RNA-binding protein Musashi

Overview
NameRNA-binding protein Musashi
Smed IDSMED30015723
Length (bp)1373
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of RNA-binding protein Musashi (SMED30015723) t-SNE clustered cells

Violin plots show distribution of expression levels for RNA-binding protein Musashi (SMED30015723) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of RNA-binding protein Musashi (SMED30015723) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for RNA-binding protein Musashi (SMED30015723) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30015723

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 11

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
head regionSMED30015723SMESG000045507.1 SMESG000045502.1 SmedASXL_014399SmedAsxl_ww_GCZZ01PMID:27034770
Currie et al., 2016
whole organism asexual adult RNA-sequencing evidence
X1 cellSMED30015723SMESG000045501.1 SMESG000045502.1 SmedASXL_010401SmedAsxl_ww_GCZZ01PMID:26114597
Zhu et al., 2015
FACS sorted cell population asexual adult RNA-sequencing evidence
X2 cellSMED30015723SMESG000045501.1 SMESG000045502.1 SmedASXL_010401SmedAsxl_ww_GCZZ01PMID:26114597
Zhu et al., 2015
FACS sorted cell population asexual adult RNA-sequencing evidence
nervous systemSMED30015723SMESG000045507.1 SMESG000045502.1 dd_Smed_v4_13817_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
cephalic gangliaSMED30015723SMESG000045507.1 SMESG000045502.1 dd_Smed_v4_13817_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
neuronSMED30015723SMESG000045507.1 SMESG000045502.1 dd_Smed_v4_13817_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult colorimetric in situ hybridization evidence
muscle cellSMED30015723SMESG000045507.1 SMESG000045502.1 dd_Smed_v4_13817_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
anterior sideSMED30015723SMESG000045507.1 SMESG000045502.1 dd_Smed_v4_13817_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
cilated neuronSMED30015723SMESG000045507.1 SMESG000045502.1 dd_Smed_v4_13817_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
head regionSMED30015723SMESG000045507.1 SMESG000045502.1 dd_Smed_v6_13817_0_1dd_Smed_v6PMID:28171748
Stückemann et al., 2017
whole organism asexual adult RNA-sequencing evidence
head regionSMED30015723SMESG000045507.1 SMESG000045502.1 OX_Smed_1.0.04904ox_Smed_v2PMID:24238224
Kao et al., 2013
whole organism asexual adult RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of RNA-binding protein Musashi vs. Ensembl Human
Match: MSI2 (musashi RNA binding protein 2 [Source:HGNC Symbol;Acc:HGNC:18585])

HSP 1 Score: 180.644 bits (457), Expect = 3.087e-53
Identity = 92/176 (52.27%), Postives = 134/176 (76.14%), Query Frame = 2
Query:  380 NKKLFIGGLSPHTTLETLRNYFQNYGDIKDVMILKDPVTKRSRGFGFVTFIDYSTIEKILLNSPHFLDSXXXXXXXXXXXXXELIDKAINTEKTRKVFIGGLSNSTVHKDLEAFFGKYGKVESCELMMDKSTNRHRGFGFVIFEKEETADHICNIRYHEINSKMVEAKKALPKDVI 907
            + K+FIGGLS  T+ ++LR+YF  +G+I++ M+++DP TKRSRGFGFVTF D ++++K+L    H LDSK IDPK+A P++ +   K +   +T+K+F+GGLS +TV +D++ +F ++GKVE   LM DK+TNRHRGFGFV FE E+  + +C I +HEIN+KMVE KKA PK+V+
Sbjct:   16 SSKMFIGGLSWQTSPDSLRDYFSKFGEIRECMVMRDPTTKRSRGFGFVTFADPASVDKVLGQPHHELDSKTIDPKVAFPRRAQ--PKMVT--RTKKIFVGGLSANTVVEDVKQYFEQFGKVEDAMLMFDKTTNRHRGFGFVTFENEDVVEKVCEIHFHEINNKMVECKKAQPKEVM 187          

HSP 2 Score: 67.781 bits (164), Expect = 3.904e-12
Identity = 29/68 (42.65%), Postives = 45/68 (66.18%), Query Frame = 2
Query:  353 EAEEKCHEVNKKLFIGGLSPHTTLETLRNYFQNYGDIKDVMILKDPVTKRSRGFGFVTFIDYSTIEKI 556
             A+ K     KK+F+GGLS +T +E ++ YF+ +G ++D M++ D  T R RGFGFVTF +   +EK+
Sbjct:   96 RAQPKMVTRTKKIFVGGLSANTVVEDVKQYFEQFGKVEDAMLMFDKTTNRHRGFGFVTFENEDVVEKV 163          
BLAST of RNA-binding protein Musashi vs. Ensembl Human
Match: MSI1 (musashi RNA binding protein 1 [Source:HGNC Symbol;Acc:HGNC:7330])

HSP 1 Score: 183.341 bits (464), Expect = 6.082e-53
Identity = 93/178 (52.25%), Postives = 133/178 (74.72%), Query Frame = 2
Query:  386 KLFIGGLSPHTTLETLRNYFQNYGDIKDVMILKDPVTKRSRGFGFVTFIDYSTIEKILLNSPHFLDSXXXXXXXXXXXXXELIDKAINTEKTRKVFIGGLSNSTVHKDLEAFFGKYGKVESCELMMDKSTNRHRGFGFVIFEKEETADHICNIRYHEINSKMVEAKKALPKDVIMQTS 919
            K+FIGGLS  TT E LR YF  +G++K+ ++++DP+TKRSRGFGFVTF+D + ++K+L  S H LDSK IDPK+A P++ +   K +   +T+K+F+GGLS +T  +D++ +F ++GKV+   LM DK+TNRHRGFGFV FE E+  + +C I +HEIN+KMVE KKA PK+V+  T 
Sbjct:   21 KMFIGGLSWQTTQEGLREYFGQFGEVKECLVMRDPLTKRSRGFGFVTFMDQAGVDKVLAQSRHELDSKTIDPKVAFPRRAQ--PKMVT--RTKKIFVGGLSVNTTVEDVKQYFEQFGKVDDAMLMFDKTTNRHRGFGFVTFESEDIVEKVCEIHFHEINNKMVECKKAQPKEVMSPTG 194          

HSP 2 Score: 67.781 bits (164), Expect = 9.286e-12
Identity = 30/68 (44.12%), Postives = 44/68 (64.71%), Query Frame = 2
Query:  353 EAEEKCHEVNKKLFIGGLSPHTTLETLRNYFQNYGDIKDVMILKDPVTKRSRGFGFVTFIDYSTIEKI 556
             A+ K     KK+F+GGLS +TT+E ++ YF+ +G + D M++ D  T R RGFGFVTF     +EK+
Sbjct:   99 RAQPKMVTRTKKIFVGGLSVNTTVEDVKQYFEQFGKVDDAMLMFDKTTNRHRGFGFVTFESEDIVEKV 166          
BLAST of RNA-binding protein Musashi vs. Ensembl Human
Match: MSI2 (musashi RNA binding protein 2 [Source:HGNC Symbol;Acc:HGNC:18585])

HSP 1 Score: 181.03 bits (458), Expect = 1.493e-52
Identity = 92/174 (52.87%), Postives = 133/174 (76.44%), Query Frame = 2
Query:  386 KLFIGGLSPHTTLETLRNYFQNYGDIKDVMILKDPVTKRSRGFGFVTFIDYSTIEKILLNSPHFLDSXXXXXXXXXXXXXELIDKAINTEKTRKVFIGGLSNSTVHKDLEAFFGKYGKVESCELMMDKSTNRHRGFGFVIFEKEETADHICNIRYHEINSKMVEAKKALPKDVI 907
            K+FIGGLS  T+ ++LR+YF  +G+I++ M+++DP TKRSRGFGFVTF D ++++K+L    H LDSK IDPK+A P++ +   K +   +T+K+F+GGLS +TV +D++ +F ++GKVE   LM DK+TNRHRGFGFV FE E+  + +C I +HEIN+KMVE KKA PK+V+
Sbjct:   22 KMFIGGLSWQTSPDSLRDYFSKFGEIRECMVMRDPTTKRSRGFGFVTFADPASVDKVLGQPHHELDSKTIDPKVAFPRRAQ--PKMVT--RTKKIFVGGLSANTVVEDVKQYFEQFGKVEDAMLMFDKTTNRHRGFGFVTFENEDVVEKVCEIHFHEINNKMVECKKAQPKEVM 191          

HSP 2 Score: 68.1662 bits (165), Expect = 6.671e-12
Identity = 29/68 (42.65%), Postives = 45/68 (66.18%), Query Frame = 2
Query:  353 EAEEKCHEVNKKLFIGGLSPHTTLETLRNYFQNYGDIKDVMILKDPVTKRSRGFGFVTFIDYSTIEKI 556
             A+ K     KK+F+GGLS +T +E ++ YF+ +G ++D M++ D  T R RGFGFVTF +   +EK+
Sbjct:  100 RAQPKMVTRTKKIFVGGLSANTVVEDVKQYFEQFGKVEDAMLMFDKTTNRHRGFGFVTFENEDVVEKV 167          
BLAST of RNA-binding protein Musashi vs. Ensembl Human
Match: MSI2 (musashi RNA binding protein 2 [Source:HGNC Symbol;Acc:HGNC:18585])

HSP 1 Score: 179.874 bits (455), Expect = 3.651e-52
Identity = 91/173 (52.60%), Postives = 132/173 (76.30%), Query Frame = 2
Query:  389 LFIGGLSPHTTLETLRNYFQNYGDIKDVMILKDPVTKRSRGFGFVTFIDYSTIEKILLNSPHFLDSXXXXXXXXXXXXXELIDKAINTEKTRKVFIGGLSNSTVHKDLEAFFGKYGKVESCELMMDKSTNRHRGFGFVIFEKEETADHICNIRYHEINSKMVEAKKALPKDVI 907
            +FIGGLS  T+ ++LR+YF  +G+I++ M+++DP TKRSRGFGFVTF D ++++K+L    H LDSK IDPK+A P++ +   K +   +T+K+F+GGLS +TV +D++ +F ++GKVE   LM DK+TNRHRGFGFV FE E+  + +C I +HEIN+KMVE KKA PK+V+
Sbjct:    1 MFIGGLSWQTSPDSLRDYFSKFGEIRECMVMRDPTTKRSRGFGFVTFADPASVDKVLGQPHHELDSKTIDPKVAFPRRAQ--PKMVT--RTKKIFVGGLSANTVVEDVKQYFEQFGKVEDAMLMFDKTTNRHRGFGFVTFENEDVVEKVCEIHFHEINNKMVECKKAQPKEVM 169          

HSP 2 Score: 68.1662 bits (165), Expect = 5.489e-12
Identity = 29/68 (42.65%), Postives = 45/68 (66.18%), Query Frame = 2
Query:  353 EAEEKCHEVNKKLFIGGLSPHTTLETLRNYFQNYGDIKDVMILKDPVTKRSRGFGFVTFIDYSTIEKI 556
             A+ K     KK+F+GGLS +T +E ++ YF+ +G ++D M++ D  T R RGFGFVTF +   +EK+
Sbjct:   78 RAQPKMVTRTKKIFVGGLSANTVVEDVKQYFEQFGKVEDAMLMFDKTTNRHRGFGFVTFENEDVVEKV 145          
BLAST of RNA-binding protein Musashi vs. Ensembl Human
Match: DAZAP1 (DAZ associated protein 1 [Source:HGNC Symbol;Acc:HGNC:2683])

HSP 1 Score: 141.354 bits (355), Expect = 1.409e-37
Identity = 80/242 (33.06%), Postives = 121/242 (50.00%), Query Frame = 2
Query:  386 KLFIGGLSPHTTLETLRNYFQNYGDIKDVMILKDPVTKRSRGFGFVTFIDYSTIEKILLNSPHFLDSXXXXXXXXXXXXXELIDKAINTEKTRKVFIGGLSNSTVHKDLEAFFGKYGKVESCELMMDKSTNRHRGFGFVIFEKEETADHICNIRYHEINSKMVEAKKALPKDVIMQTSYSNKPKQQITKSFPNPLNSKSKKLAADGFSYVPAINPPQLLSTQFNAFCLSGYLIPSNIGQNNY 1111
            KLF+GGL   TT ETLR+YF  YG++ D +I+KD  T +SRGFGFV F D + +  +L + PH LD +      +            +  K+ K+F+GG+ ++    +L  +F K+G V    ++ D    R RGFGF+ FE E++ D   N+ +H+I  K VE K+A P+D   Q        Q  ++  PN         AA+G++  P   PP    T    +   G  +P+      Y
Sbjct:   11 KLFVGGLDWSTTQETLRSYFSQYGEVVDCVIMKDKTTNQSRGFGFVKFKDPNCVGTVLASRPHTLDGRNQKGPRS------------DNSKSNKIFVGGIPHNCGETELREYFKKFGVVTEVVMIYDAEKQRPRGFGFITFEDEQSVDQAVNMHFHDIMGKKVEVKRAEPRDSKSQAPGQPGASQWGSRVVPN---------AANGWAGQP---PP----TWQQGYGPQGMWVPAGQAIGGY 224          
BLAST of RNA-binding protein Musashi vs. Ensembl Celegans
Match: msi-1 (MuSashI (Fly neural) family; Neural RNA-binding protein MSI-1 [Source:UniProtKB/TrEMBL;Acc:G5EFS2])

HSP 1 Score: 187.578 bits (475), Expect = 1.862e-55
Identity = 96/175 (54.86%), Postives = 130/175 (74.29%), Query Frame = 2
Query:  386 KLFIGGLSPHTTLETLRNYFQNYGDIKDVMILKDPVTKRSRGFGFVTFIDYSTIEKILLNSPHFLDSXXXXXXXXXXXXXELIDKAINTEKTRKVFIGGLSNSTVHKDLEAFFGKYGKVESCELMMDKSTNRHRGFGFVIFEKEETADHICNIRYHEINSKMVEAKKALPKDVIM 910
            K+FIGGLS  TT E LR+YF  +G++ + M+++DP TKR+RGFGF+TF+D S+++K+L N  H LD KKIDPK+A PK+ +    A    KT+KVFIGGLS ++  +D++ +F  YGKVE   LM DK+T RHRGFGFV F+ +E AD +C I +HEIN KMVE KKA PK+V++
Sbjct:   46 KMFIGGLSWQTTAENLRDYFGRFGEVNECMVMRDPATKRARGFGFITFVDPSSVDKVLNNREHELDGKKIDPKVAFPKRTQ----AKLVTKTKKVFIGGLSATSTLEDMKQYFETYGKVEDAMLMFDKATQRHRGFGFVTFDSDEVADKVCEIHFHEINGKMVECKKAQPKEVML 216          

HSP 2 Score: 79.337 bits (194), Expect = 4.222e-16
Identity = 35/88 (39.77%), Postives = 54/88 (61.36%), Query Frame = 2
Query:  635 DKAINTEKTRKVFIGGLSNSTVHKDLEAFFGKYGKVESCELMMDKSTNRHRGFGFVIFEKEETADHICNIRYHEINSKMVEAKKALPK 898
            D +  ++   K+FIGGLS  T  ++L  +FG++G+V  C +M D +T R RGFGF+ F    + D + N R HE++ K ++ K A PK
Sbjct:   36 DGSHGSQDPGKMFIGGLSWQTTAENLRDYFGRFGEVNECMVMRDPATKRARGFGFITFVDPSSVDKVLNNREHELDGKKIDPKVAFPK 123          

HSP 3 Score: 68.5514 bits (166), Expect = 1.719e-12
Identity = 29/58 (50.00%), Postives = 41/58 (70.69%), Query Frame = 2
Query:  383 KKLFIGGLSPHTTLETLRNYFQNYGDIKDVMILKDPVTKRSRGFGFVTFIDYSTIEKI 556
            KK+FIGGLS  +TLE ++ YF+ YG ++D M++ D  T+R RGFGFVTF      +K+
Sbjct:  134 KKVFIGGLSATSTLEDMKQYFETYGKVEDAMLMFDKATQRHRGFGFVTFDSDEVADKV 191          
BLAST of RNA-binding protein Musashi vs. Ensembl Celegans
Match: hrp-1 (Heterogeneous nuclear ribonucleoprotein A1 [Source:UniProtKB/Swiss-Prot;Acc:Q22037])

HSP 1 Score: 121.324 bits (303), Expect = 1.699e-30
Identity = 60/173 (34.68%), Postives = 108/173 (62.43%), Query Frame = 2
Query:  383 KKLFIGGLSPHTTLETLRNYFQNYGDIKDVMILKDPVTKRSRGFGFVTFIDYSTIEKILLNSPHFLDSXXXXXXXXXXXXXELIDKAINTEKTRKVFIGGLSNSTVHKDLEAFFGKYGKVESCELMMDKSTNRHRGFGFVIFEKEETADHICNIRYHEINSKMVEAKKALPKD 901
            +K+F+GGL+ +TT + +R ++  +G+I D+++++DP TKRSRGFGFVTF   + ++  +   PH +D K +DPK A+P+  +  +++ +   T+++++ G+        L  +F KYG V   E+++DK+T + RGFGFV F+  ++ D     + H +N    + +K L KD
Sbjct:   23 RKIFVGGLTSNTTDDLMREFYSQFGEITDIIVMRDPTTKRSRGFGFVTFSGKTEVDAAMKQRPHIIDGKTVDPKRAVPRDDK--NRSESNVSTKRLYVSGVREDHTEDMLTEYFTKYGTVTKSEIILDKATQKPRGFGFVTFDDHDSVDQCVLQKSHMVNGHRCDVRKGLSKD 193          

HSP 2 Score: 70.0922 bits (170), Expect = 6.205e-13
Identity = 32/89 (35.96%), Postives = 53/89 (59.55%), Query Frame = 2
Query:  635 DKAINTEKTRKVFIGGLSNSTVHKDLEAFFGKYGKVESCELMMDKSTNRHRGFGFVIFEKEETADHICNIRYHEINSKMVEAKKALPKD 901
            D ++  E  RK+F+GGL+++T    +  F+ ++G++    +M D +T R RGFGFV F  +   D     R H I+ K V+ K+A+P+D
Sbjct:   14 DASLEPENLRKIFVGGLTSNTTDDLMREFYSQFGEITDIIVMRDPTTKRSRGFGFVTFSGKTEVDAAMKQRPHIIDGKTVDPKRAVPRD 102          
BLAST of RNA-binding protein Musashi vs. Ensembl Celegans
Match: hrp-1 (Heterogeneous nuclear ribonucleoprotein A1 [Source:UniProtKB/Swiss-Prot;Acc:Q22037])

HSP 1 Score: 121.324 bits (303), Expect = 1.699e-30
Identity = 60/173 (34.68%), Postives = 108/173 (62.43%), Query Frame = 2
Query:  383 KKLFIGGLSPHTTLETLRNYFQNYGDIKDVMILKDPVTKRSRGFGFVTFIDYSTIEKILLNSPHFLDSXXXXXXXXXXXXXELIDKAINTEKTRKVFIGGLSNSTVHKDLEAFFGKYGKVESCELMMDKSTNRHRGFGFVIFEKEETADHICNIRYHEINSKMVEAKKALPKD 901
            +K+F+GGL+ +TT + +R ++  +G+I D+++++DP TKRSRGFGFVTF   + ++  +   PH +D K +DPK A+P+  +  +++ +   T+++++ G+        L  +F KYG V   E+++DK+T + RGFGFV F+  ++ D     + H +N    + +K L KD
Sbjct:   23 RKIFVGGLTSNTTDDLMREFYSQFGEITDIIVMRDPTTKRSRGFGFVTFSGKTEVDAAMKQRPHIIDGKTVDPKRAVPRDDK--NRSESNVSTKRLYVSGVREDHTEDMLTEYFTKYGTVTKSEIILDKATQKPRGFGFVTFDDHDSVDQCVLQKSHMVNGHRCDVRKGLSKD 193          

HSP 2 Score: 70.0922 bits (170), Expect = 6.205e-13
Identity = 32/89 (35.96%), Postives = 53/89 (59.55%), Query Frame = 2
Query:  635 DKAINTEKTRKVFIGGLSNSTVHKDLEAFFGKYGKVESCELMMDKSTNRHRGFGFVIFEKEETADHICNIRYHEINSKMVEAKKALPKD 901
            D ++  E  RK+F+GGL+++T    +  F+ ++G++    +M D +T R RGFGFV F  +   D     R H I+ K V+ K+A+P+D
Sbjct:   14 DASLEPENLRKIFVGGLTSNTTDDLMREFYSQFGEITDIIVMRDPTTKRSRGFGFVTFSGKTEVDAAMKQRPHIIDGKTVDPKRAVPRD 102          
BLAST of RNA-binding protein Musashi vs. Ensembl Celegans
Match: hrp-1 (Heterogeneous nuclear ribonucleoprotein A1 [Source:UniProtKB/Swiss-Prot;Acc:Q22037])

