLAVEKKFNSLLIDETSI-QRIQTITKNIGFVYSGLSPDYRVLVKSAQKIAQEYQLKHGDGISPEQLAKRIAAVMQEYTQSG---GVRPFGVSLLIAGWDNEIVRPFLFQCDPSGTYFPWKATALGKNSGNGKSFLEKRYSD-KLELEDAIHTAILTLKEGFE-GVMSEENIEVGICTEKG----FRILDQSEVK 736
            MS RY    T FSP G+L Q+EYA++A+    + +GI A +GV+LA E++    L+DE    ++I  + +++    +G++ D  VL    + IAQ Y  ++ + I  EQL   +  + Q YTQ G   G RPFGVS+L  GWD       L+Q DPSG Y  WKAT +G NS    S L++ Y +  + L+ A+  AI  L +  +   ++ E +E+   T +      ++L Q EV+
Sbjct:    1 MSRRYDSRTTIFSPEGRLYQVEYAMEAIGHAGTCLGILATDGVLLAAERRNTHKLLDEVFFSEKIYKLNEDMACSVAGITSDANVLTNELRVIAQRYLFQYQEPIPCEQLVTTLCDIKQAYTQFGAHEGKRPFGVSILYMGWDKHYGYQ-LYQSDPSGNYGGWKATCIGNNSAASVSMLKQEYKEGDMTLQSALALAIKVLNKTMDVSKLTAEKVEIATLTRENGKTKIKVLKQQEVE 237          
BLAST of Proteasome subunit alpha type vs. Ensembl Sea Lamprey
Match: psma5 (proteasome 20S subunit alpha 5 [Source:ZFIN;Acc:ZDB-GENE-040625-96])

HSP 1 Score: 134.035 bits (336), Expect = 1.313e-38
Identity = 79/236 (33.47%), Postives = 134/236 (56.78%), Query Frame = 2
Query:   65 YSFSLTTFSPSGKLVQIEYALKAVDGGASSVGIKACNGVVLAVEKKFNSLLIDETSIQRIQTITKNIGFVYSGLSPDYRVLVKSAQKIAQEYQLKHGDGISPEQLAKRIAAVM----QEYTQSGGV-RPFGVSLLIAGWDNEIVRPFLFQCDPSGTYFPWKATALGKNSGNGKSFLEKRYSDKLELEDAIHTAILTLKEGFEGVMSEENIEVGICTE-KGFRILDQSEVKDYLTAI 754
            Y   + TFSP G++ Q+EYA++A+  G++++GI+   GV LAVEK+  S L++ +SI++I  I  +IG   SGL  D R L   A+  AQ +   + + ++ E + + ++ +     +E  + G + RPFGV+LL  G D +   P LF  DPSGT+    A A+G  S   +S L++ Y   + L++AI T++  LK+  E  ++  NIE+      K F +  + E+++ +  I
Sbjct:    8 YDRGVNTFSPEGRIFQVEYAIEAIKLGSTAIGIQTSEGVCLAVEKRITSPLMEPSSIEKIVEIDAHIGCAMSGLIADARTLTDRARVEAQNHWFTYNERMTVESVTQAVSNLALQFGEEDAEPGAMSRPFGVALLFGGIDEK--GPQLFHMDPSGTFVQCDARAIGSASEGAQSSLQEVYHKSMTLKEAIKTSLTILKQVMEEKLNATNIELATVQPGKLFHMYTKEEIEEVIADI 241          
BLAST of Proteasome subunit alpha type vs. Ensembl Sea Lamprey
Match: psma3 (proteasome 20S subunit alpha 3 [Source:ZFIN;Acc:ZDB-GENE-050913-120])

HSP 1 Score: 119.783 bits (299), Expect = 4.963e-33
Identity = 64/173 (36.99%), Postives = 100/173 (57.80%), Query Frame = 2
Query:   65 YSFSLTTFSPSGKLVQIEYALKAVDGGASSVGIKACNGVVLAVEKKFNSLLIDETSIQRIQTITKNIGFVYSGLSPDYRVLVKSAQKIAQEYQLKHGDGISPEQLAKRIAAVMQEYTQSGGVRPFGVSLLIAGWDNEIVRPFLFQCDPSGTYFPWKATALGKNSGNGKSFLEK 583
            Y  S + FSP G++ Q+EYA+KAV+  +++V ++  +GVV  VEK   S L +E S +RI T+ K++G   +GL  D R L  +A+  A  ++  +G  I  + LA RIA     YT    VRPFG S+++A +  E+  P ++  DPSG  + +   A+GK     K+ +EK
Sbjct:    8 YDLSASQFSPDGRVFQVEYAMKAVENSSTAVAVRCKDGVVFGVEKLVLSKLYEEGSNKRIFTVDKHVGMAVAGLLADARQLASTARDEAASFRANYGAKIPVKHLADRIAMYAHAYTLYSSVRPFGCSVVLAAY--EVDGPQMYMIDPSGVSYGYWGCAIGKAKQAAKTEIEK 178          
BLAST of Proteasome subunit alpha type vs. Ensembl Yeast
Match: PRE8 (Alpha 2 subunit of the 20S proteasome [Source:SGD;Acc:S000004557])

HSP 1 Score: 245.743 bits (626), Expect = 2.999e-82
Identity = 135/251 (53.78%), Postives = 172/251 (68.53%), Query Frame = 2
Query:   53 MSERYSFSLTTFSPSGKLVQIEYALKAVDGGASSVGIKACNGVVLAVEKKFNSLLIDETSIQRIQTITKNIGFVYSGLSPDYRVLVKSAQKIAQ-EYQLKHGDGISPEQLAKRIAAVMQEYTQSGGVRPFGVSLLIAGWDNEIVRPFLFQCDPSGTYFPWKATALGKNSGNGKSFLEKRYSDKLELEDAIHTAILTLKEGFEGVMSEENIEV--------------GICTEKG--FRILDQSEVKDYLTAI 754
            M++RYSFSLTTFSPSGKL QI+YAL AV  G +S+GIKA NGVV+A EKK +S L    ++ ++  +T +IG VYSG+ PDYRVLV  ++K+A   Y+  +G+    + L   +A +MQE TQSGGVRPFGVSLLIAG D E     L+Q DPSG+YFPWKATA+GK S   K+FLEKR++D+LELEDAIH A+LTLKE  EG  + + IE+              GI T+KG  FR L   E+ D L A+
Sbjct:    1 MTDRYSFSLTTFSPSGKLGQIDYALTAVKQGVTSLGIKATNGVVIATEKKSSSPLAMSETLSKVSLLTPDIGAVYSGMGPDYRVLVDKSRKVAHTSYKRIYGEYPPTKLLVSEVAKIMQEATQSGGVRPFGVSLLIAGHD-EFNGFSLYQVDPSGSYFPWKATAIGKGSVAAKTFLEKRWNDELELEDAIHIALLTLKESVEGEFNGDTIELAIIGDENPDLLGYTGIPTDKGPRFRKLTSQEINDRLEAL 250          
BLAST of Proteasome subunit alpha type vs. Ensembl Yeast
Match: PRE6 (Alpha 4 subunit of the 20S proteasome; may replace alpha 3 subunit (Pre9p) under stress conditions to create a more active proteasomal isoform; GFP-fusion protein relocates from cytosol to the mitochondrial surface upon oxidative stress [Source:SGD;Acc:S000005398])

