Diacylglycerol kinase

Overview
NameDiacylglycerol kinase
Smed IDSMED30015721
Length (bp)3371
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Diacylglycerol kinase (SMED30015721) t-SNE clustered cells

Violin plots show distribution of expression levels for Diacylglycerol kinase (SMED30015721) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Diacylglycerol kinase (SMED30015721) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Diacylglycerol kinase (SMED30015721) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30015721

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 4

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
neuronSMED30015721SMESG000023623.1 SMESG000017153.1 dd_Smed_v4_7792_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
neuronSMED30015721SMESG000023623.1 SMESG000017153.1 dd_Smed_v4_7792_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult colorimetric in situ hybridization evidence
muscle cellSMED30015721SMESG000023623.1 SMESG000017153.1 dd_Smed_v4_7792_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
headSMED30015721SMESG000023623.1 SMESG000017153.1 dd_Smed_v6_7792_0_1dd_Smed_v6PMID:28171748
Stückemann et al., 2017
whole organism asexual adult RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Diacylglycerol kinase vs. Ensembl Human
Match: DGKQ (diacylglycerol kinase theta [Source:HGNC Symbol;Acc:HGNC:2856])

HSP 1 Score: 593.193 bits (1528), Expect = 0.000e+0
Identity = 344/898 (38.31%), Postives = 507/898 (56.46%), Query Frame = 2
Query:  356 GHCFVKKNFHKPLVCHHCAETLWGLLGTTGYICQICNYLVHEKCVPQIIIPCNCVLSFVITEPAAHCWSEISHFKRKFCNVCRKRLEDVAGLRCEICEYYVHTECFDFAISNCKQCAIASTDWPSKEPNHHFREGNLPINSKCFICKKICASVECLTGLRCEWCGITVHTSCYRKIPTECTHGILHDIILPASAVSLPRTSSLIEQIYEIKRPKQEDLMAQTLVDDFSDSDSGREESGFERKSVKEKRDKEYYDFVRLYDGMARFKKKQCRYLSLGKSTSVQRVIEMSMKAFQLPFYEINNIYLVEINEKDNS-DKWLKENEPFKKQLQFDMRRPQV------ILKLKTKNVERDYISIYPGDLTXXXXXXXXXXXXXXXXXXDATTILVLALRRLGLEHMNSHKFHLVETSLDCGITERVIEKDEILWSILERLQ---KESLRAFTLTRFYIRSVAD--PYGTGGVAVYVGNLKKGLSQRLYERILIDRLTPANRWNAIEVIYYDSGSLVLIYSNAEKAESAYNILKESTFDDNALTAIILPRVETSAIPNDIHPLLVFVNVKSGGCQGTELISSFRKLLNPHQVFNLDYGGPLPGLHCYRNLTNFKILVCGGDGTVGWVLSCLDNVGQDAKCPHPPMAIVPLGTGNDLARVLRWGTGYTGAEDPLSLLKDVVEAEEIRLDRWTVMIKPNEMEKDEQKRALQLQXXXXXXXXXXXRIFLMNNYFGLGIDADLNLDFHLAREENPGKFTSRIHNKGIYFKMGLRKMVNRTKCKDLHHKITLEVDGRQXXXXXXXXXXXXXXXSWGAGANPWGFTDDVSNQKFSKPTHYDGMLEVVGVTGVVHMGQIFSGLRTGTRLAQGGHIRITLKTSVPVQVDGEPWIQSPCQITVLRSALKATML 3013
            GH F K    KP  CH C++ +WGL    G++C +CN++ HEKC+  + IPC  V   ++  P AHC+      KRKFC VCRK LE  A L CE+CE ++H +C  FA S+C+QC            +HH+REGNLP  ++C +C+K C S + L G+RCEWCG+  H+ C   +  EC  G L  ++LP + V L        Q + I    +          +  D   G    G  R++  +   +     ++++DG    ++ Q R +++ +    + V+E +++A  +P  +  ++ L  +     + D W    +     +  + R P           ++     ++ + IYPG L          +    T    A ++++  L  LG +  +   F LVE ++ C   +R +  DE    +L+RLQ   + S+R  + TRFY+    D  P+    V+++VG L  GLS   Y  +L +         ++  IY   G++VL  +   +AE  Y +LK+       LTA++LP +  + +P D  PLLVFVN KSGG +G +L+ SFRKLLNPHQVF+L  GGPLPGLH +  +  F++LVCGGDGTVGWVL  L+       CP P +AI+PLGTGNDL RVLRWG GY+G EDP S+L  V EA+ + +DRWT+++  +E    E   A          + E  +I  M+NY G+GIDA+L+LDFH AREE PGKFTSR+HNKG+Y ++GL+K+   +  + LH +I L+V+ +++ELP +EG+I +NI SWG+GA+ WG   D    +F KP   DG+LEVVGVTGVVHMGQ+  GLR+G R+AQG + R+TL  + PVQVDGEPW+Q+P  + +  +  K  ML
Sbjct:   60 GHSFRKVTLTKPTFCHLCSDFIWGL---AGFLCDVCNFMSHEKCLKHVRIPCTSVAPSLVRVPVAHCFGPRGLHKRKFCAVCRKVLEAPA-LHCEVCELHLHPDCVPFACSDCRQCHQDGHQDHDTH-HHHWREGNLPSGARCEVCRKTCGSSDVLAGVRCEWCGVQAHSLCSAALAPECGFGRLRSLVLPPACVRLLPGGFSKTQSFRIVEAAEPG--------EGGDGADGSAAVGPGRET--QATPESGKQTLKIFDGDDAVRRSQFRLVTVSRLAGAEEVLEAALRAHHIP-EDPGHLELCRLPPSSQACDAW-AGGKAGSAVISEEGRSPGSGEATPEAWVIRALPRAQEVLKIYPGWLKVGVAYVSVRVTPKST----ARSVVLEVLPLLGRQAESPESFQLVEVAMGCRHVQRTMLMDE--QPLLDRLQDIRQMSVRQVSQTRFYVAESRDVAPH----VSLFVGGLPPGLSPEEYSSLLHEAGATKATVVSVSHIYSSQGAVVLDVACFAEAERLYMLLKDMAVRGRLLTALVLPDLLHAKLPPDSCPLLVFVNPKSGGLKGRDLLCSFRKLLNPHQVFDLTNGGPLPGLHLFSQVPCFRVLVCGGDGTVGWVLGALEETRYRLACPEPSVAILPLGTGNDLGRVLRWGAGYSG-EDPFSVLLSVDEADAVLMDRWTILLDAHEAGSAENDTA----------DAEPPKIVQMSNYCGIGIDAELSLDFHQAREEEPGKFTSRLHNKGVYVRVGLQKI---SHSRSLHKQIRLQVERQEVELPSIEGLIFINIPSWGSGADLWGSDSDT---RFEKPRMDDGLLEVVGVTGVVHMGQVQGGLRSGIRIAQGSYFRVTLLKATPVQVDGEPWVQAPGHMIISAAGPKVHML 913          
BLAST of Diacylglycerol kinase vs. Ensembl Human
Match: DGKQ (diacylglycerol kinase theta [Source:HGNC Symbol;Acc:HGNC:2856])

HSP 1 Score: 581.637 bits (1498), Expect = 0.000e+0
Identity = 345/903 (38.21%), Postives = 506/903 (56.04%), Query Frame = 2
Query:  356 GHCFVKKNFHKPLVCHHCAETLWGLLGTTGYICQICNYLVHEKCVPQIIIPCNCVLSFVITEPAAHCWSEISHFKRKFCNVCRKRLEDVAGLRCEICEYYVHTECFDFAISNCKQCAIASTDWPSKEPNHHFREGNLPINSKCFICKKICASVECLTGLRCEWCGITVHTSCYRKIPTECTHGILHDIILPASAVSL-----PRTSSLIEQIYEIKRPKQEDLMAQTLVDDFSDSDSGREESGFERKSVKEKRDKEYYDFVRLYDGMARFKKKQCRYLSLGKSTSVQRVIEMSMKAFQLPFYEINNIYLVEINEKDNS-DKWLKENEPFKKQLQFDMRRPQV------ILKLKTKNVERDYISIYPGDLTXXXXXXXXXXXXXXXXXXDATTILVLALRRLGLEHMNSHKFHLVETSLDCGITERVIEKDEILWSILERLQ---KESLRAFTLTRFYIRSVAD--PYGTGGVAVYVGNLKKGLSQRLYERILIDRLTPANRWNAIEVIYYDSGSLVLIYSNAEKAESAYNILKESTFDDNALTAIILPRVETSAIPNDIHPLLVFVNVKSGGCQGTELISSFRKLLNPHQVFNLDYGGPLPGLHCYRNLTNFKILVCGGDGTVGWVLSCLDNVGQDAKCPHPPMAIVPLGTGNDLARVLRWGTGYTGAEDPLSLLKDVVEAEEIRLDRWTVMIKPNEMEKDEQKRALQLQXXXXXXXXXXXRIFLMNNYFGLGIDADLNLDFHLAREENPGKFTSRIHNKGIYFKMGLRKMVNRTKCKDLHHKITLEVDGRQXXXXXXXXXXXXXXXSWGAGANPWGFTDDVSNQKFSKPTHYDGMLEVVGVTGVVHMGQIFSGLRTGTRLAQGGHIRITLKTSVPVQVDGEPWIQSPCQITVLRSALKATML 3013
            GH F K    KP  CH C++ +WGL    G++C +CN++ HEKC+  + IPC  V   ++  P AHC+      KRKFC VCRK LE  A L CE+CE ++H +C  FA S+C+QC            +HH+REGNLP  ++C +C+K C S + L G+RCEWCG+  H+ C   +  EC  G L  ++LP + V L      +T S   +I E   P +             D   G    G  R++  +   +     ++++DG    ++ Q R +++ +    + V+E +++A  +P  +  ++ L  +     + D W    +     +  + R P           ++     ++ + IYPG L          +    T    A ++++  L  LG +  +   F LVE ++ C   +R +  DE    +L+RLQ   + S+R  + TRFY+    D  P+    V+++VG L  GLS   Y  +L +                  G++VL  +   +AE  Y +LK+       LTA++LP +  + +P D  PLLVFVN KSGG +G +L+ SFRKLLNPHQVF+L  GGPLPGLH +  +  F++LVCGGDGTVGWVL  L+       CP P +AI+PLGTGNDL RVLRWG GY+G EDP S+L  V EA+ + +DRWT+++  +E    E   A          + E  +I  M+NY G+GIDA+L+LDFH AREE PGKFTSR+HNKG+Y ++GL+K+   +  + LH +I L+V+ +++ELP +EG+I +NI SWG+GA+ WG   D    +F KP   DG+LEVVGVTGVVHMGQ+  GLR+G R+AQG + R+TL  + PVQVDGEPW+Q+P  + +  +  K  ML
Sbjct:    7 GHSFRKVTLTKPTFCHLCSDFIWGL---AGFLCDVCNFMSHEKCLKHVRIPCTSVAPSLVRVPVAHCFGPRGLHKRKFCAVCRKVLEAPA-LHCEVCELHLHPDCVPFACSDCRQCHQDGHQDHDTH-HHHWREGNLPSGARCEVCRKTCGSSDVLAGVRCEWCGVQAHSLCSAALAPECGFGRLRSLVLPPACVRLLPGGFSKTQSF--RIVEAAEPGEG-----------GDGADGSAAVGPGRET--QATPESGKQTLKIFDGDDAVRRSQFRLVTVSRLAGAEEVLEAALRAHHIP-EDPGHLELCRLPPSSQACDAW-AGGKAGSAVISEEGRSPGSGEATPEAWVIRALPRAQEVLKIYPGWLKVGVAYVSVRVTPKST----ARSVVLEVLPLLGRQAESPESFQLVEVAMGCRHVQRTMLMDE--QPLLDRLQDIRQMSVRQVSQTRFYVAESRDVAPH----VSLFVGGLPPGLSPEEYSSLLHE-------------AGATKGAVVLDVACFAEAERLYMLLKDMAVRGRLLTALVLPDLLHAKLPPDSCPLLVFVNPKSGGLKGRDLLCSFRKLLNPHQVFDLTNGGPLPGLHLFSQVPCFRVLVCGGDGTVGWVLGALEETRYRLACPEPSVAILPLGTGNDLGRVLRWGAGYSG-EDPFSVLLSVDEADAVLMDRWTILLDAHEAGSAENDTA----------DAEPPKIVQMSNYCGIGIDAELSLDFHQAREEEPGKFTSRLHNKGVYVRVGLQKI---SHSRSLHKQIRLQVERQEVELPSIEGLIFINIPSWGSGADLWGSDSDT---RFEKPRMDDGLLEVVGVTGVVHMGQVQGGLRSGIRIAQGSYFRVTLLKATPVQVDGEPWVQAPGHMIISAAGPKVHML 847          
BLAST of Diacylglycerol kinase vs. Ensembl Human
Match: DGKB (diacylglycerol kinase beta [Source:HGNC Symbol;Acc:HGNC:2850])

HSP 1 Score: 273.092 bits (697), Expect = 3.007e-77
Identity = 155/369 (42.01%), Postives = 219/369 (59.35%), Query Frame = 2
Query: 1952 VETSAIPNDIHPLLVFVNVKSGGCQGTELISSFRKLLNPHQVFNLDYGGPLPGLHCYRNLTNFKILVCGGDGTVGWVLSCLD--NVGQDAKCPHPPMAIVPLGTGNDLARVLRWGTGYTGAEDPLSLLKDVVEAEEIRLDRWTVMIKPNEMEKDEQKRALQLQXXXXXXXXXXXRIFLMNNYFGLGIDADLNLDFHLAREENPGKFTSRIHNKGIYFKMGLRKMVNRTKCKDLHHKITLEVDGRQXXXXXXXXXXXXXXX--SWGAGANPWGFTD--------------------DVSNQKFSKPTHYDGMLEVVGVTGVVHMGQIFSGLRT-GTRLAQGGHIRITLKTSVPVQVDGEPWIQSPCQITV 2983
            ++ + +P   HPLLVFVN KSGG QG  +   F+ LLNP QV++L   GP+PGL+ +R++ +F++L CGGDGTVGWVL C++  NVG+     HPP+AI+PLGTGNDLAR LRWG GY G E+ + +LKD+  + EI LDRW   + PN  +KDE+   +                 ++NNYF +G+DA +   FH+ RE++P KF SR+ NK  YF+ G  +  + T CK LH  + +E DG QI+L  +    I  +   S   G+N WG +                     D    KF+     D +LEVVG+ G + MGQI++GL++ G RLAQ   + I    S+P+Q+DGEPW+Q+PC I +
Sbjct:  420 LQVTPVPG-THPLLVFVNPKSGGKQGERIYRKFQYLLNPRQVYSLSGNGPMPGLNFFRDVPDFRVLACGGDGTVGWVLDCIEKANVGK-----HPPVAILPLGTGNDLARCLRWGGGYEG-ENLMKILKDIENSTEIMLDRWKFEVIPN--DKDEKGDPVPYS--------------IINNYFSIGVDASIAHRFHIMREKHPEKFNSRMKNKFWYFEFGTSETFSAT-CKKLHESVEIECDGVQIDLINISLEGIAILNIPSMHGGSNLWGESKKRRSHRRIEKKGSDKRTTVTDAKELKFASQDLSDQLLEVVGLEGAMEMGQIYTGLKSAGRRLAQCSCVVIRTSKSLPMQIDGEPWMQTPCTIKI 764          

HSP 2 Score: 80.8777 bits (198), Expect = 9.921e-15
Identity = 49/139 (35.25%), Postives = 68/139 (48.92%), Query Frame = 2
Query:  533 ITEPAAHCWSEISHF-KRKFCNVCRKRLEDVA--GLRCEICEYYVHTECFDFAISNCKQCAIASTDWPSKEPNHHFREGNLPINSKCFICKKICASVECLTGLRCEWCGITVHTSCYRKIPTECTHGILHDIILPASAV 940
            + +   H W  + HF K  +CN+C   L  V   GL C  C+Y VH  C   A  +C +  + S    +   +H++ EGN P  +KC  C K     + LTGL C WC IT+H  C   +  EC  G L D ILP + +
Sbjct:  232 VKDDGQHVW-RLKHFNKPAYCNLCLNMLIGVGKQGLCCSFCKYTVHERCVARAPPSCIKTYVKSKR-NTDVMHHYWVEGNCP--TKCDKCHKTVKCYQGLTGLHCVWCQITLHNKCASHLKPECDCGPLKDHILPPTTI 366          

HSP 3 Score: 56.225 bits (134), Expect = 3.970e-7
Identity = 36/119 (30.25%), Postives = 57/119 (47.90%), Query Frame = 2
Query:  359 HCFVKKNFHKPLVCHHCAETLWGLLGTTGYICQICNYLVHEKCVPQIIIPCNCVLSFVI----TEPAAHCWSEISHFKRKFCNVCRKRL---EDVAGLRCEICEYYVHTECFDFAISNC 694
            H +  K+F+KP  C+ C   L G+ G  G  C  C Y VHE+CV +   P +C+ ++V     T+   H W E +   +  C+ C K +   + + GL C  C+  +H +C       C
Sbjct:  238 HVWRLKHFNKPAYCNLCLNMLIGV-GKQGLCCSFCKYTVHERCVAR--APPSCIKTYVKSKRNTDVMHHYWVEGNCPTK--CDKCHKTVKCYQGLTGLHCVWCQITLHNKCASHLKPEC 351          
BLAST of Diacylglycerol kinase vs. Ensembl Human
Match: DGKB (diacylglycerol kinase beta [Source:HGNC Symbol;Acc:HGNC:2850])

HSP 1 Score: 273.092 bits (697), Expect = 3.344e-77
Identity = 155/369 (42.01%), Postives = 219/369 (59.35%), Query Frame = 2
Query: 1952 VETSAIPNDIHPLLVFVNVKSGGCQGTELISSFRKLLNPHQVFNLDYGGPLPGLHCYRNLTNFKILVCGGDGTVGWVLSCLD--NVGQDAKCPHPPMAIVPLGTGNDLARVLRWGTGYTGAEDPLSLLKDVVEAEEIRLDRWTVMIKPNEMEKDEQKRALQLQXXXXXXXXXXXRIFLMNNYFGLGIDADLNLDFHLAREENPGKFTSRIHNKGIYFKMGLRKMVNRTKCKDLHHKITLEVDGRQXXXXXXXXXXXXXXX--SWGAGANPWGFTD--------------------DVSNQKFSKPTHYDGMLEVVGVTGVVHMGQIFSGLRT-GTRLAQGGHIRITLKTSVPVQVDGEPWIQSPCQITV 2983
            ++ + +P   HPLLVFVN KSGG QG  +   F+ LLNP QV++L   GP+PGL+ +R++ +F++L CGGDGTVGWVL C++  NVG+     HPP+AI+PLGTGNDLAR LRWG GY G E+ + +LKD+  + EI LDRW   + PN  +KDE+   +                 ++NNYF +G+DA +   FH+ RE++P KF SR+ NK  YF+ G  +  + T CK LH  + +E DG QI+L  +    I  +   S   G+N WG +                     D    KF+     D +LEVVG+ G + MGQI++GL++ G RLAQ   + I    S+P+Q+DGEPW+Q+PC I +
Sbjct:  427 LQVTPVPG-THPLLVFVNPKSGGKQGERIYRKFQYLLNPRQVYSLSGNGPMPGLNFFRDVPDFRVLACGGDGTVGWVLDCIEKANVGK-----HPPVAILPLGTGNDLARCLRWGGGYEG-ENLMKILKDIENSTEIMLDRWKFEVIPN--DKDEKGDPVPYS--------------IINNYFSIGVDASIAHRFHIMREKHPEKFNSRMKNKFWYFEFGTSETFSAT-CKKLHESVEIECDGVQIDLINISLEGIAILNIPSMHGGSNLWGESKKRRSHRRIEKKGSDKRTTVTDAKELKFASQDLSDQLLEVVGLEGAMEMGQIYTGLKSAGRRLAQCSCVVIRTSKSLPMQIDGEPWMQTPCTIKI 771          

HSP 2 Score: 80.8777 bits (198), Expect = 9.816e-15
Identity = 49/139 (35.25%), Postives = 68/139 (48.92%), Query Frame = 2
Query:  533 ITEPAAHCWSEISHF-KRKFCNVCRKRLEDVA--GLRCEICEYYVHTECFDFAISNCKQCAIASTDWPSKEPNHHFREGNLPINSKCFICKKICASVECLTGLRCEWCGITVHTSCYRKIPTECTHGILHDIILPASAV 940
            + +   H W  + HF K  +CN+C   L  V   GL C  C+Y VH  C   A  +C +  + S    +   +H++ EGN P  +KC  C K     + LTGL C WC IT+H  C   +  EC  G L D ILP + +
Sbjct:  239 VKDDGQHVW-RLKHFNKPAYCNLCLNMLIGVGKQGLCCSFCKYTVHERCVARAPPSCIKTYVKSKR-NTDVMHHYWVEGNCP--TKCDKCHKTVKCYQGLTGLHCVWCQITLHNKCASHLKPECDCGPLKDHILPPTTI 373          

HSP 3 Score: 56.225 bits (134), Expect = 3.753e-7
Identity = 36/119 (30.25%), Postives = 57/119 (47.90%), Query Frame = 2
Query:  359 HCFVKKNFHKPLVCHHCAETLWGLLGTTGYICQICNYLVHEKCVPQIIIPCNCVLSFVI----TEPAAHCWSEISHFKRKFCNVCRKRL---EDVAGLRCEICEYYVHTECFDFAISNC 694
            H +  K+F+KP  C+ C   L G+ G  G  C  C Y VHE+CV +   P +C+ ++V     T+   H W E +   +  C+ C K +   + + GL C  C+  +H +C       C
Sbjct:  245 HVWRLKHFNKPAYCNLCLNMLIGV-GKQGLCCSFCKYTVHERCVAR--APPSCIKTYVKSKRNTDVMHHYWVEGNCPTK--CDKCHKTVKCYQGLTGLHCVWCQITLHNKCASHLKPEC 358          
BLAST of Diacylglycerol kinase vs. Ensembl Human
Match: DGKB (diacylglycerol kinase beta [Source:HGNC Symbol;Acc:HGNC:2850])

HSP 1 Score: 272.707 bits (696), Expect = 4.095e-77
Identity = 155/369 (42.01%), Postives = 219/369 (59.35%), Query Frame = 2
Query: 1952 VETSAIPNDIHPLLVFVNVKSGGCQGTELISSFRKLLNPHQVFNLDYGGPLPGLHCYRNLTNFKILVCGGDGTVGWVLSCLD--NVGQDAKCPHPPMAIVPLGTGNDLARVLRWGTGYTGAEDPLSLLKDVVEAEEIRLDRWTVMIKPNEMEKDEQKRALQLQXXXXXXXXXXXRIFLMNNYFGLGIDADLNLDFHLAREENPGKFTSRIHNKGIYFKMGLRKMVNRTKCKDLHHKITLEVDGRQXXXXXXXXXXXXXXX--SWGAGANPWGFTD--------------------DVSNQKFSKPTHYDGMLEVVGVTGVVHMGQIFSGLRT-GTRLAQGGHIRITLKTSVPVQVDGEPWIQSPCQITV 2983
            ++ + +P   HPLLVFVN KSGG QG  +   F+ LLNP QV++L   GP+PGL+ +R++ +F++L CGGDGTVGWVL C++  NVG+     HPP+AI+PLGTGNDLAR LRWG GY G E+ + +LKD+  + EI LDRW   + PN  +KDE+   +                 ++NNYF +G+DA +   FH+ RE++P KF SR+ NK  YF+ G  +  + T CK LH  + +E DG QI+L  +    I  +   S   G+N WG +                     D    KF+     D +LEVVG+ G + MGQI++GL++ G RLAQ   + I    S+P+Q+DGEPW+Q+PC I +
Sbjct:  428 LQVTPVPG-THPLLVFVNPKSGGKQGERIYRKFQYLLNPRQVYSLSGNGPMPGLNFFRDVPDFRVLACGGDGTVGWVLDCIEKANVGK-----HPPVAILPLGTGNDLARCLRWGGGYEG-ENLMKILKDIENSTEIMLDRWKFEVIPN--DKDEKGDPVPYS--------------IINNYFSIGVDASIAHRFHIMREKHPEKFNSRMKNKFWYFEFGTSETFSAT-CKKLHESVEIECDGVQIDLINISLEGIAILNIPSMHGGSNLWGESKKRRSHRRIEKKGSDKRTTVTDAKELKFASQDLSDQLLEVVGLEGAMEMGQIYTGLKSAGRRLAQCSCVVIRTSKSLPMQIDGEPWMQTPCTIKI 772          

HSP 2 Score: 80.8777 bits (198), Expect = 1.008e-14
Identity = 49/139 (35.25%), Postives = 68/139 (48.92%), Query Frame = 2
Query:  533 ITEPAAHCWSEISHF-KRKFCNVCRKRLEDVA--GLRCEICEYYVHTECFDFAISNCKQCAIASTDWPSKEPNHHFREGNLPINSKCFICKKICASVECLTGLRCEWCGITVHTSCYRKIPTECTHGILHDIILPASAV 940
            + +   H W  + HF K  +CN+C   L  V   GL C  C+Y VH  C   A  +C +  + S    +   +H++ EGN P  +KC  C K     + LTGL C WC IT+H  C   +  EC  G L D ILP + +
Sbjct:  239 VKDDGQHVW-RLKHFNKPAYCNLCLNMLIGVGKQGLCCSFCKYTVHERCVARAPPSCIKTYVKSKR-NTDVMHHYWVEGNCP--TKCDKCHKTVKCYQGLTGLHCVWCQITLHNKCASHLKPECDCGPLKDHILPPTTI 373          