HSP 1 Score: 121.324 bits (303), Expect = 1.730e-30
Identity = 60/173 (34.68%), Postives = 108/173 (62.43%), Query Frame = 2
Query:  383 KKLFIGGLSPHTTLETLRNYFQNYGDIKDVMILKDPVTKRSRGFGFVTFIDYSTIEKILLNSPHFLDSXXXXXXXXXXXXXELIDKAINTEKTRKVFIGGLSNSTVHKDLEAFFGKYGKVESCELMMDKSTNRHRGFGFVIFEKEETADHICNIRYHEINSKMVEAKKALPKD 901
            +K+F+GGL+ +TT + +R ++  +G+I D+++++DP TKRSRGFGFVTF   + ++  +   PH +D K +DPK A+P+  +  +++ +   T+++++ G+        L  +F KYG V   E+++DK+T + RGFGFV F+  ++ D     + H +N    + +K L KD
Sbjct:   23 RKIFVGGLTSNTTDDLMREFYSQFGEITDIIVMRDPTTKRSRGFGFVTFSGKTEVDAAMKQRPHIIDGKTVDPKRAVPRDDK--NRSESNVSTKRLYVSGVREDHTEDMLTEYFTKYGTVTKSEIILDKATQKPRGFGFVTFDDHDSVDQCVLQKSHMVNGHRCDVRKGLSKD 193          

HSP 2 Score: 70.0922 bits (170), Expect = 6.248e-13
Identity = 32/89 (35.96%), Postives = 53/89 (59.55%), Query Frame = 2
Query:  635 DKAINTEKTRKVFIGGLSNSTVHKDLEAFFGKYGKVESCELMMDKSTNRHRGFGFVIFEKEETADHICNIRYHEINSKMVEAKKALPKD 901
            D ++  E  RK+F+GGL+++T    +  F+ ++G++    +M D +T R RGFGFV F  +   D     R H I+ K V+ K+A+P+D
Sbjct:   14 DASLEPENLRKIFVGGLTSNTTDDLMREFYSQFGEITDIIVMRDPTTKRSRGFGFVTFSGKTEVDAAMKQRPHIIDGKTVDPKRAVPRD 102          
BLAST of RNA-binding protein Musashi vs. Ensembl Celegans
Match: hrp-1 (Heterogeneous nuclear ribonucleoprotein A1 [Source:UniProtKB/Swiss-Prot;Acc:Q22037])

HSP 1 Score: 121.324 bits (303), Expect = 1.730e-30
Identity = 60/173 (34.68%), Postives = 108/173 (62.43%), Query Frame = 2
Query:  383 KKLFIGGLSPHTTLETLRNYFQNYGDIKDVMILKDPVTKRSRGFGFVTFIDYSTIEKILLNSPHFLDSXXXXXXXXXXXXXELIDKAINTEKTRKVFIGGLSNSTVHKDLEAFFGKYGKVESCELMMDKSTNRHRGFGFVIFEKEETADHICNIRYHEINSKMVEAKKALPKD 901
            +K+F+GGL+ +TT + +R ++  +G+I D+++++DP TKRSRGFGFVTF   + ++  +   PH +D K +DPK A+P+  +  +++ +   T+++++ G+        L  +F KYG V   E+++DK+T + RGFGFV F+  ++ D     + H +N    + +K L KD
Sbjct:   23 RKIFVGGLTSNTTDDLMREFYSQFGEITDIIVMRDPTTKRSRGFGFVTFSGKTEVDAAMKQRPHIIDGKTVDPKRAVPRDDK--NRSESNVSTKRLYVSGVREDHTEDMLTEYFTKYGTVTKSEIILDKATQKPRGFGFVTFDDHDSVDQCVLQKSHMVNGHRCDVRKGLSKD 193          

HSP 2 Score: 70.0922 bits (170), Expect = 6.248e-13
Identity = 32/89 (35.96%), Postives = 53/89 (59.55%), Query Frame = 2
Query:  635 DKAINTEKTRKVFIGGLSNSTVHKDLEAFFGKYGKVESCELMMDKSTNRHRGFGFVIFEKEETADHICNIRYHEINSKMVEAKKALPKD 901
            D ++  E  RK+F+GGL+++T    +  F+ ++G++    +M D +T R RGFGFV F  +   D     R H I+ K V+ K+A+P+D
Sbjct:   14 DASLEPENLRKIFVGGLTSNTTDDLMREFYSQFGEITDIIVMRDPTTKRSRGFGFVTFSGKTEVDAAMKQRPHIIDGKTVDPKRAVPRD 102          
BLAST of RNA-binding protein Musashi vs. Ensembl Fly
Match: Rbp6 (gene:FBgn0260943 transcript:FBtr0075285)

HSP 1 Score: 181.8 bits (460), Expect = 1.079e-52
Identity = 91/175 (52.00%), Postives = 129/175 (73.71%), Query Frame = 2
Query:  386 KLFIGGLSPHTTLETLRNYFQNYGDIKDVMILKDPVTKRSRGFGFVTFIDYSTIEKILLNSPHFLDSXXXXXXXXXXXXXELIDKAINTEKTRKVFIGGLSNSTVHKDLEAFFGKYGKVESCELMMDKSTNRHRGFGFVIFEKEETADHICNIRYHEINSKMVEAKKALPKDVIM 910
            K+FIGGLS  T+ E+LR+YF  YGDI + M++KDP T+RSRGFGFVTF D ++++K+L    H LD KK+DPK+A P++     K +   +T+K+F+GGLS  T  +D++++F ++G +E   LM DK TNRHRGFGFV F+ E+  D +C I +HEIN+KMVE KKA PK+V++
Sbjct:   30 KMFIGGLSWQTSPESLRDYFGRYGDISEAMVMKDPTTRRSRGFGFVTFSDPNSVDKVLTQGTHELDGKKVDPKVAFPRRAH--PKMVT--RTKKIFVGGLSAPTTLEDVKSYFEQFGPIEDAMLMFDKQTNRHRGFGFVTFQSEDVVDKVCEIHFHEINNKMVECKKAQPKEVML 200          

HSP 2 Score: 68.1662 bits (165), Expect = 3.623e-12
Identity = 31/68 (45.59%), Postives = 44/68 (64.71%), Query Frame = 2
Query:  353 EAEEKCHEVNKKLFIGGLSPHTTLETLRNYFQNYGDIKDVMILKDPVTKRSRGFGFVTFIDYSTIEKI 556
             A  K     KK+F+GGLS  TTLE +++YF+ +G I+D M++ D  T R RGFGFVTF     ++K+
Sbjct:  108 RAHPKMVTRTKKIFVGGLSAPTTLEDVKSYFEQFGPIEDAMLMFDKQTNRHRGFGFVTFQSEDVVDKV 175          
BLAST of RNA-binding protein Musashi vs. Ensembl Fly
Match: Rbp6 (gene:FBgn0260943 transcript:FBtr0333861)

HSP 1 Score: 181.8 bits (460), Expect = 1.208e-52
Identity = 91/175 (52.00%), Postives = 129/175 (73.71%), Query Frame = 2
Query:  386 KLFIGGLSPHTTLETLRNYFQNYGDIKDVMILKDPVTKRSRGFGFVTFIDYSTIEKILLNSPHFLDSXXXXXXXXXXXXXELIDKAINTEKTRKVFIGGLSNSTVHKDLEAFFGKYGKVESCELMMDKSTNRHRGFGFVIFEKEETADHICNIRYHEINSKMVEAKKALPKDVIM 910
            K+FIGGLS  T+ E+LR+YF  YGDI + M++KDP T+RSRGFGFVTF D ++++K+L    H LD KK+DPK+A P++     K +   +T+K+F+GGLS  T  +D++++F ++G +E   LM DK TNRHRGFGFV F+ E+  D +C I +HEIN+KMVE KKA PK+V++
Sbjct:   30 KMFIGGLSWQTSPESLRDYFGRYGDISEAMVMKDPTTRRSRGFGFVTFSDPNSVDKVLTQGTHELDGKKVDPKVAFPRRAH--PKMVT--RTKKIFVGGLSAPTTLEDVKSYFEQFGPIEDAMLMFDKQTNRHRGFGFVTFQSEDVVDKVCEIHFHEINNKMVECKKAQPKEVML 200          

HSP 2 Score: 68.1662 bits (165), Expect = 4.117e-12
Identity = 31/68 (45.59%), Postives = 44/68 (64.71%), Query Frame = 2
Query:  353 EAEEKCHEVNKKLFIGGLSPHTTLETLRNYFQNYGDIKDVMILKDPVTKRSRGFGFVTFIDYSTIEKI 556
             A  K     KK+F+GGLS  TTLE +++YF+ +G I+D M++ D  T R RGFGFVTF     ++K+
Sbjct:  108 RAHPKMVTRTKKIFVGGLSAPTTLEDVKSYFEQFGPIEDAMLMFDKQTNRHRGFGFVTFQSEDVVDKV 175          
BLAST of RNA-binding protein Musashi vs. Ensembl Fly
Match: Rbp6 (gene:FBgn0260943 transcript:FBtr0113427)

HSP 1 Score: 182.57 bits (462), Expect = 1.185e-51
Identity = 91/175 (52.00%), Postives = 129/175 (73.71%), Query Frame = 2
Query:  386 KLFIGGLSPHTTLETLRNYFQNYGDIKDVMILKDPVTKRSRGFGFVTFIDYSTIEKILLNSPHFLDSXXXXXXXXXXXXXELIDKAINTEKTRKVFIGGLSNSTVHKDLEAFFGKYGKVESCELMMDKSTNRHRGFGFVIFEKEETADHICNIRYHEINSKMVEAKKALPKDVIM 910
            K+FIGGLS  T+ E+LR+YF  YGDI + M++KDP T+RSRGFGFVTF D ++++K+L    H LD KK+DPK+A P++     K +   +T+K+F+GGLS  T  +D++++F ++G +E   LM DK TNRHRGFGFV F+ E+  D +C I +HEIN+KMVE KKA PK+V++
Sbjct:   30 KMFIGGLSWQTSPESLRDYFGRYGDISEAMVMKDPTTRRSRGFGFVTFSDPNSVDKVLTQGTHELDGKKVDPKVAFPRRAH--PKMVT--RTKKIFVGGLSAPTTLEDVKSYFEQFGPIEDAMLMFDKQTNRHRGFGFVTFQSEDVVDKVCEIHFHEINNKMVECKKAQPKEVML 200          

HSP 2 Score: 68.5514 bits (166), Expect = 4.105e-12
Identity = 31/68 (45.59%), Postives = 44/68 (64.71%), Query Frame = 2
Query:  353 EAEEKCHEVNKKLFIGGLSPHTTLETLRNYFQNYGDIKDVMILKDPVTKRSRGFGFVTFIDYSTIEKI 556
             A  K     KK+F+GGLS  TTLE +++YF+ +G I+D M++ D  T R RGFGFVTF     ++K+
Sbjct:  108 RAHPKMVTRTKKIFVGGLSAPTTLEDVKSYFEQFGPIEDAMLMFDKQTNRHRGFGFVTFQSEDVVDKV 175          
BLAST of RNA-binding protein Musashi vs. Ensembl Fly
Match: msi (gene:FBgn0011666 transcript:FBtr0333665)

HSP 1 Score: 166.392 bits (420), Expect = 2.958e-45
Identity = 85/174 (48.85%), Postives = 120/174 (68.97%), Query Frame = 2
Query:  386 KLFIGGLSPHTTLETLRNYFQNYGDIKDVMILKDPVTKRSRGFGFVTFIDYSTIEKILLNSPHFLDSXXXXXXXXXXXXXELIDKAINTEKTRKVFIGGLSNSTVHKDLEAFFGKYGKVESCELMMDKSTNRHRGFGFVIFEKEETADHICNIRYHEINSKMVEAKKALPKDVI 907
            KLF+GGLS  T+ + L+ YF  +G + DV+I+KDPVT+RSRGFGF+TF +  T+EK+L    H LD KKIDPK A PK     ++     KT+K+F+GG+S  T  ++++A+F ++G VE   ++MD+ T RHRGFGFV FE E+  D +C I +H I +K VE KKA PK+ +
Sbjct:  137 KLFVGGLSWQTSSDKLKEYFNMFGTVTDVLIMKDPVTQRSRGFGFITFQEPCTVEKVLKVPIHTLDGKKIDPKHATPK-----NRPRQANKTKKIFVGGVSQDTSAEEVKAYFSQFGPVEETVMLMDQQTKRHRGFGFVTFENEDVVDRVCEIHFHTIKNKKVECKKAQPKEAV 305          

HSP 2 Score: 64.6994 bits (156), Expect = 8.342e-11
Identity = 30/89 (33.71%), Postives = 49/89 (55.06%), Query Frame = 2
Query:  665 KVFIGGLSNSTVHKDLEAFFGKYGKVESCELMMDKSTNRHRGFGFVIFEKEETADHICNIRYHEINSKMVEAKKALPKDVIMQTSYSNK 931
            K+F+GGLS  T    L+ +F  +G V    +M D  T R RGFGF+ F++  T + +  +  H ++ K ++ K A PK+   Q + + K
Sbjct:  137 KLFVGGLSWQTSSDKLKEYFNMFGTVTDVLIMKDPVTQRSRGFGFITFQEPCTVEKVLKVPIHTLDGKKIDPKHATPKNRPRQANKTKK 225          

HSP 3 Score: 61.2326 bits (147), Expect = 1.111e-9
Identity = 24/58 (41.38%), Postives = 41/58 (70.69%), Query Frame = 2
Query:  383 KKLFIGGLSPHTTLETLRNYFQNYGDIKDVMILKDPVTKRSRGFGFVTFIDYSTIEKI 556
            KK+F+GG+S  T+ E ++ YF  +G +++ ++L D  TKR RGFGFVTF +   ++++
Sbjct:  224 KKIFVGGVSQDTSAEEVKAYFSQFGPVEETVMLMDQQTKRHRGFGFVTFENEDVVDRV 281          
BLAST of RNA-binding protein Musashi vs. Ensembl Fly
Match: msi (gene:FBgn0011666 transcript:FBtr0305219)

HSP 1 Score: 166.777 bits (421), Expect = 3.383e-45
Identity = 85/174 (48.85%), Postives = 120/174 (68.97%), Query Frame = 2
Query:  386 KLFIGGLSPHTTLETLRNYFQNYGDIKDVMILKDPVTKRSRGFGFVTFIDYSTIEKILLNSPHFLDSXXXXXXXXXXXXXELIDKAINTEKTRKVFIGGLSNSTVHKDLEAFFGKYGKVESCELMMDKSTNRHRGFGFVIFEKEETADHICNIRYHEINSKMVEAKKALPKDVI 907
            KLF+GGLS  T+ + L+ YF  +G + DV+I+KDPVT+RSRGFGF+TF +  T+EK+L    H LD KKIDPK A PK     ++     KT+K+F+GG+S  T  ++++A+F ++G VE   ++MD+ T RHRGFGFV FE E+  D +C I +H I +K VE KKA PK+ +
Sbjct:  175 KLFVGGLSWQTSSDKLKEYFNMFGTVTDVLIMKDPVTQRSRGFGFITFQEPCTVEKVLKVPIHTLDGKKIDPKHATPK-----NRPRQANKTKKIFVGGVSQDTSAEEVKAYFSQFGPVEETVMLMDQQTKRHRGFGFVTFENEDVVDRVCEIHFHTIKNKKVECKKAQPKEAV 343          

HSP 2 Score: 65.4698 bits (158), Expect = 4.887e-11
Identity = 30/89 (33.71%), Postives = 49/89 (55.06%), Query Frame = 2
Query:  665 KVFIGGLSNSTVHKDLEAFFGKYGKVESCELMMDKSTNRHRGFGFVIFEKEETADHICNIRYHEINSKMVEAKKALPKDVIMQTSYSNK 931
            K+F+GGLS  T    L+ +F  +G V    +M D  T R RGFGF+ F++  T + +  +  H ++ K ++ K A PK+   Q + + K
Sbjct:  175 KLFVGGLSWQTSSDKLKEYFNMFGTVTDVLIMKDPVTQRSRGFGFITFQEPCTVEKVLKVPIHTLDGKKIDPKHATPKNRPRQANKTKK 263          

HSP 3 Score: 61.2326 bits (147), Expect = 1.188e-9
Identity = 27/78 (34.62%), Postives = 49/78 (62.82%), Query Frame = 2
Query:  329 K*MDRSFSEAEEKCHEVNK--KLFIGGLSPHTTLETLRNYFQNYGDIKDVMILKDPVTKRSRGFGFVTFIDYSTIEKI 556
            K +D   +  + +  + NK  K+F+GG+S  T+ E ++ YF  +G +++ ++L D  TKR RGFGFVTF +   ++++
Sbjct:  242 KKIDPKHATPKNRPRQANKTKKIFVGGVSQDTSAEEVKAYFSQFGPVEETVMLMDQQTKRHRGFGFVTFENEDVVDRV 319          
BLAST of RNA-binding protein Musashi vs. Ensembl Zebrafish
Match: msi2b (musashi RNA-binding protein 2b [Source:ZFIN;Acc:ZDB-GENE-040426-1268])

HSP 1 Score: 183.341 bits (464), Expect = 3.745e-55
Identity = 93/177 (52.54%), Postives = 135/177 (76.27%), Query Frame = 2
Query:  377 VNKKLFIGGLSPHTTLETLRNYFQNYGDIKDVMILKDPVTKRSRGFGFVTFIDYSTIEKILLNSPHFLDSXXXXXXXXXXXXXELIDKAINTEKTRKVFIGGLSNSTVHKDLEAFFGKYGKVESCELMMDKSTNRHRGFGFVIFEKEETADHICNIRYHEINSKMVEAKKALPKDVI 907
            +N K+FIGGLS  T+ ++LR+YF  +G+I++ M+++DP TKRSRGFGFVTF D ++++K+L    H LDSK IDPK+A P++ +   K +   +T+K+F+GGLS +TV +D++ +F ++GKVE   LM DK+TNRHRGFGFV FE E+  + +C I +HEIN+KMVE KKA PK+V+
Sbjct:    1 MNLKMFIGGLSWQTSPDSLRDYFSKFGEIRECMVMRDPTTKRSRGFGFVTFADAASVDKVLAQPHHELDSKTIDPKVAFPRRAQ--PKMVT--RTKKIFVGGLSANTVVEDVKQYFEQFGKVEDAMLMFDKTTNRHRGFGFVTFENEDVVEKVCEIHFHEINNKMVECKKAQPKEVM 173          

HSP 2 Score: 67.781 bits (164), Expect = 1.021e-12
Identity = 29/68 (42.65%), Postives = 45/68 (66.18%), Query Frame = 2
Query:  353 EAEEKCHEVNKKLFIGGLSPHTTLETLRNYFQNYGDIKDVMILKDPVTKRSRGFGFVTFIDYSTIEKI 556
             A+ K     KK+F+GGLS +T +E ++ YF+ +G ++D M++ D  T R RGFGFVTF +   +EK+
Sbjct:   82 RAQPKMVTRTKKIFVGGLSANTVVEDVKQYFEQFGKVEDAMLMFDKTTNRHRGFGFVTFENEDVVEKV 149          
BLAST of RNA-binding protein Musashi vs. Ensembl Zebrafish
Match: msi2b (musashi RNA-binding protein 2b [Source:ZFIN;Acc:ZDB-GENE-040426-1268])

HSP 1 Score: 183.341 bits (464), Expect = 8.164e-54
Identity = 92/174 (52.87%), Postives = 133/174 (76.44%), Query Frame = 2
Query:  386 KLFIGGLSPHTTLETLRNYFQNYGDIKDVMILKDPVTKRSRGFGFVTFIDYSTIEKILLNSPHFLDSXXXXXXXXXXXXXELIDKAINTEKTRKVFIGGLSNSTVHKDLEAFFGKYGKVESCELMMDKSTNRHRGFGFVIFEKEETADHICNIRYHEINSKMVEAKKALPKDVI 907
            K+FIGGLS  T+ ++LR+YF  +G+I++ M+++DP TKRSRGFGFVTF D ++++K+L    H LDSK IDPK+A P++ +   K +   +T+K+F+GGLS +TV +D++ +F ++GKVE   LM DK+TNRHRGFGFV FE E+  + +C I +HEIN+KMVE KKA PK+V+
Sbjct:   22 KMFIGGLSWQTSPDSLRDYFSKFGEIRECMVMRDPTTKRSRGFGFVTFADAASVDKVLAQPHHELDSKTIDPKVAFPRRAQ--PKMVT--RTKKIFVGGLSANTVVEDVKQYFEQFGKVEDAMLMFDKTTNRHRGFGFVTFENEDVVEKVCEIHFHEINNKMVECKKAQPKEVM 191          

HSP 2 Score: 68.1662 bits (165), Expect = 3.354e-12
Identity = 29/68 (42.65%), Postives = 45/68 (66.18%), Query Frame = 2
Query:  353 EAEEKCHEVNKKLFIGGLSPHTTLETLRNYFQNYGDIKDVMILKDPVTKRSRGFGFVTFIDYSTIEKI 556
             A+ K     KK+F+GGLS +T +E ++ YF+ +G ++D M++ D  T R RGFGFVTF +   +EK+
Sbjct:  100 RAQPKMVTRTKKIFVGGLSANTVVEDVKQYFEQFGKVEDAMLMFDKTTNRHRGFGFVTFENEDVVEKV 167          
BLAST of RNA-binding protein Musashi vs. Ensembl Zebrafish
Match: msi2a (musashi RNA-binding protein 2a [Source:ZFIN;Acc:ZDB-GENE-030826-25])