HSP 1 Score: 156.762 bits (395), Expect = 1.881e-47
Identity = 91/235 (38.72%), Postives = 138/235 (58.72%), Query Frame = 2
Query:   65 YSFSLTTFSPSGKLVQIEYALKAVDGGASSVGIKACNGVVLAVEKKFNSLLIDETSI--QRIQTITKNIGFVYSGLSPDYRVLVKSAQKIAQEYQLKHGDGISPEQLAKRIAAVMQEYTQSGGVRPFGVSLLIAGWDNEIVRPFLFQCDPSGTYFPWKATALGKNSGNGKSFLEKRYSDKLELEDAIHTAI-LTLKEGFEGVMS-EENIEVGIC-TEKGFRILDQSEVKDYLTAI 754
            Y  +L+ FSP G + Q+EYAL+AV  G  +VG+K  N VVL  E++ ++L + +T I   ++  I  ++   +SGL+ D R+L++ A+  AQ ++L   D ++ E L + +A V Q YTQSGGVRPFGVS LIAG+D     P L+Q +PSG Y  W A  +G+NS   + FLEK Y D+ E    +   + LT++   E V +  +NIE+ +   +     L   E+  Y+T I
Sbjct:    4 YDRALSIFSPDGHIFQVEYALEAVKRGTCAVGVKGKNCVVLGCERR-STLKLQDTRITPSKVSKIDSHVVLSFSGLNADSRILIEKARVEAQSHRLTLEDPVTVEYLTRYVAGVQQRYTQSGGVRPFGVSTLIAGFDPRDDEPKLYQTEPSGIYSSWSAQTIGRNSKTVREFLEKNY-DRKEPPATVEECVKLTVRSLLEVVQTGAKNIEITVVKPDSDIVALSSEEINQYVTQI 236          
BLAST of Proteasome subunit alpha type vs. Ensembl Yeast
Match: PRE9 (Alpha 3 subunit of the 20S proteasome; the only nonessential 20S subunit; may be replaced by the alpha 4 subunit (Pre6p) under stress conditions to create a more active proteasomal isoform [Source:SGD;Acc:S000003367])

HSP 1 Score: 151.369 bits (381), Expect = 2.779e-45
Identity = 74/196 (37.76%), Postives = 121/196 (61.73%), Query Frame = 2
Query:   56 SERYSFSLTTFSPSGKLVQIEYALKAVDGGASSVGIKACNGVVLAVEKKFNSLLID-ETSIQRIQTITKNIGFVYSGLSPDYRVLVKSAQKIAQEYQLKHGDGISPEQLAKRIAAVMQEYTQSGGVRPFGVSLLIAGWDNEIVRPFLFQCDPSGTYFPWKATALGKNSGNGKSFLEKRYSDKLELEDAIHTAILTL 640
            S RY    T FSP G+L Q+EYAL+++    +++GI A +G+VLA E+K  S L++ +TS +++  +   I    +GL+ D  +L+ +A+  AQ Y   + + I  E L +R++ + Q YTQ GG+RPFGVS + AG+D+      L+  +PSG Y  WKA ++G N+   ++ L+  Y D ++++DAI  A+ TL
Sbjct:    3 SRRYDSRTTIFSPEGRLYQVEYALESISHAGTAIGIMASDGIVLAAERKVTSTLLEQDTSTEKLYKLNDKIAVAVAGLTADAEILINTARIHAQNYLKTYNEDIPVEILVRRLSDIKQGYTQHGGLRPFGVSFIYAGYDDRYGYQ-LYTSNPSGNYTGWKAISVGANTSAAQTLLQMDYKDDMKVDDAIELALKTL 197          
BLAST of Proteasome subunit alpha type vs. Ensembl Yeast
Match: PUP2 (Alpha 5 subunit of the 20S proteasome; involved in ubiquitin-dependent catabolism; human homolog is subunit zeta [Source:SGD;Acc:S000003485])

HSP 1 Score: 129.798 bits (325), Expect = 6.614e-37
Identity = 76/234 (32.48%), Postives = 131/234 (55.98%), Query Frame = 2
Query:   65 YSFSLTTFSPSGKLVQIEYALKAVDGGASSVGIKACNGVVLAVEKKFNSLLIDETSIQRIQTITKNIGFVYSGLSPDYRVLVKSAQKIAQEYQLKHGDGISPEQLAKRIAAVMQEYTQSGG------VRPFGVSLLIAGWDNEIVRPFLFQCDPSGTYFPWKATALGKNSGNGKSFLEKRYSDKLELEDAIHTAILTLKEGFEGVMSEENIEVGICTEK-GFRILDQSEVKDYL 745
            Y   ++TFSP G+L Q+EY+L+A+  G++++GI    GVVL VEK+  S L++  SI++I  I ++IG   SGL+ D R +++ A+  A  + L + + I+ E L + +  +   + +          RPFGV+LLIAG D +     LF  +PSGT++ + A A+G  S   ++ L   +   L L++A    +  LK+  E  + E N ++   T++ GF+I D  +  + +
Sbjct:    8 YDRGVSTFSPEGRLFQVEYSLEAIKLGSTAIGIATKEGVVLGVEKRATSPLLESDSIEKIVEIDRHIGCAMSGLTADARSMIEHARTAAVTHNLYYDEDINVESLTQSVCDLALRFGEGASGEERLMSRPFGVALLIAGHDADDGYQ-LFHAEPSGTFYRYNAKAIGSGSEGAQAELLNEWHSSLTLKEAELLVLKILKQVMEEKLDENNAQLSCITKQDGFKIYDNEKTAELI 240          
BLAST of Proteasome subunit alpha type vs. Ensembl Yeast
Match: PRE10 (Alpha 7 subunit of the 20S proteasome; protein abundance increases in response to DNA replication stress [Source:SGD;Acc:S000005889])

HSP 1 Score: 121.324 bits (303), Expect = 1.730e-33
Identity = 69/173 (39.88%), Postives = 98/173 (56.65%), Query Frame = 2
Query:   65 YSFSLTTFSPSGKLVQIEYALKAVDGGASSVGIKACNGVVLAVEKKFNSLLIDETSIQRIQTITKNIGFVYSGLSPDYRVLVKSAQKIAQEYQLKHGDGISPEQLAKRIAAVMQEYTQSGGVRPFGVSLLIAGWDNEIVRPFLFQCDPSGTYFPWKATALGKNSGNGKSFLEK 583
            Y  S + FSP G+  Q+EYA+KAV+ G +S+GIK  +GVV AVEK   S L+      +IQ + ++IG VYSGL PD R LV   ++ A  ++  +   I     A R+   +Q +T    VRPFGVS +  G D       L+  +PSG+Y+ +K  A GK   + K+ LEK
Sbjct:    8 YDLSNSVFSPDGRNFQVEYAVKAVENGTTSIGIKCNDGVVFAVEKLITSKLLVPQKNVKIQVVDRHIGCVYSGLIPDGRHLVNRGREEAASFKKLYKTPIPIPAFADRLGQYVQAHTLYNSVRPFGVSTIFGGVDKNGAH--LYMLEPSGSYWGYKGAATGKGRQSAKAELEK 178          
BLAST of Proteasome subunit alpha type vs. Ensembl Nematostella
Match: EDO42182 (Proteasome subunit alpha type [Source:UniProtKB/TrEMBL;Acc:A7S263])