HSP 3 Score: 56.225 bits (134), Expect = 3.885e-7
Identity = 36/119 (30.25%), Postives = 57/119 (47.90%), Query Frame = 2
Query:  359 HCFVKKNFHKPLVCHHCAETLWGLLGTTGYICQICNYLVHEKCVPQIIIPCNCVLSFVI----TEPAAHCWSEISHFKRKFCNVCRKRL---EDVAGLRCEICEYYVHTECFDFAISNC 694
            H +  K+F+KP  C+ C   L G+ G  G  C  C Y VHE+CV +   P +C+ ++V     T+   H W E +   +  C+ C K +   + + GL C  C+  +H +C       C
Sbjct:  245 HVWRLKHFNKPAYCNLCLNMLIGV-GKQGLCCSFCKYTVHERCVAR--APPSCIKTYVKSKRNTDVMHHYWVEGNCPTK--CDKCHKTVKCYQGLTGLHCVWCQITLHNKCASHLKPEC 358          
BLAST of Diacylglycerol kinase vs. Ensembl Celegans
Match: dgk-1 (Diacylglycerol kinase [Source:UniProtKB/TrEMBL;Acc:Q58AU5])

HSP 1 Score: 736.487 bits (1900), Expect = 0.000e+0
Identity = 398/893 (44.57%), Postives = 556/893 (62.26%), Query Frame = 2
Query:  356 GHCFVKKNFHKPLVCHHCAETLWGLLGTTGYICQICNYLVHEKCVPQIIIPCNCVLSFVITEPAAHCWSEISHFKRKFCNVCRKRLEDVAGLRCEICEYYVHTECFDFAISNCKQCA--IASTDWPSKEPNHHFREGNLPINSKCFICKKICASVECLTGLRCEWCGITVHTSCYRKIPTECTHGILHDIILPASAVSLPRTSSLIEQIYEIK---RPKQEDLMAQTLVDDFSDSDSGREESGFERKSVKEKRDKEYYDFVRLYDGMARFKKKQCRYLSLGKSTSVQRVIEMSMKAFQLPFYEINNIYLVEINEKDNSDKWLKENEPFKKQLQFDMRRPQVILKLKTKNVERDYISIYPGDLTXXXXXXXXXXXXXXXXXXDATTILVLALRRLGLEHMNSHKFHLVETSLDCGITERVIEKDEILWSILERLQKESLRAFTLTRFYIRSVADPYGTGGVAVYVGNLKKGLSQRLYERILIDRLTPANR-WNAIEVIYYDSGSLVLIYSNAEKAESAYNILKESTFDDNALTAIILPRVETSAIPNDIHPLLVFVNVKSGGCQGTELISSFRKLLNPHQVFNLDYGGPLPGLHCYRNLTNFKILVCGGDGTVGWVLSCLDNVGQDAKCPHPPMAIVPLGTGNDLARVLRWGTGYTGAEDPLSLLKDVVEAEEIRLDRWTVMIKPNEMEK-DEQKRALQLQXXXXXXXXXXXRIFLMNNYFGLGIDADLNLDFHLAREENPGKFTSRIHNKGIYFKMGLRKMVNRTKCKDLHHKITLEVDGRQXXXXXXXXXXXXXXXSWGAGANPWGFTDDVSNQKFSKPTHYDGMLEVVGVTGVVHMGQIFSGLRTGTRLAQGGHIRITLKTSVPVQVDGEPWIQSPCQITVLRSALKATML 3013
            GH FVKK F KP  CHHC + +WG+L TTGY C++CN++ HEKC+  ++  C+ V   +I  P AH WS     KRK+C VCRKR +D   + CE+CEYYVH +C D A+S+CK+ A  +A+ +  +    HH REGNLP  SKC +C+K C S ECL G+RCEWCG T H  CYR++  EC  G+L  I+LP   +++PRT   +EQ+  I    +P+     ++   DD S S           + VKE+ D   ++ +R++DG   ++ +  R + + K  SVQ+V + +++ F +   +    Y +     +  ++ L++  P +   + + +R Q+ ++    + ++D + +Y G L K             T+  D  T    AL   GL+    ++++L+E SLD G+ ER     E +  ++  L+K+SLR + + RFY++   DP+     AV+VGNL   L+QR YERIL+  L    + + AI  IY++ GSL++ ++  + A +A   L+ + +++  L  + LP V+   IP D+ PLLV VNVKSGGCQGTELI SFRKLLNP QVF++  GGPL GL+ +RN+  +KIL CGGDGT+GWVL CLD   QDA C  PP  IVPLGTGNDLARVLRWG GYTG E+P+ +LKDV+EA+ ++LDRW V+    E  +        ++     N  E+ T + +MNNYFG+GIDAD+ L FH  R+ NP KF SR+ NK  Y K+GL+KM     CKDL  +I LEVDGR IELP +EGI++LN+LSWG+GANPWG + +  N  FSKPTHYDG+LEVVG++ V  +G I S L  G R+AQGG IRIT     PVQVDGEP IQ P  IT+L+SALKA ML
Sbjct:   20 GHYFVKKTFGKPAYCHHCCDKIWGML-TTGYSCEMCNFVCHEKCLRTVVSYCSSVALQLIKNPVAHTWSAPCLIKRKYCCVCRKRTDDALSVECEVCEYYVHVDCSDLAVSDCKEAATYVANMESANTVQYHHMREGNLPKESKCIVCRKTCFSTECLAGMRCEWCGQTAHAVCYRQMDKECDFGVLRKIMLPPMCLTIPRTELPMEQLLNISSHDQPQSLSSPSKIQADDVSTSG----------EDVKERED---FEIIRVFDGNNSYRSQISRNIVVAKHVSVQQVRDAALRRFHI--NDTPERYYITQVVGEVEEEILEDPVPLRNVKRPEGKRAQIFIRY-YDDPDKDEVKVYGGWLRKVPVTFCAISVSKDTVVQDLVTD---ALYHFGLDGSCWNRYNLIEVSLDRGVAERTCNPQENVLQLVRNLRKDSLRRYHVVRFYVQEKEDPHDH---AVFVGNLPVSLAQRQYERILLKLLGAKEKPFTAIGPIYFEYGSLIITFNTPKAATAAVQKLQSAIYEEKKLIVLCLPNVQPQMIPKDVEPLLVLVNVKSGGCQGTELIQSFRKLLNPFQVFDVLNGGPLVGLYVFRNIPKYKILACGGDGTIGWVLQCLDIAKQDAACFSPPCGIVPLGTGNDLARVLRWGGGYTGEENPMDILKDVIEADTVKLDRWAVVFHEEERNQPTSSGNQTEMNEQTMNNPEDQTSMIIMNNYFGIGIDADVCLKFHNKRDANPEKFQSRLFNKTQYAKIGLQKMFFERTCKDLWKRIELEVDGRIIELPNIEGIVVLNLLSWGSGANPWGTSKEEGN--FSKPTHYDGLLEVVGISDVSRLGLIQSKLAAGIRIAQGGSIRITTHEEWPVQVDGEPHIQPPGTITILKSALKAQML 887          
BLAST of Diacylglycerol kinase vs. Ensembl Celegans
Match: dgk-1 (Diacylglycerol kinase [Source:UniProtKB/TrEMBL;Acc:Q58AU5])

HSP 1 Score: 736.102 bits (1899), Expect = 0.000e+0
Identity = 397/893 (44.46%), Postives = 557/893 (62.37%), Query Frame = 2
Query:  356 GHCFVKKNFHKPLVCHHCAETLWGLLGTTGYICQICNYLVHEKCVPQIIIPCNCVLSFVITEPAAHCWSEISHFKRKFCNVCRKRLEDVAGLRCEICEYYVHTECFDFAISNCKQCA--IASTDWPSKEPNHHFREGNLPINSKCFICKKICASVECLTGLRCEWCGITVHTSCYRKIPTECTHGILHDIILPASAVSLPRTSSLIEQIYEIK---RPKQEDLMAQTLVDDFSDSDSGREESGFERKSVKEKRDKEYYDFVRLYDGMARFKKKQCRYLSLGKSTSVQRVIEMSMKAFQLPFYEINNIYLVEINEKDNSDKWLKENEPFKKQLQFDMRRPQVILKLKTKNVERDYISIYPGDLTXXXXXXXXXXXXXXXXXXDATTILVLALRRLGLEHMNSHKFHLVETSLDCGITERVIEKDEILWSILERLQKESLRAFTLTRFYIRSVADPYGTGGVAVYVGNLKKGLSQRLYERILIDRLTPANR-WNAIEVIYYDSGSLVLIYSNAEKAESAYNILKESTFDDNALTAIILPRVETSAIPNDIHPLLVFVNVKSGGCQGTELISSFRKLLNPHQVFNLDYGGPLPGLHCYRNLTNFKILVCGGDGTVGWVLSCLDNVGQDAKCPHPPMAIVPLGTGNDLARVLRWGTGYTGAEDPLSLLKDVVEAEEIRLDRWTVMIKPNEMEK-DEQKRALQLQXXXXXXXXXXXRIFLMNNYFGLGIDADLNLDFHLAREENPGKFTSRIHNKGIYFKMGLRKMVNRTKCKDLHHKITLEVDGRQXXXXXXXXXXXXXXXSWGAGANPWGFTDDVSNQKFSKPTHYDGMLEVVGVTGVVHMGQIFSGLRTGTRLAQGGHIRITLKTSVPVQVDGEPWIQSPCQITVLRSALKATML 3013
            GH FVKK F KP  CHHC + +WG+L TTGY C++CN++ HEKC+  ++  C+ V   +I  P AH WS     KRK+C VCRKR +D   + CE+CEYYVH +C D A+S+CK+ A  +A+ +  +    HH REGNLP  SKC +C+K C S ECL G+RCEWCG T H  CYR++  EC  G+L  I+LP   +++PRT   +EQ+  I    +P+   + + + +     S SG +        VKE+ D   ++ +R++DG   ++ +  R + + K  SVQ+V + +++ F +   +    Y +     +  ++ L++  P +   + + +R Q+ ++    + ++D + +Y G L K             T+  D  T    AL   GL+    ++++L+E SLD G+ ER     E +  ++  L+K+SLR + + RFY++   DP+     AV+VGNL   L+QR YERIL+  L    + + AI  IY++ GSL++ ++  + A +A   L+ + +++  L  + LP V+   IP D+ PLLV VNVKSGGCQGTELI SFRKLLNP QVF++  GGPL GL+ +RN+  +KIL CGGDGT+GWVL CLD   QDA C  PP  IVPLGTGNDLARVLRWG GYTG E+P+ +LKDV+EA+ ++LDRW V+    E  +        ++     N  E+ T + +MNNYFG+GIDAD+ L FH  R+ NP KF SR+ NK  Y K+GL+KM     CKDL  +I LEVDGR IELP +EGI++LN+LSWG+GANPWG + +  N  FSKPTHYDG+LEVVG++ V  +G I S L  G R+AQGG IRIT     PVQVDGEP IQ P  IT+L+SALKA ML
Sbjct:   20 GHYFVKKTFGKPAYCHHCCDKIWGML-TTGYSCEMCNFVCHEKCLRTVVSYCSSVALQLIKNPVAHTWSAPCLIKRKYCCVCRKRTDDALSVECEVCEYYVHVDCSDLAVSDCKEAATYVANMESANTVQYHHMREGNLPKESKCIVCRKTCFSTECLAGMRCEWCGQTAHAVCYRQMDKECDFGVLRKIMLPPMCLTIPRTELPMEQLLNISSHDQPQSRKVSSPSKIQADDVSTSGED--------VKERED---FEIIRVFDGNNSYRSQISRNIVVAKHVSVQQVRDAALRRFHI--NDTPERYYITQVVGEVEEEILEDPVPLRNVKRPEGKRAQIFIRY-YDDPDKDEVKVYGGWLRKVPVTFCAISVSKDTVVQDLVTD---ALYHFGLDGSCWNRYNLIEVSLDRGVAERTCNPQENVLQLVRNLRKDSLRRYHVVRFYVQEKEDPHDH---AVFVGNLPVSLAQRQYERILLKLLGAKEKPFTAIGPIYFEYGSLIITFNTPKAATAAVQKLQSAIYEEKKLIVLCLPNVQPQMIPKDVEPLLVLVNVKSGGCQGTELIQSFRKLLNPFQVFDVLNGGPLVGLYVFRNIPKYKILACGGDGTIGWVLQCLDIAKQDAACFSPPCGIVPLGTGNDLARVLRWGGGYTGEENPMDILKDVIEADTVKLDRWAVVFHEEERNQPTSSGNQTEMNEQTMNNPEDQTSMIIMNNYFGIGIDADVCLKFHNKRDANPEKFQSRLFNKTQYAKIGLQKMFFERTCKDLWKRIELEVDGRIIELPNIEGIVVLNLLSWGSGANPWGTSKEEGN--FSKPTHYDGLLEVVGISDVSRLGLIQSKLAAGIRIAQGGSIRITTHEEWPVQVDGEPHIQPPGTITILKSALKAQML 889          
BLAST of Diacylglycerol kinase vs. Ensembl Celegans
Match: dgk-1 (Diacylglycerol kinase [Source:UniProtKB/TrEMBL;Acc:Q58AU5])

HSP 1 Score: 707.212 bits (1824), Expect = 0.000e+0
Identity = 390/890 (43.82%), Postives = 535/890 (60.11%), Query Frame = 2
Query:  356 GHCFVKKNFHKPLVCHHCAETLWGLLGTTGYICQICNYLVHEKCVPQIIIPCNCVLSFVITEPAAHCWSEISHFKRKFCNVCRKRLEDVAGLRCEICEYYVHTECFDFAISNCKQCA--IASTDWPSKEPNHHFREGNLPINSKCFICKKICASVECLTGLRCEWCGITVHTSCYRKIPTECTHGILHDIILPASAVSLPRTSSLIEQIYEIKRPKQEDLMAQTLVDDFSDSDSGREESGFERKSVKEKRDKEYYDFVRLYDGMARFKKKQCRYLSLGKSTSVQRVIEMSMKAFQLPFYEINNIYLVEINEKDNSDKWLKENEPFKKQLQFDMRRPQVILKLKTKNVERDYISIYPGDLTXXXXXXXXXXXXXXXXXXDATTILVLALRRLGLEHMNSHKFHLVETSLDCGITERVIEKDEILWSILERLQKESLRAFTLTRFYIRSVADPYGTGGVAVYVGNLKKGLSQRLYERILIDRLTPANR-WNAIEVIYYDSGSLVLIYSNAEKAESAYNILKESTFDDNALTAIILPRVETSAIPNDIHPLLVFVNVKSGGCQGTELISSFRKLLNPHQVFNLDYGGPLPGLHCYRNLTNFKILVCGGDGTVGWVLSCLDNVGQDAKCPHPPMAIVPLGTGNDLARVLRWGTGYTGAEDPLSLLKDVVEAEEIRLDRWTVMIKPNEMEK-DEQKRALQLQXXXXXXXXXXXRIFLMNNYFGLGIDADLNLDFHLAREENPGKFTSRIHNKGIYFKMGLRKMVNRTKCKDLHHKITLEVDGRQXXXXXXXXXXXXXXXSWGAGANPWGFTDDVSNQKFSKPTHYDGMLEVVGVTGVVHMGQIFSGLRTGTRLAQGGHIRITLKTSVPVQVDGEPWIQSPCQITVLRSALKATML 3013
            GH FVKK F KP  CHHC + +WG+L TTGY C++CN++ HEKC+  ++  C+ V   +I  P AH WS     KRK+C VCRKR +D   + CE+CEYYVH +C D A+S+CK+ A  +A+ +  +    HH REGNLP  SKC +C+K C S ECL G+RCEWCG T H  CYR++  EC  G+L  I+LP   +++PRT   +EQ+  I                 S  D  +   G                          F     R + + K  SVQ+V + +++ F +   +    Y +     +  ++ L++  P +   + + +R Q+ ++    + ++D + +Y G L K             T+  D  T    AL   GL+    ++++L+E SLD G+ ER     E +  ++  L+K+SLR + + RFY++   DP+     AV+VGNL   L+QR YERIL+  L    + + AI  IY++ GSL++ ++  + A +A   L+ + +++  L  + LP V+   IP D+ PLLV VNVKSGGCQGTELI SFRKLLNP QVF++  GGPL GL+ +RN+  +KIL CGGDGT+GWVL CLD   QDA C  PP  IVPLGTGNDLARVLRWG GYTG E+P+ +LKDV+EA+ ++LDRW V+    E  +        ++     N  E+ T + +MNNYFG+GIDAD+ L FH  R+ NP KF SR+ NK  Y K+GL+KM     CKDL  +I LEVDGR IELP +EGI++LN+LSWG+GANPWG + +  N  FSKPTHYDG+LEVVG++ V  +G I S L  G R+AQGG IRIT     PVQVDGEP IQ P  IT+L+SALKA ML
Sbjct:   20 GHYFVKKTFGKPAYCHHCCDKIWGML-TTGYSCEMCNFVCHEKCLRTVVSYCSSVALQLIKNPVAHTWSAPCLIKRKYCCVCRKRTDDALSVECEVCEYYVHVDCSDLAVSDCKEAATYVANMESANTVQYHHMREGNLPKESKCIVCRKTCFSTECLAGMRCEWCGQTAHAVCYRQMDKECDFGVLRKIMLPPMCLTIPRTELPMEQLLNI-----------------SSHDQPQSRKG------------------------QIFHYPISRNIVVAKHVSVQQVRDAALRRFHI--NDTPERYYITQVVGEVEEEILEDPVPLRNVKRPEGKRAQIFIRY-YDDPDKDEVKVYGGWLRKVPVTFCAISVSKDTVVQDLVTD---ALYHFGLDGSCWNRYNLIEVSLDRGVAERTCNPQENVLQLVRNLRKDSLRRYHVVRFYVQEKEDPHDH---AVFVGNLPVSLAQRQYERILLKLLGAKEKPFTAIGPIYFEYGSLIITFNTPKAATAAVQKLQSAIYEEKKLIVLCLPNVQPQMIPKDVEPLLVLVNVKSGGCQGTELIQSFRKLLNPFQVFDVLNGGPLVGLYVFRNIPKYKILACGGDGTIGWVLQCLDIAKQDAACFSPPCGIVPLGTGNDLARVLRWGGGYTGEENPMDILKDVIEADTVKLDRWAVVFHEEERNQPTSSGNQTEMNEQTMNNPEDQTSMIIMNNYFGIGIDADVCLKFHNKRDANPEKFQSRLFNKTQYAKIGLQKMFFERTCKDLWKRIELEVDGRIIELPNIEGIVVLNLLSWGSGANPWGTSKEEGN--FSKPTHYDGLLEVVGISDVSRLGLIQSKLAAGIRIAQGGSIRITTHEEWPVQVDGEPHIQPPGTITILKSALKAQML 856          
BLAST of Diacylglycerol kinase vs. Ensembl Celegans
Match: dgk-1 (Diacylglycerol kinase [Source:UniProtKB/TrEMBL;Acc:Q58AU5])

HSP 1 Score: 461.84 bits (1187), Expect = 2.019e-147
Identity = 247/459 (53.81%), Postives = 317/459 (69.06%), Query Frame = 2
Query: 1643 KESLRAFTLTRFYIRSVADPYGTGGVAVYVGNLKKGLSQRLYERILIDRLTPANR-WNAIEVIYYDSGSLVLIYSNAEKAESAYNILKESTFDDNALTAIILPRVETSAIPNDIHPLLVFVNVKSGGCQGTELISSFRKLLNPHQVFNLDYGGPLPGLHCYRNLTNFKILVCGGDGTVGWVLSCLDNVGQDAKCPHPPMAIVPLGTGNDLARVLRWGTGYTGAEDPLSLLKDVVEAEEIRLDRWTVMIKPNEMEK-DEQKRALQLQXXXXXXXXXXXRIFLMNNYFGLGIDADLNLDFHLAREENPGKFTSRIHNKGIYFKMGLRKMVNRTKCKDLHHKITLEVDGRQXXXXXXXXXXXXXXXSWGAGANPWGFTDDVSNQKFSKPTHYDGMLEVVGVTGVVHMGQIFSGLRTGTRLAQGGHIRITLKTSVPVQVDGEPWIQSPCQITVLRSALKATML 3013
            ++SLR + + RFY++   DP+     AV+VGNL   L+QR YERIL+  L    + + AI  IY++ GSL++ ++  + A +A   L+ + +++  L  + LP V+   IP D+ PLLV VNVKSGGCQGTELI SFRKLLNP QVF++  GGPL GL+ +RN+  +KIL CGGDGT+GWVL CLD   QDA C  PP  IVPLGTGNDLARVLRWG GYTG E+P+ +LKDV+EA+ ++LDRW V+    E  +        ++     N  E+ T + +MNNYFG+GIDAD+ L FH  R+ NP KF SR+ NK  Y K+GL+KM     CKDL  +I LEVDGR IELP +EGI++LN+LSWG+GANPWG + +  N  FSKPTHYDG+LEVVG++ V  +G I S L  G R+AQGG IRIT     PVQVDGEP IQ P  IT+L+SALKA ML
Sbjct:  278 QDSLRRYHVVRFYVQEKEDPHDH---AVFVGNLPVSLAQRQYERILLKLLGAKEKPFTAIGPIYFEYGSLIITFNTPKAATAAVQKLQSAIYEEKKLIVLCLPNVQPQMIPKDVEPLLVLVNVKSGGCQGTELIQSFRKLLNPFQVFDVLNGGPLVGLYVFRNIPKYKILACGGDGTIGWVLQCLDIAKQDAACFSPPCGIVPLGTGNDLARVLRWGGGYTGEENPMDILKDVIEADTVKLDRWAVVFHEEERNQPTSSGNQTEMNEQTMNNPEDQTSMIIMNNYFGIGIDADVCLKFHNKRDANPEKFQSRLFNKTQYAKIGLQKMFFERTCKDLWKRIELEVDGRIIELPNIEGIVVLNLLSWGSGANPWGTSKEEGN--FSKPTHYDGLLEVVGISDVSRLGLIQSKLAAGIRIAQGGSIRITTHEEWPVQVDGEPHIQPPGTITILKSALKAQML 731          

HSP 2 Score: 246.514 bits (628), Expect = 1.764e-68
Identity = 116/273 (42.49%), Postives = 166/273 (60.81%), Query Frame = 2
Query:  356 GHCFVKKNFHKPLVCHHCAETLWGLLGTTGYICQICNYLVHEKCVPQIIIPCNCVLSFVITEPAAHCWSEISHFKRKFCNVCRKRLEDVAGLRCEICEYYVHTECFDFAISNCKQCA--IASTDWPSKEPNHHFREGNLPINSKCFICKKICASVECLTGLRCEWCGITVHTSCYRKIPTECTHGILHDIILPASAVSLPRTSSLIEQIYEIK---RPKQEDLMAQTLVDDFSDSDSGREESGFERKSVKEKRDKEYYDFVRLYDGMARFKKK 1159
            GH FVKK F KP  CHHC + +WG+L TTGY C++CN++ HEKC+  ++  C+ V   +I  P AH WS     KRK+C VCRKR +D   + CE+CEYYVH +C D A+S+CK+ A  +A+ +  +    HH REGNLP  SKC +C+K C S ECL G+RCEWCG T H  CYR++  EC  G+L  I+LP   +++PRT   +EQ+  I    +P+     ++   DD S S           + VKE+ D   ++ +R++DG   ++ +
Sbjct:   20 GHYFVKKTFGKPAYCHHCCDKIWGML-TTGYSCEMCNFVCHEKCLRTVVSYCSSVALQLIKNPVAHTWSAPCLIKRKYCCVCRKRTDDALSVECEVCEYYVHVDCSDLAVSDCKEAATYVANMESANTVQYHHMREGNLPKESKCIVCRKTCFSTECLAGMRCEWCGQTAHAVCYRQMDKECDFGVLRKIMLPPMCLTIPRTELPMEQLLNISSHDQPQSLSSPSKIQADDVSTSG----------EDVKERED---FEIIRVFDGNNSYRSQ 278          
BLAST of Diacylglycerol kinase vs. Ensembl Celegans
Match: dgk-1 (Diacylglycerol kinase [Source:UniProtKB/TrEMBL;Acc:Q58AU5])

HSP 1 Score: 461.84 bits (1187), Expect = 2.666e-147
Identity = 247/459 (53.81%), Postives = 317/459 (69.06%), Query Frame = 2
Query: 1643 KESLRAFTLTRFYIRSVADPYGTGGVAVYVGNLKKGLSQRLYERILIDRLTPANR-WNAIEVIYYDSGSLVLIYSNAEKAESAYNILKESTFDDNALTAIILPRVETSAIPNDIHPLLVFVNVKSGGCQGTELISSFRKLLNPHQVFNLDYGGPLPGLHCYRNLTNFKILVCGGDGTVGWVLSCLDNVGQDAKCPHPPMAIVPLGTGNDLARVLRWGTGYTGAEDPLSLLKDVVEAEEIRLDRWTVMIKPNEMEK-DEQKRALQLQXXXXXXXXXXXRIFLMNNYFGLGIDADLNLDFHLAREENPGKFTSRIHNKGIYFKMGLRKMVNRTKCKDLHHKITLEVDGRQXXXXXXXXXXXXXXXSWGAGANPWGFTDDVSNQKFSKPTHYDGMLEVVGVTGVVHMGQIFSGLRTGTRLAQGGHIRITLKTSVPVQVDGEPWIQSPCQITVLRSALKATML 3013
            ++SLR + + RFY++   DP+     AV+VGNL   L+QR YERIL+  L    + + AI  IY++ GSL++ ++  + A +A   L+ + +++  L  + LP V+   IP D+ PLLV VNVKSGGCQGTELI SFRKLLNP QVF++  GGPL GL+ +RN+  +KIL CGGDGT+GWVL CLD   QDA C  PP  IVPLGTGNDLARVLRWG GYTG E+P+ +LKDV+EA+ ++LDRW V+    E  +        ++     N  E+ T + +MNNYFG+GIDAD+ L FH  R+ NP KF SR+ NK  Y K+GL+KM     CKDL  +I LEVDGR IELP +EGI++LN+LSWG+GANPWG + +  N  FSKPTHYDG+LEVVG++ V  +G I S L  G R+AQGG IRIT     PVQVDGEP IQ P  IT+L+SALKA ML
Sbjct:  280 QDSLRRYHVVRFYVQEKEDPHDH---AVFVGNLPVSLAQRQYERILLKLLGAKEKPFTAIGPIYFEYGSLIITFNTPKAATAAVQKLQSAIYEEKKLIVLCLPNVQPQMIPKDVEPLLVLVNVKSGGCQGTELIQSFRKLLNPFQVFDVLNGGPLVGLYVFRNIPKYKILACGGDGTIGWVLQCLDIAKQDAACFSPPCGIVPLGTGNDLARVLRWGGGYTGEENPMDILKDVIEADTVKLDRWAVVFHEEERNQPTSSGNQTEMNEQTMNNPEDQTSMIIMNNYFGIGIDADVCLKFHNKRDANPEKFQSRLFNKTQYAKIGLQKMFFERTCKDLWKRIELEVDGRIIELPNIEGIVVLNLLSWGSGANPWGTSKEEGN--FSKPTHYDGLLEVVGISDVSRLGLIQSKLAAGIRIAQGGSIRITTHEEWPVQVDGEPHIQPPGTITILKSALKAQML 733          