HSP 1 Score: 184.111 bits (466), Expect = 3.316e-53
Identity = 93/174 (53.45%), Postives = 133/174 (76.44%), Query Frame = 2
Query:  386 KLFIGGLSPHTTLETLRNYFQNYGDIKDVMILKDPVTKRSRGFGFVTFIDYSTIEKILLNSPHFLDSXXXXXXXXXXXXXELIDKAINTEKTRKVFIGGLSNSTVHKDLEAFFGKYGKVESCELMMDKSTNRHRGFGFVIFEKEETADHICNIRYHEINSKMVEAKKALPKDVI 907
            K+FIGGLS  T+ ++LR+YF  +G+I++ M+++DP TKRSRGFGF+TF D S+++K+L    H LDSK IDPK+A P++ +   K +   +T+K+F+GGLS STV +D++ +F ++GKVE   LM DK+TNRHRGFGFV FE E+  + +C I +HEIN+KMVE KKA PK+V+
Sbjct:   22 KMFIGGLSWQTSPDSLRDYFCKFGEIRECMVMRDPTTKRSRGFGFITFADVSSVDKVLAQPHHELDSKTIDPKVAFPRRAQ--PKMVT--RTKKIFVGGLSASTVVEDVKQYFEQFGKVEDAMLMFDKTTNRHRGFGFVTFENEDIVEKVCEIHFHEINNKMVECKKAQPKEVM 191          

HSP 2 Score: 67.3958 bits (163), Expect = 9.560e-12
Identity = 29/69 (42.03%), Postives = 44/69 (63.77%), Query Frame = 2
Query:  353 EAEEKCHEVNKKLFIGGLSPHTTLETLRNYFQNYGDIKDVMILKDPVTKRSRGFGFVTFIDYSTIEKIL 559
             A+ K     KK+F+GGLS  T +E ++ YF+ +G ++D M++ D  T R RGFGFVTF +   +EK+ 
Sbjct:  100 RAQPKMVTRTKKIFVGGLSASTVVEDVKQYFEQFGKVEDAMLMFDKTTNRHRGFGFVTFENEDIVEKVC 168          
BLAST of RNA-binding protein Musashi vs. Ensembl Zebrafish
Match: msi2a (musashi RNA-binding protein 2a [Source:ZFIN;Acc:ZDB-GENE-030826-25])

HSP 1 Score: 184.111 bits (466), Expect = 3.316e-53
Identity = 93/174 (53.45%), Postives = 133/174 (76.44%), Query Frame = 2
Query:  386 KLFIGGLSPHTTLETLRNYFQNYGDIKDVMILKDPVTKRSRGFGFVTFIDYSTIEKILLNSPHFLDSXXXXXXXXXXXXXELIDKAINTEKTRKVFIGGLSNSTVHKDLEAFFGKYGKVESCELMMDKSTNRHRGFGFVIFEKEETADHICNIRYHEINSKMVEAKKALPKDVI 907
            K+FIGGLS  T+ ++LR+YF  +G+I++ M+++DP TKRSRGFGF+TF D S+++K+L    H LDSK IDPK+A P++ +   K +   +T+K+F+GGLS STV +D++ +F ++GKVE   LM DK+TNRHRGFGFV FE E+  + +C I +HEIN+KMVE KKA PK+V+
Sbjct:   22 KMFIGGLSWQTSPDSLRDYFCKFGEIRECMVMRDPTTKRSRGFGFITFADVSSVDKVLAQPHHELDSKTIDPKVAFPRRAQ--PKMVT--RTKKIFVGGLSASTVVEDVKQYFEQFGKVEDAMLMFDKTTNRHRGFGFVTFENEDIVEKVCEIHFHEINNKMVECKKAQPKEVM 191          

HSP 2 Score: 67.3958 bits (163), Expect = 9.560e-12
Identity = 29/69 (42.03%), Postives = 44/69 (63.77%), Query Frame = 2
Query:  353 EAEEKCHEVNKKLFIGGLSPHTTLETLRNYFQNYGDIKDVMILKDPVTKRSRGFGFVTFIDYSTIEKIL 559
             A+ K     KK+F+GGLS  T +E ++ YF+ +G ++D M++ D  T R RGFGFVTF +   +EK+ 
Sbjct:  100 RAQPKMVTRTKKIFVGGLSASTVVEDVKQYFEQFGKVEDAMLMFDKTTNRHRGFGFVTFENEDIVEKVC 168          
BLAST of RNA-binding protein Musashi vs. Ensembl Zebrafish
Match: msi2b (musashi RNA-binding protein 2b [Source:ZFIN;Acc:ZDB-GENE-040426-1268])

HSP 1 Score: 184.496 bits (467), Expect = 4.068e-53
Identity = 92/174 (52.87%), Postives = 133/174 (76.44%), Query Frame = 2
Query:  386 KLFIGGLSPHTTLETLRNYFQNYGDIKDVMILKDPVTKRSRGFGFVTFIDYSTIEKILLNSPHFLDSXXXXXXXXXXXXXELIDKAINTEKTRKVFIGGLSNSTVHKDLEAFFGKYGKVESCELMMDKSTNRHRGFGFVIFEKEETADHICNIRYHEINSKMVEAKKALPKDVI 907
            K+FIGGLS  T+ ++LR+YF  +G+I++ M+++DP TKRSRGFGFVTF D ++++K+L    H LDSK IDPK+A P++ +   K +   +T+K+F+GGLS +TV +D++ +F ++GKVE   LM DK+TNRHRGFGFV FE E+  + +C I +HEIN+KMVE KKA PK+V+
Sbjct:   22 KMFIGGLSWQTSPDSLRDYFSKFGEIRECMVMRDPTTKRSRGFGFVTFADAASVDKVLAQPHHELDSKTIDPKVAFPRRAQ--PKMVT--RTKKIFVGGLSANTVVEDVKQYFEQFGKVEDAMLMFDKTTNRHRGFGFVTFENEDVVEKVCEIHFHEINNKMVECKKAQPKEVM 191          

HSP 2 Score: 68.5514 bits (166), Expect = 5.074e-12
Identity = 29/68 (42.65%), Postives = 45/68 (66.18%), Query Frame = 2
Query:  353 EAEEKCHEVNKKLFIGGLSPHTTLETLRNYFQNYGDIKDVMILKDPVTKRSRGFGFVTFIDYSTIEKI 556
             A+ K     KK+F+GGLS +T +E ++ YF+ +G ++D M++ D  T R RGFGFVTF +   +EK+
Sbjct:  100 RAQPKMVTRTKKIFVGGLSANTVVEDVKQYFEQFGKVEDAMLMFDKTTNRHRGFGFVTFENEDVVEKV 167          
BLAST of RNA-binding protein Musashi vs. Ensembl Xenopus
Match: msi1 (musashi RNA binding protein 1 [Source:NCBI gene;Acc:496961])

HSP 1 Score: 185.267 bits (469), Expect = 5.032e-54
Identity = 94/178 (52.81%), Postives = 135/178 (75.84%), Query Frame = 2
Query:  386 KLFIGGLSPHTTLETLRNYFQNYGDIKDVMILKDPVTKRSRGFGFVTFIDYSTIEKILLNSPHFLDSXXXXXXXXXXXXXELIDKAINTEKTRKVFIGGLSNSTVHKDLEAFFGKYGKVESCELMMDKSTNRHRGFGFVIFEKEETADHICNIRYHEINSKMVEAKKALPKDVIMQTS 919
            K+FIGGLS  TT E LR YF ++GD+K+ ++++DP+TKRSRGFGFVTF+D + ++K+L  S H LDSK IDPK+A P++ +   K +   +T+K+F+GGLS +T  +D++ +F ++GKV+   LM DK+TNRHRGFGFV FE E+  + +C+I +HEIN+KMVE KKA PK+V+  T 
Sbjct:   21 KMFIGGLSWQTTQEGLREYFSHFGDVKECLVMRDPLTKRSRGFGFVTFMDQAGVDKVLAQSRHELDSKTIDPKVAFPRRAQ--PKMVT--RTKKIFVGGLSVNTTVEDVKQYFEQFGKVDDAMLMFDKTTNRHRGFGFVTFEGEDIVEKVCDIHFHEINNKMVECKKAQPKEVMSPTG 194          

HSP 2 Score: 67.3958 bits (163), Expect = 9.118e-12
Identity = 30/68 (44.12%), Postives = 44/68 (64.71%), Query Frame = 2
Query:  353 EAEEKCHEVNKKLFIGGLSPHTTLETLRNYFQNYGDIKDVMILKDPVTKRSRGFGFVTFIDYSTIEKI 556
             A+ K     KK+F+GGLS +TT+E ++ YF+ +G + D M++ D  T R RGFGFVTF     +EK+
Sbjct:   99 RAQPKMVTRTKKIFVGGLSVNTTVEDVKQYFEQFGKVDDAMLMFDKTTNRHRGFGFVTFEGEDIVEKV 166          
BLAST of RNA-binding protein Musashi vs. Ensembl Xenopus
Match: msi1 (musashi RNA binding protein 1 [Source:NCBI gene;Acc:496961])

HSP 1 Score: 185.267 bits (469), Expect = 5.300e-54
Identity = 94/178 (52.81%), Postives = 135/178 (75.84%), Query Frame = 2
Query:  386 KLFIGGLSPHTTLETLRNYFQNYGDIKDVMILKDPVTKRSRGFGFVTFIDYSTIEKILLNSPHFLDSXXXXXXXXXXXXXELIDKAINTEKTRKVFIGGLSNSTVHKDLEAFFGKYGKVESCELMMDKSTNRHRGFGFVIFEKEETADHICNIRYHEINSKMVEAKKALPKDVIMQTS 919
            K+FIGGLS  TT E LR YF ++GD+K+ ++++DP+TKRSRGFGFVTF+D + ++K+L  S H LDSK IDPK+A P++ +   K +   +T+K+F+GGLS +T  +D++ +F ++GKV+   LM DK+TNRHRGFGFV FE E+  + +C+I +HEIN+KMVE KKA PK+V+  T 
Sbjct:   21 KMFIGGLSWQTTQEGLREYFSHFGDVKECLVMRDPLTKRSRGFGFVTFMDQAGVDKVLAQSRHELDSKTIDPKVAFPRRAQ--PKMVT--RTKKIFVGGLSVNTTVEDVKQYFEQFGKVDDAMLMFDKTTNRHRGFGFVTFEGEDIVEKVCDIHFHEINNKMVECKKAQPKEVMSPTG 194          

HSP 2 Score: 67.781 bits (164), Expect = 9.140e-12
Identity = 30/68 (44.12%), Postives = 44/68 (64.71%), Query Frame = 2
Query:  353 EAEEKCHEVNKKLFIGGLSPHTTLETLRNYFQNYGDIKDVMILKDPVTKRSRGFGFVTFIDYSTIEKI 556
             A+ K     KK+F+GGLS +TT+E ++ YF+ +G + D M++ D  T R RGFGFVTF     +EK+
Sbjct:   99 RAQPKMVTRTKKIFVGGLSVNTTVEDVKQYFEQFGKVDDAMLMFDKTTNRHRGFGFVTFEGEDIVEKV 166          
BLAST of RNA-binding protein Musashi vs. Ensembl Xenopus
Match: msi1 (musashi RNA binding protein 1 [Source:NCBI gene;Acc:496961])

HSP 1 Score: 182.956 bits (463), Expect = 9.453e-54
Identity = 93/177 (52.54%), Postives = 134/177 (75.71%), Query Frame = 2
Query:  389 LFIGGLSPHTTLETLRNYFQNYGDIKDVMILKDPVTKRSRGFGFVTFIDYSTIEKILLNSPHFLDSXXXXXXXXXXXXXELIDKAINTEKTRKVFIGGLSNSTVHKDLEAFFGKYGKVESCELMMDKSTNRHRGFGFVIFEKEETADHICNIRYHEINSKMVEAKKALPKDVIMQTS 919
            +FIGGLS  TT E LR YF ++GD+K+ ++++DP+TKRSRGFGFVTF+D + ++K+L  S H LDSK IDPK+A P++ +   K +   +T+K+F+GGLS +T  +D++ +F ++GKV+   LM DK+TNRHRGFGFV FE E+  + +C+I +HEIN+KMVE KKA PK+V+  T 
Sbjct:    1 MFIGGLSWQTTQEGLREYFSHFGDVKECLVMRDPLTKRSRGFGFVTFMDQAGVDKVLAQSRHELDSKTIDPKVAFPRRAQ--PKMVT--RTKKIFVGGLSVNTTVEDVKQYFEQFGKVDDAMLMFDKTTNRHRGFGFVTFEGEDIVEKVCDIHFHEINNKMVECKKAQPKEVMSPTG 173          

HSP 2 Score: 67.781 bits (164), Expect = 5.005e-12
Identity = 30/68 (44.12%), Postives = 44/68 (64.71%), Query Frame = 2
Query:  353 EAEEKCHEVNKKLFIGGLSPHTTLETLRNYFQNYGDIKDVMILKDPVTKRSRGFGFVTFIDYSTIEKI 556
             A+ K     KK+F+GGLS +TT+E ++ YF+ +G + D M++ D  T R RGFGFVTF     +EK+
Sbjct:   78 RAQPKMVTRTKKIFVGGLSVNTTVEDVKQYFEQFGKVDDAMLMFDKTTNRHRGFGFVTFEGEDIVEKV 145          
BLAST of RNA-binding protein Musashi vs. Ensembl Xenopus
Match: msi1 (musashi RNA binding protein 1 [Source:NCBI gene;Acc:496961])

HSP 1 Score: 183.341 bits (464), Expect = 1.515e-53
Identity = 93/177 (52.54%), Postives = 134/177 (75.71%), Query Frame = 2
Query:  389 LFIGGLSPHTTLETLRNYFQNYGDIKDVMILKDPVTKRSRGFGFVTFIDYSTIEKILLNSPHFLDSXXXXXXXXXXXXXELIDKAINTEKTRKVFIGGLSNSTVHKDLEAFFGKYGKVESCELMMDKSTNRHRGFGFVIFEKEETADHICNIRYHEINSKMVEAKKALPKDVIMQTS 919
            +FIGGLS  TT E LR YF ++GD+K+ ++++DP+TKRSRGFGFVTF+D + ++K+L  S H LDSK IDPK+A P++ +   K +   +T+K+F+GGLS +T  +D++ +F ++GKV+   LM DK+TNRHRGFGFV FE E+  + +C+I +HEIN+KMVE KKA PK+V+  T 
Sbjct:    1 MFIGGLSWQTTQEGLREYFSHFGDVKECLVMRDPLTKRSRGFGFVTFMDQAGVDKVLAQSRHELDSKTIDPKVAFPRRAQ--PKMVT--RTKKIFVGGLSVNTTVEDVKQYFEQFGKVDDAMLMFDKTTNRHRGFGFVTFEGEDIVEKVCDIHFHEINNKMVECKKAQPKEVMSPTG 173          

HSP 2 Score: 67.781 bits (164), Expect = 6.680e-12
Identity = 30/68 (44.12%), Postives = 44/68 (64.71%), Query Frame = 2
Query:  353 EAEEKCHEVNKKLFIGGLSPHTTLETLRNYFQNYGDIKDVMILKDPVTKRSRGFGFVTFIDYSTIEKI 556
             A+ K     KK+F+GGLS +TT+E ++ YF+ +G + D M++ D  T R RGFGFVTF     +EK+
Sbjct:   78 RAQPKMVTRTKKIFVGGLSVNTTVEDVKQYFEQFGKVDDAMLMFDKTTNRHRGFGFVTFEGEDIVEKV 145          
BLAST of RNA-binding protein Musashi vs. Ensembl Xenopus
Match: msi1 (musashi RNA binding protein 1 [Source:NCBI gene;Acc:496961])

HSP 1 Score: 182.956 bits (463), Expect = 1.989e-53
Identity = 93/177 (52.54%), Postives = 134/177 (75.71%), Query Frame = 2
Query:  389 LFIGGLSPHTTLETLRNYFQNYGDIKDVMILKDPVTKRSRGFGFVTFIDYSTIEKILLNSPHFLDSXXXXXXXXXXXXXELIDKAINTEKTRKVFIGGLSNSTVHKDLEAFFGKYGKVESCELMMDKSTNRHRGFGFVIFEKEETADHICNIRYHEINSKMVEAKKALPKDVIMQTS 919
            +FIGGLS  TT E LR YF ++GD+K+ ++++DP+TKRSRGFGFVTF+D + ++K+L  S H LDSK IDPK+A P++ +   K +   +T+K+F+GGLS +T  +D++ +F ++GKV+   LM DK+TNRHRGFGFV FE E+  + +C+I +HEIN+KMVE KKA PK+V+  T 
Sbjct:    1 MFIGGLSWQTTQEGLREYFSHFGDVKECLVMRDPLTKRSRGFGFVTFMDQAGVDKVLAQSRHELDSKTIDPKVAFPRRAQ--PKMVT--RTKKIFVGGLSVNTTVEDVKQYFEQFGKVDDAMLMFDKTTNRHRGFGFVTFEGEDIVEKVCDIHFHEINNKMVECKKAQPKEVMSPTG 173          

HSP 2 Score: 67.781 bits (164), Expect = 6.104e-12
Identity = 30/68 (44.12%), Postives = 44/68 (64.71%), Query Frame = 2
Query:  353 EAEEKCHEVNKKLFIGGLSPHTTLETLRNYFQNYGDIKDVMILKDPVTKRSRGFGFVTFIDYSTIEKI 556
             A+ K     KK+F+GGLS +TT+E ++ YF+ +G + D M++ D  T R RGFGFVTF     +EK+
Sbjct:   78 RAQPKMVTRTKKIFVGGLSVNTTVEDVKQYFEQFGKVDDAMLMFDKTTNRHRGFGFVTFEGEDIVEKV 145          
BLAST of RNA-binding protein Musashi vs. Ensembl Mouse
Match: Msi2 (musashi RNA-binding protein 2 [Source:MGI Symbol;Acc:MGI:1923876])

HSP 1 Score: 182.185 bits (461), Expect = 6.924e-53
Identity = 92/174 (52.87%), Postives = 133/174 (76.44%), Query Frame = 2
Query:  386 KLFIGGLSPHTTLETLRNYFQNYGDIKDVMILKDPVTKRSRGFGFVTFIDYSTIEKILLNSPHFLDSXXXXXXXXXXXXXELIDKAINTEKTRKVFIGGLSNSTVHKDLEAFFGKYGKVESCELMMDKSTNRHRGFGFVIFEKEETADHICNIRYHEINSKMVEAKKALPKDVI 907
            K+FIGGLS  T+ ++LR+YF  +G+I++ M+++DP TKRSRGFGFVTF D ++++K+L    H LDSK IDPK+A P++ +   K +   +T+K+F+GGLS +TV +D++ +F ++GKVE   LM DK+TNRHRGFGFV FE E+  + +C I +HEIN+KMVE KKA PK+V+
Sbjct:   22 KMFIGGLSWQTSPDSLRDYFSKFGEIRECMVMRDPTTKRSRGFGFVTFADPASVDKVLGQPHHELDSKTIDPKVAFPRRAQ--PKMVT--RTKKIFVGGLSANTVVEDVKQYFEQFGKVEDAMLMFDKTTNRHRGFGFVTFENEDVVEKVCEIHFHEINNKMVECKKAQPKEVM 191          

HSP 2 Score: 68.1662 bits (165), Expect = 4.064e-12
Identity = 29/68 (42.65%), Postives = 45/68 (66.18%), Query Frame = 2
Query:  353 EAEEKCHEVNKKLFIGGLSPHTTLETLRNYFQNYGDIKDVMILKDPVTKRSRGFGFVTFIDYSTIEKI 556
             A+ K     KK+F+GGLS +T +E ++ YF+ +G ++D M++ D  T R RGFGFVTF +   +EK+
Sbjct:  100 RAQPKMVTRTKKIFVGGLSANTVVEDVKQYFEQFGKVEDAMLMFDKTTNRHRGFGFVTFENEDVVEKV 167          
BLAST of RNA-binding protein Musashi vs. Ensembl Mouse
Match: Msi1 (musashi RNA-binding protein 1 [Source:MGI Symbol;Acc:MGI:107376])

HSP 1 Score: 182.57 bits (462), Expect = 7.135e-53
Identity = 93/178 (52.25%), Postives = 133/178 (74.72%), Query Frame = 2
Query:  386 KLFIGGLSPHTTLETLRNYFQNYGDIKDVMILKDPVTKRSRGFGFVTFIDYSTIEKILLNSPHFLDSXXXXXXXXXXXXXELIDKAINTEKTRKVFIGGLSNSTVHKDLEAFFGKYGKVESCELMMDKSTNRHRGFGFVIFEKEETADHICNIRYHEINSKMVEAKKALPKDVIMQTS 919
            K+FIGGLS  TT E LR YF  +G++K+ ++++DP+TKRSRGFGFVTF+D + ++K+L  S H LDSK IDPK+A P++ +   K +   +T+K+F+GGLS +T  +D++ +F ++GKV+   LM DK+TNRHRGFGFV FE E+  + +C I +HEIN+KMVE KKA PK+V+  T 
Sbjct:   21 KMFIGGLSWQTTQEGLREYFGQFGEVKECLVMRDPLTKRSRGFGFVTFMDQAGVDKVLAQSRHELDSKTIDPKVAFPRRAQ--PKMVT--RTKKIFVGGLSVNTTVEDVKHYFEQFGKVDDAMLMFDKTTNRHRGFGFVTFESEDIVEKVCEIHFHEINNKMVECKKAQPKEVMSPTG 194          