HSP 1 Score: 348.206 bits (892), Expect = 1.825e-122
Identity = 165/234 (70.51%), Postives = 195/234 (83.33%), Query Frame = 2
Query:   53 MSERYSFSLTTFSPSGKLVQIEYALKAVDGGASSVGIKACNGVVLAVEKKFNSLLIDETSIQRIQTITKNIGFVYSGLSPDYRVLVKSAQKIAQEYQLKHGDGISPEQLAKRIAAVMQEYTQSGGVRPFGVSLLIAGWDNEIVRPFLFQCDPSGTYFPWKATALGKNSGNGKSFLEKRYSDKLELEDAIHTAILTLKEGFEGVMSEENIEVGICTEKGFRILDQSEVKDYLTAI 754
            MSERYSFSLTTFSPSGKLVQIEYAL AV  G  SVGIKA NGVVLA EKK  S+L D+++I +++ +TKNIG +YSG+ PDYRVLV+ A+KIAQ+Y L + + I   QL +R+A+VMQEYTQSGGVRPFGVSLL+AGWD++  RP+LFQCDPSG YF WKATA+GKN  NGK+FLEKRY++ LELEDAIHTAILTLKE FEG M+E+NIE+G+C E GFR L   EVKDYL AI
Sbjct:    1 MSERYSFSLTTFSPSGKLVQIEYALAAVAAGGPSVGIKASNGVVLAAEKKQKSVLYDDSTICKVEMVTKNIGMIYSGMGPDYRVLVRHARKIAQQYYLMYKENIPTSQLVQRLASVMQEYTQSGGVRPFGVSLLVAGWDDD--RPYLFQCDPSGAYFAWKATAMGKNYVNGKTFLEKRYNESLELEDAIHTAILTLKESFEGQMTEDNIELGVCNENGFRRLTPPEVKDYLAAI 232          
BLAST of Proteasome subunit alpha type vs. Ensembl Nematostella
Match: EDO47310 (Proteasome subunit alpha type [Source:UniProtKB/TrEMBL;Acc:A7RMQ8])

HSP 1 Score: 162.155 bits (409), Expect = 4.539e-49
Identity = 94/237 (39.66%), Postives = 144/237 (60.76%), Query Frame = 2
Query:   53 MSERYSFSLTTFSPSGKLVQIEYALKAVDGGASSVGIKACNGVVLAVEKKFNSLLIDETSIQRIQTITKNIGFVYSGLSPDYRVLVKSAQKIAQEYQLKHGDGISPEQLAKRIAAVMQEYTQSGGVRPFGVSLLIAGWDNEIVRPFLFQCDPSGTYFPWKATALGKNSGNGKSFLEKRYSDKLELEDAIHTAILTLKEGFEGVMS-EENIEVGICTEKG--FRILDQSEVKDYLTAI 754
            MS  Y  ++T FSP G L Q+EYA +AV  G+++VG++  N VVL VE+K  + L +  ++++I T+  ++   ++GL+ D R+LV  A+   Q ++L   D ++ E + + IA + Q YTQS G RPFG+S LI G+D +   P L+Q DPSGTY  WKA A+G+++   + FLEK YSD++   D   T  L ++   E V S  +NIE+ +  +KG   RIL   EV  ++  I
Sbjct:    1 MSGSYDRAITVFSPDGHLFQVEYAQEAVKKGSTAVGVRGNNIVVLGVERKAVAKLQEPRTVRKICTLDDHVLMAFAGLTADARILVNKARVECQSHKLTVEDPVTLEYITRFIATLKQRYTQSNGRRPFGISTLIVGFDFDGT-PRLYQTDPSGTYHAWKANAIGRSAKTVREFLEKHYSDEVADSDE-STVKLAIRALLEVVQSGGKNIELAVM-KKGEPMRILKPDEVDKFVAII 234          
BLAST of Proteasome subunit alpha type vs. Ensembl Nematostella
Match: EDO39466 (Proteasome subunit alpha type [Source:UniProtKB/TrEMBL;Acc:A7S9Y7])

HSP 1 Score: 139.813 bits (351), Expect = 1.562e-40
Identity = 76/230 (33.04%), Postives = 134/230 (58.26%), Query Frame = 2
Query:   65 YSFSLTTFSPSGKLVQIEYALKAVDGGASSVGIKACNGVVLAVEKKFNSLLIDETSIQRIQTITKNIGFVYSGLSPDYRVLVKSAQKIAQEYQLKHGDGISPEQLAKRIAAVMQEY----TQSGGV-RPFGVSLLIAGWDNEIVRPFLFQCDPSGTYFPWKATALGKNSGNGKSFLEKRYSDKLELEDAIHTAILTLKEGFEGVMSEENIEVGICT-EKGFRILDQSEVK 736
            Y   + TFSP G+L Q+EYA++A+  G++++GI+   GVV+AVEK+  S L++ +S+++I  I  +IG   SGL  D R ++  A+  AQ +   + + +S E + + ++ +  E+     + G + RPFGV+LL  G+D +   P LF  DPSGT+  + A A+G  S   +  L++ Y   + L +A  +A+  LK+  E  ++  N+E+   T +  FR+  + E++
Sbjct:    8 YDRGVNTFSPEGRLFQVEYAIEAIKLGSTAIGIQTSEGVVVAVEKRITSPLMESSSVEKIVEIDSHIGCAMSGLIADSRTMIDKARVEAQNHWFTYNESMSLESITQAVSNLALEFGDDDAREGAMSRPFGVALLFGGFDEK--GPQLFHLDPSGTFIQYDAKAIGSGSEGAQHALQETYHQSMTLSEACKSALTILKQVMEEKLNATNVELATVTKDNKFRMHTKEELE 235          
BLAST of Proteasome subunit alpha type vs. Ensembl Nematostella
Match: EDO48587 (Proteasome subunit alpha type [Source:UniProtKB/TrEMBL;Acc:A7RIX7])