HSP 2 Score: 245.743 bits (626), Expect = 3.344e-68
Identity = 115/273 (42.12%), Postives = 167/273 (61.17%), Query Frame = 2
Query:  356 GHCFVKKNFHKPLVCHHCAETLWGLLGTTGYICQICNYLVHEKCVPQIIIPCNCVLSFVITEPAAHCWSEISHFKRKFCNVCRKRLEDVAGLRCEICEYYVHTECFDFAISNCKQCA--IASTDWPSKEPNHHFREGNLPINSKCFICKKICASVECLTGLRCEWCGITVHTSCYRKIPTECTHGILHDIILPASAVSLPRTSSLIEQIYEIK---RPKQEDLMAQTLVDDFSDSDSGREESGFERKSVKEKRDKEYYDFVRLYDGMARFKKK 1159
            GH FVKK F KP  CHHC + +WG+L TTGY C++CN++ HEKC+  ++  C+ V   +I  P AH WS     KRK+C VCRKR +D   + CE+CEYYVH +C D A+S+CK+ A  +A+ +  +    HH REGNLP  SKC +C+K C S ECL G+RCEWCG T H  CYR++  EC  G+L  I+LP   +++PRT   +EQ+  I    +P+   + + + +     S SG +        VKE+ D   ++ +R++DG   ++ +
Sbjct:   20 GHYFVKKTFGKPAYCHHCCDKIWGML-TTGYSCEMCNFVCHEKCLRTVVSYCSSVALQLIKNPVAHTWSAPCLIKRKYCCVCRKRTDDALSVECEVCEYYVHVDCSDLAVSDCKEAATYVANMESANTVQYHHMREGNLPKESKCIVCRKTCFSTECLAGMRCEWCGQTAHAVCYRQMDKECDFGVLRKIMLPPMCLTIPRTELPMEQLLNISSHDQPQSRKVSSPSKIQADDVSTSGED--------VKERED---FEIIRVFDGNNSYRSQ 280          
BLAST of Diacylglycerol kinase vs. Ensembl Fly
Match: CG31140 (gene:FBgn0051140 transcript:FBtr0300963)

HSP 1 Score: 611.683 bits (1576), Expect = 0.000e+0
Identity = 335/657 (50.99%), Postives = 454/657 (69.10%), Query Frame = 2
Query: 1115 DFVRLYDGMARFKKKQCRYLSLGKSTSVQRVIEMSMKAFQLPFYEINNIYLVEINEKDN-SDKWLKENEPFKKQLQFDMRRPQVILKLKTKNVERDYISIYPGDLTXXXXXXXXXXXXXXXXXXDATTILVL---ALRRLGLEHMNSHKFHLVETSLDCGITERVIEKDEILWSILERLQKESLRAFTLTRFYIRSVADPYGTGGVAVYVGNLKKGLSQRLYERILIDRLTPANRWNAIEVIYYDSGSLVLIYSNAEKAESAYNILKESTFDDNALTAIILPRVETSAIPNDIHPLLVFVNVKSGGCQGTELISSFRKLLNPHQVFNLDYGGPLPGLHCYRNLTNFKILVCGGDGTVGWVLSCLDNVGQDAKCPHPPMAIVPLGTGNDLARVLRWGTGYTGAEDPLSLLKDVVEAEEIRLDRWTVMIKPNEMEKDEQKRALQLQXXXXXXXXXXXRIFLMNNYFGLGIDADLNLDFHLAREENPGKFTSRIHNKGIYFKMGLRKMVNRTKCKDLHHKITLEVDGRQXXXXXXXXXXXXXXXSWGAGANPWGFTDDVSNQKFSKPTHYDGMLEVVGVTGVVHMGQIFSGLRTGTRLAQGGHIRITLKTSVPVQVDGEPWIQSPCQITVLRSALKATMLXXXXXXXXXXXXTEPGIPPT 3073
            + ++++DG   F+++Q R + + ++ ++++++  +++AF +   +    YL ++       D  + +  P    +  + +RP + L+   +  +R ++ +YPG L  S                ++T I  L   AL + GL+      +   E  LD G+TER++  +E  W I+++L K+S+R   L RFY++   DP+G   +A++VGNL  GLSQR YE+IL   +T  N++ +I  IYY+ GS+VL + ++ KA  A+  L+E+  +D  L  ++LP +E S +P+D+ PLLVFVNVKSGGCQG ELISSFRKLLNP+QVF+LD GGPLPGL+ +R +TN+KILVCGGDGT+GWVL CLDNVGQD++C  PP AIVPLGTGNDLARVL WG+GYTG EDPL+LL+DV+EAEEIRLDRWTV+  P +  ++   +A   Q      NE+ ++IF+MNNYFG+GIDADL LDFH AREENP +F SR+ NKG Y KMGLRK+V R   KDL  ++ LEVDG+ +ELPP++GIIILNILSWG+GANPWG   D    +FS P HYDGMLEVVGVTGVVH+GQI SG+RT  R+AQGGHI+I L T +PVQVDGEPWIQSP  + VL+SALKATML   K+ K  RR TEP I P 
Sbjct:  324 EMIKVFDGNNSFRRQQYRVIIVQRTYTLEQLLTTALRAFHI-TRDPQAFYLTDLYAPAGMEDTPMLDPTPVLNLVHLEGKRPAIYLRFHDR--DRGHVRVYPGKLQCSMLEDPYVSVPVD----NSTVIKDLIRDALDKFGLQDNQIQDYRCSEVLLDRGVTERILSWNERPWDIMKQLGKDSIRQMELMRFYMQHKQDPHGPN-IALFVGNLPTGLSQRNYEQILNKYVTDENKFISIGPIYYEYGSVVLTFEDSMKAVRAFYNLRETIIEDKKLLVLLLPNIEPSMVPSDVRPLLVFVNVKSGGCQGLELISSFRKLLNPYQVFDLDNGGPLPGLYVFRQITNYKILVCGGDGTIGWVLQCLDNVGQDSECSSPPCAIVPLGTGNDLARVLCWGSGYTGGEDPLNLLRDVIEAEEIRLDRWTVVFHPEDKPEEPAMKAPS-QTTGGAQNEDNSQIFVMNNYFGIGIDADLCLDFHNAREENPNQFNSRLRNKGYYVKMGLRKIVGRKAVKDLQKELRLEVDGKIVELPPVDGIIILNILSWGSGANPWGPDKD---DQFSTPNHYDGMLEVVGVTGVVHLGQIQSGIRTAMRIAQGGHIKIHLNTDMPVQVDGEPWIQSPGDVVVLKSALKATML---KKTKSKRRLTEPHISPA 965          

HSP 2 Score: 260.381 bits (664), Expect = 7.757e-72
Identity = 122/251 (48.61%), Postives = 160/251 (63.75%), Query Frame = 2
Query:  356 GHCFVKKNFHKPLVCHHCAETLWGLLGTTGYICQICNYLVHEKCVPQIIIPCNCVLSFVITEPAAHCWSEISHFKRKFCNVCRKRLEDVAGLRCEICEYYVHTECFDFAISNCKQCAIASTDWPSKE-----PNHHFREGNLPINSKCFICKKICASVECLTGLRCEWCGITVHTSCYRKIPTECTHGILHDIILPASAVSLPRTSSLIEQIYEIKRPKQEDLM-----AQTLVDDFSDSDSGR---EESG 1069
            GH FVKK FHKP  CHHC++ LWGL+   GYIC++CN+++HE+CV  ++ PC+ +   +I  P AHCWSE +H KRKFC VCRKRL++   + C +CEY+ H EC DFA+ +C + A   T  P KE       HH+REGNLP  SKC  CKK C S ECLTG RCEWCG+T H  C   +PTEC  GIL  I LP  +VS+PRT   IE I  ++   +  L+      +++ ++FS  D+ R   EES 
Sbjct:    5 GHSFVKKTFHKPTYCHHCSDLLWGLI-QQGYICEVCNFIIHERCVSSVVTPCSGIAPCIIKNPVAHCWSEPTHHKRKFCTVCRKRLDETPAVHCLVCEYFAHIECQDFAVPDCTENA---TYVPGKELLNVKHQHHWREGNLPSTSKCAYCKKTCWSSECLTGYRCEWCGMTTHAGCRMYLPTECNFGILQPIYLPPHSVSIPRTEVPIEAIIGVQVKSKTSLVRDYSCPRSISEEFSSGDTPRFKDEESA 251          
BLAST of Diacylglycerol kinase vs. Ensembl Fly
Match: CG31140 (gene:FBgn0051140 transcript:FBtr0330371)

HSP 1 Score: 601.282 bits (1549), Expect = 0.000e+0
Identity = 335/677 (49.48%), Postives = 455/677 (67.21%), Query Frame = 2
Query: 1115 DFVRLYDGMARFKKKQCRYLSLGKSTSVQRVIEMSMKAFQLPFYEINNIYLVEINEKDN-SDKWLKENEPFKKQLQFDMRRPQVILKLKTKNVERDYISIYPGDLTXXXXXXXXXXXXXXXXXXDATTILVL---ALRRLGLEHMNSHKFHLVETSLDCGITERVIEKDEILWSILERLQKESLRAFTLTRFYIRSVADPYGTGGVAVYVGNLKKGLSQRLYERILIDRLTPANRWNAIEVIYYDSGSLVLIYSNAEKAESAYNILKESTFDDNALTAIILPRVETSAIPNDIHPLLVFVNVKSGGCQGTELISSFRKLLNPHQVFNLDYGGPLPG--------------------LHCYRNLTNFKILVCGGDGTVGWVLSCLDNVGQDAKCPHPPMAIVPLGTGNDLARVLRWGTGYTGAEDPLSLLKDVVEAEEIRLDRWTVMIKPNEMEKDEQKRALQLQXXXXXXXXXXXRIFLMNNYFGLGIDADLNLDFHLAREENPGKFTSRIHNKGIYFKMGLRKMVNRTKCKDLHHKITLEVDGRQXXXXXXXXXXXXXXXSWGAGANPWGFTDDVSNQKFSKPTHYDGMLEVVGVTGVVHMGQIFSGLRTGTRLAQGGHIRITLKTSVPVQVDGEPWIQSPCQITVLRSALKATMLXXXXXXXXXXXXTEPGIPPT 3073
            + ++++DG   F+++Q R + + ++ ++++++  +++AF +   +    YL ++       D  + +  P    +  + +RP + L+   +  +R ++ +YPG L      S+           ++T I  L   AL + GL+      +   E  LD G+TER++  +E  W I+++L K+S+R   L RFY++   DP+G   +A++VGNL  GLSQR YE+IL   +T  N++ +I  IYY+ GS+VL + ++ KA  A+  L+E+  +D  L  ++LP +E S +P+D+ PLLVFVNVKSGGCQG ELISSFRKLLNP+QVF+LD GGPLPG                    L+ +R +TN+KILVCGGDGT+GWVL CLDNVGQD++C  PP AIVPLGTGNDLARVL WG+GYTG EDPL+LL+DV+EAEEIRLDRWTV+  P +  ++   +A   Q      NE+ ++IF+MNNYFG+GIDADL LDFH AREENP +F SR+ NKG Y KMGLRK+V R   KDL  ++ LEVDG+ +ELPP++GIIILNILSWG+GANPWG   D    +FS P HYDGMLEVVGVTGVVH+GQI SG+RT  R+AQGGHI+I L T +PVQVDGEPWIQSP  + VL+SALKATML   K+ K  RR TEP I P 
Sbjct:  833 EMIKVFDGNNSFRRQQYRVIIVQRTYTLEQLLTTALRAFHI-TRDPQAFYLTDLYAPAGMEDTPMLDPTPVLNLVHLEGKRPAIYLRFHDR--DRGHVRVYPGKL----QCSMLEDPYVSVPVDNSTVIKDLIRDALDKFGLQDNQIQDYRCSEVLLDRGVTERILSWNERPWDIMKQLGKDSIRQMELMRFYMQHKQDPHGPN-IALFVGNLPTGLSQRNYEQILNKYVTDENKFISIGPIYYEYGSVVLTFEDSMKAVRAFYNLRETIIEDKKLLVLLLPNIEPSMVPSDVRPLLVFVNVKSGGCQGLELISSFRKLLNPYQVFDLDNGGPLPGYVQPITVFVIRPLIFDSIISLYVFRQITNYKILVCGGDGTIGWVLQCLDNVGQDSECSSPPCAIVPLGTGNDLARVLCWGSGYTGGEDPLNLLRDVIEAEEIRLDRWTVVFHPEDKPEEPAMKAPS-QTTGGAQNEDNSQIFVMNNYFGIGIDADLCLDFHNAREENPNQFNSRLRNKGYYVKMGLRKIVGRKAVKDLQKELRLEVDGKIVELPPVDGIIILNILSWGSGANPWGPDKD---DQFSTPNHYDGMLEVVGVTGVVHLGQIQSGIRTAMRIAQGGHIKIHLNTDMPVQVDGEPWIQSPGDVVVLKSALKATML---KKTKSKRRLTEPHISPA 1494          

HSP 2 Score: 259.996 bits (663), Expect = 1.110e-70
Identity = 118/233 (50.64%), Postives = 151/233 (64.81%), Query Frame = 2
Query:  356 GHCFVKKNFHKPLVCHHCAETLWGLLGTTGYICQICNYLVHEKCVPQIIIPCNCVLSFVITEPAAHCWSEISHFKRKFCNVCRKRLEDVAGLRCEICEYYVHTECFDFAISNCKQCAIASTDWPSKE-----PNHHFREGNLPINSKCFICKKICASVECLTGLRCEWCGITVHTSCYRKIPTECTHGILHDIILPASAVSLPRTSSLIEQIYEIKRPKQEDLMAQTLVDDFS 1039
            GH FVKK FHKP  CHHC++ LWGL+   GYIC++CN+++HE+CV  ++ PC+ +   +I  P AHCWSE +H KRKFC VCRKRL++   + C +CEY+ H EC DFA+ +C + A   T  P KE       HH+REGNLP  SKC  CKK C S ECLTG RCEWCG+T H  C   +PTEC  GIL  I LP  +VS+PRT   IE I  ++   +      +LV D+S
Sbjct:    5 GHSFVKKTFHKPTYCHHCSDLLWGLI-QQGYICEVCNFIIHERCVSSVVTPCSGIAPCIIKNPVAHCWSEPTHHKRKFCTVCRKRLDETPAVHCLVCEYFAHIECQDFAVPDCTENA---TYVPGKELLNVKHQHHWREGNLPSTSKCAYCKKTCWSSECLTGYRCEWCGMTTHAGCRMYLPTECNFGILQPIYLPPHSVSIPRTEVPIEAIIGVQVKSK-----TSLVRDYS 228          
BLAST of Diacylglycerol kinase vs. Ensembl Fly
Match: CG31140 (gene:FBgn0051140 transcript:FBtr0113392)

HSP 1 Score: 600.897 bits (1548), Expect = 0.000e+0
Identity = 335/677 (49.48%), Postives = 455/677 (67.21%), Query Frame = 2
Query: 1115 DFVRLYDGMARFKKKQCRYLSLGKSTSVQRVIEMSMKAFQLPFYEINNIYLVEINEKDN-SDKWLKENEPFKKQLQFDMRRPQVILKLKTKNVERDYISIYPGDLTXXXXXXXXXXXXXXXXXXDATTILVL---ALRRLGLEHMNSHKFHLVETSLDCGITERVIEKDEILWSILERLQKESLRAFTLTRFYIRSVADPYGTGGVAVYVGNLKKGLSQRLYERILIDRLTPANRWNAIEVIYYDSGSLVLIYSNAEKAESAYNILKESTFDDNALTAIILPRVETSAIPNDIHPLLVFVNVKSGGCQGTELISSFRKLLNPHQVFNLDYGGPLPG--------------------LHCYRNLTNFKILVCGGDGTVGWVLSCLDNVGQDAKCPHPPMAIVPLGTGNDLARVLRWGTGYTGAEDPLSLLKDVVEAEEIRLDRWTVMIKPNEMEKDEQKRALQLQXXXXXXXXXXXRIFLMNNYFGLGIDADLNLDFHLAREENPGKFTSRIHNKGIYFKMGLRKMVNRTKCKDLHHKITLEVDGRQXXXXXXXXXXXXXXXSWGAGANPWGFTDDVSNQKFSKPTHYDGMLEVVGVTGVVHMGQIFSGLRTGTRLAQGGHIRITLKTSVPVQVDGEPWIQSPCQITVLRSALKATMLXXXXXXXXXXXXTEPGIPPT 3073
            + ++++DG   F+++Q R + + ++ ++++++  +++AF +   +    YL ++       D  + +  P    +  + +RP + L+   +  +R ++ +YPG L      S+           ++T I  L   AL + GL+      +   E  LD G+TER++  +E  W I+++L K+S+R   L RFY++   DP+G   +A++VGNL  GLSQR YE+IL   +T  N++ +I  IYY+ GS+VL + ++ KA  A+  L+E+  +D  L  ++LP +E S +P+D+ PLLVFVNVKSGGCQG ELISSFRKLLNP+QVF+LD GGPLPG                    L+ +R +TN+KILVCGGDGT+GWVL CLDNVGQD++C  PP AIVPLGTGNDLARVL WG+GYTG EDPL+LL+DV+EAEEIRLDRWTV+  P +  ++   +A   Q      NE+ ++IF+MNNYFG+GIDADL LDFH AREENP +F SR+ NKG Y KMGLRK+V R   KDL  ++ LEVDG+ +ELPP++GIIILNILSWG+GANPWG   D    +FS P HYDGMLEVVGVTGVVH+GQI SG+RT  R+AQGGHI+I L T +PVQVDGEPWIQSP  + VL+SALKATML   K+ K  RR TEP I P 
Sbjct:  833 EMIKVFDGNNSFRRQQYRVIIVQRTYTLEQLLTTALRAFHI-TRDPQAFYLTDLYAPAGMEDTPMLDPTPVLNLVHLEGKRPAIYLRFHDR--DRGHVRVYPGKL----QCSMLEDPYVSVPVDNSTVIKDLIRDALDKFGLQDNQIQDYRCSEVLLDRGVTERILSWNERPWDIMKQLGKDSIRQMELMRFYMQHKQDPHGPN-IALFVGNLPTGLSQRNYEQILNKYVTDENKFISIGPIYYEYGSVVLTFEDSMKAVRAFYNLRETIIEDKKLLVLLLPNIEPSMVPSDVRPLLVFVNVKSGGCQGLELISSFRKLLNPYQVFDLDNGGPLPGYVQPITVFVIRPLIFDSIISLYVFRQITNYKILVCGGDGTIGWVLQCLDNVGQDSECSSPPCAIVPLGTGNDLARVLCWGSGYTGGEDPLNLLRDVIEAEEIRLDRWTVVFHPEDKPEEPAMKAPS-QTTGGAQNEDNSQIFVMNNYFGIGIDADLCLDFHNAREENPNQFNSRLRNKGYYVKMGLRKIVGRKAVKDLQKELRLEVDGKIVELPPVDGIIILNILSWGSGANPWGPDKD---DQFSTPNHYDGMLEVVGVTGVVHLGQIQSGIRTAMRIAQGGHIKIHLNTDMPVQVDGEPWIQSPGDVVVLKSALKATML---KKTKSKRRLTEPHISPA 1494          

HSP 2 Score: 260.381 bits (664), Expect = 8.415e-71
Identity = 118/233 (50.64%), Postives = 151/233 (64.81%), Query Frame = 2
Query:  356 GHCFVKKNFHKPLVCHHCAETLWGLLGTTGYICQICNYLVHEKCVPQIIIPCNCVLSFVITEPAAHCWSEISHFKRKFCNVCRKRLEDVAGLRCEICEYYVHTECFDFAISNCKQCAIASTDWPSKE-----PNHHFREGNLPINSKCFICKKICASVECLTGLRCEWCGITVHTSCYRKIPTECTHGILHDIILPASAVSLPRTSSLIEQIYEIKRPKQEDLMAQTLVDDFS 1039
            GH FVKK FHKP  CHHC++ LWGL+   GYIC++CN+++HE+CV  ++ PC+ +   +I  P AHCWSE +H KRKFC VCRKRL++   + C +CEY+ H EC DFA+ +C + A   T  P KE       HH+REGNLP  SKC  CKK C S ECLTG RCEWCG+T H  C   +PTEC  GIL  I LP  +VS+PRT   IE I  ++   +      +LV D+S
Sbjct:    5 GHSFVKKTFHKPTYCHHCSDLLWGLI-QQGYICEVCNFIIHERCVSSVVTPCSGIAPCIIKNPVAHCWSEPTHHKRKFCTVCRKRLDETPAVHCLVCEYFAHIECQDFAVPDCTENA---TYVPGKELLNVKHQHHWREGNLPSTSKCAYCKKTCWSSECLTGYRCEWCGMTTHAGCRMYLPTECNFGILQPIYLPPHSVSIPRTEVPIEAIIGVQVKSK-----TSLVRDYS 228          
BLAST of Diacylglycerol kinase vs. Ensembl Fly
Match: CG31140 (gene:FBgn0051140 transcript:FBtr0084497)

HSP 1 Score: 584.719 bits (1506), Expect = 0.000e+0
Identity = 323/686 (47.08%), Postives = 446/686 (65.01%), Query Frame = 2
Query: 1115 DFVRLYDGMARFKKKQCRYLSLGKSTSVQRVIEMSMKAFQLPFYEINNIYLVEINEKDN-SDKWLKENEPFKKQLQFDMRRPQVILKLKTKNVERDYISIYPGDLTXXXXXXXXXXXXXXXXXXDATTILVL---ALRRLGLEHMNSHKFHLVETSLDCGITERVIEKDEILWSILERLQKESLRAFTLTRFYIRSVADPYGTGGVAVYVGNLKKGLSQRLYERILIDRLTPANRWNAIEVIYYDSGSLVLIYSNAEKAESAYNILKESTFDDNALTAIILPRVETSAIPNDIHPLLVFVNVKSGGCQGTELISSFRKLLNPHQVFNLDYGGPLPG--------------------LHCYRNLTNFKILVCGGDGTVGWVLSCLDNVGQDAKCPHPPMAIVPLGTGNDLARVLRWGTGYTGAEDPLSLLKDVVEAEEIRLDRWTVMIKPNEMEKD-----------EQKRALQLQXXXXXXXXX--------------------XXRIFLMNNYFGLGIDADLNLDFHLAREENPGKFTSRIHNKGIYFKMGLRKMVNRTKCKDLHHKITLEVDGRQXXXXXXXXXXXXXXXSWGAGANPWGFTDDVSNQKFSKPTHYDGMLEVVGVTGVVHMGQIFSGLRTGTRLAQGGHIRITLKTSVPVQVDGEPWIQSPCQITVLRSALKAT 3007
            + ++++DG   F+++Q R + + ++ ++++++  +++AF +   +    YL ++       D  + +  P    +  + +RP + L+   +  +R ++ +YPG L      S+           ++T I  L   AL + GL+      +   E  LD G+TER++  +E  W I+++L K+S+R   L RFY++   DP+G   +A++VGNL  GLSQR YE+IL   +T  N++ +I  IYY+ GS+VL + ++ KA  A+  L+E+  +D  L  ++LP +E S +P+D+ PLLVFVNVKSGGCQG ELISSFRKLLNP+QVF+LD GGPLPG                    L+ +R +TN+KILVCGGDGT+GWVL CLDNVGQD++C  PP AIVPLGTGNDLARVL WG+GYTG EDPL+LL+DV+EAEEIRLDRWTV+  P +  ++           ++K+A Q   + +    +                     ++IF+MNNYFG+GIDADL LDFH AREENP +F SR+ NKG Y KMGLRK+V R   KDL  ++ LEVDG+ +ELPP++GIIILNILSWG+GANPWG   D    +FS P HYDGMLEVVGVTGVVH+GQI SG+RT  R+AQGGHI+I L T +PVQVDGEPWIQSP  + VL+SALKAT
Sbjct:  833 EMIKVFDGNNSFRRQQYRVIIVQRTYTLEQLLTTALRAFHI-TRDPQAFYLTDLYAPAGMEDTPMLDPTPVLNLVHLEGKRPAIYLRFHDR--DRGHVRVYPGKL----QCSMLEDPYVSVPVDNSTVIKDLIRDALDKFGLQDNQIQDYRCSEVLLDRGVTERILSWNERPWDIMKQLGKDSIRQMELMRFYMQHKQDPHGPN-IALFVGNLPTGLSQRNYEQILNKYVTDENKFISIGPIYYEYGSVVLTFEDSMKAVRAFYNLRETIIEDKKLLVLLLPNIEPSMVPSDVRPLLVFVNVKSGGCQGLELISSFRKLLNPYQVFDLDNGGPLPGYVQPITVFVIRPLIFDSIISLYVFRQITNYKILVCGGDGTIGWVLQCLDNVGQDSECSSPPCAIVPLGTGNDLARVLCWGSGYTGGEDPLNLLRDVIEAEEIRLDRWTVVFHPEDKPEEPAMKAPSQTTGKKKKAHQAHLSQSQQTNQHHQLPALTSSDISGGAQNEDNSQIFVMNNYFGIGIDADLCLDFHNAREENPNQFNSRLRNKGYYVKMGLRKIVGRKAVKDLQKELRLEVDGKIVELPPVDGIIILNILSWGSGANPWGPDKD---DQFSTPNHYDGMLEVVGVTGVVHLGQIQSGIRTAMRIAQGGHIKIHLNTDMPVQVDGEPWIQSPGDVVVLKSALKAT 1507          