HSP 2 Score: 68.1662 bits (165), Expect = 5.720e-12
Identity = 30/68 (44.12%), Postives = 45/68 (66.18%), Query Frame = 2
Query:  353 EAEEKCHEVNKKLFIGGLSPHTTLETLRNYFQNYGDIKDVMILKDPVTKRSRGFGFVTFIDYSTIEKI 556
             A+ K     KK+F+GGLS +TT+E +++YF+ +G + D M++ D  T R RGFGFVTF     +EK+
Sbjct:   99 RAQPKMVTRTKKIFVGGLSVNTTVEDVKHYFEQFGKVDDAMLMFDKTTNRHRGFGFVTFESEDIVEKV 166          
BLAST of RNA-binding protein Musashi vs. Ensembl Mouse
Match: Msi2 (musashi RNA-binding protein 2 [Source:MGI Symbol;Acc:MGI:1923876])

HSP 1 Score: 181.03 bits (458), Expect = 9.825e-53
Identity = 92/174 (52.87%), Postives = 133/174 (76.44%), Query Frame = 2
Query:  386 KLFIGGLSPHTTLETLRNYFQNYGDIKDVMILKDPVTKRSRGFGFVTFIDYSTIEKILLNSPHFLDSXXXXXXXXXXXXXELIDKAINTEKTRKVFIGGLSNSTVHKDLEAFFGKYGKVESCELMMDKSTNRHRGFGFVIFEKEETADHICNIRYHEINSKMVEAKKALPKDVI 907
            K+FIGGLS  T+ ++LR+YF  +G+I++ M+++DP TKRSRGFGFVTF D ++++K+L    H LDSK IDPK+A P++ +   K +   +T+K+F+GGLS +TV +D++ +F ++GKVE   LM DK+TNRHRGFGFV FE E+  + +C I +HEIN+KMVE KKA PK+V+
Sbjct:   22 KMFIGGLSWQTSPDSLRDYFSKFGEIRECMVMRDPTTKRSRGFGFVTFADPASVDKVLGQPHHELDSKTIDPKVAFPRRAQ--PKMVT--RTKKIFVGGLSANTVVEDVKQYFEQFGKVEDAMLMFDKTTNRHRGFGFVTFENEDVVEKVCEIHFHEINNKMVECKKAQPKEVM 191          

HSP 2 Score: 67.781 bits (164), Expect = 4.972e-12
Identity = 29/68 (42.65%), Postives = 45/68 (66.18%), Query Frame = 2
Query:  353 EAEEKCHEVNKKLFIGGLSPHTTLETLRNYFQNYGDIKDVMILKDPVTKRSRGFGFVTFIDYSTIEKI 556
             A+ K     KK+F+GGLS +T +E ++ YF+ +G ++D M++ D  T R RGFGFVTF +   +EK+
Sbjct:  100 RAQPKMVTRTKKIFVGGLSANTVVEDVKQYFEQFGKVEDAMLMFDKTTNRHRGFGFVTFENEDVVEKV 167          
BLAST of RNA-binding protein Musashi vs. Ensembl Mouse
Match: Msi1 (musashi RNA-binding protein 1 [Source:MGI Symbol;Acc:MGI:107376])

HSP 1 Score: 169.474 bits (428), Expect = 2.946e-48
Identity = 87/171 (50.88%), Postives = 126/171 (73.68%), Query Frame = 2
Query:  407 SPHTTLETLRNYFQNYGDIKDVMILKDPVTKRSRGFGFVTFIDYSTIEKILLNSPHFLDSXXXXXXXXXXXXXELIDKAINTEKTRKVFIGGLSNSTVHKDLEAFFGKYGKVESCELMMDKSTNRHRGFGFVIFEKEETADHICNIRYHEINSKMVEAKKALPKDVIMQTS 919
            S  TT E LR YF  +G++K+ ++++DP+TKRSRGFGFVTF+D + ++K+L  S H LDSK IDPK+A P++ +   K +   +T+K+F+GGLS +T  +D++ +F ++GKV+   LM DK+TNRHRGFGFV FE E+  + +C I +HEIN+KMVE KKA PK+V+  T 
Sbjct:    2 SWQTTQEGLREYFGQFGEVKECLVMRDPLTKRSRGFGFVTFMDQAGVDKVLAQSRHELDSKTIDPKVAFPRRAQ--PKMVT--RTKKIFVGGLSVNTTVEDVKHYFEQFGKVDDAMLMFDKTTNRHRGFGFVTFESEDIVEKVCEIHFHEINNKMVECKKAQPKEVMSPTG 168          

HSP 2 Score: 68.1662 bits (165), Expect = 3.939e-12
Identity = 30/68 (44.12%), Postives = 45/68 (66.18%), Query Frame = 2
Query:  353 EAEEKCHEVNKKLFIGGLSPHTTLETLRNYFQNYGDIKDVMILKDPVTKRSRGFGFVTFIDYSTIEKI 556
             A+ K     KK+F+GGLS +TT+E +++YF+ +G + D M++ D  T R RGFGFVTF     +EK+
Sbjct:   73 RAQPKMVTRTKKIFVGGLSVNTTVEDVKHYFEQFGKVDDAMLMFDKTTNRHRGFGFVTFESEDIVEKV 140          
BLAST of RNA-binding protein Musashi vs. Ensembl Mouse
Match: Msi1 (musashi RNA-binding protein 1 [Source:MGI Symbol;Acc:MGI:107376])

HSP 1 Score: 164.466 bits (415), Expect = 4.315e-47
Identity = 84/165 (50.91%), Postives = 123/165 (74.55%), Query Frame = 2
Query:  425 ETLRNYFQNYGDIKDVMILKDPVTKRSRGFGFVTFIDYSTIEKILLNSPHFLDSXXXXXXXXXXXXXELIDKAINTEKTRKVFIGGLSNSTVHKDLEAFFGKYGKVESCELMMDKSTNRHRGFGFVIFEKEETADHICNIRYHEINSKMVEAKKALPKDVIMQTS 919
            E LR YF  +G++K+ ++++DP+TKRSRGFGFVTF+D + ++K+L  S H LDSK IDPK+A P++ +   K +   +T+K+F+GGLS +T  +D++ +F ++GKV+   LM DK+TNRHRGFGFV FE E+  + +C I +HEIN+KMVE KKA PK+V+  T 
Sbjct:    7 EGLREYFGQFGEVKECLVMRDPLTKRSRGFGFVTFMDQAGVDKVLAQSRHELDSKTIDPKVAFPRRAQ--PKMVT--RTKKIFVGGLSVNTTVEDVKHYFEQFGKVDDAMLMFDKTTNRHRGFGFVTFESEDIVEKVCEIHFHEINNKMVECKKAQPKEVMSPTG 167          

HSP 2 Score: 67.3958 bits (163), Expect = 3.681e-12
Identity = 30/68 (44.12%), Postives = 45/68 (66.18%), Query Frame = 2
Query:  353 EAEEKCHEVNKKLFIGGLSPHTTLETLRNYFQNYGDIKDVMILKDPVTKRSRGFGFVTFIDYSTIEKI 556
             A+ K     KK+F+GGLS +TT+E +++YF+ +G + D M++ D  T R RGFGFVTF     +EK+
Sbjct:   72 RAQPKMVTRTKKIFVGGLSVNTTVEDVKHYFEQFGKVDDAMLMFDKTTNRHRGFGFVTFESEDIVEKV 139          

HSP 3 Score: 60.077 bits (144), Expect = 1.197e-9
Identity = 26/67 (38.81%), Postives = 40/67 (59.70%), Query Frame = 2
Query:  698 VHKDLEAFFGKYGKVESCELMMDKSTNRHRGFGFVIFEKEETADHICNIRYHEINSKMVEAKKALPK 898
            V + L  +FG++G+V+ C +M D  T R RGFGFV F  +   D +     HE++SK ++ K A P+
Sbjct:    5 VTEGLREYFGQFGEVKECLVMRDPLTKRSRGFGFVTFMDQAGVDKVLAQSRHELDSKTIDPKVAFPR 71          
BLAST of RNA-binding protein Musashi vs. UniProt/SwissProt
Match: sp|O43347|MSI1H_HUMAN (RNA-binding protein Musashi homolog 1 OS=Homo sapiens OX=9606 GN=MSI1 PE=1 SV=1)

HSP 1 Score: 183.341 bits (464), Expect = 2.921e-52
Identity = 93/178 (52.25%), Postives = 133/178 (74.72%), Query Frame = 2
Query:  386 KLFIGGLSPHTTLETLRNYFQNYGDIKDVMILKDPVTKRSRGFGFVTFIDYSTIEKILLNSPHFLDSXXXXXXXXXXXXXELIDKAINTEKTRKVFIGGLSNSTVHKDLEAFFGKYGKVESCELMMDKSTNRHRGFGFVIFEKEETADHICNIRYHEINSKMVEAKKALPKDVIMQTS 919
            K+FIGGLS  TT E LR YF  +G++K+ ++++DP+TKRSRGFGFVTF+D + ++K+L  S H LDSK IDPK+A P++ +   K +   +T+K+F+GGLS +T  +D++ +F ++GKV+   LM DK+TNRHRGFGFV FE E+  + +C I +HEIN+KMVE KKA PK+V+  T 
Sbjct:   21 KMFIGGLSWQTTQEGLREYFGQFGEVKECLVMRDPLTKRSRGFGFVTFMDQAGVDKVLAQSRHELDSKTIDPKVAFPRRAQ--PKMVT--RTKKIFVGGLSVNTTVEDVKQYFEQFGKVDDAMLMFDKTTNRHRGFGFVTFESEDIVEKVCEIHFHEINNKMVECKKAQPKEVMSPTG 194          

HSP 2 Score: 67.781 bits (164), Expect = 4.459e-11
Identity = 30/68 (44.12%), Postives = 44/68 (64.71%), Query Frame = 2
Query:  353 EAEEKCHEVNKKLFIGGLSPHTTLETLRNYFQNYGDIKDVMILKDPVTKRSRGFGFVTFIDYSTIEKI 556
             A+ K     KK+F+GGLS +TT+E ++ YF+ +G + D M++ D  T R RGFGFVTF     +EK+
Sbjct:   99 RAQPKMVTRTKKIFVGGLSVNTTVEDVKQYFEQFGKVDDAMLMFDKTTNRHRGFGFVTFESEDIVEKV 166          
BLAST of RNA-binding protein Musashi vs. UniProt/SwissProt
Match: sp|Q920Q6|MSI2H_MOUSE (RNA-binding protein Musashi homolog 2 OS=Mus musculus OX=10090 GN=Msi2 PE=1 SV=1)

HSP 1 Score: 182.185 bits (461), Expect = 4.844e-52
Identity = 92/174 (52.87%), Postives = 133/174 (76.44%), Query Frame = 2
Query:  386 KLFIGGLSPHTTLETLRNYFQNYGDIKDVMILKDPVTKRSRGFGFVTFIDYSTIEKILLNSPHFLDSXXXXXXXXXXXXXELIDKAINTEKTRKVFIGGLSNSTVHKDLEAFFGKYGKVESCELMMDKSTNRHRGFGFVIFEKEETADHICNIRYHEINSKMVEAKKALPKDVI 907
            K+FIGGLS  T+ ++LR+YF  +G+I++ M+++DP TKRSRGFGFVTF D ++++K+L    H LDSK IDPK+A P++ +   K +   +T+K+F+GGLS +TV +D++ +F ++GKVE   LM DK+TNRHRGFGFV FE E+  + +C I +HEIN+KMVE KKA PK+V+
Sbjct:   22 KMFIGGLSWQTSPDSLRDYFSKFGEIRECMVMRDPTTKRSRGFGFVTFADPASVDKVLGQPHHELDSKTIDPKVAFPRRAQ--PKMVT--RTKKIFVGGLSANTVVEDVKQYFEQFGKVEDAMLMFDKTTNRHRGFGFVTFENEDVVEKVCEIHFHEINNKMVECKKAQPKEVM 191          

HSP 2 Score: 68.1662 bits (165), Expect = 2.843e-11
Identity = 29/68 (42.65%), Postives = 45/68 (66.18%), Query Frame = 2
Query:  353 EAEEKCHEVNKKLFIGGLSPHTTLETLRNYFQNYGDIKDVMILKDPVTKRSRGFGFVTFIDYSTIEKI 556
             A+ K     KK+F+GGLS +T +E ++ YF+ +G ++D M++ D  T R RGFGFVTF +   +EK+
Sbjct:  100 RAQPKMVTRTKKIFVGGLSANTVVEDVKQYFEQFGKVEDAMLMFDKTTNRHRGFGFVTFENEDVVEKV 167          
BLAST of RNA-binding protein Musashi vs. UniProt/SwissProt
Match: sp|Q8K3P4|MSI1H_RAT (RNA-binding protein Musashi homolog 1 OS=Rattus norvegicus OX=10116 GN=Msi1 PE=1 SV=1)

HSP 1 Score: 182.57 bits (462), Expect = 4.887e-52
Identity = 93/178 (52.25%), Postives = 133/178 (74.72%), Query Frame = 2
Query:  386 KLFIGGLSPHTTLETLRNYFQNYGDIKDVMILKDPVTKRSRGFGFVTFIDYSTIEKILLNSPHFLDSXXXXXXXXXXXXXELIDKAINTEKTRKVFIGGLSNSTVHKDLEAFFGKYGKVESCELMMDKSTNRHRGFGFVIFEKEETADHICNIRYHEINSKMVEAKKALPKDVIMQTS 919
            K+FIGGLS  TT E LR YF  +G++K+ ++++DP+TKRSRGFGFVTF+D + ++K+L  S H LDSK IDPK+A P++ +   K +   +T+K+F+GGLS +T  +D++ +F ++GKV+   LM DK+TNRHRGFGFV FE E+  + +C I +HEIN+KMVE KKA PK+V+  T 
Sbjct:   21 KMFIGGLSWQTTQEGLREYFGQFGEVKECLVMRDPLTKRSRGFGFVTFMDQAGVDKVLAQSRHELDSKTIDPKVAFPRRAQ--PKMVT--RTKKIFVGGLSVNTTVEDVKHYFEQFGKVDDAMLMFDKTTNRHRGFGFVTFESEDIVEKVCEIHFHEINNKMVECKKAQPKEVMSPTG 194          

HSP 2 Score: 68.1662 bits (165), Expect = 4.111e-11
Identity = 30/68 (44.12%), Postives = 45/68 (66.18%), Query Frame = 2
Query:  353 EAEEKCHEVNKKLFIGGLSPHTTLETLRNYFQNYGDIKDVMILKDPVTKRSRGFGFVTFIDYSTIEKI 556
             A+ K     KK+F+GGLS +TT+E +++YF+ +G + D M++ D  T R RGFGFVTF     +EK+
Sbjct:   99 RAQPKMVTRTKKIFVGGLSVNTTVEDVKHYFEQFGKVDDAMLMFDKTTNRHRGFGFVTFESEDIVEKV 166          
BLAST of RNA-binding protein Musashi vs. UniProt/SwissProt
Match: sp|Q61474|MSI1H_MOUSE (RNA-binding protein Musashi homolog 1 OS=Mus musculus OX=10090 GN=Msi1 PE=1 SV=1)

HSP 1 Score: 182.57 bits (462), Expect = 4.991e-52
Identity = 93/178 (52.25%), Postives = 133/178 (74.72%), Query Frame = 2
Query:  386 KLFIGGLSPHTTLETLRNYFQNYGDIKDVMILKDPVTKRSRGFGFVTFIDYSTIEKILLNSPHFLDSXXXXXXXXXXXXXELIDKAINTEKTRKVFIGGLSNSTVHKDLEAFFGKYGKVESCELMMDKSTNRHRGFGFVIFEKEETADHICNIRYHEINSKMVEAKKALPKDVIMQTS 919
            K+FIGGLS  TT E LR YF  +G++K+ ++++DP+TKRSRGFGFVTF+D + ++K+L  S H LDSK IDPK+A P++ +   K +   +T+K+F+GGLS +T  +D++ +F ++GKV+   LM DK+TNRHRGFGFV FE E+  + +C I +HEIN+KMVE KKA PK+V+  T 
Sbjct:   21 KMFIGGLSWQTTQEGLREYFGQFGEVKECLVMRDPLTKRSRGFGFVTFMDQAGVDKVLAQSRHELDSKTIDPKVAFPRRAQ--PKMVT--RTKKIFVGGLSVNTTVEDVKHYFEQFGKVDDAMLMFDKTTNRHRGFGFVTFESEDIVEKVCEIHFHEINNKMVECKKAQPKEVMSPTG 194          

HSP 2 Score: 68.1662 bits (165), Expect = 4.001e-11
Identity = 30/68 (44.12%), Postives = 45/68 (66.18%), Query Frame = 2
Query:  353 EAEEKCHEVNKKLFIGGLSPHTTLETLRNYFQNYGDIKDVMILKDPVTKRSRGFGFVTFIDYSTIEKI 556
             A+ K     KK+F+GGLS +TT+E +++YF+ +G + D M++ D  T R RGFGFVTF     +EK+
Sbjct:   99 RAQPKMVTRTKKIFVGGLSVNTTVEDVKHYFEQFGKVDDAMLMFDKTTNRHRGFGFVTFESEDIVEKV 166          
BLAST of RNA-binding protein Musashi vs. UniProt/SwissProt
Match: sp|Q96DH6|MSI2H_HUMAN (RNA-binding protein Musashi homolog 2 OS=Homo sapiens OX=9606 GN=MSI2 PE=1 SV=1)

HSP 1 Score: 181.03 bits (458), Expect = 7.168e-52
Identity = 92/174 (52.87%), Postives = 133/174 (76.44%), Query Frame = 2
Query:  386 KLFIGGLSPHTTLETLRNYFQNYGDIKDVMILKDPVTKRSRGFGFVTFIDYSTIEKILLNSPHFLDSXXXXXXXXXXXXXELIDKAINTEKTRKVFIGGLSNSTVHKDLEAFFGKYGKVESCELMMDKSTNRHRGFGFVIFEKEETADHICNIRYHEINSKMVEAKKALPKDVI 907
            K+FIGGLS  T+ ++LR+YF  +G+I++ M+++DP TKRSRGFGFVTF D ++++K+L    H LDSK IDPK+A P++ +   K +   +T+K+F+GGLS +TV +D++ +F ++GKVE   LM DK+TNRHRGFGFV FE E+  + +C I +HEIN+KMVE KKA PK+V+
Sbjct:   22 KMFIGGLSWQTSPDSLRDYFSKFGEIRECMVMRDPTTKRSRGFGFVTFADPASVDKVLGQPHHELDSKTIDPKVAFPRRAQ--PKMVT--RTKKIFVGGLSANTVVEDVKQYFEQFGKVEDAMLMFDKTTNRHRGFGFVTFENEDVVEKVCEIHFHEINNKMVECKKAQPKEVM 191          

HSP 2 Score: 68.1662 bits (165), Expect = 3.204e-11
Identity = 29/68 (42.65%), Postives = 45/68 (66.18%), Query Frame = 2
Query:  353 EAEEKCHEVNKKLFIGGLSPHTTLETLRNYFQNYGDIKDVMILKDPVTKRSRGFGFVTFIDYSTIEKI 556
             A+ K     KK+F+GGLS +T +E ++ YF+ +G ++D M++ D  T R RGFGFVTF +   +EK+
Sbjct:  100 RAQPKMVTRTKKIFVGGLSANTVVEDVKQYFEQFGKVEDAMLMFDKTTNRHRGFGFVTFENEDVVEKV 167          
BLAST of RNA-binding protein Musashi vs. TrEMBL
Match: B1Q3I7 (Musashi OS=Dugesia japonica OX=6161 GN=DjmlgA PE=2 SV=1)

HSP 1 Score: 539.65 bits (1389), Expect = 0.000e+0
Identity = 272/327 (83.18%), Postives = 301/327 (92.05%), Query Frame = 2
Query:  335 MDRSFSEAEEKCHEVNKKLFIGGLSPHTTLETLRNYFQNYGDIKDVMILKDPVTKRSRGFGFVTFIDYSTIEKILLNSPHFLDSXXXXXXXXXXXXXELIDKAINTEKTRKVFIGGLSNSTVHKDLEAFFGKYGKVESCELMMDKSTNRHRGFGFVIFEKEETADHICNIRYHEINSKMVEAKKALPKDVIMQTSYSNKPKQQITKSFPNPLNSKSKKLAADGFSYVPAINPPQLLSTQFNAFCLSGYLIPSNIGQNNYYFPNANENGFV-SCLSSPLPIYLVQNYSHESIGQTYSYKNNEALFVINPQKSEQFNIQPYQTYMVNAV 1312
            M+  F E EEK HE NKKLFIGGLSP+TTLETLRNYFQNYGDIKDVMILKDPVTKRSRGFGFVTFI+YSTIEKILLNSPHFLDSKKIDPKIAIPKKP+L+DK+INTEKTRKVFIGGLSN+TVHKDLEAFFGKYGK+ESCELMMDKSTNRHRGFGFV+FEKEE A+HICNIRYHEINSKMVEAKKALPKD+IMQT+YSNKPKQQI+KS   P+N KSKKL  +G +Y P IN PQLL+TQFNAFCLSGYL+PSNIGQNNYYFPN+ +NG++ +C+SSPLPIYL+QNY HES GQTYSYKNNEA++VINPQ SEQFN+ PYQ  +VN V
Sbjct:    1 MNHGFEETEEKYHETNKKLFIGGLSPNTTLETLRNYFQNYGDIKDVMILKDPVTKRSRGFGFVTFIEYSTIEKILLNSPHFLDSKKIDPKIAIPKKPDLVDKSINTEKTRKVFIGGLSNNTVHKDLEAFFGKYGKIESCELMMDKSTNRHRGFGFVMFEKEEIANHICNIRYHEINSKMVEAKKALPKDLIMQTTYSNKPKQQISKSLSTPVNQKSKKLIPNGINYHPPINAPQLLTTQFNAFCLSGYLVPSNIGQNNYYFPNSTDNGYMRNCISSPLPIYLIQNYLHESFGQTYSYKNNEAMYVINPQMSEQFNLSPYQPCVVNPV 327          
BLAST of RNA-binding protein Musashi vs. TrEMBL
Match: A0A3R7JHP3 (RNA-binding protein Musashi-like protein 1 (Fragment) OS=Clonorchis sinensis OX=79923 GN=MSI1 PE=4 SV=1)