HSP 1 Score: 132.109 bits (331), Expect = 1.720e-37
Identity = 78/231 (33.77%), Postives = 126/231 (54.55%), Query Frame = 2
Query:   77 LTTFSPSGKLVQIEYALKAVD-GGASSVGIKACNGVVLAVEKKFNSLLIDETSIQRIQTITKNIGFVYSGLSPDYRVLVKSAQKIAQEYQLKHGDGISPEQLAKRIAAVMQEYTQSGGVRPFGVSLLIAGWDNEIVRPFLFQCDPSGTYFPWKATALGKNSGNGKSFLEKRYSDK--LELEDAIHTAILTLKEGFEGVMSEENIEVGICTEKG--FRILDQSEVKDYLTAI 754
            +T FSP G+L Q+EYA KA++ GG +SVGI+  +  V+  +KK    L+D  ++ ++  +++ IG V +G+  D R  V+ A+  A  ++ K G  I  + L KRIA + Q YTQ+  +RP G  +++ G D E   P L++ DP+G +  +KA ++G       SFLEK+   K      + + TAI  L            +EVG+ +     FR L ++E+  +L AI
Sbjct:   13 ITIFSPEGRLYQVEYAFKAINQGGLTSVGIRGADSAVVVTQKKVPDKLLDSNTVTQLFELSERIGCVMTGMVADSRSQVQRARYEAANWKYKFGYEIPVDMLCKRIADISQVYTQNAEMRPLGCGMILIGIDEE-KGPQLYKTDPAGYFCGFKACSVGVKQTEANSFLEKKVKKKHAWTFNETVETAISCLSSVLSADFKPSELEVGVVSMDNPRFRKLTEAEIDTHLVAI 242          
BLAST of Proteasome subunit alpha type vs. Ensembl Nematostella
Match: EDO36538 (Proteasome subunit alpha type [Source:UniProtKB/TrEMBL;Acc:A7SIA2])

HSP 1 Score: 107.071 bits (266), Expect = 7.014e-28
Identity = 59/185 (31.89%), Postives = 102/185 (55.14%), Query Frame = 2
Query:   65 YSFSLTTFSPSGKLVQIEYALKAVDGGASSVGIKACNGVVLAVEKKFNSLLIDETSIQRIQTITKNIGFVYSGLSPDYRVLVKSAQKIAQEYQLKHGDGISPEQLAKRIAAVMQEYTQSGGVRPFGVSLLIAGWDNEIVRPFLFQCDPSGTYFPWKATALGKNSGNGKSFLEKRYSDKLELEDAI 619
            Y  S + FSP G++ Q+EYA KAV+   +++ I+  +GVV  VEK   S L +  + +RI  I  +IG   +GL  D R +V +A++ A  Y+  +G  I  + L  R++  +  +T    +RPFG S++++    +   P L+  DPSG  + +   A+GK   N K+ +EK    ++  ++A+
Sbjct:    8 YDLSASQFSPDGRVFQVEYANKAVENSGTAIAIRCKDGVVFGVEKLVLSKLYEYGANKRIFHIDTHIGMAIAGLIADSRQIVATAREEAANYRSVYGSPIPLKYLVNRVSGFIHAFTLYSAMRPFGCSIMLSSMGPD--GPELYTIDPSGVSYGYHGCAIGKAKQNAKTEIEKLKMSEMTCQEAV 190          
BLAST of Proteasome subunit alpha type vs. Ensembl Medaka
Match: psma2 (proteasome 20S subunit alpha 2 [Source:NCBI gene;Acc:101170543])

HSP 1 Score: 325.865 bits (834), Expect = 3.724e-113
Identity = 167/235 (71.06%), Postives = 193/235 (82.13%), Query Frame = 2
Query:   53 MSER-YSFSLTTFSPSGKLVQIEYALKAVDGGASSVGIKACNGVVLAVEKKFNSLLIDETSIQRIQTITKNIGFVYSGLSPDYRVLVKSAQKIAQEYQLKHGDGISPEQLAKRIAAVMQEYTQSGGVRPFGVSLLIAGWDNEIVRPFLFQCDPSGTYFPWKATALGKNSGNGKSFLEKRYSDKLELEDAIHTAILTLKEGFEGVMSEENIEVGICTEKGFRILDQSEVKDYLTAI 754
            M+ER YSFSLTTFSPSGKLVQIEYAL AV  GA SVGIKA NGVVLA EKK  S+L DE S+ +++ ITK+IG VYSG+ PDYRVLV+ A+K+AQ+Y L + + I   QL +R+A+VMQEYTQSGGVRPFGVSLLIAGWD +   P+LFQ DPSG YF WKATA+GKN  NGK+FLEKRY++ LELEDAIHTAILTLKE FEG M+EENIEVGIC E GF+ L  +EVKDYL AI
Sbjct:    1 MAERGYSFSLTTFSPSGKLVQIEYALAAVAAGAPSVGIKASNGVVLATEKKQKSILYDEQSVHKVEPITKHIGMVYSGMGPDYRVLVRRARKLAQQYYLVYQEPIPTGQLVQRVASVMQEYTQSGGVRPFGVSLLIAGWDED--HPYLFQSDPSGAYFAWKATAMGKNYVNGKTFLEKRYNNDLELEDAIHTAILTLKESFEGQMTEENIEVGICNEAGFKRLTPAEVKDYLAAI 233          
BLAST of Proteasome subunit alpha type vs. Ensembl Medaka
Match: psma2 (proteasome 20S subunit alpha 2 [Source:NCBI gene;Acc:101170543])

HSP 1 Score: 224.557 bits (571), Expect = 2.996e-74
Identity = 107/153 (69.93%), Postives = 126/153 (82.35%), Query Frame = 2
Query:  296 YRVLVKSAQKIAQEYQLKHGDGISPEQLAKRIAAVMQEYTQSGGVRPFGVSLLIAGWDNEIVRPFLFQCDPSGTYFPWKATALGKNSGNGKSFLEKRYSDKLELEDAIHTAILTLKEGFEGVMSEENIEVGICTEKGFRILDQSEVKDYLTAI 754
            +RVLV+ A+K+AQ+Y L + + I   QL +R+A+VMQEYTQSGGVRPFGVSLLIAGWD +   P+LFQ DPSG YF WKATA+GKN  NGK+FLEKRY++ LELEDAIHTAILTLKE FEG M+EENIEVGIC E GF+ L  +EVKDYL AI
Sbjct:   13 FRVLVRRARKLAQQYYLVYQEPIPTGQLVQRVASVMQEYTQSGGVRPFGVSLLIAGWDED--HPYLFQSDPSGAYFAWKATAMGKNYVNGKTFLEKRYNNDLELEDAIHTAILTLKESFEGQMTEENIEVGICNEAGFKRLTPAEVKDYLAAI 163          
BLAST of Proteasome subunit alpha type vs. Ensembl Medaka
Match: psma8 (proteasome 20S subunit alpha 8 [Source:NCBI gene;Acc:101164507])