HSP 2 Score: 260.381 bits (664), Expect = 8.969e-71
Identity = 118/233 (50.64%), Postives = 151/233 (64.81%), Query Frame = 2
Query:  356 GHCFVKKNFHKPLVCHHCAETLWGLLGTTGYICQICNYLVHEKCVPQIIIPCNCVLSFVITEPAAHCWSEISHFKRKFCNVCRKRLEDVAGLRCEICEYYVHTECFDFAISNCKQCAIASTDWPSKE-----PNHHFREGNLPINSKCFICKKICASVECLTGLRCEWCGITVHTSCYRKIPTECTHGILHDIILPASAVSLPRTSSLIEQIYEIKRPKQEDLMAQTLVDDFS 1039
            GH FVKK FHKP  CHHC++ LWGL+   GYIC++CN+++HE+CV  ++ PC+ +   +I  P AHCWSE +H KRKFC VCRKRL++   + C +CEY+ H EC DFA+ +C + A   T  P KE       HH+REGNLP  SKC  CKK C S ECLTG RCEWCG+T H  C   +PTEC  GIL  I LP  +VS+PRT   IE I  ++   +      +LV D+S
Sbjct:    5 GHSFVKKTFHKPTYCHHCSDLLWGLI-QQGYICEVCNFIIHERCVSSVVTPCSGIAPCIIKNPVAHCWSEPTHHKRKFCTVCRKRLDETPAVHCLVCEYFAHIECQDFAVPDCTENA---TYVPGKELLNVKHQHHWREGNLPSTSKCAYCKKTCWSSECLTGYRCEWCGMTTHAGCRMYLPTECNFGILQPIYLPPHSVSIPRTEVPIEAIIGVQVKSK-----TSLVRDYS 228          
BLAST of Diacylglycerol kinase vs. Ensembl Fly
Match: CG31140 (gene:FBgn0051140 transcript:FBtr0305041)

HSP 1 Score: 584.334 bits (1505), Expect = 0.000e+0
Identity = 323/686 (47.08%), Postives = 446/686 (65.01%), Query Frame = 2
Query: 1115 DFVRLYDGMARFKKKQCRYLSLGKSTSVQRVIEMSMKAFQLPFYEINNIYLVEINEKDN-SDKWLKENEPFKKQLQFDMRRPQVILKLKTKNVERDYISIYPGDLTXXXXXXXXXXXXXXXXXXDATTILVL---ALRRLGLEHMNSHKFHLVETSLDCGITERVIEKDEILWSILERLQKESLRAFTLTRFYIRSVADPYGTGGVAVYVGNLKKGLSQRLYERILIDRLTPANRWNAIEVIYYDSGSLVLIYSNAEKAESAYNILKESTFDDNALTAIILPRVETSAIPNDIHPLLVFVNVKSGGCQGTELISSFRKLLNPHQVFNLDYGGPLPG--------------------LHCYRNLTNFKILVCGGDGTVGWVLSCLDNVGQDAKCPHPPMAIVPLGTGNDLARVLRWGTGYTGAEDPLSLLKDVVEAEEIRLDRWTVMIKPNEMEKD-----------EQKRALQLQXXXXXXXXX--------------------XXRIFLMNNYFGLGIDADLNLDFHLAREENPGKFTSRIHNKGIYFKMGLRKMVNRTKCKDLHHKITLEVDGRQXXXXXXXXXXXXXXXSWGAGANPWGFTDDVSNQKFSKPTHYDGMLEVVGVTGVVHMGQIFSGLRTGTRLAQGGHIRITLKTSVPVQVDGEPWIQSPCQITVLRSALKAT 3007
            + ++++DG   F+++Q R + + ++ ++++++  +++AF +   +    YL ++       D  + +  P    +  + +RP + L+   +  +R ++ +YPG L      S+           ++T I  L   AL + GL+      +   E  LD G+TER++  +E  W I+++L K+S+R   L RFY++   DP+G   +A++VGNL  GLSQR YE+IL   +T  N++ +I  IYY+ GS+VL + ++ KA  A+  L+E+  +D  L  ++LP +E S +P+D+ PLLVFVNVKSGGCQG ELISSFRKLLNP+QVF+LD GGPLPG                    L+ +R +TN+KILVCGGDGT+GWVL CLDNVGQD++C  PP AIVPLGTGNDLARVL WG+GYTG EDPL+LL+DV+EAEEIRLDRWTV+  P +  ++           ++K+A Q   + +    +                     ++IF+MNNYFG+GIDADL LDFH AREENP +F SR+ NKG Y KMGLRK+V R   KDL  ++ LEVDG+ +ELPP++GIIILNILSWG+GANPWG   D    +FS P HYDGMLEVVGVTGVVH+GQI SG+RT  R+AQGGHI+I L T +PVQVDGEPWIQSP  + VL+SALKAT
Sbjct:  767 EMIKVFDGNNSFRRQQYRVIIVQRTYTLEQLLTTALRAFHI-TRDPQAFYLTDLYAPAGMEDTPMLDPTPVLNLVHLEGKRPAIYLRFHDR--DRGHVRVYPGKL----QCSMLEDPYVSVPVDNSTVIKDLIRDALDKFGLQDNQIQDYRCSEVLLDRGVTERILSWNERPWDIMKQLGKDSIRQMELMRFYMQHKQDPHGPN-IALFVGNLPTGLSQRNYEQILNKYVTDENKFISIGPIYYEYGSVVLTFEDSMKAVRAFYNLRETIIEDKKLLVLLLPNIEPSMVPSDVRPLLVFVNVKSGGCQGLELISSFRKLLNPYQVFDLDNGGPLPGYVQPITVFVIRPLIFDSIISLYVFRQITNYKILVCGGDGTIGWVLQCLDNVGQDSECSSPPCAIVPLGTGNDLARVLCWGSGYTGGEDPLNLLRDVIEAEEIRLDRWTVVFHPEDKPEEPAMKAPSQTTGKKKKAHQAHLSQSQQTNQHHQLPALTSSDISGGAQNEDNSQIFVMNNYFGIGIDADLCLDFHNAREENPNQFNSRLRNKGYYVKMGLRKIVGRKAVKDLQKELRLEVDGKIVELPPVDGIIILNILSWGSGANPWGPDKD---DQFSTPNHYDGMLEVVGVTGVVHLGQIQSGIRTAMRIAQGGHIKIHLNTDMPVQVDGEPWIQSPGDVVVLKSALKAT 1441          

HSP 2 Score: 260.766 bits (665), Expect = 6.029e-71
Identity = 118/233 (50.64%), Postives = 151/233 (64.81%), Query Frame = 2
Query:  356 GHCFVKKNFHKPLVCHHCAETLWGLLGTTGYICQICNYLVHEKCVPQIIIPCNCVLSFVITEPAAHCWSEISHFKRKFCNVCRKRLEDVAGLRCEICEYYVHTECFDFAISNCKQCAIASTDWPSKE-----PNHHFREGNLPINSKCFICKKICASVECLTGLRCEWCGITVHTSCYRKIPTECTHGILHDIILPASAVSLPRTSSLIEQIYEIKRPKQEDLMAQTLVDDFS 1039
            GH FVKK FHKP  CHHC++ LWGL+   GYIC++CN+++HE+CV  ++ PC+ +   +I  P AHCWSE +H KRKFC VCRKRL++   + C +CEY+ H EC DFA+ +C + A   T  P KE       HH+REGNLP  SKC  CKK C S ECLTG RCEWCG+T H  C   +PTEC  GIL  I LP  +VS+PRT   IE I  ++   +      +LV D+S
Sbjct:    5 GHSFVKKTFHKPTYCHHCSDLLWGLI-QQGYICEVCNFIIHERCVSSVVTPCSGIAPCIIKNPVAHCWSEPTHHKRKFCTVCRKRLDETPAVHCLVCEYFAHIECQDFAVPDCTENA---TYVPGKELLNVKHQHHWREGNLPSTSKCAYCKKTCWSSECLTGYRCEWCGMTTHAGCRMYLPTECNFGILQPIYLPPHSVSIPRTEVPIEAIIGVQVKSK-----TSLVRDYS 228          
BLAST of Diacylglycerol kinase vs. Ensembl Zebrafish
Match: dgkg (diacylglycerol kinase, gamma [Source:ZFIN;Acc:ZDB-GENE-081105-39])

HSP 1 Score: 257.684 bits (657), Expect = 5.032e-73
Identity = 155/383 (40.47%), Postives = 217/383 (56.66%), Query Frame = 2
Query: 1910 TFDDNALTAIILPRVETSAIPNDIHPLLVFVNVKSGGCQGTELISSFRKLLNPHQVFNLDYGGPLPGLHCYRNLTNFKILVCGGDGTVGWVLSCLDNVGQDAKCPHPPMAIVPLGTGNDLARVLRWGTGYTGAEDPLSLLKDVVEAEEIRLDRWTVMIKPNEMEKDEQKRALQLQXXXXXXXXXXXRIFLMNNYFGLGIDADLNLDFHLAREENPGKFTSRIHNKGIYFKMGLRKMVNRTKCKDLHHKITLEVDG--RQXXXXXXXXXXXXXXXSWGAGANPWGFTD----------------------DVSNQKFSKPTHYDGMLEVVGVTGVVHMGQIFSGLRT-GTRLAQGGHIRITLKTSVPVQVDGEPWIQSPCQITV 2983
            T D  AL    LP           HPLLV VN KSGG QG  ++  F+ LLNP QV++L+ GGP+ GL+ +R++ +F++L CGGDG+VGW+L C+D     +   HPP+AI+PLGTGNDLAR LRWG GY G    +  L+D+  + E+ LDRW + I P+  +K+E+   +                 ++NNYF +G+DA +   FHL RE++P KF SR+ NK  YF+ G  + ++ T CK L+  I +E DG    +    LEGI +LNI S   G+N WG T                       D    KF      D +LEVVG+ G + MGQI++GL++ G RLAQ  ++ I     +P+Q+DGEPW+Q PC I +
Sbjct:  301 TGDGQALQITPLP---------GTHPLLVLVNPKSGGRQGERVLRKFQYLLNPRQVYSLERGGPMAGLNFFRDVPDFRVLACGGDGSVGWILDCIDKA---SFARHPPVAILPLGTGNDLARCLRWGGGYEGGS-LVKFLRDIEHSTEVLLDRWNIDIVPD--DKEEKGDPVPYS--------------IVNNYFSIGVDASIAHRFHLMREKHPEKFNSRMKNKLWYFEFGTTETISAT-CKKLNETIEVECDGIILDLSSTSLEGIAVLNIPSMHGGSNLWGETKKRRNYNRMSKKVPERMTGSTVTDAKELKFCVQDLSDQLLEVVGLEGAIEMGQIYTGLKSAGRRLAQCSNVTIRTSRLLPMQIDGEPWMQPPCTIRI 653          

HSP 2 Score: 71.633 bits (174), Expect = 3.462e-12
Identity = 47/137 (34.31%), Postives = 65/137 (47.45%), Query Frame = 2
Query:  533 ITEPAAHCWSEISHF-KRKFCNVCRKRLEDV--AGLRCEICEYYVHTECFDFAISNCKQCAIASTDWPSKEPNHHFREGNLPINSKCFICKKICASVECLTGLRCEWCGITVHTSCYRKIPTECTHGILHD-IILPA 931
            + E   H W ++ HF K  +CN C   L  V   GL C +C+Y VH  C    I+ C     A +   +    H + EGN   ++KC  C +     + LTGL C WC IT+H  C   +  EC  G L D  +LP+
Sbjct:  133 VQEDGQHIW-KLKHFNKPAYCNYCHTMLLGVRKQGLCCALCKYTVHERCVSKDIAPCIS-TYAKSRRHTNAMQHVWMEGN--SSAKCDKCHRSIKCYQGLTGLHCVWCQITLHNKCASNMKPECDGGPLRDHTLLPS 265          

HSP 3 Score: 58.151 bits (139), Expect = 4.870e-8
Identity = 34/109 (31.19%), Postives = 53/109 (48.62%), Query Frame = 2
Query:  359 HCFVKKNFHKPLVCHHCAETLWGLLGTTGYICQICNYLVHEKCVPQIIIPC--NCVLSFVITEPAAHCWSEISHFKRKFCNVCRKRL---EDVAGLRCEICEYYVHTEC 670
            H +  K+F+KP  C++C   L G+    G  C +C Y VHE+CV + I PC      S   T    H W E +   +  C+ C + +   + + GL C  C+  +H +C
Sbjct:  139 HIWKLKHFNKPAYCNYCHTMLLGVR-KQGLCCALCKYTVHERCVSKDIAPCISTYAKSRRHTNAMQHVWMEGNSSAK--CDKCHRSIKCYQGLTGLHCVWCQITLHNKC 244          
BLAST of Diacylglycerol kinase vs. Ensembl Zebrafish
Match: BX548053.1 (diacylglycerol kinase beta-like [Source:NCBI gene;Acc:567728])

HSP 1 Score: 258.455 bits (659), Expect = 1.981e-72
Identity = 149/359 (41.50%), Postives = 211/359 (58.77%), Query Frame = 2
Query: 1982 HPLLVFVNVKSGGCQGTELISSFRKLLNPHQVFNLDYGGPLPGLHCYRNLTNFKILVCGGDGTVGWVLSCLDNVGQDAKCPHPPMAIVPLGTGNDLARVLRWGTGYTGAEDPLSLLKDVVEAEEIRLDRWTVMIKPNEMEKDEQKRALQLQXXXXXXXXXXXRIFLMNNYFGLGIDADLNLDFHLAREENPGKFTSRIHNKGIYFKMGLRKMVNRTKCKDLHHKITLEVDG--RQXXXXXXXXXXXXXXXSWGAGANPWGFTD----------------------DVSNQKFSKPTHYDGMLEVVGVTGVVHMGQIFSGLRT-GTRLAQGGHIRITLKTSVPVQVDGEPWIQSPCQITV 2983
            HPLLV VN KSGG QG  ++  F+ LLNP QV++L+ GGP+ GL+ +R++ +F++L CGGDG+VGW+L C+D     +   HPP+AI+PLGTGNDLAR LRWG GY G    +  L+D+  + E+ LDRW + I P+  +K+E+   +                 ++NNYF +G+DA +   FHL RE++P KF SR+ NK  YF+ G  + ++ T CK L+  I +E DG    +    LEGI +LNI S   G+N WG T                       D    KF      D +LEVVG+ G + MGQI++GL++ G RLAQ  ++ I     +P+Q+DGEPW+Q PC I +
Sbjct:  423 HPLLVLVNPKSGGRQGERVLRKFQYLLNPRQVYSLERGGPMAGLNFFRDVPDFRVLACGGDGSVGWILDCIDKA---SFARHPPVAILPLGTGNDLARCLRWGGGYEGG-SLVKFLRDIEHSTEVLLDRWNIDIVPD--DKEEKGDPVPYS--------------IVNNYFSIGVDASIAHRFHLMREKHPEKFNSRMKNKLWYFEFGTTETISAT-CKKLNETIEVECDGIILDLSSTSLEGIAVLNIPSMHGGSNLWGETKKRRNYNRMSKKVPERMTGSTVTDAKELKFCVQDLSDQLLEVVGLEGAIEMGQIYTGLKSAGRRLAQCSNVTIRTSRLLPMQIDGEPWMQPPCTIRI 760          

HSP 2 Score: 71.2478 bits (173), Expect = 5.661e-12
Identity = 47/139 (33.81%), Postives = 64/139 (46.04%), Query Frame = 2
Query:  533 ITEPAAHCWSEISHF-KRKFCNVCRKRLEDV--AGLRCEICEYYVHTECFDFAISNCKQCAIASTDWPSKEPNHHFREGNLPINSKCFICKKICASVECLTGLRCEWCGITVHTSCYRKIPTECTHGILHDIILPASAV 940
            + E   H W ++ HF K  +CN C   L  V   GL C +C+Y VH  C    I+ C     A +   +    H + EGN   ++KC  C +     + LTGL C WC IT+H  C   +  EC  G L D  L  S +
Sbjct:  257 VQEDGQHIW-KLKHFNKPAYCNYCHTMLLGVRKQGLCCALCKYTVHERCVSKDIAPCIS-TYAKSRRHTNAMQHVWMEGN--SSAKCDKCHRSIKCYQGLTGLHCVWCQITLHNKCASNMKPECDGGPLRDHTLLPSYI 391          

HSP 3 Score: 57.3806 bits (137), Expect = 9.619e-8
Identity = 34/109 (31.19%), Postives = 53/109 (48.62%), Query Frame = 2
Query:  359 HCFVKKNFHKPLVCHHCAETLWGLLGTTGYICQICNYLVHEKCVPQIIIPC--NCVLSFVITEPAAHCWSEISHFKRKFCNVCRKRL---EDVAGLRCEICEYYVHTEC 670
            H +  K+F+KP  C++C   L G+    G  C +C Y VHE+CV + I PC      S   T    H W E +   +  C+ C + +   + + GL C  C+  +H +C
Sbjct:  263 HIWKLKHFNKPAYCNYCHTMLLGVR-KQGLCCALCKYTVHERCVSKDIAPCISTYAKSRRHTNAMQHVWMEGNSSAK--CDKCHRSIKCYQGLTGLHCVWCQITLHNKC 368          
BLAST of Diacylglycerol kinase vs. Ensembl Zebrafish
Match: BX548053.2 (diacylglycerol kinase beta-like [Source:NCBI gene;Acc:567728])

HSP 1 Score: 258.455 bits (659), Expect = 1.981e-72
Identity = 149/359 (41.50%), Postives = 211/359 (58.77%), Query Frame = 2
Query: 1982 HPLLVFVNVKSGGCQGTELISSFRKLLNPHQVFNLDYGGPLPGLHCYRNLTNFKILVCGGDGTVGWVLSCLDNVGQDAKCPHPPMAIVPLGTGNDLARVLRWGTGYTGAEDPLSLLKDVVEAEEIRLDRWTVMIKPNEMEKDEQKRALQLQXXXXXXXXXXXRIFLMNNYFGLGIDADLNLDFHLAREENPGKFTSRIHNKGIYFKMGLRKMVNRTKCKDLHHKITLEVDG--RQXXXXXXXXXXXXXXXSWGAGANPWGFTD----------------------DVSNQKFSKPTHYDGMLEVVGVTGVVHMGQIFSGLRT-GTRLAQGGHIRITLKTSVPVQVDGEPWIQSPCQITV 2983
            HPLLV VN KSGG QG  ++  F+ LLNP QV++L+ GGP+ GL+ +R++ +F++L CGGDG+VGW+L C+D     +   HPP+AI+PLGTGNDLAR LRWG GY G    +  L+D+  + E+ LDRW + I P+  +K+E+   +                 ++NNYF +G+DA +   FHL RE++P KF SR+ NK  YF+ G  + ++ T CK L+  I +E DG    +    LEGI +LNI S   G+N WG T                       D    KF      D +LEVVG+ G + MGQI++GL++ G RLAQ  ++ I     +P+Q+DGEPW+Q PC I +
Sbjct:  423 HPLLVLVNPKSGGRQGERVLRKFQYLLNPRQVYSLERGGPMAGLNFFRDVPDFRVLACGGDGSVGWILDCIDKA---SFARHPPVAILPLGTGNDLARCLRWGGGYEGG-SLVKFLRDIEHSTEVLLDRWNIDIVPD--DKEEKGDPVPYS--------------IVNNYFSIGVDASIAHRFHLMREKHPEKFNSRMKNKLWYFEFGTTETISAT-CKKLNETIEVECDGIILDLSSTSLEGIAVLNIPSMHGGSNLWGETKKRRNYNRMSKKVPERMTGSTVTDAKELKFCVQDLSDQLLEVVGLEGAIEMGQIYTGLKSAGRRLAQCSNVTIRTSRLLPMQIDGEPWMQPPCTIRI 760          

HSP 2 Score: 70.8626 bits (172), Expect = 6.829e-12
Identity = 47/139 (33.81%), Postives = 64/139 (46.04%), Query Frame = 2
Query:  533 ITEPAAHCWSEISHF-KRKFCNVCRKRLEDV--AGLRCEICEYYVHTECFDFAISNCKQCAIASTDWPSKEPNHHFREGNLPINSKCFICKKICASVECLTGLRCEWCGITVHTSCYRKIPTECTHGILHDIILPASAV 940
            + E   H W ++ HF K  +CN C   L  V   GL C +C+Y VH  C    I+ C     A +   +    H + EGN   ++KC  C +     + LTGL C WC IT+H  C   +  EC  G L D  L  S +
Sbjct:  257 VQEDGQHIW-KLKHFNKPAYCNYCHTMLLGVRKQGLCCALCKYTVHERCVSKDIAPCIS-TYAKSRRHTNAMQHVWMEGN--SSAKCDKCHRSIKCYQGLTGLHCVWCQITLHNKCASNMKPECDGGPLRDHTLLPSYI 391          

HSP 3 Score: 56.9954 bits (136), Expect = 1.200e-7
Identity = 34/109 (31.19%), Postives = 53/109 (48.62%), Query Frame = 2
Query:  359 HCFVKKNFHKPLVCHHCAETLWGLLGTTGYICQICNYLVHEKCVPQIIIPC--NCVLSFVITEPAAHCWSEISHFKRKFCNVCRKRL---EDVAGLRCEICEYYVHTEC 670
            H +  K+F+KP  C++C   L G+    G  C +C Y VHE+CV + I PC      S   T    H W E +   +  C+ C + +   + + GL C  C+  +H +C
Sbjct:  263 HIWKLKHFNKPAYCNYCHTMLLGVR-KQGLCCALCKYTVHERCVSKDIAPCISTYAKSRRHTNAMQHVWMEGNSSAK--CDKCHRSIKCYQGLTGLHCVWCQITLHNKC 368          
BLAST of Diacylglycerol kinase vs. Ensembl Zebrafish
Match: BX548053.1 (diacylglycerol kinase beta-like [Source:NCBI gene;Acc:567728])

HSP 1 Score: 258.455 bits (659), Expect = 2.095e-72
Identity = 149/359 (41.50%), Postives = 211/359 (58.77%), Query Frame = 2
Query: 1982 HPLLVFVNVKSGGCQGTELISSFRKLLNPHQVFNLDYGGPLPGLHCYRNLTNFKILVCGGDGTVGWVLSCLDNVGQDAKCPHPPMAIVPLGTGNDLARVLRWGTGYTGAEDPLSLLKDVVEAEEIRLDRWTVMIKPNEMEKDEQKRALQLQXXXXXXXXXXXRIFLMNNYFGLGIDADLNLDFHLAREENPGKFTSRIHNKGIYFKMGLRKMVNRTKCKDLHHKITLEVDG--RQXXXXXXXXXXXXXXXSWGAGANPWGFTD----------------------DVSNQKFSKPTHYDGMLEVVGVTGVVHMGQIFSGLRT-GTRLAQGGHIRITLKTSVPVQVDGEPWIQSPCQITV 2983
            HPLLV VN KSGG QG  ++  F+ LLNP QV++L+ GGP+ GL+ +R++ +F++L CGGDG+VGW+L C+D     +   HPP+AI+PLGTGNDLAR LRWG GY G    +  L+D+  + E+ LDRW + I P+  +K+E+   +                 ++NNYF +G+DA +   FHL RE++P KF SR+ NK  YF+ G  + ++ T CK L+  I +E DG    +    LEGI +LNI S   G+N WG T                       D    KF      D +LEVVG+ G + MGQI++GL++ G RLAQ  ++ I     +P+Q+DGEPW+Q PC I +
Sbjct:  415 HPLLVLVNPKSGGRQGERVLRKFQYLLNPRQVYSLERGGPMAGLNFFRDVPDFRVLACGGDGSVGWILDCIDKA---SFARHPPVAILPLGTGNDLARCLRWGGGYEGG-SLVKFLRDIEHSTEVLLDRWNIDIVPD--DKEEKGDPVPYS--------------IVNNYFSIGVDASIAHRFHLMREKHPEKFNSRMKNKLWYFEFGTTETISAT-CKKLNETIEVECDGIILDLSSTSLEGIAVLNIPSMHGGSNLWGETKKRRNYNRMSKKVPERMTGSTVTDAKELKFCVQDLSDQLLEVVGLEGAIEMGQIYTGLKSAGRRLAQCSNVTIRTSRLLPMQIDGEPWMQPPCTIRI 752          

HSP 2 Score: 71.2478 bits (173), Expect = 4.784e-12
Identity = 49/148 (33.11%), Postives = 69/148 (46.62%), Query Frame = 2
Query:  533 ITEPAAHCWSEISHF-KRKFCNVCRKRLEDV--AGLRCEICEYYVHTECFDFAISNCKQCAIASTDWPSKEPNHHFREGNLPINSKCFICKKICASVECLTGLRCEWCGITVHTSCYRKIPTECTHGILHD-IILPASAVSLPRTSSL 964
            + E   H W ++ HF K  +CN C   L  V   GL C +C+Y VH  C    I+ C     A +   +    H + EGN   ++KC  C +     + LTGL C WC IT+H  C   +  EC  G L D  +LP+    +   SS+
Sbjct:  251 VQEDGQHIW-KLKHFNKPAYCNYCHTMLLGVRKQGLCCALCKYTVHERCVSKDIAPCIS-TYAKSRRHTNAMQHVWMEGN--SSAKCDKCHRSIKCYQGLTGLHCVWCQITLHNKCASNMKPECDGGPLRDHTLLPSYICPVVLVSSV 394          

HSP 3 Score: 57.3806 bits (137), Expect = 1.070e-7
Identity = 34/109 (31.19%), Postives = 53/109 (48.62%), Query Frame = 2
Query:  359 HCFVKKNFHKPLVCHHCAETLWGLLGTTGYICQICNYLVHEKCVPQIIIPC--NCVLSFVITEPAAHCWSEISHFKRKFCNVCRKRL---EDVAGLRCEICEYYVHTEC 670
            H +  K+F+KP  C++C   L G+    G  C +C Y VHE+CV + I PC      S   T    H W E +   +  C+ C + +   + + GL C  C+  +H +C
Sbjct:  257 HIWKLKHFNKPAYCNYCHTMLLGVR-KQGLCCALCKYTVHERCVSKDIAPCISTYAKSRRHTNAMQHVWMEGNSSAK--CDKCHRSIKCYQGLTGLHCVWCQITLHNKC 362          
BLAST of Diacylglycerol kinase vs. Ensembl Zebrafish
Match: BX548053.2 (diacylglycerol kinase beta-like [Source:NCBI gene;Acc:567728])