HSP 1 Score: 213.772 bits (543), Expect = 9.897e-63
Identity = 106/174 (60.92%), Postives = 144/174 (82.76%), Query Frame = 2
Query:  386 KLFIGGLSPHTTLETLRNYFQNYGDIKDVMILKDPVTKRSRGFGFVTFIDYSTIEKILLNSPHFLDSXXXXXXXXXXXXXELIDKAINTEKTRKVFIGGLSNSTVHKDLEAFFGKYGKVESCELMMDKSTNRHRGFGFVIFEKEETADHICNIRYHEINSKMVEAKKALPKDVI 907
            K+FIGGLSP TT + LR YFQ +G++K+ MI++DP+TKRSRGFGFVTF D   +EK+L ++PHFLDSKKIDPK+A+P+KP     A  T +T++VFIGG++  T +++L  +F +YGK+ESCELMMDK+TNRHRGFGFV FE EETA+ +C I +H++++KMVEAKKA+PK+V+
Sbjct:    1 KMFIGGLSPTTTADKLREYFQRFGEVKECMIMRDPLTKRSRGFGFVTFCDSVCVEKVLESAPHFLDSKKIDPKLAVPRKPG--QNAKLTTRTKRVFIGGVATQTTNEELSEYFSQYGKIESCELMMDKATNRHRGFGFVTFESEETAEKVCEIHFHDLHNKMVEAKKAVPKEVM 172          

HSP 2 Score: 61.2326 bits (147), Expect = 1.089e-6
Identity = 35/99 (35.35%), Postives = 49/99 (49.49%), Query Frame = 2
Query:  380 NKKLFIGGLSPHTTLETLRNYFQNYGDIKDVMILKDPVTKRSRGFGFVTFIDYSTIEKILLNSPHFLDSXXXXXXXXXXXXXELIDKAINTEKTRKVFI 676
             K++FIGG++  TT E L  YF  YG I+   ++ D  T R RGFGFVTF    T EK+     HF D      +       E++  + +  K R  F+
Sbjct:   90 TKRVFIGGVATQTTNEELSEYFSQYGKIESCELMMDKATNRHRGFGFVTFESEETAEKVC--EIHFHDLHNKMVEAKKAVPKEVMSSSNSLLKQRSPFL 186          
BLAST of RNA-binding protein Musashi vs. TrEMBL
Match: A0A267DHL6 (Uncharacterized protein OS=Macrostomum lignano OX=282301 GN=BOX15_Mlig024791g2 PE=4 SV=1)

HSP 1 Score: 215.698 bits (548), Expect = 1.466e-62
Identity = 109/175 (62.29%), Postives = 146/175 (83.43%), Query Frame = 2
Query:  386 KLFIGGLSPHTTLETLRNYFQNYGDIKDVMILKDPVTKRSRGFGFVTFIDYSTIEKILLNSPHFLDSXXXXXXXXXXXXXELIDKAINTEKTRKVFIGGLSNSTVHKDLEAFFGKYGKVESCELMMDKSTNRHRGFGFVIFEKEETADHICNIRYHEINSKMVEAKKALPKDVIM 910
            K+FIGGLSP T  E L  YF  +G+IK+ MI+KDP++KRSRGFGFVTF + S+++++L ++PHFL+SKKIDPK+A+P+KP    K +  +KT+KVF+GG+SN+T  ++L+ +F KYGK+ESCELMMDK+TNRHRGFGFV FE EE+AD +C I +HE+NSKMVE KKALPK+V+M
Sbjct:   26 KMFIGGLSPTTAPEVLHQYFAKFGEIKEYMIMKDPISKRSRGFGFVTFSEPSSVDRVLESAPHFLESKKIDPKVAVPRKPGQGAKQL--QKTKKVFVGGISNNTTAEELKEYFCKYGKIESCELMMDKTTNRHRGFGFVTFEMEESADKVCEIHFHELNSKMVECKKALPKEVMM 198          
BLAST of RNA-binding protein Musashi vs. TrEMBL
Match: A0A267F8T8 (Uncharacterized protein OS=Macrostomum lignano OX=282301 GN=BOX15_Mlig024791g1 PE=4 SV=1)

HSP 1 Score: 215.698 bits (548), Expect = 1.466e-62
Identity = 109/175 (62.29%), Postives = 146/175 (83.43%), Query Frame = 2
Query:  386 KLFIGGLSPHTTLETLRNYFQNYGDIKDVMILKDPVTKRSRGFGFVTFIDYSTIEKILLNSPHFLDSXXXXXXXXXXXXXELIDKAINTEKTRKVFIGGLSNSTVHKDLEAFFGKYGKVESCELMMDKSTNRHRGFGFVIFEKEETADHICNIRYHEINSKMVEAKKALPKDVIM 910
            K+FIGGLSP T  E L  YF  +G+IK+ MI+KDP++KRSRGFGFVTF + S+++++L ++PHFL+SKKIDPK+A+P+KP    K +  +KT+KVF+GG+SN+T  ++L+ +F KYGK+ESCELMMDK+TNRHRGFGFV FE EE+AD +C I +HE+NSKMVE KKALPK+V+M
Sbjct:   26 KMFIGGLSPTTAPEVLHQYFAKFGEIKEYMIMKDPISKRSRGFGFVTFSEPSSVDRVLESAPHFLESKKIDPKVAVPRKPGQGAKQL--QKTKKVFVGGISNNTTAEELKEYFCKYGKIESCELMMDKTTNRHRGFGFVTFEMEESADKVCEIHFHELNSKMVECKKALPKEVMM 198          
BLAST of RNA-binding protein Musashi vs. TrEMBL
Match: A0A074Z637 (Uncharacterized protein OS=Opisthorchis viverrini OX=6198 GN=T265_09341 PE=4 SV=1)

HSP 1 Score: 214.927 bits (546), Expect = 1.322e-61
Identity = 106/174 (60.92%), Postives = 144/174 (82.76%), Query Frame = 2
Query:  386 KLFIGGLSPHTTLETLRNYFQNYGDIKDVMILKDPVTKRSRGFGFVTFIDYSTIEKILLNSPHFLDSXXXXXXXXXXXXXELIDKAINTEKTRKVFIGGLSNSTVHKDLEAFFGKYGKVESCELMMDKSTNRHRGFGFVIFEKEETADHICNIRYHEINSKMVEAKKALPKDVI 907
            K+FIGGLSP TT + LR YFQ +G++K+ MI++DP+TKRSRGFGFVTF D   +EK+L ++PHFLDSKKIDPK+A+P+KP     A  T +T++VFIGG++  T +++L  +F +YGK+ESCELMMDK+TNRHRGFGFV FE EETA+ +C I +H++++KMVEAKKA+PK+V+
Sbjct:   80 KMFIGGLSPTTTADKLREYFQRFGEVKECMIMRDPLTKRSRGFGFVTFCDSVCVEKVLESAPHFLDSKKIDPKLAVPRKPG--QNAKLTTRTKRVFIGGVATQTTNEELSEYFSQYGKIESCELMMDKTTNRHRGFGFVTFESEETAEKVCEIHFHDLHNKMVEAKKAVPKEVM 251          

HSP 2 Score: 66.6254 bits (161), Expect = 3.472e-8
Identity = 30/89 (33.71%), Postives = 51/89 (57.30%), Query Frame = 2
Query:  632 IDKAINTEKTRKVFIGGLSNSTVHKDLEAFFGKYGKVESCELMMDKSTNRHRGFGFVIFEKEETADHICNIRYHEINSKMVEAKKALPK 898
            ++  +++    K+FIGGLS +T    L  +F ++G+V+ C +M D  T R RGFGFV F      + +     H ++SK ++ K A+P+
Sbjct:   69 MENGVDSNDPGKMFIGGLSPTTTADKLREYFQRFGEVKECMIMRDPLTKRSRGFGFVTFCDSVCVEKVLESAPHFLDSKKIDPKLAVPR 157          

HSP 3 Score: 61.6178 bits (148), Expect = 1.773e-6
Identity = 35/99 (35.35%), Postives = 49/99 (49.49%), Query Frame = 2
Query:  380 NKKLFIGGLSPHTTLETLRNYFQNYGDIKDVMILKDPVTKRSRGFGFVTFIDYSTIEKILLNSPHFLDSXXXXXXXXXXXXXELIDKAINTEKTRKVFI 676
             K++FIGG++  TT E L  YF  YG I+   ++ D  T R RGFGFVTF    T EK+     HF D      +       E++  + +  K R  F+
Sbjct:  169 TKRVFIGGVATQTTNEELSEYFSQYGKIESCELMMDKTTNRHRGFGFVTFESEETAEKVC--EIHFHDLHNKMVEAKKAVPKEVMSSSNSLLKQRSPFL 265          
BLAST of RNA-binding protein Musashi vs. Ensembl Cavefish
Match: msi2b (RNA-binding protein Musashi homolog 2 [Source:NCBI gene;Acc:103023867])

HSP 1 Score: 182.185 bits (461), Expect = 1.455e-53
Identity = 92/174 (52.87%), Postives = 133/174 (76.44%), Query Frame = 2
Query:  386 KLFIGGLSPHTTLETLRNYFQNYGDIKDVMILKDPVTKRSRGFGFVTFIDYSTIEKILLNSPHFLDSXXXXXXXXXXXXXELIDKAINTEKTRKVFIGGLSNSTVHKDLEAFFGKYGKVESCELMMDKSTNRHRGFGFVIFEKEETADHICNIRYHEINSKMVEAKKALPKDVI 907
            K+FIGGLS  T+ ++LR+YF  +G+I++ M+++DP TKRSRGFGFVTF D ++++K+L    H LDSK IDPK+A P++ +   K +   +T+K+F+GGLS +TV +D++ +F ++GKVE   LM DK+TNRHRGFGFV FE E+  + +C I +HEIN+KMVE KKA PK+V+
Sbjct:   18 KMFIGGLSWQTSPDSLRDYFSKFGEIRECMVMRDPTTKRSRGFGFVTFADAASVDKVLGQPHHELDSKTIDPKVAFPRRAQ--PKMVT--RTKKIFVGGLSANTVVEDVKQYFEQFGKVEDAMLMFDKTTNRHRGFGFVTFENEDVVEKVCEIHFHEINNKMVECKKAQPKEVM 187          

HSP 2 Score: 68.1662 bits (165), Expect = 2.453e-12
Identity = 29/68 (42.65%), Postives = 45/68 (66.18%), Query Frame = 2
Query:  353 EAEEKCHEVNKKLFIGGLSPHTTLETLRNYFQNYGDIKDVMILKDPVTKRSRGFGFVTFIDYSTIEKI 556
             A+ K     KK+F+GGLS +T +E ++ YF+ +G ++D M++ D  T R RGFGFVTF +   +EK+
Sbjct:   96 RAQPKMVTRTKKIFVGGLSANTVVEDVKQYFEQFGKVEDAMLMFDKTTNRHRGFGFVTFENEDVVEKV 163          
BLAST of RNA-binding protein Musashi vs. Ensembl Cavefish
Match: msi2a (RNA-binding protein Musashi homolog 2-like [Source:NCBI gene;Acc:103045937])

HSP 1 Score: 182.956 bits (463), Expect = 1.614e-53
Identity = 92/174 (52.87%), Postives = 133/174 (76.44%), Query Frame = 2
Query:  386 KLFIGGLSPHTTLETLRNYFQNYGDIKDVMILKDPVTKRSRGFGFVTFIDYSTIEKILLNSPHFLDSXXXXXXXXXXXXXELIDKAINTEKTRKVFIGGLSNSTVHKDLEAFFGKYGKVESCELMMDKSTNRHRGFGFVIFEKEETADHICNIRYHEINSKMVEAKKALPKDVI 907
            K+FIGGLS  T+ ++LR+YF  +G+I++ M+++DP TKRSRGFGFVTF D ++++K+L    H LDSK IDPK+A P++ +   K +   +T+K+F+GGLS +TV +D++ +F ++GKVE   LM DK+TNRHRGFGFV FE E+  + +C I +HEIN+KMVE KKA PK+V+
Sbjct:   22 KMFIGGLSWQTSPDSLRDYFSKFGEIRECMVMRDPTTKRSRGFGFVTFADAASVDKVLAQPHHELDSKTIDPKVAFPRRAQ--PKMVT--RTKKIFVGGLSANTVVEDVKQYFEQFGKVEDAMLMFDKTTNRHRGFGFVTFENEDVVEKVCEIHFHEINNKMVECKKAQPKEVM 191          

HSP 2 Score: 68.1662 bits (165), Expect = 3.494e-12
Identity = 29/68 (42.65%), Postives = 45/68 (66.18%), Query Frame = 2
Query:  353 EAEEKCHEVNKKLFIGGLSPHTTLETLRNYFQNYGDIKDVMILKDPVTKRSRGFGFVTFIDYSTIEKI 556
             A+ K     KK+F+GGLS +T +E ++ YF+ +G ++D M++ D  T R RGFGFVTF +   +EK+
Sbjct:  100 RAQPKMVTRTKKIFVGGLSANTVVEDVKQYFEQFGKVEDAMLMFDKTTNRHRGFGFVTFENEDVVEKV 167          
BLAST of RNA-binding protein Musashi vs. Ensembl Cavefish
Match: msi2b (RNA-binding protein Musashi homolog 2 [Source:NCBI gene;Acc:103023867])

HSP 1 Score: 182.185 bits (461), Expect = 2.773e-53
Identity = 92/174 (52.87%), Postives = 133/174 (76.44%), Query Frame = 2
Query:  386 KLFIGGLSPHTTLETLRNYFQNYGDIKDVMILKDPVTKRSRGFGFVTFIDYSTIEKILLNSPHFLDSXXXXXXXXXXXXXELIDKAINTEKTRKVFIGGLSNSTVHKDLEAFFGKYGKVESCELMMDKSTNRHRGFGFVIFEKEETADHICNIRYHEINSKMVEAKKALPKDVI 907
            K+FIGGLS  T+ ++LR+YF  +G+I++ M+++DP TKRSRGFGFVTF D ++++K+L    H LDSK IDPK+A P++ +   K +   +T+K+F+GGLS +TV +D++ +F ++GKVE   LM DK+TNRHRGFGFV FE E+  + +C I +HEIN+KMVE KKA PK+V+
Sbjct:   18 KMFIGGLSWQTSPDSLRDYFSKFGEIRECMVMRDPTTKRSRGFGFVTFADAASVDKVLGQPHHELDSKTIDPKVAFPRRAQ--PKMVT--RTKKIFVGGLSANTVVEDVKQYFEQFGKVEDAMLMFDKTTNRHRGFGFVTFENEDVVEKVCEIHFHEINNKMVECKKAQPKEVM 187          

HSP 2 Score: 68.1662 bits (165), Expect = 3.126e-12
Identity = 29/68 (42.65%), Postives = 45/68 (66.18%), Query Frame = 2
Query:  353 EAEEKCHEVNKKLFIGGLSPHTTLETLRNYFQNYGDIKDVMILKDPVTKRSRGFGFVTFIDYSTIEKI 556
             A+ K     KK+F+GGLS +T +E ++ YF+ +G ++D M++ D  T R RGFGFVTF +   +EK+
Sbjct:   96 RAQPKMVTRTKKIFVGGLSANTVVEDVKQYFEQFGKVEDAMLMFDKTTNRHRGFGFVTFENEDVVEKV 163          
BLAST of RNA-binding protein Musashi vs. Ensembl Cavefish
Match: msi2a (RNA-binding protein Musashi homolog 2-like [Source:NCBI gene;Acc:103045937])

HSP 1 Score: 183.726 bits (465), Expect = 3.902e-53
Identity = 92/174 (52.87%), Postives = 133/174 (76.44%), Query Frame = 2
Query:  386 KLFIGGLSPHTTLETLRNYFQNYGDIKDVMILKDPVTKRSRGFGFVTFIDYSTIEKILLNSPHFLDSXXXXXXXXXXXXXELIDKAINTEKTRKVFIGGLSNSTVHKDLEAFFGKYGKVESCELMMDKSTNRHRGFGFVIFEKEETADHICNIRYHEINSKMVEAKKALPKDVI 907
            K+FIGGLS  T+ ++LR+YF  +G+I++ M+++DP TKRSRGFGFVTF D ++++K+L    H LDSK IDPK+A P++ +   K +   +T+K+F+GGLS +TV +D++ +F ++GKVE   LM DK+TNRHRGFGFV FE E+  + +C I +HEIN+KMVE KKA PK+V+
Sbjct:   22 KMFIGGLSWQTSPDSLRDYFSKFGEIRECMVMRDPTTKRSRGFGFVTFADAASVDKVLAQPHHELDSKTIDPKVAFPRRAQ--PKMVT--RTKKIFVGGLSANTVVEDVKQYFEQFGKVEDAMLMFDKTTNRHRGFGFVTFENEDVVEKVCEIHFHEINNKMVECKKAQPKEVM 191          

HSP 2 Score: 68.1662 bits (165), Expect = 4.151e-12
Identity = 29/68 (42.65%), Postives = 45/68 (66.18%), Query Frame = 2
Query:  353 EAEEKCHEVNKKLFIGGLSPHTTLETLRNYFQNYGDIKDVMILKDPVTKRSRGFGFVTFIDYSTIEKI 556
             A+ K     KK+F+GGLS +T +E ++ YF+ +G ++D M++ D  T R RGFGFVTF +   +EK+
Sbjct:  100 RAQPKMVTRTKKIFVGGLSANTVVEDVKQYFEQFGKVEDAMLMFDKTTNRHRGFGFVTFENEDVVEKV 167          
BLAST of RNA-binding protein Musashi vs. Ensembl Cavefish
Match: msi2a (RNA-binding protein Musashi homolog 2-like [Source:NCBI gene;Acc:103045937])

HSP 1 Score: 183.726 bits (465), Expect = 4.288e-53
Identity = 92/174 (52.87%), Postives = 133/174 (76.44%), Query Frame = 2
Query:  386 KLFIGGLSPHTTLETLRNYFQNYGDIKDVMILKDPVTKRSRGFGFVTFIDYSTIEKILLNSPHFLDSXXXXXXXXXXXXXELIDKAINTEKTRKVFIGGLSNSTVHKDLEAFFGKYGKVESCELMMDKSTNRHRGFGFVIFEKEETADHICNIRYHEINSKMVEAKKALPKDVI 907
            K+FIGGLS  T+ ++LR+YF  +G+I++ M+++DP TKRSRGFGFVTF D ++++K+L    H LDSK IDPK+A P++ +   K +   +T+K+F+GGLS +TV +D++ +F ++GKVE   LM DK+TNRHRGFGFV FE E+  + +C I +HEIN+KMVE KKA PK+V+
Sbjct:   22 KMFIGGLSWQTSPDSLRDYFSKFGEIRECMVMRDPTTKRSRGFGFVTFADAASVDKVLAQPHHELDSKTIDPKVAFPRRAQ--PKMVT--RTKKIFVGGLSANTVVEDVKQYFEQFGKVEDAMLMFDKTTNRHRGFGFVTFENEDVVEKVCEIHFHEINNKMVECKKAQPKEVM 191          

HSP 2 Score: 68.1662 bits (165), Expect = 4.500e-12
Identity = 29/68 (42.65%), Postives = 45/68 (66.18%), Query Frame = 2
Query:  353 EAEEKCHEVNKKLFIGGLSPHTTLETLRNYFQNYGDIKDVMILKDPVTKRSRGFGFVTFIDYSTIEKI 556
             A+ K     KK+F+GGLS +T +E ++ YF+ +G ++D M++ D  T R RGFGFVTF +   +EK+
Sbjct:  100 RAQPKMVTRTKKIFVGGLSANTVVEDVKQYFEQFGKVEDAMLMFDKTTNRHRGFGFVTFENEDVVEKV 167          
BLAST of RNA-binding protein Musashi vs. Ensembl Sea Lamprey
Match: HNRNPA0 (heterogeneous nuclear ribonucleoprotein A0 [Source:HGNC Symbol;Acc:HGNC:5030])