HSP 1 Score: 160.999 bits (406), Expect = 2.942e-48
Identity = 89/231 (38.53%), Postives = 142/231 (61.47%), Query Frame = 2
Query:   53 MSERYSFSLTTFSPSGKLVQIEYALKAVDGGASSVGIKACNGVVLAVEKKFNSLLIDETSIQRIQTITKNIGFVYSGLSPDYRVLVKSAQKIAQEYQLKHGDGISPEQLAKRIAAVMQEYTQSGGVRPFGVSLLIAGWDNEIVRPFLFQCDPSGTYFPWKATALGKNSGNGKSFLEKRYSDKLELED--AIHTAILTLKEGFEGVMSEENIEVGICTE-KGFRILDQSEVK 736
            M+ RY  ++T FSP G L Q+EYA +AV  G+++VGI+  + VVL VEKK  + L DE ++++I  + +++   ++GL+ D R+++  A+   Q ++L   D ++ E + + IA + Q YTQS G RPFG+S LI G+D +   P L+Q DPSGTY  WKA A+G+++   + FLEK Y+D+    D  AI  AI  L E  +     +NIE+ +    +  +IL+  E++
Sbjct:    1 MAARYDRAITVFSPDGHLFQVEYAQEAVKKGSTAVGIRGKDIVVLGVEKKSVAKLQDERTVRKICALDEHVCMAFAGLTADARIVINRARVECQSHRLTVEDPVTVEYITRYIATLKQRYTQSNGRRPFGISALIVGFDYDGT-PRLYQTDPSGTYHAWKANAIGRSAKTVREFLEKNYTDEAIAGDNEAIKLAIKALLEVVQS--GGKNIELAVIRRNQPLKILESKEIE 228          
BLAST of Proteasome subunit alpha type vs. Ensembl Medaka
Match: psma6b (proteasome subunit alpha type-6 [Source:NCBI gene;Acc:101162259])

HSP 1 Score: 153.295 bits (386), Expect = 2.370e-45
Identity = 88/231 (38.10%), Postives = 132/231 (57.14%), Query Frame = 2
Query:   77 LTTFSPSGKLVQIEYALKAVD-GGASSVGIKACNGVVLAVEKKFNSLLIDETSIQRIQTITKNIGFVYSGLSPDYRVLVKSAQKIAQEYQLKHGDGISPEQLAKRIAAVMQEYTQSGGVRPFGVSLLIAGWDNEIVRPFLFQCDPSGTYFPWKATALGKNSGNGKSFLEKRYSDKLE--LEDAIHTAILTLKEGFEGVMSEENIEVGICT--EKGFRILDQSEVKDYLTAI 754
            +T FSP G+L Q+EYA KA++ GG +SV ++  +  V+  +KK    L+D +++  +  IT NIG V SG++ D R  V+ A+  A  +Q K+G  +  + L KRIA + Q YTQ+  +RP G  +++ G D E   P +++CDP+G Y  +KATA G       SFLEK+   KL+   E  I TAI  L            +EVG+ T  +  FRIL ++EV  +L A+
Sbjct:   13 ITIFSPEGRLYQVEYAFKAINQGGLTSVAVRGKDCAVVVTQKKVPDKLLDASTVTHLFRITDNIGCVMSGMTADSRSQVQRARYEAANWQYKYGYEVPVDMLCKRIADISQVYTQNAEMRPLGCCMIVIGIDEEF-GPQVYKCDPAGYYCGFKATAAGVKQTEATSFLEKKVKKKLDWTFEQTIETAISCLSTVLSIDFKPSELEVGVVTTQDHKFRILTEAEVDTHLMAL 242          
BLAST of Proteasome subunit alpha type vs. Ensembl Medaka
Match: psma4 (proteasome 20S subunit alpha 4 [Source:NCBI gene;Acc:101164216])

HSP 1 Score: 147.132 bits (370), Expect = 9.310e-43
Identity = 86/238 (36.13%), Postives = 133/238 (55.88%), Query Frame = 2
Query:   53 MSERYSFSLTTFSPSGKLVQIEYALKAVDGGASSVGIKACNGVVLAVEKKFNSLLIDETSI-QRIQTITKNIGFVYSGLSPDYRVLVKSAQKIAQEYQLKHGDGISPEQLAKRIAAVMQEYTQSGGVRPFGVSLLIAGWDNEIVRPFLFQCDPSGTYFPWKATALGKNSGNGKSFLEKRYSD-KLELEDAIHTAILTLKEGFE-GVMSEENIEVGICTEKG----FRILDQSEVKDYL 745
            MS RY    T FSP G+L Q+EYA++A+    + +GI A +GV+LA E++    L+DE    ++I  + +++    +G++ D  VL    + IAQ Y L++ + I  EQL   +  + Q YTQ GG RPFGVSLL  GWD       L+Q DPSG Y  WKAT +G NS    S L++ Y + ++ L  A+  A+  L +  +   +S E +E+   T +      ++L Q EV++ +
Sbjct:    1 MSRRYDSRTTIFSPEGRLYQVEYAMEAIGHAGTCLGILANDGVLLAAERRNIHKLLDEVFFSEKIYKLNEDMACSVAGITSDANVLTNELRLIAQRYLLQYQEPIPCEQLVTALCDIKQAYTQFGGKRPFGVSLLYMGWDKHYGFQ-LYQSDPSGNYGGWKATCIGNNSAAAVSMLKQDYKEGEMTLSSALALAVKVLNKTMDVSKLSAEKVEIATLTREDGKTTIKVLKQKEVEELI 237          
BLAST of Proteasome subunit alpha type vs. Planmine SMEST
Match: SMESG000013387.1 (SMESG000013387.1)

HSP 1 Score: 483.026 bits (1242), Expect = 1.949e-175
Identity = 235/235 (100.00%), Postives = 235/235 (100.00%), Query Frame = 2
Query:   53 MSERYSFSLTTFSPSGKLVQIEYALKAVDGGASSVGIKACNGVVLAVEKKFNSLLIDETSIQRIQTITKNIGFVYSGLSPDYRVLVKSAQKIAQEYQLKHGDGISPEQLAKRIAAVMQEYTQSGGVRPFGVSLLIAGWDNEIVRPFLFQCDPSGTYFPWKATALGKNSGNGKSFLEKRYSDKLELEDAIHTAILTLKEGFEGVMSEENIEVGICTEKGFRILDQSEVKDYLTAIP 757
            MSERYSFSLTTFSPSGKLVQIEYALKAVDGGASSVGIKACNGVVLAVEKKFNSLLIDETSIQRIQTITKNIGFVYSGLSPDYRVLVKSAQKIAQEYQLKHGDGISPEQLAKRIAAVMQEYTQSGGVRPFGVSLLIAGWDNEIVRPFLFQCDPSGTYFPWKATALGKNSGNGKSFLEKRYSDKLELEDAIHTAILTLKEGFEGVMSEENIEVGICTEKGFRILDQSEVKDYLTAIP
Sbjct:    1 MSERYSFSLTTFSPSGKLVQIEYALKAVDGGASSVGIKACNGVVLAVEKKFNSLLIDETSIQRIQTITKNIGFVYSGLSPDYRVLVKSAQKIAQEYQLKHGDGISPEQLAKRIAAVMQEYTQSGGVRPFGVSLLIAGWDNEIVRPFLFQCDPSGTYFPWKATALGKNSGNGKSFLEKRYSDKLELEDAIHTAILTLKEGFEGVMSEENIEVGICTEKGFRILDQSEVKDYLTAIP 235          
BLAST of Proteasome subunit alpha type vs. Planmine SMEST
Match: SMESG000030651.1 (SMESG000030651.1)