HSP 1 Score: 258.07 bits (658), Expect = 2.434e-72
Identity = 149/359 (41.50%), Postives = 211/359 (58.77%), Query Frame = 2
Query: 1982 HPLLVFVNVKSGGCQGTELISSFRKLLNPHQVFNLDYGGPLPGLHCYRNLTNFKILVCGGDGTVGWVLSCLDNVGQDAKCPHPPMAIVPLGTGNDLARVLRWGTGYTGAEDPLSLLKDVVEAEEIRLDRWTVMIKPNEMEKDEQKRALQLQXXXXXXXXXXXRIFLMNNYFGLGIDADLNLDFHLAREENPGKFTSRIHNKGIYFKMGLRKMVNRTKCKDLHHKITLEVDG--RQXXXXXXXXXXXXXXXSWGAGANPWGFTD----------------------DVSNQKFSKPTHYDGMLEVVGVTGVVHMGQIFSGLRT-GTRLAQGGHIRITLKTSVPVQVDGEPWIQSPCQITV 2983
            HPLLV VN KSGG QG  ++  F+ LLNP QV++L+ GGP+ GL+ +R++ +F++L CGGDG+VGW+L C+D     +   HPP+AI+PLGTGNDLAR LRWG GY G    +  L+D+  + E+ LDRW + I P+  +K+E+   +                 ++NNYF +G+DA +   FHL RE++P KF SR+ NK  YF+ G  + ++ T CK L+  I +E DG    +    LEGI +LNI S   G+N WG T                       D    KF      D +LEVVG+ G + MGQI++GL++ G RLAQ  ++ I     +P+Q+DGEPW+Q PC I +
Sbjct:  417 HPLLVLVNPKSGGRQGERVLRKFQYLLNPRQVYSLERGGPMAGLNFFRDVPDFRVLACGGDGSVGWILDCIDKA---SFARHPPVAILPLGTGNDLARCLRWGGGYEGGS-LVKFLRDIEHSTEVLLDRWNIDIVPD--DKEEKGDPVPYS--------------IVNNYFSIGVDASIAHRFHLMREKHPEKFNSRMKNKLWYFEFGTTETISAT-CKKLNETIEVECDGIILDLSSTSLEGIAVLNIPSMHGGSNLWGETKKRRNYNRMSKKVPERMTGSTVTDAKELKFCVQDLSDQLLEVVGLEGAIEMGQIYTGLKSAGRRLAQCSNVTIRTSRLLPMQIDGEPWMQPPCTIRI 754          

HSP 2 Score: 71.633 bits (174), Expect = 4.711e-12
Identity = 49/148 (33.11%), Postives = 69/148 (46.62%), Query Frame = 2
Query:  533 ITEPAAHCWSEISHF-KRKFCNVCRKRLEDV--AGLRCEICEYYVHTECFDFAISNCKQCAIASTDWPSKEPNHHFREGNLPINSKCFICKKICASVECLTGLRCEWCGITVHTSCYRKIPTECTHGILHD-IILPASAVSLPRTSSL 964
            + E   H W ++ HF K  +CN C   L  V   GL C +C+Y VH  C    I+ C     A +   +    H + EGN   ++KC  C +     + LTGL C WC IT+H  C   +  EC  G L D  +LP+    +   SS+
Sbjct:  253 VQEDGQHIW-KLKHFNKPAYCNYCHTMLLGVRKQGLCCALCKYTVHERCVSKDIAPCIS-TYAKSRRHTNAMQHVWMEGN--SSAKCDKCHRSIKCYQGLTGLHCVWCQITLHNKCASNMKPECDGGPLRDHTLLPSYICPVVLVSSV 396          

HSP 3 Score: 57.3806 bits (137), Expect = 9.347e-8
Identity = 34/109 (31.19%), Postives = 53/109 (48.62%), Query Frame = 2
Query:  359 HCFVKKNFHKPLVCHHCAETLWGLLGTTGYICQICNYLVHEKCVPQIIIPC--NCVLSFVITEPAAHCWSEISHFKRKFCNVCRKRL---EDVAGLRCEICEYYVHTEC 670
            H +  K+F+KP  C++C   L G+    G  C +C Y VHE+CV + I PC      S   T    H W E +   +  C+ C + +   + + GL C  C+  +H +C
Sbjct:  259 HIWKLKHFNKPAYCNYCHTMLLGVR-KQGLCCALCKYTVHERCVSKDIAPCISTYAKSRRHTNAMQHVWMEGNSSAK--CDKCHRSIKCYQGLTGLHCVWCQITLHNKC 364          
BLAST of Diacylglycerol kinase vs. Ensembl Xenopus
Match: DGKQ (diacylglycerol kinase theta [Source:NCBI gene;Acc:733958])

HSP 1 Score: 609.372 bits (1570), Expect = 0.000e+0
Identity = 349/896 (38.95%), Postives = 512/896 (57.14%), Query Frame = 2
Query:  356 GHCFVKKNFHKPLVCHHCAETLWGLLGTTGYICQICNYLVHEKCVPQIIIPCNCVLSFVITEPAAHCWSEISHFKRKFCNVCRKRLEDVAGLRCEICEYYVHTECFDFAISNCKQCAIASTDWPSKEPNHHFREGNLPINSKCFICKKICASVECLTGLRCEWCGITVHTSCYRKIPTECTHGILHDIILPASAVSLPRTSSLIEQIYEIKRPKQEDLMAQTLVDDFSDSDSGREESGFERKSVKEK--RDKEYYDFVRLYDGMARFKKKQCRYLSLGKSTSVQRVIEMSMKAFQLPF----YEINNIYLVEINEKDNSDKWLKEN---EPFKKQLQFDMRRPQVILKLKTKNVERDYISIYPGDLTXXXXXXXXXXXXXXXXXXDATTILVLALRRLGLEHMNSHKFHLVETSLDCGITER-VIEKDEILWSILERLQKESLRAFTLTRFYIRSVADPYGTGGVAVYVGNLKKGLSQRLYERILIDRLTPANRWNAIEVIYYDSGSLVLIYSNAEKAESAYNILKESTFDDNALTAIILPRVETSAIPNDIHPLLVFVNVKSGGCQGTELISSFRKLLNPHQVFNLDYGGPLPGLHCYRNLTNFKILVCGGDGTVGWVLSCLDNVGQDAKCPHPPMAIVPLGTGNDLARVLRWGTGYTGAEDPLSLLKDVVEAEEIRLDRWTVMIKPNEMEKDEQKRALQLQXXXXXXXXXXXRIFLMNNYFGLGIDADLNLDFHLAREENPGKFTSRIHNKGIYFKMGLRKMVNRTKCKDLHHKITLEVDGRQXXXXXXXXXXXXXXXSWGAGANPWGFTDDVSNQKFSKPTHYDGMLEVVGVTGVVHMGQIFSGLRTGTRLAQGGHIRITLKTSVPVQVDGEPWIQSPCQITVLRSALKATML 3013
             H F K    KP  CHHC + +WGL    G+ C++CN++ HEKC+  +   C+C+   ++  P AHC+    H+K+KFC+VCRK LE+   LRCE+CE +VHT+C  FA S+C+QC            +HH+REGN   +++C +CKK C S E L+G++CEWCGI  H++CY  +  ECT G L  ++LP + V L   +      + I     E++ A        + D   E  G  + SVKE           +++YDG    K+ Q R +S+ +    + V+E +++A+ +P     YE+  +    + +   SD  +  N   E  K    F    P+  + ++ K  ER+ + IYPG +         P+    T      T++   L +LG +  N   F LVE  +     +R V+  +EI++  L  ++K S+R    TRFYI     P     + +++  L   LS   Y  +L + L   ++  ++   Y   G++VL      +AE  + ++K+++ ++  L  +I+P +    +P +  PLLVFVN KSGG +G +L+ SFRKLLNPHQVF L  GGPLPG H +  +  F++LVCGGDGTVGWVL  L+ +     C  P +A++PLGTGNDL RVLRWG GY+G EDP S+L  V EAE + +DRWT+++   E   D  +  +           +  +I  MNNY G+GIDA+L+LDFH ARE  PGKF SR HNKG+Y K GL+K+ +    ++LH  + L+VD +++ELP +EG+I LNI SWG+GA+ WG  +D    ++ KP   DG+LEVVGVTGVVHMGQ+  GLR+G R+AQG + R+TL   +PVQVDGEPWIQ P QI +  +  K  ML
Sbjct:   75 AHSFRKVTLTKPTFCHHCTDFIWGL---AGFQCEVCNFMSHEKCLKHVKTVCSCMAPSLVRVPVAHCFRPPGHYKKKFCSVCRKHLEESLTLRCEVCELHVHTDCAQFACSDCRQCH-HDGQQNHDTYHHHWREGNTSSSARCEVCKKNCGSSEVLSGMKCEWCGIQAHSACYIILTHECTFGRLRSMVLPPNCVHLQARNFSKMHCFRIS----ENIQA--------EQDEDNENDGIIQGSVKETPTSADSSKQSLKIYDGHDAVKRNQPRIISVPRIAKSEEVVEAALRAYYIPDEPQDYELQTL----MQQTLVSDDIINRNGAMEDGKVGSVFKEATPEAWM-IRAKPKEREILKIYPGWMKVGVAYISIPVNKEHT----VQTVIQEVLIQLGRQKENLENFRLVEVLMSSKQVQRMVLPFEEIIFDRLNEVRKTSIRQMNQTRFYIEENEKPEIK--IHIFISGLPPLLSSEEYTDLLKEHLAIKDKLVSVIPAYSPQGAVVLEILCFSEAERIFMLVKDTSINNKQLHGVIIPHIMHEKLPQETCPLLVFVNPKSGGLKGRDLLYSFRKLLNPHQVFELTNGGPLPGFHTFSRVPYFRVLVCGGDGTVGWVLGALEEIRHKLACTEPSIAVLPLGTGNDLGRVLRWGAGYSG-EDPYSILISVNEAENVLMDRWTILLDAQEA-VDVMENGIS--------EPDPPKIVQMNNYCGIGIDAELSLDFHHAREIEPGKFNSRFHNKGVYVKAGLQKLSHN---RNLHRDMKLQVDQQEVELPNIEGLIFLNIPSWGSGADLWGSDND---NRYGKPRIDDGLLEVVGVTGVVHMGQVQGGLRSGIRIAQGSYFRVTLLKPIPVQVDGEPWIQPPGQIIISAAGPKVHML 927          
BLAST of Diacylglycerol kinase vs. Ensembl Xenopus
Match: DGKQ (diacylglycerol kinase theta [Source:NCBI gene;Acc:733958])

HSP 1 Score: 376.711 bits (966), Expect = 4.198e-114
Identity = 201/432 (46.53%), Postives = 280/432 (64.81%), Query Frame = 2
Query: 1718 VAVYVGNLKKGLSQRLYERILIDRLTPANRWNAIEVIYYDSGSLVLIYSNAEKAESAYNILKESTFDDNALTAIILPRVETSAIPNDIHPLLVFVNVKSGGCQGTELISSFRKLLNPHQVFNLDYGGPLPGLHCYRNLTNFKILVCGGDGTVGWVLSCLDNVGQDAKCPHPPMAIVPLGTGNDLARVLRWGTGYTGAEDPLSLLKDVVEAEEIRLDRWTVMIKPNEMEKDEQKRALQLQXXXXXXXXXXXRIFLMNNYFGLGIDADLNLDFHLAREENPGKFTSRIHNKGIYFKMGLRKMVNRTKCKDLHHKITLEVDGRQXXXXXXXXXXXXXXXSWGAGANPWGFTDDVSNQKFSKPTHYDGMLEVVGVTGVVHMGQIFSGLRTGTRLAQGGHIRITLKTSVPVQVDGEPWIQSPCQITVLRSALKATML 3013
            + +++  L   LS   Y  +L + L   ++  ++   Y   G++VL      +AE  + ++K+++ ++  L  +I+P +    +P +  PLLVFVN KSGG +G +L+ SFRKLLNPHQVF L  GGPLPG H +  +  F++LVCGGDGTVGWVL  L+ +     C  P +A++PLGTGNDL RVLRWG GY+G EDP S+L  V EAE + +DRWT+++   E   D  +  +           +  +I  MNNY G+GIDA+L+LDFH ARE  PGKF SR HNKG+Y K GL+K+ +    ++LH  + L+VD +++ELP +EG+I LNI SWG+GA+ WG  +D    ++ KP   DG+LEVVGVTGVVHMGQ+  GLR+G R+AQG + R+TL   +PVQVDGEPWIQ P QI +  +  K  ML
Sbjct:  429 IHIFISGLPPLLSSEEYTDLLKEHLAIKDKLVSVIPAYSPQGAVVLEILCFSEAERIFMLVKDTSINNKQLHGVIIPHIMHEKLPQETCPLLVFVNPKSGGLKGRDLLYSFRKLLNPHQVFELTNGGPLPGFHTFSRVPYFRVLVCGGDGTVGWVLGALEEIRHKLACTEPSIAVLPLGTGNDLGRVLRWGAGYSG-EDPYSILISVNEAENVLMDRWTILLDAQEA-VDVMENGIS--------EPDPPKIVQMNNYCGIGIDAELSLDFHHAREIEPGKFNSRFHNKGVYVKAGLQKLSHN---RNLHRDMKLQVDQQEVELPNIEGLIFLNIPSWGSGADLWGSDND---NRYGKPRIDDGLLEVVGVTGVVHMGQVQGGLRSGIRIAQGSYFRVTLLKPIPVQVDGEPWIQPPGQIIISAAGPKVHML 844          

HSP 2 Score: 224.557 bits (571), Expect = 3.021e-60
Identity = 124/365 (33.97%), Postives = 194/365 (53.15%), Query Frame = 2
Query:  356 GHCFVKKNFHKPLVCHHCAETLWGLLGTTGYICQICNYLVHEKCVPQIIIPCNCVLSFVITEPAAHCWSEISHFKRKFCNVCRKRLEDVAGLRCEICEYYVHTECFDFAISNCKQCAI-ASTDWPSKEPNHHFREGNLPINSKCFICKKICASVECLTGLRCEWCGITVHTSCYRKIPTECTHGILHDIILPASAVSLPRTSSLIEQIYEIKRPKQ--EDLMAQTLVDDFSDSDSGREESGFERKSVKEKRDKEYYDFVRLYDGMARFKKKQCRYLSLGKSTSVQRVIEMSMKAFQLP----FYEINNIYLVEINEKDNSDKWLKEN---EPFKKQLQFDMRRPQVILKLKTKNVERDYISIYPG 1420
             H F K    KP  CHHC + +WGL    G+ C++CN++ HEKC+  +   C+C+   ++  P AHC+    H+K+KFC+VCRK LE+   LRCE+CE +VHT+C  FA S+C+QC      +  S   +HH+REGN   +++C +CKK C S E L+G++CEWCGI  H++CY  +  ECT G L  ++LP + V L   +      + I    Q  +  MA T          G+ E G  R+    K+       +++YDG    K+ Q R +S+ +    + V+E +++A+ +P     YE+  +    + +   SD  +  N   E  K    F    P+  + ++ K  ER+ + IYPG
Sbjct:   42 AHSFRKVTLTKPTFCHHCTDFIWGL---AGFQCEVCNFMSHEKCLKHVKTVCSCMAPSLVRVPVAHCFRPPGHYKKKFCSVCRKHLEESLTLRCEVCELHVHTDCAQFACSDCRQCHHDGQQNHVSDTYHHHWREGNTSSSARCEVCKKNCGSSEVLSGMKCEWCGIQAHSACYIILTHECTFGRLRSMVLPPNCVHLQARNFSKMHCFRISENIQAEQGFMAHT-------GSIGQAEYGTHRQYRAGKQS------LKIYDGHDAVKRNQPRIISVPRIAKSEEVVEAALRAYYIPDEPQDYELQTL----MQQTLVSDDIINRNGAMEDGKVGSVFKEATPEAWM-IRAKPKEREILKIYPG 385          
BLAST of Diacylglycerol kinase vs. Ensembl Xenopus
Match: DGKQ (diacylglycerol kinase theta [Source:NCBI gene;Acc:733958])

HSP 1 Score: 377.481 bits (968), Expect = 5.975e-114
Identity = 201/432 (46.53%), Postives = 280/432 (64.81%), Query Frame = 2
Query: 1718 VAVYVGNLKKGLSQRLYERILIDRLTPANRWNAIEVIYYDSGSLVLIYSNAEKAESAYNILKESTFDDNALTAIILPRVETSAIPNDIHPLLVFVNVKSGGCQGTELISSFRKLLNPHQVFNLDYGGPLPGLHCYRNLTNFKILVCGGDGTVGWVLSCLDNVGQDAKCPHPPMAIVPLGTGNDLARVLRWGTGYTGAEDPLSLLKDVVEAEEIRLDRWTVMIKPNEMEKDEQKRALQLQXXXXXXXXXXXRIFLMNNYFGLGIDADLNLDFHLAREENPGKFTSRIHNKGIYFKMGLRKMVNRTKCKDLHHKITLEVDGRQXXXXXXXXXXXXXXXSWGAGANPWGFTDDVSNQKFSKPTHYDGMLEVVGVTGVVHMGQIFSGLRTGTRLAQGGHIRITLKTSVPVQVDGEPWIQSPCQITVLRSALKATML 3013
            + +++  L   LS   Y  +L + L   ++  ++   Y   G++VL      +AE  + ++K+++ ++  L  +I+P +    +P +  PLLVFVN KSGG +G +L+ SFRKLLNPHQVF L  GGPLPG H +  +  F++LVCGGDGTVGWVL  L+ +     C  P +A++PLGTGNDL RVLRWG GY+G EDP S+L  V EAE + +DRWT+++   E   D  +  +           +  +I  MNNY G+GIDA+L+LDFH ARE  PGKF SR HNKG+Y K GL+K+ +    ++LH  + L+VD +++ELP +EG+I LNI SWG+GA+ WG  +D    ++ KP   DG+LEVVGVTGVVHMGQ+  GLR+G R+AQG + R+TL   +PVQVDGEPWIQ P QI +  +  K  ML
Sbjct:  468 IHIFISGLPPLLSSEEYTDLLKEHLAIKDKLVSVIPAYSPQGAVVLEILCFSEAERIFMLVKDTSINNKQLHGVIIPHIMHEKLPQETCPLLVFVNPKSGGLKGRDLLYSFRKLLNPHQVFELTNGGPLPGFHTFSRVPYFRVLVCGGDGTVGWVLGALEEIRHKLACTEPSIAVLPLGTGNDLGRVLRWGAGYSG-EDPYSILISVNEAENVLMDRWTILLDAQEA-VDVMENGIS--------EPDPPKIVQMNNYCGIGIDAELSLDFHHAREIEPGKFNSRFHNKGVYVKAGLQKLSHN---RNLHRDMKLQVDQQEVELPNIEGLIFLNIPSWGSGADLWGSDND---NRYGKPRIDDGLLEVVGVTGVVHMGQVQGGLRSGIRIAQGSYFRVTLLKPIPVQVDGEPWIQPPGQIIISAAGPKVHML 883          

HSP 2 Score: 212.231 bits (539), Expect = 5.308e-56
Identity = 120/371 (32.35%), Postives = 191/371 (51.48%), Query Frame = 2
Query:  356 GHCFVKKNFHKPLVCHHCAETLWGLLGTTGYICQICNYLVHEKCVPQIIIPCNCVLSFVITEPAAHCWSEISHFKRKFCNVCRKRLEDVAGLRCEICEYYVHTECFDFAISNCKQCAIASTDWPSKEPNHHFREGNLPINSKCFICKKICASVECLTGLRCEWCGITVHTSCYRKIPTECTHGILHDIILPASAVSLPRTSSLIEQIYEIKRPKQED---------LMAQTLVDDFSDSDSGREESGFERKSVKEKRDKEYYDFVRLYDGMARFKKKQCRYLSLGKSTSVQRVIEMSMKAFQLP----FYEINNIYLVEINEKDNSDKWLKEN---EPFKKQLQFDMRRPQVILKLKTKNVERDYISIYPG 1420
             H F K    KP  CHHC + +WGL    G+ C++CN++ HEKC+  +   C+C+   ++  P AHC+    H+K+KFC+VCRK LE+   LRCE+CE +VHT+C  FA S+C+QC            +HH+REGN   +++C +CKK C S E L+G++CEWCGI  H++CY  +  ECT G L  ++LP + V L   +      + I    Q +         L A  +      + +    + F ++S+K            +YDG    K+ Q R +S+ +    + V+E +++A+ +P     YE+  +    + +   SD  +  N   E  K    F    P+  + ++ K  ER+ + IYPG
Sbjct:   75 AHSFRKVTLTKPTFCHHCTDFIWGL---AGFQCEVCNFMSHEKCLKHVKTVCSCMAPSLVRVPVAHCFRPPGHYKKKFCSVCRKHLEESLTLRCEVCELHVHTDCAQFACSDCRQCH-HDGQQNHDTYHHHWREGNTSSSARCEVCKKNCGSSEVLSGMKCEWCGIQAHSACYIILTHECTFGRLRSMVLPPNCVHLQARNFSKMHCFRISENIQAEQGLYCLYHLLWALFITSIPKVTVNALVHADFCKQSLK------------IYDGHDAVKRNQPRIISVPRIAKSEEVVEAALRAYYIPDEPQDYELQTL----MQQTLVSDDIINRNGAMEDGKVGSVFKEATPEAWM-IRAKPKEREILKIYPG 424          
BLAST of Diacylglycerol kinase vs. Ensembl Xenopus
Match: DGKQ (diacylglycerol kinase theta [Source:NCBI gene;Acc:733958])

HSP 1 Score: 358.992 bits (920), Expect = 2.675e-107
Identity = 201/435 (46.21%), Postives = 275/435 (63.22%), Query Frame = 2
Query: 1718 VAVYVGNLKKGLSQRLYERILIDRLTPANRWNAIEVIYYDSGSLVL---IYSNAEKAESAYNILKESTFDDNALTAIILPRVETSAIPNDIHPLLVFVNVKSGGCQGTELISSFRKLLNPHQVFNLDYGGPLPGLHCYRNLTNFKILVCGGDGTVGWVLSCLDNVGQDAKCPHPPMAIVPLGTGNDLARVLRWGTGYTGAEDPLSLLKDVVEAEEIRLDRWTVMIKPNEMEKDEQKRALQLQXXXXXXXXXXXRIFLMNNYFGLGIDADLNLDFHLAREENPGKFTSRIHNKGIYFKMGLRKMVNRTKCKDLHHKITLEVDGRQXXXXXXXXXXXXXXXSWGAGANPWGFTDDVSNQKFSKPTHYDGMLEVVGVTGVVHMGQIFSGLRTGTRLAQGGHIRITLKTSVPVQVDGEPWIQSPCQITVLRSALKATML 3013
            + +++  L   LS   Y  +L + L   ++  ++   Y   G++VL    +S AE+    + +     F       I+L  ++   +P +  PLLVFVN KSGG +G +L+ SFRKLLNPHQVF L  GGPLPG H +  +  F++LVCGGDGTVGWVL  L+ +     C  P +A++PLGTGNDL RVLRWG GY+G EDP S+L  V EAE + +DRWT+++   E   D  +  +           +  +I  MNNY G+GIDA+L+LDFH ARE  PGKF SR HNKG+Y K GL+K+ +    ++LH  + L+VD +++ELP +EG+I LNI SWG+GA+ WG  +D    ++ KP   DG+LEVVGVTGVVHMGQ+  GLR+G R+AQG + R+TL   +PVQVDGEPWIQ P QI +  +  K  ML
Sbjct:  459 IHIFISGLPPLLSSEEYTDLLKEHLAIKDKLVSVIPAYSPQGAVVLEILCFSEAERIFMLFCLRVIYLF-------ILLFYLQHEKLPQETCPLLVFVNPKSGGLKGRDLLYSFRKLLNPHQVFELTNGGPLPGFHTFSRVPYFRVLVCGGDGTVGWVLGALEEIRHKLACTEPSIAVLPLGTGNDLGRVLRWGAGYSG-EDPYSILISVNEAENVLMDRWTILLDAQEA-VDVMENGIS--------EPDPPKIVQMNNYCGIGIDAELSLDFHHAREIEPGKFNSRFHNKGVYVKAGLQKLSHN---RNLHRDMKLQVDQQEVELPNIEGLIFLNIPSWGSGADLWGSDND---NRYGKPRIDDGLLEVVGVTGVVHMGQVQGGLRSGIRIAQGSYFRVTLLKPIPVQVDGEPWIQPPGQIIISAAGPKVHML 870          

HSP 2 Score: 217.238 bits (552), Expect = 1.004e-57
Identity = 122/362 (33.70%), Postives = 188/362 (51.93%), Query Frame = 2
Query:  356 GHCFVKKNFHKPLVCHHCAETLWGLLGTTGYICQICNYLVHEKCVPQIIIPCNCVLSFVITEPAAHCWSEISHFKRKFCNVCRKRLEDVAGLRCEICEYYVHTECFDFAISNCKQCAIASTDWPSKEPNHHFREGNLPINSKCFICKKICASVECLTGLRCEWCGITVHTSCYRKIPTECTHGILHDIILPASAVSLPRTSSLIEQIYEIKRPKQEDLMAQTLVDDFSDSDSGREESGFERKSVKEKRDKEYYDFVRLYDGMARFKKKQCRYLSLGKSTSVQRVIEMSMKAFQLP----FYEINNIYLVEINEKDNSDKWLKEN---EPFKKQLQFDMRRPQVILKLKTKNVERDYISIYPG 1420
             H F K    KP  CHHC + +WGL    G+ C++CN++ HEKC+  +   C+C+   ++  P AHC+    H+K+KFC+VCRK LE+   LRCE+CE +VHT+C  FA S+C+QC            +HH+REGN   +++C +CKK C S E L+G++CEWCGI  H++CY  +  ECT G L  ++LP + V L   +      + I    Q +   Q   D  SD    R         V    D      +++YDG    K+ Q R +S+ +    + V+E +++A+ +P     YE+  +    + +   SD  +  N   E  K    F    P+  + ++ K  ER+ + IYPG
Sbjct:   75 AHSFRKVTLTKPTFCHHCTDFIWGL---AGFQCEVCNFMSHEKCLKHVKTVCSCMAPSLVRVPVAHCFRPPGHYKKKFCSVCRKHLEESLTLRCEVCELHVHTDCAQFACSDCRQCH-HDGQQNHDTYHHHWREGNTSSSARCEVCKKNCGSSEVLSGMKCEWCGIQAHSACYIILTHECTFGRLRSMVLPPNCVHLQARNFSKMHCFRISENIQAE---QGRFDILSDQGPHR--------LVDAAPDSPAL-VLKIYDGHDAVKRNQPRIISVPRIAKSEEVVEAALRAYYIPDEPQDYELQTL----MQQTLVSDDIINRNGAMEDGKVGSVFKEATPEAWM-IRAKPKEREILKIYPG 415          
BLAST of Diacylglycerol kinase vs. Ensembl Xenopus
Match: DGKA (diacylglycerol kinase alpha [Source:NCBI gene;Acc:100124931])