HSP 1 Score: 138.272 bits (347), Expect = 1.148e-38
Identity = 72/175 (41.14%), Postives = 109/175 (62.29%), Query Frame = 2
Query:  374 EVNKKLFIGGLSPHTTLETLRNYFQNYGDIKDVMILKDPVTKRSRGFGFVTFIDYSTIEKILLNSPHFLDSXXXXXXXXXXXXXELIDKAINTEKTRKVFIGGLSNSTVHKDLEAFFGKYGKVESCELMMDKSTNRHRGFGFVIFEKEETADHICNIRYHEINSKMVEAKKALPK 898
            E  +KLFIGGLS  TT +++R +F+ +G + D ++++DP TKRSRGFGFVT+     ++  +   PH LD++ ++ K AI ++  L  K     K +K+F+GG+ + T  + L  +F  YG VE+ E+M D+ST + RGFGFV F   +T D +   +YH IN    E +KAL K
Sbjct:    6 EQQRKLFIGGLSFETTEDSMRKHFEQWGTLTDCVVMRDPHTKRSRGFGFVTYTCPEEVDAAMDARPHHLDNRVVEAKRAISREDSL--KPGAHLKVKKIFVGGIRDDTDEQHLREYFQVYGDVEAAEVMEDRSTGKKRGFGFVTFSDHDTVDKVIVQKYHTINGHKAEVRKALSK 178          

HSP 2 Score: 68.9366 bits (167), Expect = 8.943e-14
Identity = 32/83 (38.55%), Postives = 50/83 (60.24%), Query Frame = 2
Query:  653 EKTRKVFIGGLSNSTVHKDLEAFFGKYGKVESCELMMDKSTNRHRGFGFVIFEKEETADHICNIRYHEINSKMVEAKKALPKD 901
            E+ RK+FIGGLS  T    +   F ++G +  C +M D  T R RGFGFV +   E  D   + R H +++++VEAK+A+ ++
Sbjct:    6 EQQRKLFIGGLSFETTEDSMRKHFEQWGTLTDCVVMRDPHTKRSRGFGFVTYTCPEEVDAAMDARPHHLDNRVVEAKRAISRE 88          
BLAST of RNA-binding protein Musashi vs. Ensembl Sea Lamprey
Match: HNRNPA0 (heterogeneous nuclear ribonucleoprotein A0 [Source:HGNC Symbol;Acc:HGNC:5030])

HSP 1 Score: 137.502 bits (345), Expect = 9.039e-37
Identity = 72/189 (38.10%), Postives = 113/189 (59.79%), Query Frame = 2
Query:  374 EVNKKLFIGGLSPHTTLETLRNYFQNYGDIKDVMILKDPVTKRSRGFGFVTFIDYSTIEKILLNSPHFLDSXXXXXXXXXXXXXELIDKAINTEKTRKVFIGGLSNSTVHKDLEAFFGKYGKVESCELMMDKSTNRHRGFGFVIFEKEETADHICNIRYHEINSKMVEAKKALPKDVIMQTSYSNKPKQ 940
            E  +KLFIGGLS  TT E+++ +F+ +G + D ++++DP TKRSRGFGFVT++    ++  +   PH LD + ++ K AI ++  L  K     K +K+F+GG+ ++T    L  +F +YG VES ++M D+ + + RGFGFV F   +  D +   +YH IN    E +KAL K  +   S    P+Q
Sbjct:   30 EQQRKLFIGGLSFETTEESMQKHFEQWGTLTDCVVMRDPHTKRSRGFGFVTYMSAEEVDAAMEVRPHHLDGRVVEAKRAISREDSL--KPGAHLKVKKIFVGGIKDNTDEDHLRDYFSEYGMVESVDVMEDRQSGKKRGFGFVTFSDHDAVDKVVVQKYHTINGHKAEVRKALSKQEM--NSLGGDPRQ 214          
BLAST of RNA-binding protein Musashi vs. Ensembl Sea Lamprey
Match: ENSPMAT00000004893.1 (pep scaffold:Pmarinus_7.0:GL479484:4:2056:-1 gene:ENSPMAG00000004449.1 transcript:ENSPMAT00000004893.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 130.183 bits (326), Expect = 1.895e-35
Identity = 68/172 (39.53%), Postives = 106/172 (61.63%), Query Frame = 2
Query:  383 KKLFIGGLSPHTTLETLRNYFQNYGDIKDVMILKDPVTKRSRGFGFVTFIDYSTIEKILLNSPHFLDSXXXXXXXXXXXXXELIDKAINTEKTRKVFIGGLSNSTVHKDLEAFFGKYGKVESCELMMDKSTNRHRGFGFVIFEKEETADHICNIRYHEINSKMVEAKKALPK 898
            +KLF+GGLS  TT E LR YF+ +G + D +++KD  +KRSRGFGFVTF   S ++  +   PH +D + ++PK A+ ++  +   A  +   +K+F+GG+ + T  + L  +F KYG++E  E+M ++ + + RGF FV F   +  D I   +YH IN    E +KALPK
Sbjct:   11 RKLFVGGLSFETTEEGLRQYFEQWGSLTDCVVMKDTQSKRSRGFGFVTFSSMSEVDAAMSARPHKIDGRMVEPKRAVSREDSMRPGAHLS--VKKIFVGGIKDDTDEEHLRDYFEKYGRIEIVEVMTERESGKKRGFAFVTFNDHDPVDKIVVQKYHTINGHNCEIRKALPK 180          

HSP 2 Score: 71.2478 bits (173), Expect = 1.856e-14
Identity = 33/87 (37.93%), Postives = 52/87 (59.77%), Query Frame = 2
Query:  653 EKTRKVFIGGLSNSTVHKDLEAFFGKYGKVESCELMMDKSTNRHRGFGFVIFEKEETADHICNIRYHEINSKMVEAKKALPKDVIMQ 913
            E+ RK+F+GGLS  T  + L  +F ++G +  C +M D  + R RGFGFV F      D   + R H+I+ +MVE K+A+ ++  M+
Sbjct:    8 EQFRKLFVGGLSFETTEEGLRQYFEQWGSLTDCVVMKDTQSKRSRGFGFVTFSSMSEVDAAMSARPHKIDGRMVEPKRAVSREDSMR 94          
BLAST of RNA-binding protein Musashi vs. Ensembl Sea Lamprey
Match: HNRNPA2B1 (heterogeneous nuclear ribonucleoprotein A2/B1 [Source:HGNC Symbol;Acc:HGNC:5033])

HSP 1 Score: 127.102 bits (318), Expect = 3.787e-34
Identity = 66/183 (36.07%), Postives = 106/183 (57.92%), Query Frame = 2
Query:  374 EVNKKLFIGGLSPHTTLETLRNYFQNYGDIKDVMILKDPVTKRSRGFGFVTFIDYSTIEKILLNSPHFLDSXXXXXXXXXXXXXELIDKAINTEKTR--------KVFIGGLSNSTVHKDLEAFFGKYGKVESCELMMDKSTNRHRGFGFVIFEKEETADHICNIRYHEINSKMVEAKKALPK 898
            E  +KLFIGGLS  TT E+LR Y++ +G I D +++KDP +KRSRGFGF+T+     +   +   PH +D + ++ K           +A+  + +R        K+F+GG+ ++T    L  +F K+G+VES +++ DK T + RGF FV F+  +  D I   ++H IN   +E +KAL +
Sbjct:   11 EQMRKLFIGGLSFETTEESLREYYEQWGTIVDCVVMKDPSSKRSRGFGFITYSVMEEVNSAMQARPHTVDGRVVEAK-----------RAVPRDDSRPGIQVTVKKLFVGGIKDNTDESHLRDYFSKFGRVESVDMVTDKQTGKKRGFAFVTFDDYDPVDQIVFQKFHTINCHKLEVRKALSR 182          

HSP 2 Score: 75.0998 bits (183), Expect = 1.285e-15
Identity = 35/99 (35.35%), Postives = 58/99 (58.59%), Query Frame = 2
Query:  653 EKTRKVFIGGLSNSTVHKDLEAFFGKYGKVESCELMMDKSTNRHRGFGFVIFEKEETADHICNIRYHEINSKMVEAKKALPKDVIMQTSYSNKPKQQIT 949
            E+ RK+FIGGLS  T  + L  ++ ++G +  C +M D S+ R RGFGF+ +   E  +     R H ++ ++VEAK+A+P+D        ++P  Q+T
Sbjct:   11 EQMRKLFIGGLSFETTEESLREYYEQWGTIVDCVVMKDPSSKRSRGFGFITYSVMEEVNSAMQARPHTVDGRVVEAKRAVPRD-------DSRPGIQVT 102          
BLAST of RNA-binding protein Musashi vs. Ensembl Sea Lamprey
Match: RBM39 (RNA binding motif protein 39 [Source:HGNC Symbol;Acc:HGNC:15923])

HSP 1 Score: 72.4034 bits (176), Expect = 6.247e-14
Identity = 39/155 (25.16%), Postives = 73/155 (47.10%), Query Frame = 2
Query:  383 KKLFIGGLSPHTTLETLRNYFQNYGDIKDVMILKDPVTKRSRGFGFVTFIDYSTIE-------KILLNSPHFLDSXXXXXXXXXXXXXELIDKAINTEKTRKVFIGGLSNSTVHKDLEAFFGKYGKVESCELMMDKSTNRHRGFGFVIFEKEETA 826
            + +F   L+       L  +F   G ++DV ++ D  ++RS+G  ++ F++  ++        + LL  P  + + + +   A            +T    ++++G L  +     L+  F  +GK+E+C+LMMD  T R RG+GFV F   E A
Sbjct:  159 RTVFCMQLAARIRPRDLEEFFSAVGKVRDVRMISDRNSRRSKGIAYIEFVEVDSVSLAIGLTGQRLLGVPIIVQASQAEKNRAAAAAAAAATMQKSTAGPMRLYVGSLHFNITEDMLKGIFEPFGKIENCQLMMDSDTGRSRGYGFVTFADAECA 313          

HSP 2 Score: 48.9062 bits (115), Expect = 1.653e-6
Identity = 22/58 (37.93%), Postives = 35/58 (60.34%), Query Frame = 2
Query:  386 KLFIGGLSPHTTLETLRNYFQNYGDIKDVMILKDPVTKRSRGFGFVTFIDYSTIEKIL 559
            +L++G L  + T + L+  F+ +G I++  ++ D  T RSRG+GFVTF D     K L
Sbjct:  260 RLYVGSLHFNITEDMLKGIFEPFGKIENCQLMMDSDTGRSRGYGFVTFADAECARKAL 317          
BLAST of RNA-binding protein Musashi vs. Ensembl Yeast
Match: HRP1 (Subunit of cleavage factor I; cleavage factor I is a five-subunit complex required for the cleavage and polyadenylation of pre-mRNA 3' ends; RRM-containing heteronuclear RNA binding protein and hnRNPA/B family member that binds to poly (A) signal sequences; required for genome stability [Source:SGD;Acc:S000005483])

HSP 1 Score: 131.339 bits (329), Expect = 9.680e-34
Identity = 67/193 (34.72%), Postives = 112/193 (58.03%), Query Frame = 2
Query:  356 AEEKCHEVNKKLFIGGLSPHTTLETLRNYFQNYGDIKDVMILKDPVTKRSRGFGFVTFIDYSTIEKILLNSPHFLDSXXXXXXXXXXXXXELID--KAI---NTEKTRKVFIGGLSNSTVHKDLEAFFGKYGKVESCELMMDKSTNRHRGFGFVIFEKEETADHICNIRYHEINSKMVEAKKALPKDVIMQTS 919
            ++E C     K+FIGGL+  TT + LR YF  YG + D+ I+KDP T RSRGFGF++F   S++++++  + H LD              ++ID  +AI     +KT K+F+GG+      K+ E FF ++G +   +LM+DK T + RGFGFV ++  +  D +C  ++ +   + +E K+A P+ +  ++S
Sbjct:  155 SKESC-----KMFIGGLNWDTTEDNLREYFGKYGTVTDLKIMKDPATGRSRGFGFLSFEKPSSVDEVV-KTQHILDG-------------KVIDPKRAIPRDEQDKTGKIFVGGIGPDVRPKEFEEFFSQWGTIIDAQLMLDKDTGQSRGFGFVTYDSADAVDRVCQNKFIDFKDRKIEIKRAEPRHMQQKSS 328          

HSP 2 Score: 76.6406 bits (187), Expect = 1.539e-15
Identity = 35/88 (39.77%), Postives = 58/88 (65.91%), Query Frame = 2
Query:  638 KAINTEKTRKVFIGGLSNSTVHKDLEAFFGKYGKVESCELMMDKSTNRHRGFGFVIFEKEETADHICNIRYHEINSKMVEAKKALPKD 901
            KA  ++++ K+FIGGL+  T   +L  +FGKYG V   ++M D +T R RGFGF+ FEK  + D +   + H ++ K+++ K+A+P+D
Sbjct:  151 KADLSKESCKMFIGGLNWDTTEDNLREYFGKYGTVTDLKIMKDPATGRSRGFGFLSFEKPSSVDEVVKTQ-HILDGKVIDPKRAIPRD 237          
BLAST of RNA-binding protein Musashi vs. Ensembl Yeast
Match: NSR1 (Nucleolar protein that binds nuclear localization sequences; required for pre-rRNA processing and ribosome biogenesis; binds to single stranded telomeric DNA and mRNA; methylated by Hmt1p; interaction with Top1p and nucleolar localization are negatively regulated by polyphosphorylation [Source:SGD;Acc:S000003391])

HSP 1 Score: 51.2174 bits (121), Expect = 1.568e-7
Identity = 53/203 (26.11%), Postives = 85/203 (41.87%), Query Frame = 2
Query:  389 LFIGGLSPHTTLETLRNYFQNYGDIKDVMILKDPVTKRSRGFGFVTFIDYSTIEKILL--------NSPHFLDSXXXXXXXXXXXXXELIDKAINTEKTRKVFIGGLSNSTVHKDLEAFFGKYGKVESCELMMDKSTNRHRGFGFVIFEKEETADHICNIRYHEINSKMVEAKKALPKDVIMQTSYSNKPKQQITKSFPNPLN 973
            +F+G LS     E L+  F++ G +    ++ +  T RSRG+G+V F + S  EK +           P   D     P     +  +  D    +E +  +F+G LS +     +   F K+G+V S  +     T + +GFG+V F                  S M +AKKAL  D +      N+P  ++  S P P N
Sbjct:  170 IFVGRLSWSIDDEWLKKEFEHIGGVIGARVIYERGTDRSRGYGYVDFENKSYAEKAIQEMQGKEIDGRPINCDMSTSKPAGNNDRAKKFGD--TPSEPSDTLFLGNLSFNADRDAIFELFAKHGEVVSVRIPTHPETEQPKGFGYVQF------------------SNMEDAKKAL--DALQGEYIDNRP-VRLDFSSPRPNN 349          
BLAST of RNA-binding protein Musashi vs. Ensembl Yeast
Match: PAB1 (Poly(A) binding protein; part of the 3'-end RNA-processing complex, mediates interactions between the 5' cap structure and the 3' mRNA poly(A) tail, involved in control of poly(A) tail length, interacts with translation factor eIF-4G; stimulates, but is not required for the deadenylation activity of the Pan2p-Pan3p poly(A)-ribonuclease complex [Source:SGD;Acc:S000000967])

HSP 1 Score: 48.9062 bits (115), Expect = 1.130e-6
Identity = 37/153 (24.18%), Postives = 66/153 (43.14%), Query Frame = 2
Query:  389 LFIGGLSPHTTLETLRNYFQNYGDIKDVMILKDPVTKRSRGFGFVTFIDYSTIEKIL--LNSPHFLDSXXXXXXXXXXXXXELIDKAINTEKTRKVFIGGLSNSTVHKDLEAFFGKYGKVESCELMMDKSTNRHRGFGFVIFEKEETADHICN 841
            L++G L P  +   L + F   G +  + + +D +TK S G+ +V F D+    K +  LN                       D ++  + +  +FI  L     +K L   F  +G + S ++  D++  + +GFGFV FE+E  A    +
Sbjct:   40 LYVGDLEPSVSEAHLYDIFSPIGSVSSIRVCRDAITKTSLGYAYVNFNDHEAGRKAIEQLNYTPIKGRLCRIMWSQR-------DPSLRKKGSGNIFIKNLHPDIDNKALYDTFSVFGDILSSKIATDEN-GKSKGFGFVHFEEEGAAKEAID 184          

HSP 2 Score: 46.2098 bits (108), Expect = 7.773e-6
Identity = 46/182 (25.27%), Postives = 79/182 (43.41%), Query Frame = 2
Query:  389 LFIGGLSPHTTLETLRNYFQNYGDIKDVMILKDPVTKRSRGFGFVTFIDYSTIEK-------ILLNSPHFLDSXXXXXXXXXXXXXELIDKAINTEKTRKVFIGGLSNSTVHKDLEAFFGKYGKVESCELMMDKSTNRHRGFGFVIFEKEETA-DHICNIRYHEINSKMVEAKKALPKDVIM 910
            +FI  L P    + L + F  +GDI    I  D   K S+GFGFV F +    ++       +LLN      +  +  K    +  E      N      +++  +++ T  +  +  F K+G + S  L  D +  + +GFGFV +EK E A   +  +   E+N + +   +A  K+  M
Sbjct:  128 IFIKNLHPDIDNKALYDTFSVFGDILSSKIATDENGK-SKGFGFVHFEEEGAAKEAIDALNGMLLNGQEIYVAPHLSRKERDSQLEETKAHYTN------LYVKNINSETTDEQFQELFAKFGPIVSASLEKD-ADGKLKGFGFVNYEKHEDAVKAVEALNDSELNGEKLYVGRAQKKNERM 301          
BLAST of RNA-binding protein Musashi vs. Ensembl Yeast
Match: NOP12 (Nucleolar protein involved in pre-25S rRNA processing; also involved in biogenesis of large 60S ribosomal subunit; contains an RNA recognition motif (RRM); binds to Ebp2; similar to Nop13p and Nsr1p [Source:SGD;Acc:S000005401])

HSP 1 Score: 47.3654 bits (111), Expect = 2.738e-6
Identity = 22/64 (34.38%), Postives = 36/64 (56.25%), Query Frame = 2
Query:  371 HEVNKKLFIGGLSPHTTLETLRNYFQNYGDIKDVMILKDPVTKRSRGFGFVTFIDYSTIEKILL 562
            H+  + +F+G L      E+L  +F+  GDI+ V I++D  T   +GF +V F D  ++ K LL
Sbjct:  275 HDKKRSIFVGNLDFEEIEESLWKHFEPCGDIEYVRIIRDSKTNMGKGFAYVQFKDLQSVNKALL 338          
BLAST of RNA-binding protein Musashi vs. Ensembl Yeast
Match: SGN1 (Cytoplasmic RNA-binding protein; contains an RNA recognition motif (RRM); may have a role in mRNA translation, as suggested by genetic interactions with genes encoding proteins involved in translational initiation [Source:SGD;Acc:S000001440])

HSP 1 Score: 45.8246 bits (107), Expect = 5.852e-6
Identity = 21/78 (26.92%), Postives = 45/78 (57.69%), Query Frame = 2
Query:  335 MDRSFSEAEEKCHEV---NKKLFIGGLSPHTTLETLRNYFQNYGDIKDVMILKDPVTKRSRGFGFVTFIDYSTIEKIL 559
            + +  S+ E+  H++   ++ +F+G ++P  T E + ++F++ G IK + +L D  T   +G+G++ F   +  EK L
Sbjct:   45 VSQKLSKEEKHAHQLEADSRSIFVGNITPDVTPEQIEDHFKDCGQIKRITLLYDRNTGTPKGYGYIEFESPAYREKAL 122          
BLAST of RNA-binding protein Musashi vs. Ensembl Nematostella
Match: EDO39879 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S8S5])

HSP 1 Score: 164.851 bits (416), Expect = 8.956e-49
Identity = 89/174 (51.15%), Postives = 126/174 (72.41%), Query Frame = 2
Query:  386 KLFIGGLSPHTTLETLRNYFQNYGDIKDVMILKDPVTKRSRGFGFVTFIDYSTIEKILLNSPHFLDSXXXXXXXXXXXXXELIDKAINTEKTRKVFIGGLSNSTVHKDLEAFFGKYGKVESCELMMDKSTNRHRGFGFVIFEKEETADHICNIRYHEINSKMVEAKKALPKDVI 907
            K+FIGGLS  TT E LR +F+ +G++K+ ++++DPVTKRSRGFGF+TF D   ++ +L +    LD KKIDPK+A+PK+     K + T  T+K+FIGGLS +T  +D++ +F ++GK+    LM DK+T RHRGFGFV FE E +AD  C+ +YH IN+K VE KKA PK+V+
Sbjct:    1 KMFIGGLSWQTTAEGLRQHFEKFGELKECVVMRDPVTKRSRGFGFLTFKDPKAVDVVLNSGAQELDGKKIDPKLAVPKRAPA--KMVTT--TKKIFIGGLSTNTSEEDMKKYFSQFGKITETMLMFDKATQRHRGFGFVTFESENSADKACDTQYHLINNKKVEVKKAQPKEVM 170          

HSP 2 Score: 62.3882 bits (150), Expect = 1.689e-11
Identity = 30/76 (39.47%), Postives = 45/76 (59.21%), Query Frame = 2
Query:  356 AEEKCHEVNKKLFIGGLSPHTTLETLRNYFQNYGDIKDVMILKDPVTKRSRGFGFVTFIDYSTIEKILLNSPHFLD 583
            A  K     KK+FIGGLS +T+ E ++ YF  +G I + M++ D  T+R RGFGFVTF   ++ +K      H ++
Sbjct:   80 APAKMVTTTKKIFIGGLSTNTSEEDMKKYFSQFGKITETMLMFDKATQRHRGFGFVTFESENSADKACDTQYHLIN 155          
BLAST of RNA-binding protein Musashi vs. Ensembl Nematostella
Match: EDO33389 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SSE1])