HSP 1 Score: 167.933 bits (424), Expect = 8.341e-51
Identity = 100/241 (41.49%), Postives = 144/241 (59.75%), Query Frame = 2
Query:   53 MSERYSFSLTTFSPSGKLVQIEYALKAVDGGASSVGIKACNGVVLAVEKKFNSLLIDETSIQRIQTITKNIGFVYSGLSPDYRVLVKSAQKIAQEYQLKHGDGISPEQLAKRIAAVMQEYTQSGGVRPFGVSLLIAGWDNEIVRPFLFQCDPSGTYFPWKATALGKNSGNGKSFLEKRYS-DKLELE-DAIHTAILTLKEGFEGVMSEENIEVGICT---EKG-----FRILDQSEVKDYL 745
            MS +Y  ++T FSP G L Q+EYA +AV  G+++V ++  + VVL VEKK  + L DE ++++I  I +NI   +SGL+ D RVL+  A+   + Y+L      S E LA  IA + Q+YTQS G RPFG+S LI G+D +   P L+Q DPSGT+F + A ++GKN  + K FLEK YS D +  E D++  AIL L EG +      +I +  C     KG     +R L  SE++ Y+
Sbjct:    1 MSSKYDRAITVFSPDGHLFQVEYAQEAVKKGSTAVAVRGKDCVVLGVEKKAIAKLQDERTVKKIALIDENIAMAFSGLTADARVLIDRARIECKSYRLTTEVPASVEYLASYIANLKQKYTQSNGRRPFGLSCLIVGFDMDGT-PHLYQTDPSGTHFEYYANSIGKNGKSVKEFLEKSYSGDSVTNEHDSVKLAILALLEGVQSSADHMDISLMSCNFDIAKGRNVVSYRALKPSEIESYV 240          
BLAST of Proteasome subunit alpha type vs. Planmine SMEST
Match: SMESG000040163.1 (SMESG000040163.1)

HSP 1 Score: 145.976 bits (367), Expect = 1.887e-42
Identity = 83/235 (35.32%), Postives = 131/235 (55.74%), Query Frame = 2
Query:   53 MSERYSFSLTTFSPSGKLVQIEYALKAVDGGASSVGIKACNGVVLAVEKKFNSLLIDETSI-QRIQTITKNIGFVYSGLSPDYRVLVKSAQKIAQEYQLKHGDGISPEQLAKRIAAVMQEYTQSGGVRPFGVSLLIAGWDNEIVRPFLFQCDPSGTYFPWKATALGKNSGNGKSFLEKRYS-DKLELEDAIHTAILTL-KEGFEGVMSEENIEVGICTEKG----FRILDQSEVK 736
            M+ RY    T FSP G+L Q+EYA++AV    + +G+   +G++LA E++  + L+DET   ++I  I ++I    +G++ D  +L+   +  AQ + L   + I  +QL  +I  +M  YT  GG RP+GVS+L  GWD E     LFQ DPSG +  WKAT +G NS    S LE+ Y  DKL++E  +   +  L K      ++ E IE+ +   K      +++ QSE++
Sbjct:    1 MARRYDTRTTIFSPEGRLYQVEYAMEAVGHAGTCLGMVTKDGIILAAERRSYNKLLDETIFSEKIYKINEDISCAVAGITSDANILLDQMRLNAQRHLLTLQEPIPVDQLVTQICDLMHAYTMYGGRRPYGVSMLFIGWDKEYGYQ-LFQSDPSGNFVGWKATCIGSNSAAASSMLEQEYDIDKLDVESGLKLCVKILYKSMTMSKLTAEKIELAVMKRKDDKTYVKLIAQSEIE 234          
BLAST of Proteasome subunit alpha type vs. Planmine SMEST
Match: SMESG000060349.1 (SMESG000060349.1)

HSP 1 Score: 132.494 bits (332), Expect = 2.243e-37
Identity = 78/234 (33.33%), Postives = 126/234 (53.85%), Query Frame = 2
Query:   62 RYSFSLTTFSPSGKLVQIEYALKAVDGGASSVGIKACNGVVLAVEKKFNSLLIDETSIQRIQTITKNIGFVYSGLSPDYRVLVKSAQKIAQEYQLKHGDGISPEQLAKRIAAVMQEYTQSGG-----VRPFGVSLLIAGWDNEIVRPFLFQCDPSGTYFPWKATALGKNSGNGKSFLEKRYSDKLELEDAIHTAILTLKEGFEGVMSEENIEVGICTEKG-FRILDQSEVKDYL 745
             Y   + TFSP G+L Q+EYA++A   G++++GIK  +GVVLAVEK+  S L+  +S+++I  +        SGL  D R+LV+ A+  +  +   H + +  E + K ++ +   +  +        RPFGV+LL AG D     P L   DPSGTY  + A A+G      +  L++ Y+  + +E+A   A+  LK   E  +   NIE+   TEKG F +  + EV++ +
Sbjct:    5 EYDHGVNTFSPEGRLFQVEYAIEATKLGSTAIGIKTNHGVVLAVEKRITSPLLVPSSVEKIFKVDDFTAIAVSGLVADSRILVEKARVESTNHWFNHNERMPIESITKAVSKMALSFAANDNEPAAMSRPFGVALLFAGVDEN--GPQLLHMDPSGTYINYFAKAIGSGCEGAQQSLQEIYNKNMTIEEAAMEALSILKHVMEEKLDCTNIEMSSITEKGKFHLYTKEEVQEVI 236          
BLAST of Proteasome subunit alpha type vs. Planmine SMEST
Match: SMESG000060349.1 (SMESG000060349.1)