HSP 1 Score: 242.276 bits (617), Expect = 7.095e-68
Identity = 152/382 (39.79%), Postives = 212/382 (55.50%), Query Frame = 2
Query: 1934 AIILPRVETSAIPNDIHPLLVFVNVKSGGCQGTELISSFRKLLNPHQVFNLDYGGPLPGLHCYRNLTNFKILVCGGDGTVGWVLSCLDNVGQDAKCPH-PPMAIVPLGTGNDLARVLRWGTGYTGAEDPLSLLKDVVEAEEIRLDRWTVMIKPNEMEKDEQKRALQLQXXXXXXXXXXXRIFLMNNYFGLGIDADLNLDFHLAREENPGKFTSRIHNKGIYFKMGLRKMVNRTKCKDLHHKITLEVDGRQXXXXXXXXXXXXXXX--SWGAGANPWGFTDDVSNQKFSKPTH-------------------YDGMLEVVGVTGVVHMGQIFSGLRT-GTRLAQGGHIRITLKTSVPVQVDGEPWIQSPCQITVLRSALKATM 3010
            A I P +  + +P   HPLLVFVN KSGG QG  ++  F+ LLNP QV NL  GGP PGL+ +R++  ++ILVCGGDGTVGW+L  +D     A  P+ PP+A++PLGTGNDLAR L WG GY G E+ +  LKD+ ++  I++DRW + + P     DE+   +  +              ++NNYF +G+DA +   FH  RE+ P KF SR+ NK  YF+    + V  T CK L   IT+E  G  ++L  L    I  I   S   G+N WG T     +  +   H                    D  LEVVG+ G + MGQI++GL++ G RLA    + I     +P+Q+DGEPW+Q PC  TV ++A+ A +
Sbjct:  258 ACIYPVILIAPLPG-THPLLVFVNPKSGGKQGERVLRKFQYLLNPRQVHNLIKGGPSPGLNFFRDVPEYRILVCGGDGTVGWILDAIDK----ANLPYRPPVAVLPLGTGNDLARCLSWGGGYDG-ENLMKFLKDIEKSVPIKMDRWNIEVIPE--NPDEKGDPVPYE--------------IINNYFSIGVDASIAHRFHNMREKYPEKFNSRMKNKLWYFEFATSETVFST-CKKLKEVITIECCGSPLKLSSLSLEGIAVINIPSMHGGSNLWGETKKHWGEPRNASCHNAPEAITDPDALKSCVQDLSDKRLEVVGLEGAIEMGQIYTGLKSAGKRLATCSELTIRTTKPLPMQIDGEPWMQPPC--TVRQAAIIALL 614          

HSP 2 Score: 56.6102 bits (135), Expect = 2.463e-7
Identity = 47/139 (33.81%), Postives = 61/139 (43.88%), Query Frame = 2
Query:  533 ITEPAAHCWSEISHFKRK-FCNVCRKRLEDV--AGLRCEICEYYVHTECFDFAISNCKQCAIASTDWPSKEPNHHFREGNLPINSKCFICKKICASVECLTGLRCEWCGITVHTSCYRKIPTECTHGILHDIILPASAV 940
            I +   H W  + HF R  +CNVC   L  V   GL C  C++ VH  C   A ++C      S    S++ +   R G     SKC  C+K   S + LTG RC      VH  C       C  GIL D ILP + +
Sbjct:  133 IKDDGQHLW-RLKHFNRPVYCNVCEALLFGVRKQGLCCTFCKFTVHERCARKAPNSCISTYAKSRKDFSEQAHVWMRGGCEA--SKCDKCQKKIKSFQSLTGQRC------VHDECASS--PLCDGGILKDHILPPACI 260          
BLAST of Diacylglycerol kinase vs. Ensembl Mouse
Match: Dgkq (diacylglycerol kinase, theta [Source:MGI Symbol;Acc:MGI:102918])

HSP 1 Score: 608.601 bits (1568), Expect = 0.000e+0
Identity = 345/893 (38.63%), Postives = 519/893 (58.12%), Query Frame = 2
Query:  356 GHCFVKKNFHKPLVCHHCAETLWGLLGTTGYICQICNYLVHEKCVPQIIIPCNCVLSFVITEPAAHCWSEISHFKRKFCNVCRKRLEDVAGLRCEICEYYVHTECFDFAISNCKQC-AIASTDWPSKEPNHHFREGNLPINSKCFICKKICASVECLTGLRCEWCGITVHTSCYRKIPTECTHGILHDIILPASAVSLPRTSSLIEQIYEIKRPKQEDLMAQTLVDDFSDSDSGREESGFERKSVKEKRDKEYYDFVRLYDGMARFKKKQCRYLSLGKSTSVQRVIEMSMKAFQLPFYEINNIYLVEINEKDNSDKWLKENEPFKKQLQFDMRRPQVILKLKTKNVER--DYISIYPGDLTXXXXXXXXXXXXXXXXXXDATTILVLALRRLGLEHMNSHKFHLVETSLDCGITERVIEKDEILWSILERL---QKESLRAFTLTRFYIRSVADPYGTGG-VAVYVGNLKKGLSQRLYERILIDRLTPANRWNAIEVIYYDSGSLVLIYSNAEKAESAYNILKESTFDDNALTAIILPRVETSAIPNDIHPLLVFVNVKSGGCQGTELISSFRKLLNPHQVFNLDYGGPLPGLHCYRNLTNFKILVCGGDGTVGWVLSCLDNVGQDAKCPHPPMAIVPLGTGNDLARVLRWGTGYTGAEDPLSLLKDVVEAEEIRLDRWTVMIKPNEMEKDEQKRALQLQXXXXXXXXXXXRIFLMNNYFGLGIDADLNLDFHLAREENPGKFTSRIHNKGIYFKMGLRKMVNRTKCKDLHHKITLEVDGRQXXXXXXXXXXXXXXXSWGAGANPWGFTDDVSNQKFSKPTHYDGMLEVVGVTGVVHMGQIFSGLRTGTRLAQGGHIRITLKTSVPVQVDGEPWIQSPCQITVLRSALKATML 3013
            GH F K    KP  CH C++ +WGL    G++C +CN++ HEKC+ Q+  PC  +   ++  P AHC+  +  +KRKFC VCRK LE V   RCE+CE +VH +C  FA S+C+QC      D+ +   +HH+REGNLP  ++C +C+K C S + L G+RCEWCG+  H+ C   +  ECT G L  ++LP S V L   S    +++  + P  E ++ +    D     S    +G E  +  E   +     ++++DG    +K Q R +++ +    + V+E +++A+ +   +  +  L  +    N+    K     ++  +    R  V      +++ R  + + IYPG L          +    T    A +++   L   G +  +  +F L+E  +     +R +  DE    +L+RL   ++ S+R  + TRFY   VA+   T   V+++VG L  GLS + Y  +L + +       ++  +Y   G+++L  +   +AE  Y + +++      LTA++LP V  + +P D  PLLVFVN KSGG +G EL+ SFRKLLNPHQVF L  GGPLPG H +  + +F++LVCGGDGTVGWVL+ L+   +   CP P +AI+PLGTGNDL RVLRWG GY+G EDP S+L  V EA+ + +DRWT+++  +E++  E                E  +I  MNNY G+GIDA+L+LDFH AREE PGKFTSR HNKG+Y ++GL+K+   +  + LH +I L+V+ +++ELP +EG+I +NI SWG+GA+ WG  +D    +F KP   DG+LEVVGVTGVVHMGQ+  GLR+G R+AQG + R+TL  + PVQVDGEPW+Q+P  + +  +A K  ML
Sbjct:   54 GHSFRKVTLTKPTFCHLCSDFIWGL---AGFLCDVCNFMSHEKCLKQVKTPCTSIAPSLVRVPVAHCFGSLGLYKRKFCVVCRKSLE-VPAFRCEVCELHVHPDCVPFACSDCRQCHQDGQQDYDTY--HHHWREGNLPSGARCEVCRKTCGSSDVLAGVRCEWCGVQAHSVCSTALAPECTFGRLRSMVLPPSCVRL--LSRNFSKMHCFRIP--ETMVLELGDGDDGVDGSAAIGTGREVLTATESTKQT----LKIFDGNDSMRKNQFRLVTVSRLARNEEVMEAALRAYYIS-EDPKDFQLQALPLSGNAQALGKAGTTEEEASKGSCPRDSVPEAWVIRSLPRTQEILKIYPGWLKVGVAYVSIRVNSQST----ARSVVQEVLPLFGQQVEDKERFQLIEVLMSSRQVQRTVLADE--EPLLDRLWDIRQTSVRQVSQTRFY---VAETRATAPRVSLFVGGLPPGLSPQDYSNLLHEAMATKAAVVSVSHVYSLQGAVILDVTCFAEAERLYMLARDTAVHGRPLTALVLPDVLHTKLPPDCCPLLVFVNPKSGGLKGRELLCSFRKLLNPHQVFELTNGGPLPGFHLFSQVPSFRVLVCGGDGTVGWVLAALEETRRHLACPEPSVAILPLGTGNDLGRVLRWGAGYSG-EDPFSVLVSVDEADAVLMDRWTILLDAHEIDSTENN----------VVETEPPKIVQMNNYCGIGIDAELSLDFHQAREEEPGKFTSRFHNKGVYVRVGLQKI---SHSRSLHKEIRLQVEQQEVELPSIEGLIFINIPSWGSGADLWGSDND---SRFEKPRIDDGLLEVVGVTGVVHMGQVQGGLRSGIRIAQGSYFRVTLLKATPVQVDGEPWVQAPGHMIISATAPKVHML 905          
BLAST of Diacylglycerol kinase vs. Ensembl Mouse
Match: Dgkb (diacylglycerol kinase, beta [Source:MGI Symbol;Acc:MGI:2442474])

HSP 1 Score: 274.248 bits (700), Expect = 7.078e-78
Identity = 152/367 (41.42%), Postives = 215/367 (58.58%), Query Frame = 2
Query: 1952 VETSAIPNDIHPLLVFVNVKSGGCQGTELISSFRKLLNPHQVFNLDYGGPLPGLHCYRNLTNFKILVCGGDGTVGWVLSCLDNVGQDAKCPHPPMAIVPLGTGNDLARVLRWGTGYTGAEDPLSLLKDVVEAEEIRLDRWTVMIKPNEMEKDEQKRALQLQXXXXXXXXXXXRIFLMNNYFGLGIDADLNLDFHLAREENPGKFTSRIHNKGIYFKMGLRKMVNRTKCKDLHHKITLEVDGRQXXXXXXXXXXXXXXX--SWGAGANPWGFTD--------------------DVSNQKFSKPTHYDGMLEVVGVTGVVHMGQIFSGLRT-GTRLAQGGHIRITLKTSVPVQVDGEPWIQSPCQITV 2983
            ++ + +P   HPLLVFVN KSGG QG  +   F+ LLNP QV++L   GP+PGLH +R++ +F++L CGGDGTVGW+L C++         HPP+AI+PLGTGNDLAR LRWG GY G E+ + +LKD+  + EI LDRW   + PN  +KDE+   +                 ++NNYF +G+DA +   FH+ RE++P KF SR+ NK  YF+ G  +  + T CK LH  + +E DG QI+L  +    I  +   S   G+N WG +                     D    KF+     D +LEVVG+ G + MGQI++GL++ G RLAQ   + I    S+P+Q+DGEPW+Q+PC I +
Sbjct:  419 LQITPVPG-THPLLVFVNPKSGGKQGERIYRKFQYLLNPRQVYSLSGNGPMPGLHFFRDVPDFRVLACGGDGTVGWILDCIEKANV---VKHPPVAILPLGTGNDLARCLRWGGGYEG-ENLMKILKDIESSTEIMLDRWKFEVTPN--DKDEKGDPVPYS--------------IINNYFSIGVDASIAHRFHIMREKHPEKFNSRMKNKFWYFEFGTSETFSAT-CKKLHESVEIECDGVQIDLINISLEGIAILNIPSMHGGSNLWGESKKKRSHRRIEKKGSDKRPTLTDAKELKFASQDLSDQLLEVVGLEGAMEMGQIYTGLKSAGRRLAQCSSVVIRTSKSLPMQIDGEPWMQTPCTIKI 763          

HSP 2 Score: 79.337 bits (194), Expect = 2.102e-14
Identity = 48/139 (34.53%), Postives = 67/139 (48.20%), Query Frame = 2
Query:  533 ITEPAAHCWSEISHF-KRKFCNVCRKRLEDVA--GLRCEICEYYVHTECFDFAISNCKQCAIASTDWPSKEPNHHFREGNLPINSKCFICKKICASVECLTGLRCEWCGITVHTSCYRKIPTECTHGILHDIILPASAV 940
            + +   H W  + HF K  +CN+C   L  V   GL C  C+Y VH  C   A  +C +  + S    +   +H++ EGN P  +KC  C K     + LTGL C WC  T+H  C   +  EC  G L D ILP + +
Sbjct:  231 VKDDGQHVW-RLKHFNKPAYCNLCLNMLIGVGKQGLCCSFCKYTVHERCVARAPPSCIKTYVKSKK-NTDVMHHYWVEGNCP--TKCDKCHKTVKCYQGLTGLHCVWCQTTLHNKCASHLKPECDCGPLKDHILPPTTI 365          

HSP 3 Score: 56.225 bits (134), Expect = 2.523e-7
Identity = 36/119 (30.25%), Postives = 57/119 (47.90%), Query Frame = 2
Query:  359 HCFVKKNFHKPLVCHHCAETLWGLLGTTGYICQICNYLVHEKCVPQIIIPCNCVLSFVI----TEPAAHCWSEISHFKRKFCNVCRKRL---EDVAGLRCEICEYYVHTECFDFAISNC 694
            H +  K+F+KP  C+ C   L G+ G  G  C  C Y VHE+CV +   P +C+ ++V     T+   H W E +   +  C+ C K +   + + GL C  C+  +H +C       C
Sbjct:  237 HVWRLKHFNKPAYCNLCLNMLIGV-GKQGLCCSFCKYTVHERCVAR--APPSCIKTYVKSKKNTDVMHHYWVEGNCPTK--CDKCHKTVKCYQGLTGLHCVWCQTTLHNKCASHLKPEC 350          
BLAST of Diacylglycerol kinase vs. Ensembl Mouse
Match: Dgkb (diacylglycerol kinase, beta [Source:MGI Symbol;Acc:MGI:2442474])

HSP 1 Score: 274.248 bits (700), Expect = 7.078e-78
Identity = 152/367 (41.42%), Postives = 215/367 (58.58%), Query Frame = 2
Query: 1952 VETSAIPNDIHPLLVFVNVKSGGCQGTELISSFRKLLNPHQVFNLDYGGPLPGLHCYRNLTNFKILVCGGDGTVGWVLSCLDNVGQDAKCPHPPMAIVPLGTGNDLARVLRWGTGYTGAEDPLSLLKDVVEAEEIRLDRWTVMIKPNEMEKDEQKRALQLQXXXXXXXXXXXRIFLMNNYFGLGIDADLNLDFHLAREENPGKFTSRIHNKGIYFKMGLRKMVNRTKCKDLHHKITLEVDGRQXXXXXXXXXXXXXXX--SWGAGANPWGFTD--------------------DVSNQKFSKPTHYDGMLEVVGVTGVVHMGQIFSGLRT-GTRLAQGGHIRITLKTSVPVQVDGEPWIQSPCQITV 2983
            ++ + +P   HPLLVFVN KSGG QG  +   F+ LLNP QV++L   GP+PGLH +R++ +F++L CGGDGTVGW+L C++         HPP+AI+PLGTGNDLAR LRWG GY G E+ + +LKD+  + EI LDRW   + PN  +KDE+   +                 ++NNYF +G+DA +   FH+ RE++P KF SR+ NK  YF+ G  +  + T CK LH  + +E DG QI+L  +    I  +   S   G+N WG +                     D    KF+     D +LEVVG+ G + MGQI++GL++ G RLAQ   + I    S+P+Q+DGEPW+Q+PC I +
Sbjct:  419 LQITPVPG-THPLLVFVNPKSGGKQGERIYRKFQYLLNPRQVYSLSGNGPMPGLHFFRDVPDFRVLACGGDGTVGWILDCIEKANV---VKHPPVAILPLGTGNDLARCLRWGGGYEG-ENLMKILKDIESSTEIMLDRWKFEVTPN--DKDEKGDPVPYS--------------IINNYFSIGVDASIAHRFHIMREKHPEKFNSRMKNKFWYFEFGTSETFSAT-CKKLHESVEIECDGVQIDLINISLEGIAILNIPSMHGGSNLWGESKKKRSHRRIEKKGSDKRPTLTDAKELKFASQDLSDQLLEVVGLEGAMEMGQIYTGLKSAGRRLAQCSSVVIRTSKSLPMQIDGEPWMQTPCTIKI 763          

HSP 2 Score: 79.337 bits (194), Expect = 2.102e-14
Identity = 48/139 (34.53%), Postives = 67/139 (48.20%), Query Frame = 2
Query:  533 ITEPAAHCWSEISHF-KRKFCNVCRKRLEDVA--GLRCEICEYYVHTECFDFAISNCKQCAIASTDWPSKEPNHHFREGNLPINSKCFICKKICASVECLTGLRCEWCGITVHTSCYRKIPTECTHGILHDIILPASAV 940
            + +   H W  + HF K  +CN+C   L  V   GL C  C+Y VH  C   A  +C +  + S    +   +H++ EGN P  +KC  C K     + LTGL C WC  T+H  C   +  EC  G L D ILP + +
Sbjct:  231 VKDDGQHVW-RLKHFNKPAYCNLCLNMLIGVGKQGLCCSFCKYTVHERCVARAPPSCIKTYVKSKK-NTDVMHHYWVEGNCP--TKCDKCHKTVKCYQGLTGLHCVWCQTTLHNKCASHLKPECDCGPLKDHILPPTTI 365          

HSP 3 Score: 56.225 bits (134), Expect = 2.523e-7
Identity = 36/119 (30.25%), Postives = 57/119 (47.90%), Query Frame = 2
Query:  359 HCFVKKNFHKPLVCHHCAETLWGLLGTTGYICQICNYLVHEKCVPQIIIPCNCVLSFVI----TEPAAHCWSEISHFKRKFCNVCRKRL---EDVAGLRCEICEYYVHTECFDFAISNC 694
            H +  K+F+KP  C+ C   L G+ G  G  C  C Y VHE+CV +   P +C+ ++V     T+   H W E +   +  C+ C K +   + + GL C  C+  +H +C       C
Sbjct:  237 HVWRLKHFNKPAYCNLCLNMLIGV-GKQGLCCSFCKYTVHERCVAR--APPSCIKTYVKSKKNTDVMHHYWVEGNCPTK--CDKCHKTVKCYQGLTGLHCVWCQTTLHNKCASHLKPEC 350          
BLAST of Diacylglycerol kinase vs. Ensembl Mouse
Match: Dgkg (diacylglycerol kinase, gamma [Source:MGI Symbol;Acc:MGI:105060])

HSP 1 Score: 255.758 bits (652), Expect = 1.107e-71
Identity = 149/361 (41.27%), Postives = 202/361 (55.96%), Query Frame = 2
Query: 1982 HPLLVFVNVKSGGCQGTELISSFRKLLNPHQVFNLDYGGPLPGLHCYRNLTNFKILVCGGDGTVGWVLSCLDNVGQDAKCPHPPMAIVPLGTGNDLARVLRWGTGYTGAEDPLSLLKDVVEAEEIRLDRWTVMIKPNEMEKDEQKRALQLQXXXXXXXXXXXRIFLMNNYFGLGIDADLNLDFHLAREENPGKFTSRIHNKGIYFKMGLRKMVNRTKCKDLHHKITLEVDGRQXXXXXXXXXXXXXXX--SWGAGANPWGFTDD------VSNQKFSKPTHY--------DGMLEVVGVTGVVHMGQIFSGLRT-GTRLAQGGHIRITLKTSVPVQVDGEPWIQSPCQITVLRSALKATML 3013
            HPLLV VN KSGG QG  ++  F  LLNP QVFNLD GGP PGL+ + +  +F++L CGGDGTVGW+L C+D         HPP+A++PLGTGNDLAR LRWG GY G      +LK++ ++  + LDRW + + P E    E +   Q+  N            +MNNYF +G+DA +   FH+ RE++P KF SR+ NK  YF+ G  +    T CK LH  I LE DG +++L  +    I  +   S   G N WG T         S +  + P           D +LEVVG+ G + MGQI++GL++ G RLAQ   + I     +P+QVDGEPW+Q  C I +        M+
Sbjct:  391 HPLLVLVNPKSGGRQGERILRKFHYLLNPEQVFNLDNGGPTPGLNFFHDTPDFRVLACGGDGTVGWILDCIDKANFTK---HPPVAVLPLGTGNDLARCLRWGGGYEGG-SLTKILKEIEQSPLVMLDRWYLEVMPRE----EVENGDQVPYN------------IMNNYFSIGVDASIAHRFHMMREKHPEKFNSRMKNKLWYFEFGTSETFAAT-CKKLHDHIELECDGVEVDLSNIFLEGIAILNIPSMYGGTNLWGETKKNRAVIRESRKSVTDPKELKCCVQDLSDQLLEVVGLEGAMEMGQIYTGLKSAGRRLAQCSSVTIRTNKLLPMQVDGEPWMQPQCTIKITHKNQAPMMM 730          
BLAST of Diacylglycerol kinase vs. Ensembl Mouse
Match: Dgkg (diacylglycerol kinase, gamma [Source:MGI Symbol;Acc:MGI:105060])

HSP 1 Score: 255.758 bits (652), Expect = 1.920e-71
Identity = 156/361 (43.21%), Postives = 207/361 (57.34%), Query Frame = 2
Query: 1982 HPLLVFVNVKSGGCQGTELISSFRKLLNPHQVFNLDYGGPLPGLHCYRNLTNFKILVCGGDGTVGWVLSCLDNVGQDAKCPHPPMAIVPLGTGNDLARVLRWGTGYTGAEDPLSLLKDVVEAEEIRLDRWTVMIKPNEMEKDEQKRALQLQXXXXXXXXXXXRIFLMNNYFGLGIDADLNLDFHLAREENPGKFTSRIHNKGIYFKMGLRKMVNRTKCKDLHHKITLEVDGRQXXXXX--XXXXXXXXXXSWGAGANPWGFTDD------VSNQKFSKPTHY--------DGMLEVVGVTGVVHMGQIFSGLRT-GTRLAQGGHIRITLKTSVPVQVDGEPWIQSPCQITVLRSALKATML 3013
            HPLLV VN KSGG QG  ++  F  LLNP QVFNLD GGP PGL+ + +  +F++L CGGDGTVGW+L C+D         HPP+A++PLGTGNDLAR LRWG GY G      +LK++ ++  + LDRW + + P E    E +   Q+  N            +MNNYF +G+DA +   FH+ RE++P KF SR+ NK  YF+ G  +    T CK LH  I LE DG +++L    LEGI ILNI S   G N WG T         S +  + P           D +LEVVG+ G + MGQI++GL++ G RLAQ   + I     +P+QVDGEPW+Q  C I +        M+
Sbjct:  430 HPLLVLVNPKSGGRQGERILRKFHYLLNPEQVFNLDNGGPTPGLNFFHDTPDFRVLACGGDGTVGWILDCIDKANFTK---HPPVAVLPLGTGNDLARCLRWGGGYEGGS-LTKILKEIEQSPLVMLDRWYLEVMPRE----EVENGDQVPYN------------IMNNYFSIGVDASIAHRFHMMREKHPEKFNSRMKNKLWYFEFGTSETFAAT-CKKLHDHIELECDGVEVDLSNIFLEGIAILNIPSMYGGTNLWGETKKNRAVIRESRKSVTDPKELKCCVQDLSDQLLEVVGLEGAMEMGQIYTGLKSAGRRLAQCSSVTIRTNKLLPMQVDGEPWMQPQCTIKITHKNQAPMMM 769          

HSP 2 Score: 64.3142 bits (155), Expect = 8.506e-10
Identity = 45/132 (34.09%), Postives = 61/132 (46.21%), Query Frame = 2
Query:  551 HCWSEISHFKR-KFCNVCRKRLEDVA--GLRCEICEYYVHTECFDFAISNCKQCAIASTDWPSKEPNHHFREGNLPINSKCFICKKICASVECLTGLRCEWCGITVHTSCYRKIPTECTHGILHD-IILPAS 934
            H W+ + HFK+  +CN CR  L  V   GL C  C+Y VH  C    I  C +   +      +   H + EGN  +  KC  C K     + +T   C WC +T H  C  ++ T C  G L D I+LP S
Sbjct:  269 HAWT-LKHFKKPTYCNFCRAMLMGVGKQGLCCIYCKYTVHQRCVSKTIHGCVKTN-SKAKRSGEVMQHAWVEGNSSV--KCDRCHKSIKCYQSVTARHCVWCRMTFHRKC--ELSTVCDGGELKDHILLPTS 394          
BLAST of Diacylglycerol kinase vs. UniProt/SwissProt
Match: sp|Q6P5E8|DGKQ_MOUSE (Diacylglycerol kinase theta OS=Mus musculus OX=10090 GN=Dgkq PE=1 SV=1)