HSP 1 Score: 135.191 bits (339), Expect = 8.236e-38
Identity = 74/164 (45.12%), Postives = 106/164 (64.63%), Query Frame = 2
Query:  383 KKLFIGGLSPHTTLETLRNYFQNYGDIKDVMILKDPVTKRSRGFGFVTFIDYSTIEKILLNSPHFLDSXXXXXXXXXXXXXELIDKAINTEKTRKVFIGGLSNSTVHKDLEAFFGKYGKVESCELMMDKSTNRHRGFGFVIFEKEETADHICNIRYHEINSKMV 874
            +K+F+GGL+  T    L+ YF+ YG++ D +++ DPVTKRSR FGF+TF D S ++ ++ + PH LD K IDPK A+P+ P       N     K+F+GGL++ST  +DLE +F  YGKV S  LM+D  T + RGFGFV FE +++     +  YH+IN K V
Sbjct:    1 RKIFVGGLAISTDSAGLQGYFEKYGEVTDCVLMTDPVTKRSRCFGFITFRDPSVVQNVMDDKPHQLDGKMIDPKPAVPRGPGQGPPQGNQNNEFKIFVGGLAHSTSKQDLEDYFTAYGKVVSVNLMVDPQTQKMRGFGFVTFESKDSVTKAADEHYHQINGKTV 164          

HSP 2 Score: 73.559 bits (179), Expect = 1.665e-15
Identity = 31/79 (39.24%), Postives = 49/79 (62.03%), Query Frame = 2
Query:  662 RKVFIGGLSNSTVHKDLEAFFGKYGKVESCELMMDKSTNRHRGFGFVIFEKEETADHICNIRYHEINSKMVEAKKALPK 898
            RK+F+GGL+ ST    L+ +F KYG+V  C LM D  T R R FGF+ F       ++ + + H+++ KM++ K A+P+
Sbjct:    1 RKIFVGGLAISTDSAGLQGYFEKYGEVTDCVLMTDPVTKRSRCFGFITFRDPSVVQNVMDDKPHQLDGKMIDPKPAVPR 79          
BLAST of RNA-binding protein Musashi vs. Ensembl Nematostella
Match: EDO36522 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SIF0])

HSP 1 Score: 129.413 bits (324), Expect = 2.487e-35
Identity = 75/179 (41.90%), Postives = 109/179 (60.89%), Query Frame = 2
Query:  386 KLFIGGLSPHTTLETLRNYFQNYGDIKDVMILKDPVTKRSRGFGFVTFIDYSTIEKILL----NSPHFLDSXXXXXXXXXXXXXELIDKAINTEKTRKVFIGGLSNSTVHKDLEAFFGKY--GKVESCELMMDK-STNRHRGFGFVIFEKEETADHICNIRYHEINSKMVEAKKALPKD 901
            KLF+GGL+  TT ETLR YF+ YG++ DV+++ D  TK+SRGFG+VTF DY     +L     N  H +D K+++ K AIP+     + A + EKT+K+F+GGL      +D++         KV+  +L+M K    +HRGF FV    E+ AD +C ++   +  KMVEAKKA P+D
Sbjct:   15 KLFVGGLNRETTNETLREYFEAYGELTDVVVICDSATKKSRGFGYVTFADYKVTRNVLKDKVENGAHRIDGKEVEVKRAIPRDD---NSATSHEKTKKIFVGGLPEDATKEDIQEAIESLLEEKVDKVDLIMKKEDETKHRGFAFVELNNEDQADELCCVKKIHVKGKMVEAKKATPRD 190          

HSP 2 Score: 58.151 bits (139), Expect = 5.190e-10
Identity = 30/95 (31.58%), Postives = 52/95 (54.74%), Query Frame = 2
Query:  665 KVFIGGLSNSTVHKDLEAFFGKYGKVESCELMMDKSTNRHRGFGFVIFEKEETADHICNIRY----HEINSKMVEAKKALPKDVIMQTSYSNKPK 937
            K+F+GGL+  T ++ L  +F  YG++    ++ D +T + RGFG+V F   +   ++   +     H I+ K VE K+A+P+D    TS+    K
Sbjct:   15 KLFVGGLNRETTNETLREYFEAYGELTDVVVICDSATKKSRGFGYVTFADYKVTRNVLKDKVENGAHRIDGKEVEVKRAIPRDDNSATSHEKTKK 109          
BLAST of RNA-binding protein Musashi vs. Ensembl Nematostella
Match: EDO38417 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SCX6])

HSP 1 Score: 121.709 bits (304), Expect = 2.169e-31
Identity = 76/175 (43.43%), Postives = 103/175 (58.86%), Query Frame = 2
Query:  386 KLFIGGLSPHTTLETLRNYFQNYGDIKDVMILKDPVTKRSRGFGFVTFIDYSTIEKILLN-SPHFLDSXXXXXXXXXXXXXELIDKAINTEKTRKVFIGGLSNSTVHKDLEAFFGK-YGKVESCELMMDKSTNRHRGFGFVIFEKEETADHICNIRYHEINSKMVEAKKALPKDV 904
            KLF+GGLS  TT E+L+ YF  YG++  V I  D +T R RGF FV F   S  + +L    PH LD + IDPK A P     I K  +  + +K+F+GGL   T  + +  +FGK Y  V+  E + + S+NR RGF FV F+ E+T D IC  ++H I    VE K+ALPK+V
Sbjct:   30 KLFVGGLSYETTKESLKEYFSKYGELVGVDIKMDALTGRPRGFAFVQFKHQSEADAVLNQVDPHVLDGRTIDPKPAAP-----IGKPPHL-RVKKIFVGGLKPETSDEKIREYFGKAYAPVKEIEYITEHSSNRRRGFCFVSFDSEDTVDKICETQFHNIEGNKVEVKRALPKEV 198          

HSP 2 Score: 51.6026 bits (122), Expect = 2.924e-7
Identity = 24/59 (40.68%), Postives = 38/59 (64.41%), Query Frame = 2
Query:  383 KKLFIGGLSPHTTLETLRNYF-QNYGDIKDVMILKDPVTKRSRGFGFVTFIDYSTIEKI 556
            KK+F+GGL P T+ E +R YF + Y  +K++  + +  + R RGF FV+F    T++KI
Sbjct:  117 KKIFVGGLKPETSDEKIREYFGKAYAPVKEIEYITEHSSNRRRGFCFVSFDSEDTVDKI 175          
BLAST of RNA-binding protein Musashi vs. Ensembl Nematostella
Match: EDO49349 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RG33])

HSP 1 Score: 117.857 bits (294), Expect = 2.921e-31
Identity = 70/181 (38.67%), Postives = 112/181 (61.88%), Query Frame = 2
Query:  386 KLFIGGLSPHTTLETLRNYFQNYGDIKDVMILKDPVTKRSRGFGFVTFIDYSTIEKILLNSPHFLDSXXXXXXXXXXXXXELIDKAINTEKTRKVFIGGLSNSTVHKDLEAFFGK------YGKVESCELMMDKST-NRHRGFGFVIFEKEETADHICNIRYHEINSKMVEAKKALPKDVI 907
            K+FIGGL+ +TT E L++YF  +G I D +I+K     RSRGFGFVT+    ++ ++L    H LD ++I+PK ++P+      +A++  KTRK+F+GGL+++TV +D++ +F         G+V   +L  D+    R RGF FV F+ +E  + +C ++YHEI  K  E KKA P+  +
Sbjct:    1 KIFIGGLNWNTTEEGLKDYFSQWGTIVDCVIMKRD--GRSRGFGFVTYESSDSVNEVLKKKDHVLDDREIEPKRSVPRDESGAPEAMS--KTRKIFVGGLASTTVEEDIKEYFNSLCRKNGMGEVIDVDLKRDRDNPKRIRGFAFVTFDNDEIVEKVCAMKYHEIRMKQCEVKKAEPQSAM 177          
BLAST of RNA-binding protein Musashi vs. Ensembl Medaka
Match: msi1 (musashi RNA binding protein 1 [Source:NCBI gene;Acc:101173434])

HSP 1 Score: 185.652 bits (470), Expect = 3.198e-54
Identity = 95/177 (53.67%), Postives = 133/177 (75.14%), Query Frame = 2
Query:  386 KLFIGGLSPHTTLETLRNYFQNYGDIKDVMILKDPVTKRSRGFGFVTFIDYSTIEKILLNSPHFLDSXXXXXXXXXXXXXELIDKAINTEKTRKVFIGGLSNSTVHKDLEAFFGKYGKVESCELMMDKSTNRHRGFGFVIFEKEETADHICNIRYHEINSKMVEAKKALPKDVIMQT 916
            K+FIGGLS  TT E L+ YF  YG++K+ M+++DPVTKRSRGFGFVTF+D + ++K+L  S H LDSK IDPK+A P++ +   K +   +T+K+F+GGLS +T  +D++ +F ++GKV+   LM DK+TNRHRGFGFV FE E+  + +C I +HEIN+KMVE KKA PK+V+  T
Sbjct:   21 KMFIGGLSWQTTQEGLKEYFCKYGEVKECMVMRDPVTKRSRGFGFVTFVDQAGVDKVLAQSRHELDSKTIDPKVAFPRRAQ--PKLVT--RTKKIFVGGLSVNTTIEDVKQYFDQFGKVDDAMLMFDKTTNRHRGFGFVTFENEDVVEKVCEIHFHEINNKMVECKKAQPKEVMSPT 193          

HSP 2 Score: 68.1662 bits (165), Expect = 4.093e-12
Identity = 30/68 (44.12%), Postives = 44/68 (64.71%), Query Frame = 2
Query:  353 EAEEKCHEVNKKLFIGGLSPHTTLETLRNYFQNYGDIKDVMILKDPVTKRSRGFGFVTFIDYSTIEKI 556
             A+ K     KK+F+GGLS +TT+E ++ YF  +G + D M++ D  T R RGFGFVTF +   +EK+
Sbjct:   99 RAQPKLVTRTKKIFVGGLSVNTTIEDVKQYFDQFGKVDDAMLMFDKTTNRHRGFGFVTFENEDVVEKV 166          
BLAST of RNA-binding protein Musashi vs. Ensembl Medaka
Match: MSI1 (RNA-binding protein Musashi homolog 1 [Source:NCBI gene;Acc:101154771])

HSP 1 Score: 182.185 bits (461), Expect = 2.981e-53
Identity = 93/178 (52.25%), Postives = 132/178 (74.16%), Query Frame = 2
Query:  386 KLFIGGLSPHTTLETLRNYFQNYGDIKDVMILKDPVTKRSRGFGFVTFIDYSTIEKILLNSPHFLDSXXXXXXXXXXXXXELIDKAINTEKTRKVFIGGLSNSTVHKDLEAFFGKYGKVESCELMMDKSTNRHRGFGFVIFEKEETADHICNIRYHEINSKMVEAKKALPKDVIMQTS 919
            K+FIGGLS  TT E LR YF  +G++K+ M+++DPVTKRSRGFGFVT+ D + +E++L  + H LDSK IDPK+A P++ +   K +   +T+K+F+GGLS +T  +D++ +F ++GKV+   LM DK+TNRHRGFGFV FE E+  + +C I +HEIN+KMVE KKA PK+V+  T 
Sbjct:   10 KMFIGGLSWQTTQEGLREYFGKFGEVKECMVMRDPVTKRSRGFGFVTYADQAGVEQVLAQNRHELDSKTIDPKVAFPRRAQ--PKLVT--RTKKIFVGGLSVNTTIEDVKQYFDQFGKVDDAMLMFDKTTNRHRGFGFVTFENEDVVEKVCEIHFHEINNKMVECKKAQPKEVMTPTG 183          

HSP 2 Score: 68.1662 bits (165), Expect = 3.140e-12
Identity = 30/68 (44.12%), Postives = 44/68 (64.71%), Query Frame = 2
Query:  353 EAEEKCHEVNKKLFIGGLSPHTTLETLRNYFQNYGDIKDVMILKDPVTKRSRGFGFVTFIDYSTIEKI 556
             A+ K     KK+F+GGLS +TT+E ++ YF  +G + D M++ D  T R RGFGFVTF +   +EK+
Sbjct:   88 RAQPKLVTRTKKIFVGGLSVNTTIEDVKQYFDQFGKVDDAMLMFDKTTNRHRGFGFVTFENEDVVEKV 155          
BLAST of RNA-binding protein Musashi vs. Ensembl Medaka
Match: msi2a (musashi RNA binding protein 2 [Source:NCBI gene;Acc:101163923])

HSP 1 Score: 181.415 bits (459), Expect = 3.548e-53
Identity = 90/174 (51.72%), Postives = 133/174 (76.44%), Query Frame = 2
Query:  386 KLFIGGLSPHTTLETLRNYFQNYGDIKDVMILKDPVTKRSRGFGFVTFIDYSTIEKILLNSPHFLDSXXXXXXXXXXXXXELIDKAINTEKTRKVFIGGLSNSTVHKDLEAFFGKYGKVESCELMMDKSTNRHRGFGFVIFEKEETADHICNIRYHEINSKMVEAKKALPKDVI 907
            K+FIGGLS  T+ ++LR+YF  +G+I++ M+++DP TKRSRGFGFVTF D ++++K+L    H LDSK IDPK+A P++ +   K +   +T+K+F+GGLS +TV +D++ +F ++GKV+   LM DK+TNRHRGFGF+ FE E+  + +C I +HEIN+KMVE KKA PK+V+
Sbjct:   22 KMFIGGLSWQTSPDSLRDYFSKFGEIRECMVMRDPTTKRSRGFGFVTFTDAASVDKVLAQQHHELDSKTIDPKVAFPRRAQ--PKMVT--RTKKIFVGGLSANTVVEDVKQYFEQFGKVDDAMLMFDKTTNRHRGFGFITFESEDIVEKVCEIHFHEINNKMVECKKAQPKEVM 191          

HSP 2 Score: 66.2402 bits (160), Expect = 1.137e-11
Identity = 28/68 (41.18%), Postives = 43/68 (63.24%), Query Frame = 2
Query:  353 EAEEKCHEVNKKLFIGGLSPHTTLETLRNYFQNYGDIKDVMILKDPVTKRSRGFGFVTFIDYSTIEKI 556
             A+ K     KK+F+GGLS +T +E ++ YF+ +G + D M++ D  T R RGFGF+TF     +EK+
Sbjct:  100 RAQPKMVTRTKKIFVGGLSANTVVEDVKQYFEQFGKVDDAMLMFDKTTNRHRGFGFITFESEDIVEKV 167          
BLAST of RNA-binding protein Musashi vs. Ensembl Medaka
Match: msi2a (musashi RNA binding protein 2 [Source:NCBI gene;Acc:101163923])

HSP 1 Score: 181.8 bits (460), Expect = 5.332e-53
Identity = 90/174 (51.72%), Postives = 133/174 (76.44%), Query Frame = 2
Query:  386 KLFIGGLSPHTTLETLRNYFQNYGDIKDVMILKDPVTKRSRGFGFVTFIDYSTIEKILLNSPHFLDSXXXXXXXXXXXXXELIDKAINTEKTRKVFIGGLSNSTVHKDLEAFFGKYGKVESCELMMDKSTNRHRGFGFVIFEKEETADHICNIRYHEINSKMVEAKKALPKDVI 907
            K+FIGGLS  T+ ++LR+YF  +G+I++ M+++DP TKRSRGFGFVTF D ++++K+L    H LDSK IDPK+A P++ +   K +   +T+K+F+GGLS +TV +D++ +F ++GKV+   LM DK+TNRHRGFGF+ FE E+  + +C I +HEIN+KMVE KKA PK+V+
Sbjct:   22 KMFIGGLSWQTSPDSLRDYFSKFGEIRECMVMRDPTTKRSRGFGFVTFTDAASVDKVLAQQHHELDSKTIDPKVAFPRRAQ--PKMVT--RTKKIFVGGLSANTVVEDVKQYFEQFGKVDDAMLMFDKTTNRHRGFGFITFESEDIVEKVCEIHFHEINNKMVECKKAQPKEVM 191          

HSP 2 Score: 66.2402 bits (160), Expect = 1.325e-11
Identity = 28/68 (41.18%), Postives = 43/68 (63.24%), Query Frame = 2
Query:  353 EAEEKCHEVNKKLFIGGLSPHTTLETLRNYFQNYGDIKDVMILKDPVTKRSRGFGFVTFIDYSTIEKI 556
             A+ K     KK+F+GGLS +T +E ++ YF+ +G + D M++ D  T R RGFGF+TF     +EK+
Sbjct:  100 RAQPKMVTRTKKIFVGGLSANTVVEDVKQYFEQFGKVDDAMLMFDKTTNRHRGFGFITFESEDIVEKV 167          
BLAST of RNA-binding protein Musashi vs. Ensembl Medaka
Match: MSI1 (RNA-binding protein Musashi homolog 1 [Source:NCBI gene;Acc:101154771])

HSP 1 Score: 181.8 bits (460), Expect = 8.399e-53
Identity = 93/178 (52.25%), Postives = 132/178 (74.16%), Query Frame = 2
Query:  386 KLFIGGLSPHTTLETLRNYFQNYGDIKDVMILKDPVTKRSRGFGFVTFIDYSTIEKILLNSPHFLDSXXXXXXXXXXXXXELIDKAINTEKTRKVFIGGLSNSTVHKDLEAFFGKYGKVESCELMMDKSTNRHRGFGFVIFEKEETADHICNIRYHEINSKMVEAKKALPKDVIMQTS 919
            K+FIGGLS  TT E LR YF  +G++K+ M+++DPVTKRSRGFGFVT+ D + +E++L  + H LDSK IDPK+A P++ +   K +   +T+K+F+GGLS +T  +D++ +F ++GKV+   LM DK+TNRHRGFGFV FE E+  + +C I +HEIN+KMVE KKA PK+V+  T 
Sbjct:   29 KMFIGGLSWQTTQEGLREYFGKFGEVKECMVMRDPVTKRSRGFGFVTYADQAGVEQVLAQNRHELDSKTIDPKVAFPRRAQ--PKLVT--RTKKIFVGGLSVNTTIEDVKQYFDQFGKVDDAMLMFDKTTNRHRGFGFVTFENEDVVEKVCEIHFHEINNKMVECKKAQPKEVMTPTG 202          

HSP 2 Score: 68.1662 bits (165), Expect = 4.325e-12
Identity = 30/68 (44.12%), Postives = 44/68 (64.71%), Query Frame = 2
Query:  353 EAEEKCHEVNKKLFIGGLSPHTTLETLRNYFQNYGDIKDVMILKDPVTKRSRGFGFVTFIDYSTIEKI 556
             A+ K     KK+F+GGLS +TT+E ++ YF  +G + D M++ D  T R RGFGFVTF +   +EK+
Sbjct:  107 RAQPKLVTRTKKIFVGGLSVNTTIEDVKQYFDQFGKVDDAMLMFDKTTNRHRGFGFVTFENEDVVEKV 174          
BLAST of RNA-binding protein Musashi vs. Planmine SMEST
Match: SMESG000045502.1 (SMESG000045502.1)

HSP 1 Score: 359.377 bits (921), Expect = 5.396e-122
Identity = 173/174 (99.43%), Postives = 173/174 (99.43%), Query Frame = 2
Query:  791 FGFVIFEKEETADHICNIRYHEINSKMVEAKKALPKDVIMQTSYSNKPKQQITKSFPNPLNSKSKKLAADGFSYVPAINPPQLLSTQFNAFCLSGYLIPSNIGQNNYYFPNANENGFVSCLSSPLPIYLVQNYSHESIGQTYSYKNNEALFVINPQKSEQFNIQPYQTYMVNAV 1312
            FGFVIFEKEETADHICNIRYHEINSKMVEAKKALPKDVIMQTSYSNKPKQQITKSFP PLNSKSKKLAADGFSYVPAINPPQLLSTQFNAFCLSGYLIPSNIGQNNYYFPNANENGFVSCLSSPLPIYLVQNYSHESIGQTYSYKNNEALFVINPQKSEQFNIQPYQTYMVNAV
Sbjct:  165 FGFVIFEKEETADHICNIRYHEINSKMVEAKKALPKDVIMQTSYSNKPKQQITKSFPTPLNSKSKKLAADGFSYVPAINPPQLLSTQFNAFCLSGYLIPSNIGQNNYYFPNANENGFVSCLSSPLPIYLVQNYSHESIGQTYSYKNNEALFVINPQKSEQFNIQPYQTYMVNAV 338          
BLAST of RNA-binding protein Musashi vs. Planmine SMEST
Match: SMESG000045507.1 (SMESG000045507.1)