HSP 1 Score: 132.109 bits (331), Expect = 2.684e-37
Identity = 78/234 (33.33%), Postives = 126/234 (53.85%), Query Frame = 2
Query:   62 RYSFSLTTFSPSGKLVQIEYALKAVDGGASSVGIKACNGVVLAVEKKFNSLLIDETSIQRIQTITKNIGFVYSGLSPDYRVLVKSAQKIAQEYQLKHGDGISPEQLAKRIAAVMQEYTQSGG-----VRPFGVSLLIAGWDNEIVRPFLFQCDPSGTYFPWKATALGKNSGNGKSFLEKRYSDKLELEDAIHTAILTLKEGFEGVMSEENIEVGICTEKG-FRILDQSEVKDYL 745
             Y   + TFSP G+L Q+EYA++A   G++++GIK  +GVVLAVEK+  S L+  +S+++I  +        SGL  D R+LV+ A+  +  +   H + +  E + K ++ +   +  +        RPFGV+LL AG D     P L   DPSGTY  + A A+G      +  L++ Y+  + +E+A   A+  LK   E  +   NIE+   TEKG F +  + EV++ +
Sbjct:    7 EYDHGVNTFSPEGRLFQVEYAIEATKLGSTAIGIKTNHGVVLAVEKRITSPLLVPSSVEKIFKVDDFTAIAVSGLVADSRILVEKARVESTNHWFNHNERMPIESITKAVSKMALSFAANDNEPAAMSRPFGVALLFAGVDEN--GPQLLHMDPSGTYINYFAKAIGSGCEGAQQSLQEIYNKNMTIEEAAMEALSILKHVMEEKLDCTNIEMSSITEKGKFHLYTKEEVQEVI 238          
The following BLAST results are available for this feature:
BLAST of Proteasome subunit alpha type vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
AC010132.31.030e-11771.06novel PSMA2 and C7orf25 readthrough[more]
PSMA21.030e-11771.06proteasome 20S subunit alpha 2 [Source:HGNC Symbol... [more]
PSMA21.019e-7267.50proteasome 20S subunit alpha 2 [Source:HGNC Symbol... [more]
PSMA89.843e-4940.59proteasome 20S subunit alpha 8 [Source:HGNC Symbol... [more]
PSMA71.682e-4838.70proteasome 20S subunit alpha 7 [Source:HGNC Symbol... [more]
back to top
BLAST of Proteasome subunit alpha type vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
pas-23.459e-9860.17Proteasome subunit alpha type-2 [Source:UniProtKB... [more]
pas-23.459e-9860.17Proteasome subunit alpha type-2 [Source:UniProtKB... [more]
pas-31.272e-4134.20Proteasome subunit alpha type-4 [Source:UniProtKB... [more]
pas-31.272e-4134.20Proteasome subunit alpha type-4 [Source:UniProtKB... [more]
pas-41.277e-4135.17Proteasome subunit alpha type-7 [Source:UniProtKB... [more]
back to top
BLAST of Proteasome subunit alpha type vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Prosalpha27.228e-11566.24gene:FBgn0086134 transcript:FBtr0082590[more]
Prosalpha42.552e-4435.62gene:FBgn0004066 transcript:FBtr0074210[more]
Prosalpha4T11.308e-4236.56gene:FBgn0265606 transcript:FBtr0083928[more]
Prosalpha32.411e-4238.99gene:FBgn0261394 transcript:FBtr0071522[more]
Prosalpha4T25.410e-4233.48gene:FBgn0017556 transcript:FBtr0072350[more]
back to top
BLAST of Proteasome subunit alpha type vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
si:rp71-45k5.41.270e-11371.49si:rp71-45k5.4 [Source:ZFIN;Acc:ZDB-GENE-060503-94... [more]
psma21.530e-11371.49proteasome 20S subunit alpha 2 [Source:ZFIN;Acc:ZD... [more]
si:rp71-45k5.41.498e-9371.36si:rp71-45k5.4 [Source:ZFIN;Acc:ZDB-GENE-060503-94... [more]
psma84.825e-4838.10proteasome 20S subunit alpha 8 [Source:ZFIN;Acc:ZD... [more]
psma6b1.461e-4537.23proteasome 20S subunit alpha 6b [Source:ZFIN;Acc:Z... [more]
back to top
BLAST of Proteasome subunit alpha type vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
sgta2.613e-11271.06small glutamine-rich tetratricopeptide repeat (TPR... [more]
itih55.263e-4938.89inter-alpha-trypsin inhibitor heavy chain family m... [more]
itih54.933e-4838.70inter-alpha-trypsin inhibitor heavy chain family m... [more]
gdpd15.455e-4336.55glycerophosphodiester phosphodiesterase domain con... [more]
fkbp96.261e-4135.50FKBP prolyl isomerase 9 [Source:Xenbase;Acc:XB-GEN... [more]
back to top
BLAST of Proteasome subunit alpha type vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Psma21.505e-11770.64proteasome (prosome, macropain) subunit, alpha typ... [more]
Psma22.904e-8767.03proteasome (prosome, macropain) subunit, alpha typ... [more]
Psma82.326e-4942.20proteasome (prosome, macropain) subunit, alpha typ... [more]
Psma75.260e-4937.77proteasome (prosome, macropain) subunit, alpha typ... [more]
Psma71.578e-4741.97proteasome (prosome, macropain) subunit, alpha typ... [more]
back to top
BLAST of Proteasome subunit alpha type vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|P25787|PSA2_HUMAN4.948e-11771.06Proteasome subunit alpha type-2 OS=Homo sapiens OX... [more]
sp|Q3T0Y5|PSA2_BOVIN4.948e-11771.06Proteasome subunit alpha type-2 OS=Bos taurus OX=9... [more]
sp|P17220|PSA2_RAT1.053e-11670.64Proteasome subunit alpha type-2 OS=Rattus norvegic... [more]
sp|P49722|PSA2_MOUSE1.053e-11670.64Proteasome subunit alpha type-2 OS=Mus musculus OX... [more]
sp|P40301|PSA2_DROME7.246e-11466.24Proteasome subunit alpha type-2 OS=Drosophila mela... [more]
back to top
BLAST of Proteasome subunit alpha type vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A0X3PI244.751e-13577.45Proteasome subunit alpha type OS=Schistocephalus s... [more]
A0A4S2LRC84.198e-13377.78Proteasome subunit alpha type OS=Opisthorchis feli... [more]
A0A074Z6K94.198e-13377.78Proteasome subunit alpha type OS=Opisthorchis vive... [more]
E4W3S24.198e-13377.78Proteasome subunit alpha type OS=Clonorchis sinens... [more]
A0A0R3WJA04.100e-13277.02Proteasome subunit alpha type OS=Hydatigena taenia... [more]
back to top
BLAST of Proteasome subunit alpha type vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
psma24.320e-11371.06proteasome 20S subunit alpha 2 [Source:NCBI gene;A... [more]
ENSAMXT00000057419.12.252e-10668.22pep primary_assembly:Astyanax_mexicanus-2.0:23:258... [more]
psma27.458e-7570.59proteasome 20S subunit alpha 2 [Source:NCBI gene;A... [more]
psma84.554e-4838.10proteasome subunit alpha type-7 [Source:NCBI gene;... [more]
PSMA78.250e-4638.12proteasome 20S subunit alpha 7 [Source:HGNC Symbol... [more]
back to top
BLAST of Proteasome subunit alpha type vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 5
Match NameE-valueIdentityDescription
psma21.619e-10969.13proteasome 20S subunit alpha 2 [Source:ZFIN;Acc:ZD... [more]
psma6a6.427e-4335.50proteasome 20S subunit alpha 6a [Source:ZFIN;Acc:Z... [more]
psma42.589e-4135.29proteasome 20S subunit alpha 4 [Source:ZFIN;Acc:ZD... [more]
psma51.313e-3833.47proteasome 20S subunit alpha 5 [Source:ZFIN;Acc:ZD... [more]
psma34.963e-3336.99proteasome 20S subunit alpha 3 [Source:ZFIN;Acc:ZD... [more]
back to top
BLAST of Proteasome subunit alpha type vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 5
Match NameE-valueIdentityDescription
PRE82.999e-8253.78Alpha 2 subunit of the 20S proteasome [Source:SGD;... [more]
PRE61.881e-4738.72Alpha 4 subunit of the 20S proteasome; may replace... [more]
PRE92.779e-4537.76Alpha 3 subunit of the 20S proteasome; the only no... [more]
PUP26.614e-3732.48Alpha 5 subunit of the 20S proteasome; involved in... [more]
PRE101.730e-3339.88Alpha 7 subunit of the 20S proteasome; protein abu... [more]
back to top
BLAST of Proteasome subunit alpha type vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
EDO421821.825e-12270.51Proteasome subunit alpha type [Source:UniProtKB/T... [more]
EDO473104.539e-4939.66Proteasome subunit alpha type [Source:UniProtKB/T... [more]
EDO394661.562e-4033.04Proteasome subunit alpha type [Source:UniProtKB/T... [more]
EDO485871.720e-3733.77Proteasome subunit alpha type [Source:UniProtKB/T... [more]
EDO365387.014e-2831.89Proteasome subunit alpha type [Source:UniProtKB/T... [more]
back to top
BLAST of Proteasome subunit alpha type vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
psma23.724e-11371.06proteasome 20S subunit alpha 2 [Source:NCBI gene;A... [more]
psma22.996e-7469.93proteasome 20S subunit alpha 2 [Source:NCBI gene;A... [more]
psma82.942e-4838.53proteasome 20S subunit alpha 8 [Source:NCBI gene;A... [more]
psma6b2.370e-4538.10proteasome subunit alpha type-6 [Source:NCBI gene;... [more]
psma49.310e-4336.13proteasome 20S subunit alpha 4 [Source:NCBI gene;A... [more]
back to top
BLAST of Proteasome subunit alpha type vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000013387.11.949e-175100.00SMESG000013387.1[more]
SMESG000030651.18.341e-5141.49SMESG000030651.1[more]
SMESG000040163.11.887e-4235.32SMESG000040163.1[more]
SMESG000060349.12.243e-3733.33SMESG000060349.1[more]
SMESG000060349.12.684e-3733.33SMESG000060349.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30015728 ID=SMED30015728|Name=Proteasome subunit alpha type|organism=Schmidtea mediterranea sexual|type=transcript|length=801bp
TTTAAATATTCTATATCTAATTTTGAAATTCAAAATATAGCTTATTAATC
AAATGTCTGAAAGATATAGTTTCTCTTTAACTACATTTAGTCCTTCAGGA
AAGCTTGTTCAAATTGAATATGCATTGAAAGCCGTGGATGGTGGGGCCTC
CTCTGTCGGTATTAAAGCGTGTAATGGAGTAGTTCTTGCCGTTGAAAAAA
AATTCAACTCCTTGTTGATCGATGAGACATCTATTCAACGTATCCAAACT
ATTACTAAAAATATTGGCTTTGTTTATAGTGGATTGTCGCCAGATTATCG
AGTTTTAGTAAAAAGTGCACAAAAAATTGCACAAGAATATCAGTTGAAAC
ATGGTGATGGAATTTCTCCTGAACAGTTAGCCAAGAGAATTGCAGCAGTA
ATGCAGGAATATACTCAATCTGGTGGTGTAAGACCATTTGGGGTATCTTT
ACTTATTGCTGGTTGGGATAACGAAATTGTTCGACCATTTTTATTTCAAT
GTGACCCGTCGGGAACATATTTCCCATGGAAAGCCACGGCTCTTGGAAAA
AACTCTGGAAATGGAAAATCGTTTTTGGAGAAAAGATATAGTGATAAATT
AGAATTGGAAGATGCAATCCATACTGCAATTTTAACTCTTAAAGAAGGTT
TTGAAGGAGTAATGTCAGAGGAGAATATTGAAGTTGGAATTTGCACAGAA
AAAGGATTCCGAATACTCGATCAATCGGAAGTAAAGGATTATCTTACAGC
AATCCCATAAATAACTTATTTTTAATTGAAATATAATTGTTGTTGAATTT
T
back to top