HSP 1 Score: 608.601 bits (1568), Expect = 0.000e+0
Identity = 345/893 (38.63%), Postives = 519/893 (58.12%), Query Frame = 2
Query:  356 GHCFVKKNFHKPLVCHHCAETLWGLLGTTGYICQICNYLVHEKCVPQIIIPCNCVLSFVITEPAAHCWSEISHFKRKFCNVCRKRLEDVAGLRCEICEYYVHTECFDFAISNCKQC-AIASTDWPSKEPNHHFREGNLPINSKCFICKKICASVECLTGLRCEWCGITVHTSCYRKIPTECTHGILHDIILPASAVSLPRTSSLIEQIYEIKRPKQEDLMAQTLVDDFSDSDSGREESGFERKSVKEKRDKEYYDFVRLYDGMARFKKKQCRYLSLGKSTSVQRVIEMSMKAFQLPFYEINNIYLVEINEKDNSDKWLKENEPFKKQLQFDMRRPQVILKLKTKNVER--DYISIYPGDLTXXXXXXXXXXXXXXXXXXDATTILVLALRRLGLEHMNSHKFHLVETSLDCGITERVIEKDEILWSILERL---QKESLRAFTLTRFYIRSVADPYGTGG-VAVYVGNLKKGLSQRLYERILIDRLTPANRWNAIEVIYYDSGSLVLIYSNAEKAESAYNILKESTFDDNALTAIILPRVETSAIPNDIHPLLVFVNVKSGGCQGTELISSFRKLLNPHQVFNLDYGGPLPGLHCYRNLTNFKILVCGGDGTVGWVLSCLDNVGQDAKCPHPPMAIVPLGTGNDLARVLRWGTGYTGAEDPLSLLKDVVEAEEIRLDRWTVMIKPNEMEKDEQKRALQLQXXXXXXXXXXXRIFLMNNYFGLGIDADLNLDFHLAREENPGKFTSRIHNKGIYFKMGLRKMVNRTKCKDLHHKITLEVDGRQXXXXXXXXXXXXXXXSWGAGANPWGFTDDVSNQKFSKPTHYDGMLEVVGVTGVVHMGQIFSGLRTGTRLAQGGHIRITLKTSVPVQVDGEPWIQSPCQITVLRSALKATML 3013
            GH F K    KP  CH C++ +WGL    G++C +CN++ HEKC+ Q+  PC  +   ++  P AHC+  +  +KRKFC VCRK LE V   RCE+CE +VH +C  FA S+C+QC      D+ +   +HH+REGNLP  ++C +C+K C S + L G+RCEWCG+  H+ C   +  ECT G L  ++LP S V L   S    +++  + P  E ++ +    D     S    +G E  +  E   +     ++++DG    +K Q R +++ +    + V+E +++A+ +   +  +  L  +    N+    K     ++  +    R  V      +++ R  + + IYPG L          +    T    A +++   L   G +  +  +F L+E  +     +R +  DE    +L+RL   ++ S+R  + TRFY   VA+   T   V+++VG L  GLS + Y  +L + +       ++  +Y   G+++L  +   +AE  Y + +++      LTA++LP V  + +P D  PLLVFVN KSGG +G EL+ SFRKLLNPHQVF L  GGPLPG H +  + +F++LVCGGDGTVGWVL+ L+   +   CP P +AI+PLGTGNDL RVLRWG GY+G EDP S+L  V EA+ + +DRWT+++  +E++  E                E  +I  MNNY G+GIDA+L+LDFH AREE PGKFTSR HNKG+Y ++GL+K+   +  + LH +I L+V+ +++ELP +EG+I +NI SWG+GA+ WG  +D    +F KP   DG+LEVVGVTGVVHMGQ+  GLR+G R+AQG + R+TL  + PVQVDGEPW+Q+P  + +  +A K  ML
Sbjct:   54 GHSFRKVTLTKPTFCHLCSDFIWGL---AGFLCDVCNFMSHEKCLKQVKTPCTSIAPSLVRVPVAHCFGSLGLYKRKFCVVCRKSLE-VPAFRCEVCELHVHPDCVPFACSDCRQCHQDGQQDYDTY--HHHWREGNLPSGARCEVCRKTCGSSDVLAGVRCEWCGVQAHSVCSTALAPECTFGRLRSMVLPPSCVRL--LSRNFSKMHCFRIP--ETMVLELGDGDDGVDGSAAIGTGREVLTATESTKQT----LKIFDGNDSMRKNQFRLVTVSRLARNEEVMEAALRAYYIS-EDPKDFQLQALPLSGNAQALGKAGTTEEEASKGSCPRDSVPEAWVIRSLPRTQEILKIYPGWLKVGVAYVSIRVNSQST----ARSVVQEVLPLFGQQVEDKERFQLIEVLMSSRQVQRTVLADE--EPLLDRLWDIRQTSVRQVSQTRFY---VAETRATAPRVSLFVGGLPPGLSPQDYSNLLHEAMATKAAVVSVSHVYSLQGAVILDVTCFAEAERLYMLARDTAVHGRPLTALVLPDVLHTKLPPDCCPLLVFVNPKSGGLKGRELLCSFRKLLNPHQVFELTNGGPLPGFHLFSQVPSFRVLVCGGDGTVGWVLAALEETRRHLACPEPSVAILPLGTGNDLGRVLRWGAGYSG-EDPFSVLVSVDEADAVLMDRWTILLDAHEIDSTENN----------VVETEPPKIVQMNNYCGIGIDAELSLDFHQAREEEPGKFTSRFHNKGVYVRVGLQKI---SHSRSLHKEIRLQVEQQEVELPSIEGLIFINIPSWGSGADLWGSDND---SRFEKPRIDDGLLEVVGVTGVVHMGQVQGGLRSGIRIAQGSYFRVTLLKATPVQVDGEPWVQAPGHMIISATAPKVHML 905          
BLAST of Diacylglycerol kinase vs. UniProt/SwissProt
Match: sp|P52824|DGKQ_HUMAN (Diacylglycerol kinase theta OS=Homo sapiens OX=9606 GN=DGKQ PE=1 SV=2)

HSP 1 Score: 593.193 bits (1528), Expect = 0.000e+0
Identity = 344/898 (38.31%), Postives = 507/898 (56.46%), Query Frame = 2
Query:  356 GHCFVKKNFHKPLVCHHCAETLWGLLGTTGYICQICNYLVHEKCVPQIIIPCNCVLSFVITEPAAHCWSEISHFKRKFCNVCRKRLEDVAGLRCEICEYYVHTECFDFAISNCKQCAIASTDWPSKEPNHHFREGNLPINSKCFICKKICASVECLTGLRCEWCGITVHTSCYRKIPTECTHGILHDIILPASAVSLPRTSSLIEQIYEIKRPKQEDLMAQTLVDDFSDSDSGREESGFERKSVKEKRDKEYYDFVRLYDGMARFKKKQCRYLSLGKSTSVQRVIEMSMKAFQLPFYEINNIYLVEINEKDNS-DKWLKENEPFKKQLQFDMRRPQV------ILKLKTKNVERDYISIYPGDLTXXXXXXXXXXXXXXXXXXDATTILVLALRRLGLEHMNSHKFHLVETSLDCGITERVIEKDEILWSILERLQ---KESLRAFTLTRFYIRSVAD--PYGTGGVAVYVGNLKKGLSQRLYERILIDRLTPANRWNAIEVIYYDSGSLVLIYSNAEKAESAYNILKESTFDDNALTAIILPRVETSAIPNDIHPLLVFVNVKSGGCQGTELISSFRKLLNPHQVFNLDYGGPLPGLHCYRNLTNFKILVCGGDGTVGWVLSCLDNVGQDAKCPHPPMAIVPLGTGNDLARVLRWGTGYTGAEDPLSLLKDVVEAEEIRLDRWTVMIKPNEMEKDEQKRALQLQXXXXXXXXXXXRIFLMNNYFGLGIDADLNLDFHLAREENPGKFTSRIHNKGIYFKMGLRKMVNRTKCKDLHHKITLEVDGRQXXXXXXXXXXXXXXXSWGAGANPWGFTDDVSNQKFSKPTHYDGMLEVVGVTGVVHMGQIFSGLRTGTRLAQGGHIRITLKTSVPVQVDGEPWIQSPCQITVLRSALKATML 3013
            GH F K    KP  CH C++ +WGL    G++C +CN++ HEKC+  + IPC  V   ++  P AHC+      KRKFC VCRK LE  A L CE+CE ++H +C  FA S+C+QC            +HH+REGNLP  ++C +C+K C S + L G+RCEWCG+  H+ C   +  EC  G L  ++LP + V L        Q + I    +          +  D   G    G  R++  +   +     ++++DG    ++ Q R +++ +    + V+E +++A  +P  +  ++ L  +     + D W    +     +  + R P           ++     ++ + IYPG L          +    T    A ++++  L  LG +  +   F LVE ++ C   +R +  DE    +L+RLQ   + S+R  + TRFY+    D  P+    V+++VG L  GLS   Y  +L +         ++  IY   G++VL  +   +AE  Y +LK+       LTA++LP +  + +P D  PLLVFVN KSGG +G +L+ SFRKLLNPHQVF+L  GGPLPGLH +  +  F++LVCGGDGTVGWVL  L+       CP P +AI+PLGTGNDL RVLRWG GY+G EDP S+L  V EA+ + +DRWT+++  +E    E   A          + E  +I  M+NY G+GIDA+L+LDFH AREE PGKFTSR+HNKG+Y ++GL+K+   +  + LH +I L+V+ +++ELP +EG+I +NI SWG+GA+ WG   D    +F KP   DG+LEVVGVTGVVHMGQ+  GLR+G R+AQG + R+TL  + PVQVDGEPW+Q+P  + +  +  K  ML
Sbjct:   60 GHSFRKVTLTKPTFCHLCSDFIWGL---AGFLCDVCNFMSHEKCLKHVRIPCTSVAPSLVRVPVAHCFGPRGLHKRKFCAVCRKVLEAPA-LHCEVCELHLHPDCVPFACSDCRQCHQDGHQDHDTH-HHHWREGNLPSGARCEVCRKTCGSSDVLAGVRCEWCGVQAHSLCSAALAPECGFGRLRSLVLPPACVRLLPGGFSKTQSFRIVEAAEPG--------EGGDGADGSAAVGPGRET--QATPESGKQTLKIFDGDDAVRRSQFRLVTVSRLAGAEEVLEAALRAHHIP-EDPGHLELCRLPPSSQACDAW-AGGKAGSAVISEEGRSPGSGEATPEAWVIRALPRAQEVLKIYPGWLKVGVAYVSVRVTPKST----ARSVVLEVLPLLGRQAESPESFQLVEVAMGCRHVQRTMLMDE--QPLLDRLQDIRQMSVRQVSQTRFYVAESRDVAPH----VSLFVGGLPPGLSPEEYSSLLHEAGATKATVVSVSHIYSSQGAVVLDVACFAEAERLYMLLKDMAVRGRLLTALVLPDLLHAKLPPDSCPLLVFVNPKSGGLKGRDLLCSFRKLLNPHQVFDLTNGGPLPGLHLFSQVPCFRVLVCGGDGTVGWVLGALEETRYRLACPEPSVAILPLGTGNDLGRVLRWGAGYSG-EDPFSVLLSVDEADAVLMDRWTILLDAHEAGSAENDTA----------DAEPPKIVQMSNYCGIGIDAELSLDFHQAREEEPGKFTSRLHNKGVYVRVGLQKI---SHSRSLHKQIRLQVERQEVELPSIEGLIFINIPSWGSGADLWGSDSDT---RFEKPRMDDGLLEVVGVTGVVHMGQVQGGLRSGIRIAQGSYFRVTLLKATPVQVDGEPWVQAPGHMIISAAGPKVHML 913          
BLAST of Diacylglycerol kinase vs. UniProt/SwissProt
Match: sp|Q6NS52|DGKB_MOUSE (Diacylglycerol kinase beta OS=Mus musculus OX=10090 GN=Dgkb PE=1 SV=2)

HSP 1 Score: 274.633 bits (701), Expect = 4.715e-77
Identity = 152/367 (41.42%), Postives = 215/367 (58.58%), Query Frame = 2
Query: 1952 VETSAIPNDIHPLLVFVNVKSGGCQGTELISSFRKLLNPHQVFNLDYGGPLPGLHCYRNLTNFKILVCGGDGTVGWVLSCLDNVGQDAKCPHPPMAIVPLGTGNDLARVLRWGTGYTGAEDPLSLLKDVVEAEEIRLDRWTVMIKPNEMEKDEQKRALQLQXXXXXXXXXXXRIFLMNNYFGLGIDADLNLDFHLAREENPGKFTSRIHNKGIYFKMGLRKMVNRTKCKDLHHKITLEVDGRQXXXXXXXXXXXXXXX--SWGAGANPWGFTD--------------------DVSNQKFSKPTHYDGMLEVVGVTGVVHMGQIFSGLRT-GTRLAQGGHIRITLKTSVPVQVDGEPWIQSPCQITV 2983
            ++ + +P   HPLLVFVN KSGG QG  +   F+ LLNP QV++L   GP+PGLH +R++ +F++L CGGDGTVGW+L C++         HPP+AI+PLGTGNDLAR LRWG GY G E+ + +LKD+  + EI LDRW   + PN  +KDE+   +                 ++NNYF +G+DA +   FH+ RE++P KF SR+ NK  YF+ G  +  + T CK LH  + +E DG QI+L  +    I  +   S   G+N WG +                     D    KF+     D +LEVVG+ G + MGQI++GL++ G RLAQ   + I    S+P+Q+DGEPW+Q+PC I +
Sbjct:  426 LQITPVPG-THPLLVFVNPKSGGKQGERIYRKFQYLLNPRQVYSLSGNGPMPGLHFFRDVPDFRVLACGGDGTVGWILDCIEKANV---VKHPPVAILPLGTGNDLARCLRWGGGYEG-ENLMKILKDIESSTEIMLDRWKFEVTPN--DKDEKGDPVPYS--------------IINNYFSIGVDASIAHRFHIMREKHPEKFNSRMKNKFWYFEFGTSETFSAT-CKKLHESVEIECDGVQIDLINISLEGIAILNIPSMHGGSNLWGESKKKRSHRRIEKKGSDKRPTLTDAKELKFASQDLSDQLLEVVGLEGAMEMGQIYTGLKSAGRRLAQCSSVVIRTSKSLPMQIDGEPWMQTPCTIKI 770          

HSP 2 Score: 79.337 bits (194), Expect = 1.382e-13
Identity = 48/139 (34.53%), Postives = 67/139 (48.20%), Query Frame = 2
Query:  533 ITEPAAHCWSEISHF-KRKFCNVCRKRLEDVA--GLRCEICEYYVHTECFDFAISNCKQCAIASTDWPSKEPNHHFREGNLPINSKCFICKKICASVECLTGLRCEWCGITVHTSCYRKIPTECTHGILHDIILPASAV 940
            + +   H W  + HF K  +CN+C   L  V   GL C  C+Y VH  C   A  +C +  + S    +   +H++ EGN P  +KC  C K     + LTGL C WC  T+H  C   +  EC  G L D ILP + +
Sbjct:  238 VKDDGQHVW-RLKHFNKPAYCNLCLNMLIGVGKQGLCCSFCKYTVHERCVARAPPSCIKTYVKSKK-NTDVMHHYWVEGNCP--TKCDKCHKTVKCYQGLTGLHCVWCQTTLHNKCASHLKPECDCGPLKDHILPPTTI 372          

HSP 3 Score: 56.225 bits (134), Expect = 1.669e-6
Identity = 36/119 (30.25%), Postives = 57/119 (47.90%), Query Frame = 2
Query:  359 HCFVKKNFHKPLVCHHCAETLWGLLGTTGYICQICNYLVHEKCVPQIIIPCNCVLSFVI----TEPAAHCWSEISHFKRKFCNVCRKRL---EDVAGLRCEICEYYVHTECFDFAISNC 694
            H +  K+F+KP  C+ C   L G+ G  G  C  C Y VHE+CV +   P +C+ ++V     T+   H W E +   +  C+ C K +   + + GL C  C+  +H +C       C
Sbjct:  244 HVWRLKHFNKPAYCNLCLNMLIGV-GKQGLCCSFCKYTVHERCVAR--APPSCIKTYVKSKKNTDVMHHYWVEGNCPTK--CDKCHKTVKCYQGLTGLHCVWCQTTLHNKCASHLKPEC 357          
BLAST of Diacylglycerol kinase vs. UniProt/SwissProt
Match: sp|P49621|DGKB_RAT (Diacylglycerol kinase beta OS=Rattus norvegicus OX=10116 GN=Dgkb PE=1 SV=1)

HSP 1 Score: 274.633 bits (701), Expect = 4.722e-77
Identity = 153/367 (41.69%), Postives = 215/367 (58.58%), Query Frame = 2
Query: 1952 VETSAIPNDIHPLLVFVNVKSGGCQGTELISSFRKLLNPHQVFNLDYGGPLPGLHCYRNLTNFKILVCGGDGTVGWVLSCLDNVGQDAKCPHPPMAIVPLGTGNDLARVLRWGTGYTGAEDPLSLLKDVVEAEEIRLDRWTVMIKPNEMEKDEQKRALQLQXXXXXXXXXXXRIFLMNNYFGLGIDADLNLDFHLAREENPGKFTSRIHNKGIYFKMGLRKMVNRTKCKDLHHKITLEVDGRQXXXXXXXXXXXXXXX--SWGAGANPWGFTD--------------------DVSNQKFSKPTHYDGMLEVVGVTGVVHMGQIFSGLRT-GTRLAQGGHIRITLKTSVPVQVDGEPWIQSPCQITV 2983
            ++ + IP   HPLLVFVN KSGG QG  +   F+ LLNP QV++L   GP+PGLH +R++ +F++L CGGDGTVGW+L C++         HPP+AI+PLGTGNDLAR LRWG GY G E+ + +LKD+  + EI LDRW   + PN  +KDE+   +                 ++NNYF +G+DA +   FH+ RE++P KF SR+ NK  YF+ G  +  + T CK LH  + +E DG QI+L  +    I  +   S   G+N WG +                     D    KF+     D +LEVVG+ G + MGQI++GL++ G RLAQ   + I    S+P+Q+DGEPW+Q+PC I +
Sbjct:  425 LQITPIPG-THPLLVFVNPKSGGKQGERIYRKFQYLLNPRQVYSLSGNGPMPGLHFFRDVPDFRVLACGGDGTVGWILDCIEKANV---VKHPPVAILPLGTGNDLARCLRWGGGYEG-ENLMKILKDIESSTEIMLDRWKFEVTPN--DKDEKGDPVPYS--------------IINNYFSIGVDASIAHRFHIMREKHPEKFNSRMKNKFWYFEFGTSETFSAT-CKKLHESVEIECDGVQIDLINISLQGIAILNIPSMHGGSNLWGESKKKRSHRRIEKKGSDKRPTLTDAKELKFASQDLSDQLLEVVGLEGAMEMGQIYTGLKSAGRRLAQCSSVVIRTSKSLPMQIDGEPWMQTPCTIKI 769          

HSP 2 Score: 75.0998 bits (183), Expect = 2.432e-12
Identity = 48/139 (34.53%), Postives = 67/139 (48.20%), Query Frame = 2
Query:  533 ITEPAAHCWSEISHF-KRKFCNVCRKRLEDVA--GLRCEICEYYVHTECFDFAISNCKQCAIASTDWPSKEPNHHFREGNLPINSKCFICKKICASVECLTGLRCEWCGITVHTSCYRKIPTECTHGILHDIILPASAV 940
            + +   H W  + HF K  +CN+C   L  V   GL C  C+Y VH  C   A  +C +  + S    +   +H++ EGN P  +KC  C K     + LTGL C WC  T+H  C   +  EC  G L D ILP + +
Sbjct:  238 VKDDGQHVW-RLKHFNKPAYCNLCLNMLIGVGKQGLCCSFCKYTVHERCAR-APPSCIKTYVKSKK-NTDVMHHYWVEGNCP--TKCDKCHKTVKCYQGLTGLHCVWCQTTLHNKCASHLKPECDCGPLKDHILPPTTI 371          
BLAST of Diacylglycerol kinase vs. UniProt/SwissProt
Match: sp|Q9Y6T7|DGKB_HUMAN (Diacylglycerol kinase beta OS=Homo sapiens OX=9606 GN=DGKB PE=2 SV=2)

HSP 1 Score: 272.707 bits (696), Expect = 1.967e-76
Identity = 155/369 (42.01%), Postives = 219/369 (59.35%), Query Frame = 2
Query: 1952 VETSAIPNDIHPLLVFVNVKSGGCQGTELISSFRKLLNPHQVFNLDYGGPLPGLHCYRNLTNFKILVCGGDGTVGWVLSCLD--NVGQDAKCPHPPMAIVPLGTGNDLARVLRWGTGYTGAEDPLSLLKDVVEAEEIRLDRWTVMIKPNEMEKDEQKRALQLQXXXXXXXXXXXRIFLMNNYFGLGIDADLNLDFHLAREENPGKFTSRIHNKGIYFKMGLRKMVNRTKCKDLHHKITLEVDGRQXXXXXXXXXXXXXXX--SWGAGANPWGFTD--------------------DVSNQKFSKPTHYDGMLEVVGVTGVVHMGQIFSGLRT-GTRLAQGGHIRITLKTSVPVQVDGEPWIQSPCQITV 2983
            ++ + +P   HPLLVFVN KSGG QG  +   F+ LLNP QV++L   GP+PGL+ +R++ +F++L CGGDGTVGWVL C++  NVG+     HPP+AI+PLGTGNDLAR LRWG GY G E+ + +LKD+  + EI LDRW   + PN  +KDE+   +                 ++NNYF +G+DA +   FH+ RE++P KF SR+ NK  YF+ G  +  + T CK LH  + +E DG QI+L  +    I  +   S   G+N WG +                     D    KF+     D +LEVVG+ G + MGQI++GL++ G RLAQ   + I    S+P+Q+DGEPW+Q+PC I +
Sbjct:  428 LQVTPVPG-THPLLVFVNPKSGGKQGERIYRKFQYLLNPRQVYSLSGNGPMPGLNFFRDVPDFRVLACGGDGTVGWVLDCIEKANVGK-----HPPVAILPLGTGNDLARCLRWGGGYEG-ENLMKILKDIENSTEIMLDRWKFEVIPN--DKDEKGDPVPYS--------------IINNYFSIGVDASIAHRFHIMREKHPEKFNSRMKNKFWYFEFGTSETFSAT-CKKLHESVEIECDGVQIDLINISLEGIAILNIPSMHGGSNLWGESKKRRSHRRIEKKGSDKRTTVTDAKELKFASQDLSDQLLEVVGLEGAMEMGQIYTGLKSAGRRLAQCSCVVIRTSKSLPMQIDGEPWMQTPCTIKI 772          

HSP 2 Score: 80.8777 bits (198), Expect = 4.841e-14
Identity = 49/139 (35.25%), Postives = 68/139 (48.92%), Query Frame = 2
Query:  533 ITEPAAHCWSEISHF-KRKFCNVCRKRLEDVA--GLRCEICEYYVHTECFDFAISNCKQCAIASTDWPSKEPNHHFREGNLPINSKCFICKKICASVECLTGLRCEWCGITVHTSCYRKIPTECTHGILHDIILPASAV 940
            + +   H W  + HF K  +CN+C   L  V   GL C  C+Y VH  C   A  +C +  + S    +   +H++ EGN P  +KC  C K     + LTGL C WC IT+H  C   +  EC  G L D ILP + +
Sbjct:  239 VKDDGQHVW-RLKHFNKPAYCNLCLNMLIGVGKQGLCCSFCKYTVHERCVARAPPSCIKTYVKSKR-NTDVMHHYWVEGNCP--TKCDKCHKTVKCYQGLTGLHCVWCQITLHNKCASHLKPECDCGPLKDHILPPTTI 373          

HSP 3 Score: 56.225 bits (134), Expect = 1.866e-6
Identity = 36/119 (30.25%), Postives = 57/119 (47.90%), Query Frame = 2
Query:  359 HCFVKKNFHKPLVCHHCAETLWGLLGTTGYICQICNYLVHEKCVPQIIIPCNCVLSFVI----TEPAAHCWSEISHFKRKFCNVCRKRL---EDVAGLRCEICEYYVHTECFDFAISNC 694
            H +  K+F+KP  C+ C   L G+ G  G  C  C Y VHE+CV +   P +C+ ++V     T+   H W E +   +  C+ C K +   + + GL C  C+  +H +C       C
Sbjct:  245 HVWRLKHFNKPAYCNLCLNMLIGV-GKQGLCCSFCKYTVHERCVAR--APPSCIKTYVKSKRNTDVMHHYWVEGNCPTK--CDKCHKTVKCYQGLTGLHCVWCQITLHNKCASHLKPEC 358          
BLAST of Diacylglycerol kinase vs. TrEMBL
Match: G7YB49 (Diacylglycerol kinase (Fragment) OS=Clonorchis sinensis OX=79923 GN=CLF_104168 PE=3 SV=1)