HSP 1 Score: 283.878 bits (725), Expect = 4.522e-95
Identity = 152/153 (99.35%), Postives = 153/153 (100.00%), Query Frame = 2
Query:  335 MDRSFSEAEEKCHEVNKKLFIGGLSPHTTLETLRNYFQNYGDIKDVMILKDPVTKRSRGFGFVTFIDYSTIEKILLNSPHFLDSXXXXXXXXXXXXXELIDKAINTEKTRKVFIGGLSNSTVHKDLEAFFGKYGKVESCELMMDKSTNRHRGF 793
            MDRSFSEAEEKCHEVNKKLFIGGLSPHTTLETLRNYFQNYGDIKDVMILKDPVTKRSRGFGFVTFIDYSTIEKILLNSPHFLDSKKIDPKIAIPKKPELIDKAINTEKTRKVFIGGLSNSTVHKDLEAFFGKYGKVESCELMMDKSTNRHRG+
Sbjct:    1 MDRSFSEAEEKCHEVNKKLFIGGLSPHTTLETLRNYFQNYGDIKDVMILKDPVTKRSRGFGFVTFIDYSTIEKILLNSPHFLDSKKIDPKIAIPKKPELIDKAINTEKTRKVFIGGLSNSTVHKDLEAFFGKYGKVESCELMMDKSTNRHRGY 153          

HSP 2 Score: 57.7658 bits (138), Expect = 7.962e-10
Identity = 32/82 (39.02%), Postives = 46/82 (56.10%), Query Frame = 2
Query:  653 EKTRKVFIGGLSNSTVHKDLEAFFGKYGKVESCELMMDKSTNRHRGFGFVIFEKEETADHICNIRYHEINSKMVEAKKALPK 898
            E  +K+FIGGLS  T  + L  +F  YG ++   ++ D  T R RGFGFV F    T + I     H ++SK ++ K A+PK
Sbjct:   14 EVNKKLFIGGLSPHTTLETLRNYFQNYGDIKDVMILKDPVTKRSRGFGFVTFIDYSTIEKILLNSPHFLDSKKIDPKIAIPK 95          
BLAST of RNA-binding protein Musashi vs. Planmine SMEST
Match: SMESG000077233.1 (SMESG000077233.1)

HSP 1 Score: 224.172 bits (570), Expect = 8.684e-68
Identity = 123/266 (46.24%), Postives = 174/266 (65.41%), Query Frame = 2
Query:  386 KLFIGGLSPHTTLETLRNYFQNYGDIKDVMILKDPVTKRSRGFGFVTFIDYSTIEKILLNSPHFLDSXXXXXXXXXXXXXE----------------------LIDKAINTEKTRKVFIGGLSNSTVHKDLEAFFGKYGKVESCELMMDKSTNRHRGFGFVIFEKEETADHICNIRYHEINSKMVEAKKALPKDVIMQTSYSNKPKQQITKSFPNPLNSKSKKLAADGFSYVPAINPPQLLSTQFNAFCLSGYLIPSNIGQNNYYF 1117
            K+FIGGLSP T+ ET+R+YF+ YGDIK+ MI++DPVTKRSRGFGFVTF++ S+++K+L  +PHFLDSKKIDPK+A+P+K E                      L D ++N  KT+KVFIGG+S +T  ++LE +F ++G +E+CELMMDK+T+RHRGFGFV FE E++A+ +C+I +H++N+K VEAKKALPK++I       +  Q I  S P   N      A +  S + A       + Q N F +  Y I S +  +N+  
Sbjct:   29 KMFIGGLSPTTSPETMRDYFRKYGDIKEFMIMRDPVTKRSRGFGFVTFLESSSVKKVLNKTPHFLDSKKIDPKVAVPRKIESSTKNCDTSIDCLGINGYSSGKLSDSSLNNAKTKKVFIGGISTNTTKQELEEYFSQFGILETCELMMDKATSRHRGFGFVTFENEDSAEKVCDIHFHDLNNKTVEAKKALPKEIIGNNGVLKQRNQLIRTSLPLISNQLQNNYALNALSAIAA-------ARQCNTFLMPSYYITSGLIPSNFML 287          
BLAST of RNA-binding protein Musashi vs. Planmine SMEST
Match: SMESG000077233.1 (SMESG000077233.1)

HSP 1 Score: 224.172 bits (570), Expect = 1.076e-67
Identity = 123/266 (46.24%), Postives = 174/266 (65.41%), Query Frame = 2
Query:  386 KLFIGGLSPHTTLETLRNYFQNYGDIKDVMILKDPVTKRSRGFGFVTFIDYSTIEKILLNSPHFLDSXXXXXXXXXXXXXE----------------------LIDKAINTEKTRKVFIGGLSNSTVHKDLEAFFGKYGKVESCELMMDKSTNRHRGFGFVIFEKEETADHICNIRYHEINSKMVEAKKALPKDVIMQTSYSNKPKQQITKSFPNPLNSKSKKLAADGFSYVPAINPPQLLSTQFNAFCLSGYLIPSNIGQNNYYF 1117
            K+FIGGLSP T+ ET+R+YF+ YGDIK+ MI++DPVTKRSRGFGFVTF++ S+++K+L  +PHFLDSKKIDPK+A+P+K E                      L D ++N  KT+KVFIGG+S +T  ++LE +F ++G +E+CELMMDK+T+RHRGFGFV FE E++A+ +C+I +H++N+K VEAKKALPK++I       +  Q I  S P   N      A +  S + A       + Q N F +  Y I S +  +N+  
Sbjct:   29 KMFIGGLSPTTSPETMRDYFRKYGDIKEFMIMRDPVTKRSRGFGFVTFLESSSVKKVLNKTPHFLDSKKIDPKVAVPRKIESSTKNCDTSIDCLGINGYSSGKLSDSSLNNAKTKKVFIGGISTNTTKQELEEYFSQFGILETCELMMDKATSRHRGFGFVTFENEDSAEKVCDIHFHDLNNKTVEAKKALPKEIIGNNGVLKQRNQLIRTSLPLISNQLQNNYALNALSAIAA-------ARQCNTFLMPSYYITSGLIPSNFML 287          
BLAST of RNA-binding protein Musashi vs. Planmine SMEST
Match: SMESG000071202.1 (SMESG000071202.1)

HSP 1 Score: 194.897 bits (494), Expect = 1.095e-56
Identity = 106/195 (54.36%), Postives = 143/195 (73.33%), Query Frame = 2
Query:  386 KLFIGGLSPHTTLETLRNYFQNYGDIKDVMILKDPVTKRSRGFGFVTFIDYSTIEKILLNSPHFLDSXXXXXXXXXXXXXELIDKAINTEKTRKVFIGGLSNSTVHKDLEAFFGKYGKVESCELMMDKSTNRHRGFGFVIFEKEETADHICNIRYHEINSKMVEAKKALPKDVIMQTSYSNKPKQQITKSFPNPL 970
            KLF+GGL+P TT E L++YF  +G+IK+ M+++D V KRSRGFGFVTF DYS + K+L    H LDSKKIDPK+A+PK     +K   + +T+K+FIGG++ S+  +++  +F +YG+VE+CELMMDK+TNRHRGFGFV F  E+ A+ IC I YH IN+KMVEAKKALPK+++   S SN   +   KS   PL
Sbjct:   38 KLFVGGLNPTTTSEALQSYFSQFGEIKEFMVMRDIVHKRSRGFGFVTFTDYSGVIKVLKQENHILDSKKIDPKLAVPKSICQPEKI--SARTKKIFIGGIATSSTVEEIRQYFNRYGEVENCELMMDKATNRHRGFGFVTFLDEDVAEQICQIHYHNINNKMVEAKKALPKELL---STSNATPKSENKSLQVPL 227          
The following BLAST results are available for this feature:
BLAST of RNA-binding protein Musashi vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
MSI23.087e-5352.27musashi RNA binding protein 2 [Source:HGNC Symbol;... [more]
MSI16.082e-5352.25musashi RNA binding protein 1 [Source:HGNC Symbol;... [more]
MSI21.493e-5252.87musashi RNA binding protein 2 [Source:HGNC Symbol;... [more]
MSI23.651e-5252.60musashi RNA binding protein 2 [Source:HGNC Symbol;... [more]
DAZAP11.409e-3733.06DAZ associated protein 1 [Source:HGNC Symbol;Acc:H... [more]
back to top
BLAST of RNA-binding protein Musashi vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
msi-11.862e-5554.86MuSashI (Fly neural) family; Neural RNA-binding pr... [more]
hrp-11.699e-3034.68Heterogeneous nuclear ribonucleoprotein A1 [Sourc... [more]
hrp-11.699e-3034.68Heterogeneous nuclear ribonucleoprotein A1 [Sourc... [more]
hrp-11.730e-3034.68Heterogeneous nuclear ribonucleoprotein A1 [Sourc... [more]
hrp-11.730e-3034.68Heterogeneous nuclear ribonucleoprotein A1 [Sourc... [more]
back to top
BLAST of RNA-binding protein Musashi vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Rbp61.079e-5252.00gene:FBgn0260943 transcript:FBtr0075285[more]
Rbp61.208e-5252.00gene:FBgn0260943 transcript:FBtr0333861[more]
Rbp61.185e-5152.00gene:FBgn0260943 transcript:FBtr0113427[more]
msi2.958e-4548.85gene:FBgn0011666 transcript:FBtr0333665[more]
msi3.383e-4548.85gene:FBgn0011666 transcript:FBtr0305219[more]
back to top
BLAST of RNA-binding protein Musashi vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
msi2b3.745e-5552.54musashi RNA-binding protein 2b [Source:ZFIN;Acc:ZD... [more]
msi2b8.164e-5452.87musashi RNA-binding protein 2b [Source:ZFIN;Acc:ZD... [more]
msi2a3.316e-5353.45musashi RNA-binding protein 2a [Source:ZFIN;Acc:ZD... [more]
msi2a3.316e-5353.45musashi RNA-binding protein 2a [Source:ZFIN;Acc:ZD... [more]
msi2b4.068e-5352.87musashi RNA-binding protein 2b [Source:ZFIN;Acc:ZD... [more]
back to top
BLAST of RNA-binding protein Musashi vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
msi15.032e-5452.81musashi RNA binding protein 1 [Source:NCBI gene;Ac... [more]
msi15.300e-5452.81musashi RNA binding protein 1 [Source:NCBI gene;Ac... [more]
msi19.453e-5452.54musashi RNA binding protein 1 [Source:NCBI gene;Ac... [more]
msi11.515e-5352.54musashi RNA binding protein 1 [Source:NCBI gene;Ac... [more]
msi11.989e-5352.54musashi RNA binding protein 1 [Source:NCBI gene;Ac... [more]
back to top
BLAST of RNA-binding protein Musashi vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Msi26.924e-5352.87musashi RNA-binding protein 2 [Source:MGI Symbol;A... [more]
Msi17.135e-5352.25musashi RNA-binding protein 1 [Source:MGI Symbol;A... [more]
Msi29.825e-5352.87musashi RNA-binding protein 2 [Source:MGI Symbol;A... [more]
Msi12.946e-4850.88musashi RNA-binding protein 1 [Source:MGI Symbol;A... [more]
Msi14.315e-4750.91musashi RNA-binding protein 1 [Source:MGI Symbol;A... [more]
back to top
BLAST of RNA-binding protein Musashi vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|O43347|MSI1H_HUMAN2.921e-5252.25RNA-binding protein Musashi homolog 1 OS=Homo sapi... [more]
sp|Q920Q6|MSI2H_MOUSE4.844e-5252.87RNA-binding protein Musashi homolog 2 OS=Mus muscu... [more]
sp|Q8K3P4|MSI1H_RAT4.887e-5252.25RNA-binding protein Musashi homolog 1 OS=Rattus no... [more]
sp|Q61474|MSI1H_MOUSE4.991e-5252.25RNA-binding protein Musashi homolog 1 OS=Mus muscu... [more]
sp|Q96DH6|MSI2H_HUMAN7.168e-5252.87RNA-binding protein Musashi homolog 2 OS=Homo sapi... [more]
back to top
BLAST of RNA-binding protein Musashi vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
B1Q3I70.000e+083.18Musashi OS=Dugesia japonica OX=6161 GN=DjmlgA PE=2... [more]
A0A3R7JHP39.897e-6360.92RNA-binding protein Musashi-like protein 1 (Fragme... [more]
A0A267DHL61.466e-6262.29Uncharacterized protein OS=Macrostomum lignano OX=... [more]
A0A267F8T81.466e-6262.29Uncharacterized protein OS=Macrostomum lignano OX=... [more]
A0A074Z6371.322e-6160.92Uncharacterized protein OS=Opisthorchis viverrini ... [more]
back to top
BLAST of RNA-binding protein Musashi vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
msi2b1.455e-5352.87RNA-binding protein Musashi homolog 2 [Source:NCBI... [more]
msi2a1.614e-5352.87RNA-binding protein Musashi homolog 2-like [Source... [more]
msi2b2.773e-5352.87RNA-binding protein Musashi homolog 2 [Source:NCBI... [more]
msi2a3.902e-5352.87RNA-binding protein Musashi homolog 2-like [Source... [more]
msi2a4.288e-5352.87RNA-binding protein Musashi homolog 2-like [Source... [more]
back to top
BLAST of RNA-binding protein Musashi vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 5
Match NameE-valueIdentityDescription
HNRNPA01.148e-3841.14heterogeneous nuclear ribonucleoprotein A0 [Source... [more]
HNRNPA09.039e-3738.10heterogeneous nuclear ribonucleoprotein A0 [Source... [more]
ENSPMAT00000004893.11.895e-3539.53pep scaffold:Pmarinus_7.0:GL479484:4:2056:-1 gene:... [more]
HNRNPA2B13.787e-3436.07heterogeneous nuclear ribonucleoprotein A2/B1 [Sou... [more]
RBM396.247e-1425.16RNA binding motif protein 39 [Source:HGNC Symbol;A... [more]
back to top
BLAST of RNA-binding protein Musashi vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 5
Match NameE-valueIdentityDescription
HRP19.680e-3434.72Subunit of cleavage factor I; cleavage factor I is... [more]
NSR11.568e-726.11Nucleolar protein that binds nuclear localization ... [more]
PAB11.130e-624.18Poly(A) binding protein; part of the 3'-end RNA-pr... [more]
NOP122.738e-634.38Nucleolar protein involved in pre-25S rRNA process... [more]
SGN15.852e-626.92Cytoplasmic RNA-binding protein; contains an RNA r... [more]
back to top
BLAST of RNA-binding protein Musashi vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
EDO398798.956e-4951.15Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO333898.236e-3845.12Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO365222.487e-3541.90Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO384172.169e-3143.43Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO493492.921e-3138.67Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of RNA-binding protein Musashi vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
msi13.198e-5453.67musashi RNA binding protein 1 [Source:NCBI gene;Ac... [more]
MSI12.981e-5352.25RNA-binding protein Musashi homolog 1 [Source:NCBI... [more]
msi2a3.548e-5351.72musashi RNA binding protein 2 [Source:NCBI gene;Ac... [more]
msi2a5.332e-5351.72musashi RNA binding protein 2 [Source:NCBI gene;Ac... [more]
MSI18.399e-5352.25RNA-binding protein Musashi homolog 1 [Source:NCBI... [more]
back to top
BLAST of RNA-binding protein Musashi vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000045502.15.396e-12299.43SMESG000045502.1[more]
SMESG000045507.14.522e-9599.35SMESG000045507.1[more]
SMESG000077233.18.684e-6846.24SMESG000077233.1[more]
SMESG000077233.11.076e-6746.24SMESG000077233.1[more]
SMESG000071202.11.095e-5654.36SMESG000071202.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30015723 ID=SMED30015723|Name=RNA-binding protein Musashi|organism=Schmidtea mediterranea sexual|type=transcript|length=1373bp
ATTCCACGATGCCTGAAGAATACACACCATCAGTTACCAAATGACGAAAA
GGAAAATCACTGGTGATAAACCGAAATCCCCAGCCTGTGTGTCAGCTCAT
CACTAACGGACAACTAGTGGATGCTGCAGATTTTGACAAATTAAGATTCT
CCGAGACTTCTCGTAGATATTTTTACTATTATTCTTGTAGGTTGTGTGTG
ATTTTTATTTTTGTTTTTTATATTTTTCTTTTGTTGACAATTAAATTCGT
CACATTAAATTGGCTGTCCAGTTTTAATATTTAGTTGAATTGTATTTTTT
TTTGCTTTTGCTCTTCTGATCGTTGAGGAAATAAATGGATCGCTCTTTTT
CGGAAGCTGAGGAGAAATGCCACGAAGTAAACAAGAAATTATTTATTGGT
GGATTAAGCCCTCATACGACTCTAGAAACGTTGAGAAATTATTTTCAGAA
TTATGGAGATATCAAAGATGTTATGATTTTAAAAGATCCAGTCACGAAGA
GATCACGTGGATTTGGATTTGTAACTTTTATCGATTATTCGACAATTGAA
AAGATTCTGCTCAATTCTCCCCATTTTTTGGACTCGAAAAAAATTGATCC
GAAAATTGCAATCCCAAAGAAACCTGAGCTGATTGATAAAGCAATTAATA
CAGAAAAAACCCGGAAAGTATTTATTGGTGGCTTGTCGAATTCTACAGTT
CACAAGGATTTGGAAGCCTTTTTCGGGAAATATGGAAAGGTTGAATCGTG
CGAGCTAATGATGGATAAATCAACTAATCGCCATCGAGGATTTGGATTTG
TGATATTTGAAAAGGAAGAAACTGCGGATCACATATGTAACATACGCTAC
CACGAAATAAATAGCAAAATGGTTGAAGCCAAAAAAGCTCTACCAAAAGA
TGTAATAATGCAAACAAGCTACTCAAACAAACCAAAGCAGCAAATCACAA
AATCTTTTCCTAATCCTTTAAATTCCAAATCTAAGAAGCTTGCTGCTGAC
GGGTTCAGTTATGTTCCAGCTATAAATCCTCCACAACTACTCTCAACTCA
ATTCAACGCCTTTTGTTTATCTGGTTATTTAATACCTTCAAATATTGGAC
AAAACAATTATTACTTTCCTAACGCAAATGAAAATGGATTCGTAAGTTGT
TTATCCTCTCCATTGCCTATTTACCTAGTACAAAATTACTCGCACGAATC
AATCGGACAAACATATTCATACAAGAATAACGAAGCTTTATTCGTCATTA
ATCCTCAAAAATCCGAACAATTCAATATCCAGCCGTACCAGACGTACATG
GTAAACGCTGTATAGCAAAAATATAATTGATAATTGCAACTGTTATCGAA
ATCCTTATTAAAATAAAGATGTG
back to top

protein sequence of SMED30015723-orf-1

>SMED30015723-orf-1 ID=SMED30015723-orf-1|Name=SMED30015723-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=327bp
MDRSFSEAEEKCHEVNKKLFIGGLSPHTTLETLRNYFQNYGDIKDVMILK
DPVTKRSRGFGFVTFIDYSTIEKILLNSPHFLDSKKIDPKIAIPKKPELI
DKAINTEKTRKVFIGGLSNSTVHKDLEAFFGKYGKVESCELMMDKSTNRH
RGFGFVIFEKEETADHICNIRYHEINSKMVEAKKALPKDVIMQTSYSNKP
KQQITKSFPNPLNSKSKKLAADGFSYVPAINPPQLLSTQFNAFCLSGYLI
PSNIGQNNYYFPNANENGFVSCLSSPLPIYLVQNYSHESIGQTYSYKNNE
ALFVINPQKSEQFNIQPYQTYMVNAV*
back to top
Aliases
The feature 'RNA-binding protein Musashi' has the following synonyms
Synonym
Dj-musashi
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: molecular function
TermDefinition
GO:0003723RNA binding
GO:0003729mRNA binding
GO:0003676nucleic acid binding
GO:0000166nucleotide binding
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000099neuron
PLANA:0000101muscle cell
PLANA:0000140anterior region of the whole animal
PLANA:0000418head
PLANA:0002109X1 cell
PLANA:0002111X2 cell
Vocabulary: INTERPRO
TermDefinition
IPR037366BOULE/DAZ
IPR035979RBD_domain_sf
IPR000504RRM_dom
IPR012677Nucleotide-bd_a/b_plait_sf
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR000504RNA recognition motif domainSMARTSM00360rrm1_1coord: 111..183
e-value: 7.6E-20
score: 81.9
coord: 18..90
e-value: 1.2E-19
score: 81.3
IPR000504RNA recognition motif domainPFAMPF00076RRM_1coord: 112..168
e-value: 2.1E-15
score: 56.3
coord: 19..76
e-value: 2.9E-15
score: 55.8
IPR000504RNA recognition motif domainPROSITEPS50102RRMcoord: 110..187
score: 15.613
IPR000504RNA recognition motif domainPROSITEPS50102RRMcoord: 17..94
score: 16.5
IPR012677Nucleotide-binding alpha-beta plait domain superfamilyGENE3DG3DSA:3.30.70.330coord: 3..103
e-value: 2.3E-23
score: 84.4
IPR012677Nucleotide-binding alpha-beta plait domain superfamilyGENE3DG3DSA:3.30.70.330coord: 108..185
e-value: 1.1E-22
score: 82.1
IPR037366BOULE/DAZ familyPANTHERPTHR11176BOULE-RELATEDcoord: 12..97
coord: 105..209
NoneNo IPR availablePANTHERPTHR11176:SF13GENE 17190-RELATEDcoord: 12..97
coord: 105..209
IPR035979RNA-binding domain superfamilySUPERFAMILYSSF54928RNA-binding domain, RBDcoord: 16..99
IPR035979RNA-binding domain superfamilySUPERFAMILYSSF54928RNA-binding domain, RBDcoord: 104..194