protein sequence of SMED30015728-orf-1

>SMED30015728-orf-1 ID=SMED30015728-orf-1|Name=SMED30015728-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=236bp
MSERYSFSLTTFSPSGKLVQIEYALKAVDGGASSVGIKACNGVVLAVEKK
FNSLLIDETSIQRIQTITKNIGFVYSGLSPDYRVLVKSAQKIAQEYQLKH
GDGISPEQLAKRIAAVMQEYTQSGGVRPFGVSLLIAGWDNEIVRPFLFQC
DPSGTYFPWKATALGKNSGNGKSFLEKRYSDKLELEDAIHTAILTLKEGF
EGVMSEENIEVGICTEKGFRILDQSEVKDYLTAIP*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000101muscle cell
PLANA:0000142posterior region of the whole animal
Vocabulary: INTERPRO
TermDefinition
IPR034644Proteasome_subunit_alpha2
IPR000426Proteasome_asu_N
IPR029055Ntn_hydrolases_N
IPR001353Proteasome_sua/b
IPR023332Proteasome_alpha-type
Vocabulary: cellular component
TermDefinition
GO:0019773proteasome core complex, alpha-subunit complex
GO:0005839proteasome core complex
GO:0000502proteasome complex
GO:0005634nucleus
GO:0005737cytoplasm
Vocabulary: biological process
TermDefinition
GO:0006511ubiquitin-dependent protein catabolic process
GO:0051603proteolysis involved in cellular protein catabolic process
GO:0006508proteolysis
Vocabulary: molecular function
TermDefinition
GO:0004175endopeptidase activity
GO:0004298threonine-type endopeptidase activity
GO:0008233peptidase activity
GO:0016787hydrolase activity
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR000426Proteasome alpha-subunit, N-terminal domainSMARTSM00948Proteasome_A_N_2coord: 5..27
e-value: 5.6E-8
score: 42.5
IPR000426Proteasome alpha-subunit, N-terminal domainPFAMPF10584Proteasome_A_Ncoord: 5..27
e-value: 5.9E-11
score: 41.8
IPR000426Proteasome alpha-subunit, N-terminal domainPROSITEPS00388PROTEASOME_ALPHA_1coord: 5..27
IPR029055Nucleophile aminohydrolases, N-terminalGENE3DG3DSA:3.60.20.10coord: 4..235
e-value: 3.0E-85
score: 287.2
IPR029055Nucleophile aminohydrolases, N-terminalSUPERFAMILYSSF56235N-terminal nucleophile aminohydrolases (Ntn hydrolases)coord: 4..234
IPR001353Proteasome, subunit alpha/betaPFAMPF00227Proteasomecoord: 29..213
e-value: 7.0E-58
score: 195.3
IPR034644Proteasome subunit alpha2PANTHERPTHR11599:SF16PROTEASOME SUBUNIT ALPHA TYPE-2coord: 4..232
NoneNo IPR availablePANTHERPTHR11599PROTEASOME SUBUNIT ALPHA/BETAcoord: 4..232
NoneNo IPR availableCDDcd03750proteasome_alpha_type_2coord: 5..231
e-value: 3.24864E-144
score: 400.159
IPR023332Proteasome alpha-type subunitPROSITEPS51475PROTEASOME_ALPHA_2coord: 20..231
score: 77.52