HSP 1 Score: 1121.3 bits (2899), Expect = 0.000e+0
Identity = 570/848 (67.22%), Postives = 694/848 (81.84%), Query Frame = 2
Query:  539 EPAAHCWSEISHFKRKFCNVCRKRLEDVAGLRCEICEYYVHTECFDFAISNCKQCAIASTDWP-----SKEPNHHFREGNLPINSKCFICKKICASVECLTGLRCEWCGITVHTSCYRKIPTECTHGILHDIILPASAVSLPRTSSLIEQIYEIKRPKQEDLMA-QTLVDDFSDSDSGREESGFERKSVKEKRDKEYYDFVRLYDGMARFKKKQCRYLSLGKSTSVQRVIEMSMKAFQLPFYEINNIYLVEINEKDNSDKWLKENEPFKKQLQFDMRRPQVILKLKTKNVERDYISIYPGDLTXXXXXXXXXXXXXXXXXXDATTILVLALRRLGLEHMNSHKFHLVETSLDCGITERVIEKDEILWSILERLQKESLRAFTLTRFYIRSVADPYGTGGVAVYVGNLKKGLSQRLYERILIDRLTPANRWNAIEVIYYDSGSLVLIYSNAEKAESAYNILKESTFDDNALTAIILPRVETSAIPNDIHPLLVFVNVKSGGCQGTELISSFRKLLNPHQVFNLDYGGPLPGLHCYRNLTNFKILVCGGDGTVGWVLSCLDNVGQDAKCPHPPMAIVPLGTGNDLARVLRWGTGYTGAEDPLSLLKDVVEAEEIRLDRWTVMIKPNEMEKDEQKRALQLQXXXXXXXXXXXRIFLMNNYFGLGIDADLNLDFHLAREENPGKFTSRIHNKGIYFKMGLRKMVNRTKCKDLHHKITLEVDGRQXXXXXXXXXXXXXXXSWGAGANPWGFTDDVSNQKFSKPTHYDGMLEVVGVTGVVHMGQIFSGLRTGTRLAQGGHIRITLKTSVPVQVDGEPWIQSPCQITVLRSALKATMLXXXXXXXXXXXXTEPGI 3064
            +P  HCWSEI HFKRKFCNVCRKR++D+  LRCEICEYY H EC DFA ++CKQCA+++         +++  HH+REGNLP+ SKC  CKK C S ECLTG+RCEWCGIT H SC + +P EC  G+L +I+LP + VSLPRTS L+EQI  + RP  E LM  Q+L D+FS S    EESG +R+S+KE+ D  + D+VR+YDGMAR++K+QCRYLSLG+S SV +VIE+S+KAFQLP  E  +  LVE+NE+D ++  L     FK QLQF+ RRPQ+IL+++ ++V+R+YI +YPG + + C+  + P+ +P+T ET +   +VLALRR  LEH+++ KFHLVET LD G+TER +   E +W++LER+++ES+RA  LTRFY++ V D  G G VA++VGNLKKGLSQRLYERIL++RL   NRW++IEVIYYD GSLVL+YSN E+A+ AY+ILK+STF+D  + A+ILPR+  + +PND+ PLLV VNVKSGGCQG ELI+SFRKLLNPHQVFNLD GGPLPGLHC+R+L  FKILVCGGDGTVGW LSCLDNVGQDA CP PPMAI+P+GTGNDLARVLRWG GYTG E+PL++L+DVVEAE+IRLDRWTV+IKP+E EKD QK+ LQ+QANAANTNE+++RIF+MNNYFGLGIDADLNLDFH+AREENP KF SRIHNK +Y KMGLRKMVNRTKC+DLH  I +EVDGRQ++LPPLEGIIILNILSWGAGANPWG   D     FS PTHYDG LEVVGVTGVVH+GQIFSGLRTGTRLAQG HIRIT+KT +PVQVDGEPWIQ P QI VLRSALKATMLKKRKRRKVNRR+TEPG+
Sbjct:  506 DPVPHCWSEIGHFKRKFCNVCRKRVDDLLALRCEICEYYSHYECLDFASTDCKQCAVSTMTTALKVKKTQQQFHHWREGNLPMTSKCAACKKTCWSTECLTGVRCEWCGITAHFSCQKNLPVECDFGVLREIMLPPACVSLPRTSLLVEQIIGMTRPPPETLMGVQSLTDEFSSSGDSPEESGMDRRSIKERSD--FDDYVRVYDGMARYRKRQCRYLSLGRSVSVHKVIELSLKAFQLPPDEAKSYCLVELNERDGAEHVLVNTSSFKSQLQFETRRPQIILRVRERSVDREYIQVYPGAMGEQCDTDLAPVSVPVTRETTSHDAIVLALRRFNLEHLDARKFHLVETILDRGLTERAMPAGERIWALLERVRRESVRACRLTRFYVQPVEDLTGPG-VALFVGNLKKGLSQRLYERILLERLGVENRWDSIEVIYYDFGSLVLVYSNPERADEAYHILKQSTFEDRPILAMILPRLIAANLPNDVQPLLVLVNVKSGGCQGIELITSFRKLLNPHQVFNLDCGGPLPGLHCFRHLKRFKILVCGGDGTVGWALSCLDNVGQDAACPTPPMAILPIGTGNDLARVLRWGPGYTGGEEPLTILRDVVEAEKIRLDRWTVVIKPDEAEKDAQKKQLQIQANAANTNEDSSRIFVMNNYFGLGIDADLNLDFHMAREENPAKFNSRIHNKSVYLKMGLRKMVNRTKCRDLHQNICVEVDGRQLDLPPLEGIIILNILSWGAGANPWGVEKD---DAFSVPTHYDGQLEVVGVTGVVHLGQIFSGLRTGTRLAQGRHIRITIKTEIPVQVDGEPWIQPPGQIIVLRSALKATMLKKRKRRKVNRRHTEPGL 1347          
BLAST of Diacylglycerol kinase vs. TrEMBL
Match: A0A4E0RM77 (Diacylglycerol kinase OS=Fasciola hepatica OX=6192 GN=D915_001398 PE=3 SV=1)

HSP 1 Score: 1038.87 bits (2685), Expect = 0.000e+0
Identity = 530/775 (68.39%), Postives = 644/775 (83.10%), Query Frame = 2
Query:  743 HHFREGNLPINSKCFICKKICASVECLTGLRCEWCGITVHTSCYRKIPTECTHGILHDIILPASAVSLPRTSSLIEQIYEIKRPKQEDLMA-QTLVDDFSDSDSGREESGFERKSVKEKRDKEYYDFVRLYDGMARFKKKQCRYLSLGKSTSVQRVIEMSMKAFQLPFYEINNIYLVEINEKDNSDKWLKENEPFKKQLQFDMRRPQVILKLKTKNVERDYISIYPGDLTXXXXXXXXXXXXXXXXXXDATTILVLALRRLGLEHMNSHKFHLVETSLDCGITERVIEKDEILWSILERLQKESLRAFTLTRFYIRSVADPYGTGGVAVYVGNLKKGLSQRLYERILIDRLTPANRWNAIEVIYYDSGSLVLIYSNAEKAESAYNILKESTFDDNALTAIILPRVETSAIPNDIHPLLVFVNVKSGGCQGTELISSFRKLLNPHQVFNLDYGGPLPGLHCYRNLTNFKILVCGGDGTVGWVLSCLDNVGQDAKCPHPPMAIVPLGTGNDLARVLRWGTGYTGAEDPLSLLKDVVEAEEIRLDRWTVMIKPNEMEKDEQKRALQLQXXXXXXXXXXXRIFLMNNYFGLGIDADLNLDFHLAREENPGKFTSRIHNKGIYFKMGLRKMVNRTKCKDLHHKITLEVDGRQXXXXXXXXXXXXXXXSWGAGANPWGFTDDVSNQKFSKPTHYDGMLEVVGVTGVVHMGQIFSGLRTGTRLAQGGHIRITLKTSVPVQVDGEPWIQSPCQITVLRSALKATMLXXXXXXXXXXXXTEPGI 3064
            HH+REGNLP+ SKC +C+K C S ECLTG RCEWCG TVH SC++ +  +C  G+L DI+LP   VSLPRTS L+EQI  + RP+ E LM  Q+L D+FS S    EESG ER+SVKEK D+++ D+VR+YDG+AR++K+QCRYLSLG+S SVQ+VIE+S+KAFQLP  E  +  L+E+NEKD S+  L  +  FK QLQ++ RRPQ+IL+ + + V+RD+I +YPG + +  ++ + PI +PI  ET +  ++ +AL+R GLEH++  KF LVET LD G+TERV+   E +WS+L+R+++ES+RA  LTRFY++ V D  G G VA++VGNLKKGLSQRLYERIL++RL   NRW+ IEVIYYD GSLV++Y N E+A+ AY+ILK+STF+D  + A+ILPR++ + +PN + PLLV VNVKSGGCQG ELI+SFRKLLNPHQVFNLDYGGPLPGLHC+R+L  FKILVCGGDGTVGW LSCLDNVGQDA CP PPMAI+PLGTGNDLARVLRWG+GYTG E+PLS+L+DVVEAE+IRLDRWTV+IKP+E EKD QK+ LQ+QANAANTNE+T+RIF+MNNYFGLGIDADLNLDFH+AREENP KF SRIHNK +Y KMGLRKMVNRTKCKDLH  +++EVDG+Q++LPPLEGIIILNILSWGAGANPWG   D     FS PTHYDG LEVVGVTGVVHMGQIFSGLRTGTRLAQGGHIRIT+K  +PVQVDGEPWIQSP QI VLRSALKATMLKKRKRRKVNRR+TEPG+
Sbjct:  314 HHWREGNLPMYSKCMVCRKTCWSAECLTGFRCEWCGTTVHCSCFKNVSEDCDFGVLRDIMLPPGCVSLPRTSLLVEQIIGMTRPQPESLMGVQSLTDEFSSSGDSPEESGMERRSVKEKVDRDFDDYVRVYDGLARYRKRQCRYLSLGRSVSVQKVIELSLKAFQLPPDEAKDYCLIELNEKDGSEHSLHTSASFKSQLQYETRRPQIILRFRDRPVDRDFIHVYPGTIGRYSDVDLQPISLPIMRETTSQDVISMALKRFGLEHLDPSKFQLVETVLDRGLTERVMPIGERIWSLLDRVKRESVRALRLTRFYVQPVEDSNGPG-VALFVGNLKKGLSQRLYERILLERLGVENRWDFIEVIYYDFGSLVIVYLNPERADEAYHILKQSTFEDRPILAMILPRLQPADLPNGVQPLLVLVNVKSGGCQGIELITSFRKLLNPHQVFNLDYGGPLPGLHCFRHLKRFKILVCGGDGTVGWALSCLDNVGQDAACPTPPMAILPLGTGNDLARVLRWGSGYTGGEEPLSILRDVVEAEKIRLDRWTVVIKPDEAEKDAQKKQLQIQANAANTNEDTSRIFVMNNYFGLGIDADLNLDFHMAREENPAKFNSRIHNKSVYLKMGLRKMVNRTKCKDLHQNVSIEVDGKQLDLPPLEGIIILNILSWGAGANPWGVEKD---DAFSVPTHYDGQLEVVGVTGVVHMGQIFSGLRTGTRLAQGGHIRITVKNDIPVQVDGEPWIQSPGQIIVLRSALKATMLKKRKRRKVNRRHTEPGL 1084          

HSP 2 Score: 205.297 bits (521), Expect = 5.221e-50
Identity = 85/150 (56.67%), Postives = 108/150 (72.00%), Query Frame = 2
Query:  275 SALSGLCIEDNS---NATFNKANLTTGKIKGHCFVKKNFHKPLVCHHCAETLWGLLGTTGYICQICNYLVHEKCVPQIIIPCNCVLSFVITEPAAHCWSEISHFKRKFCNVCRKRLEDVAGLRCEICEYYVHTECFDFAISNCKQCAIAS 715
            +A SG  + D     +A            +GH FVKKN HKP  CHHC++ LWG+LGTTG +C++CN+LVHEKC+  II PC C++ F+I +P  HCWSEI HFKRKFCNVCRKR++D+  LRCEICEYY H EC DFA ++CKQCA++S
Sbjct:   18 AAFSGESVTDEEEVHSACSKSGQSLRDSFQGHSFVKKNLHKPATCHHCSDLLWGILGTTGMVCEVCNFLVHEKCMRLIISPCTCIVPFLIKDPVPHCWSEIGHFKRKFCNVCRKRVDDLLALRCEICEYYSHYECLDFASADCKQCALSS 167          
BLAST of Diacylglycerol kinase vs. TrEMBL
Match: W6USM4 (Diacylglycerol kinase OS=Echinococcus granulosus OX=6210 GN=EGR_00832 PE=3 SV=1)

HSP 1 Score: 1030.78 bits (2664), Expect = 0.000e+0
Identity = 527/778 (67.74%), Postives = 641/778 (82.39%), Query Frame = 2
Query:  737 PNHHFREGNLPINSKCFICKKICASVECLTGLRCEWCGITVHTSCYRKIPTECTHGILHDIILPASAVSLPRTSSLIEQIYEIKRPKQEDLMA--QTLVDDFSDSDSGREESGFERKSVKEKRDKEYYDFVRLYDGMARFKKKQCRYLSLGKSTSVQRVIEMSMKAFQLPFYEINNIYLVEINEKDNSDKWLKENEPFKKQLQFDMRRPQVILKLKTKNVERDYISIYPGDLTXXXXXXXXXXXXXXXXXXDATTILVLALRRLGLEHMNSHKFHLVETSLDCGITERVIEKDEILWSILERLQKESLRAFTLTRFYIRSVADPYGTGGVAVYVGNLKKGLSQRLYERILIDRLTPANRWNAIEVIYYDSGSLVLIYSNAEKAESAYNILKESTFDDNALTAIILPRVETSAIPNDIHPLLVFVNVKSGGCQGTELISSFRKLLNPHQVFNLDYGGPLPGLHCYRNLTNFKILVCGGDGTVGWVLSCLDNVGQDAKCPHPPMAIVPLGTGNDLARVLRWGTGYTGAEDPLSLLKDVVEAEEIRLDRWTVMIKPNEMEKDEQKRALQLQXXXXXXXXXXXRIFLMNNYFGLGIDADLNLDFHLAREENPGKFTSRIHNKGIYFKMGLRKMVNRTKCKDLHHKITLEVDGRQXXXXXXXXXXXXXXXSWGAGANPWGFTDDVSNQKFSKPTHYDGMLEVVGVTGVVHMGQIFSGLRTGTRLAQGGHIRITLKTSVPVQVDGEPWIQSPCQITVLRSALKATMLXXXXXXXXXXXXTEPGI 3064
            P HH+REGNLP NSKC  CKK C S ECLTG+RCEWCG+TVH +C+R +P EC +G L DI+LP  AVS+PRTS L+E I  + +P Q D       L+D+F+ S    EESGFER++ ++K D+++ D+VR+YDGM R+++ QCRYLSLGK+ SV++VIE+S+KAFQLP  E  + YLVEINE+D S+  L  N PFK+QLQF+ RRPQ+IL+   +   RDYI++YPG L    +IS+  I++ IT  T A  +LVL+L RLG+ +++++KF+LVET +D G+ ERV+  ++  W I++ ++ ES+RA  LTRFYIRSV DPYG G V+++VGNLK+GLSQRLYE IL++RL   N+W+AIEVIYYD GSLV+IYSNAEKA+ AY +LK STF+D  + A+ILPR++   I +   PLLVFVNVKSGGCQG ELI+SFRKLLNPHQVFNLD GGPLPGLHC+R+L+ FKILVCGGDGTVGW LSCLDNVGQDA CP PPMAI+P+GTGNDLARVL WG GYTG EDPL +L+DVVEAEEIRLDRWTV+IKP+++E D QK+ LQ++AN  NTNE+T+RIF+MNNYFGLGIDADLNLDFHLAREENP KF SRIHNK +YFKMGLRKMVN+TKCKDLH  + +EVDGRQ++LPP+EGIIILNILSWGAGANPWG   D   + F+KPTHYDG+LEVVGVTGVVHMGQIFSGLRTGTRLAQGGHIRITLK+ +PVQVDGEPWIQSP QI VLRSALKATMLKKRKRRKVNRR+TEPG+
Sbjct:  948 PVHHWREGNLPANSKCSSCKKTCWSAECLTGMRCEWCGVTVHYTCFRNLPMECDYGSLRDIMLPPQAVSIPRTSLLMEHIIGLPKP-QPDFFPGLPALMDEFTSSGESLEESGFERRTNRDKSDRDFDDYVRVYDGMDRYRRHQCRYLSLGKNVSVRKVIELSLKAFQLPPDEEKDFYLVEINERDGSEHPLDSNTPFKRQLQFETRRPQIILRYVEREENRDYINVYPGSLVDYADISVPSIQVSITPTTSAHDVLVLSLHRLGVGYLDANKFNLVETVVDRGLVERVLHPNDRPWEIIDNVRLESVRALRLTRFYIRSVKDPYGQG-VSLFVGNLKRGLSQRLYEIILLERLGYQNKWDAIEVIYYDFGSLVVIYSNAEKADEAYRLLKNSTFEDRPILAMILPRIKPEHILDGTQPLLVFVNVKSGGCQGLELITSFRKLLNPHQVFNLDNGGPLPGLHCFRHLSRFKILVCGGDGTVGWALSCLDNVGQDAACPTPPMAILPIGTGNDLARVLHWGPGYTGTEDPLQILRDVVEAEEIRLDRWTVVIKPDQVESDAQKKQLQIEANTCNTNEDTSRIFVMNNYFGLGIDADLNLDFHLAREENPAKFNSRIHNKSVYFKMGLRKMVNQTKCKDLHQNVLIEVDGRQLDLPPIEGIIILNILSWGAGANPWGMEKD---EAFAKPTHYDGLLEVVGVTGVVHMGQIFSGLRTGTRLAQGGHIRITLKSDIPVQVDGEPWIQSPGQIVVLRSALKATMLKKRKRRKVNRRHTEPGL 1720          

HSP 2 Score: 202.216 bits (513), Expect = 1.033e-48
Identity = 79/145 (54.48%), Postives = 107/145 (73.79%), Query Frame = 2
Query:  302 DNSNATFNKANLTTGKIKGHCFVKKNFHKPLVCHHCAETLWGLLGTTGYICQICNYLVHEKCVPQIIIPCNCVLSFVITEPAAHCWSEISHFKRKFCNVCRKRLEDVAGLRCEICEYYVHTECFDFAISNCKQCAIASTDWPSKE 736
            D  +++        G  +GH F+KKN HKP  CHHC + LWG+LGTTG IC+ICN+L HEKC+ Q++ PC C++ F+I +P AHCWS++ HFKRKFCNVCRKRL+D+  +RCEICEYY H EC +F  ++CK C+I++   PSK+
Sbjct:  648 DTQSSSPRVGTAVKGWFQGHAFIKKNLHKPATCHHCCDLLWGILGTTGMICEICNFLAHEKCIRQVVSPCTCIIPFLIQDPMAHCWSDVGHFKRKFCNVCRKRLDDLLSVRCEICEYYTHYECLEFVSADCKVCSIST---PSKD 789          
BLAST of Diacylglycerol kinase vs. TrEMBL
Match: A0A068YC64 (Diacylglycerol kinase OS=Echinococcus multilocularis OX=6211 GN=EmuJ_001008900 PE=3 SV=1)

HSP 1 Score: 1026.54 bits (2653), Expect = 0.000e+0
Identity = 530/803 (66.00%), Postives = 652/803 (81.20%), Query Frame = 2
Query:  737 PNHHFREGNLPINSKCFICKKICASVECLTGLRCEWCGITVHTSCYRKIPTECTHGILHDIILPASAVSLPRTSSLIEQIYEIKRPKQEDLMA--QTLVDDFSDSDSGREESGFERKSVKEKRDKEYYDFVRLYDGMARFKKKQCRYLSLGKSTSVQRVIEMSMKAFQLPFYEINNIYLVEINEKDNSDKWLKENEPFKKQLQFDMRRPQVILKLKTKNVERDYISIYPGDLTXXXXXXXXXXXXXXXXXXDATTILVLALRRLGLEHMNSHKFHLVETSLDCGITERVIEKDEILWSILERLQKESLRAFTLTRFYIRSVADPYGTGGVAVYVGNLKKGLSQRLYERILIDRLTPANRWNAIEVIYYDSGSLVLIYSNAEKAESAYNILKESTFDDNALTAIILPRVETSAIPNDIHPLLVFVNVKSGGCQGTELISSFRKLLNPHQVFNLDYGGPLPGLHCYRNLTNFKILVCGGDGTVGWVLSCLDNVGQDAKCPHPPMAIVPLGTGNDLARVLRWGTGYTGAEDPLSLLKDVVEAEEIRLDRWTVMIKPNEMEKDEQKRALQLQXXXXXXXXXXXRIFLMNNYFGLGIDADLNLDFHLAREENPGKFTSRIHNKGIYFKMGLRKMVNRTKCKDLHHKITLEVDGRQXXXXXXXXXXXXXXXSWGAGANPWGFTDDVSNQKFSKPTHYDGMLEVVGVTGVVHMGQIFSGLRTGTRLAQGGHIRITLKTSVPVQVDGEPWIQSPCQITVLRSALKATMLXXXXXXXXXXXXTEPGIPPTDNKIVPNETARTQISVIPGKST 3139
            P HH+REGNLP NSKC  CKK C S ECLTG+RCEWCG+TVH +C+R +P EC +G L DI+LP  AVS+PRTS L+E I  + +P Q D       L+D+F+ S    EESGFER++ ++K D+++ D+VR+YDGM R+++ QCRYLSLGK+ SV++VIE+S+KAFQLP  E  + YLVEINE+D S+  L  N PFK+QLQF+ RRPQ+IL+   +   RDYI++YPG L    +IS+  I++ IT  T A  +LVL+L RLG+ +++++KF+LVET +D G+ ERV+  ++  W I++ ++ ES+RA  LTRFYIRSV DPYG G V+++VGNLK+GLSQRLYE IL++RL   N+W+AIEVIYYD GSLV+IYSNAEKA+ AY +LK STF+D  + A+ILPR++   I +   PLLVFVNVKSGGCQG ELI+SFRKLLNPHQVFNLD GGPLPGLHC+R+L+ FKILVCGGDGTVGW LSCLDNVGQDA CP PPMAI+P+GTGNDLARVL WG GYTG EDPL +L+DVVEAEEIRLDRWTV+IKP+++E D QK+ LQ++AN  NTNE+T+RIF+MNNYFGLGIDADLNLDFHLAREENP KF SRIHNK +YFKMGLRKMVN+TKCKDLH  + +EVDGRQ++LPP+EGIIILNILSWGAGANPWG   D   + F+KPTHYDG+LEVVGVTGVVHMGQIFSGLRTGTRLAQGGHIRITLK+ +PVQVDGEPWIQSP QI VLRSALKATMLKKRKRRKVNRR+TEPG+   ++ +  + ++   +  IP  +T
Sbjct:  253 PVHHWREGNLPANSKCSSCKKTCWSAECLTGMRCEWCGVTVHYTCFRNLPMECDYGSLRDIMLPPQAVSIPRTSLLMEHIIGLPKP-QPDFFPGLPALMDEFTSSGESLEESGFERRTNRDKSDRDFDDYVRVYDGMDRYRRHQCRYLSLGKNVSVRKVIELSLKAFQLPPDEERDFYLVEINERDGSEHPLDSNTPFKRQLQFETRRPQIILRYVEREENRDYINVYPGSLVDYADISVPSIQVSITPATSAHDVLVLSLHRLGVGYLDANKFNLVETVVDRGLVERVLHPNDRPWEIIDNVRLESVRALRLTRFYIRSVKDPYGQG-VSLFVGNLKRGLSQRLYEIILLERLGYQNKWDAIEVIYYDFGSLVVIYSNAEKADEAYRLLKNSTFEDRPILAMILPRIKPEHILDGTQPLLVFVNVKSGGCQGLELITSFRKLLNPHQVFNLDNGGPLPGLHCFRHLSRFKILVCGGDGTVGWALSCLDNVGQDAACPTPPMAILPIGTGNDLARVLHWGPGYTGTEDPLQILRDVVEAEEIRLDRWTVVIKPDQVESDAQKKQLQIEANTCNTNEDTSRIFVMNNYFGLGIDADLNLDFHLAREENPAKFNSRIHNKSVYFKMGLRKMVNQTKCKDLHQNVLIEVDGRQLDLPPIEGIIILNILSWGAGANPWGMEKD---EAFAKPTHYDGLLEVVGVTGVVHMGQIFSGLRTGTRLAQGGHIRITLKSDIPVQVDGEPWIQSPGQIVVLRSALKATMLKKRKRRKVNRRHTEPGL-GANSGVAGDASSGAMLPAIPPTTT 1049          

HSP 2 Score: 146.362 bits (368), Expect = 1.258e-31
Identity = 57/96 (59.38%), Postives = 77/96 (80.21%), Query Frame = 2
Query:  449 ICQICNYLVHEKCVPQIIIPCNCVLSFVITEPAAHCWSEISHFKRKFCNVCRKRLEDVAGLRCEICEYYVHTECFDFAISNCKQCAIASTDWPSKE 736
            IC+ICN+L HEKC+ Q++ PC C++ F+I +P AHCWS++ HFKRKFCNVCRKRL+D+  +RCEICEYY H EC +F  ++CK C+I+S   PSK+
Sbjct:    2 ICEICNFLAHEKCIRQVVSPCTCIIPFLIQDPMAHCWSDVGHFKRKFCNVCRKRLDDLLSVRCEICEYYTHYECLEFVSADCKVCSISS---PSKD 94          
BLAST of Diacylglycerol kinase vs. TrEMBL
Match: A0A068WIB2 (Diacylglycerol kinase OS=Echinococcus granulosus OX=6210 GN=EgrG_001008900 PE=3 SV=1)

HSP 1 Score: 1025.39 bits (2650), Expect = 0.000e+0
Identity = 529/799 (66.21%), Postives = 647/799 (80.98%), Query Frame = 2
Query:  737 PNHHFREGNLPINSKCFICKKICASVECLTGLRCEWCGITVHTSCYRKIPTECTHGILHDIILPASAVSLPRTSSLIEQIYEIKRPKQEDLMA--QTLVDDFSDSDSGREESGFERKSVKEKRDKEYYDFVRLYDGMARFKKKQCRYLSLGKSTSVQRVIEMSMKAFQLPFYEINNIYLVEINEKDNSDKWLKENEPFKKQLQFDMRRPQVILKLKTKNVERDYISIYPGDLTXXXXXXXXXXXXXXXXXXDATTILVLALRRLGLEHMNSHKFHLVETSLDCGITERVIEKDEILWSILERLQKESLRAFTLTRFYIRSVADPYGTGGVAVYVGNLKKGLSQRLYERILIDRLTPANRWNAIEVIYYDSGSLVLIYSNAEKAESAYNILKESTFDDNALTAIILPRVETSAIPNDIHPLLVFVNVKSGGCQGTELISSFRKLLNPHQVFNLDYGGPLPGLHCYRNLTNFKILVCGGDGTVGWVLSCLDNVGQDAKCPHPPMAIVPLGTGNDLARVLRWGTGYTGAEDPLSLLKDVVEAEEIRLDRWTVMIKPNEMEKDEQKRALQLQXXXXXXXXXXXRIFLMNNYFGLGIDADLNLDFHLAREENPGKFTSRIHNKGIYFKMGLRKMVNRTKCKDLHHKITLEVDGRQXXXXXXXXXXXXXXXSWGAGANPWGFTDDVSNQKFSKPTHYDGMLEVVGVTGVVHMGQIFSGLRTGTRLAQGGHIRITLKTSVPVQVDGEPWIQSPCQITVLRSALKATMLXXXXXXXXXXXXTEPGIPPTDNKIVPNETARTQISVIP 3127
            P HH+REGNLP NSKC  CKK C S ECLTG+RCEWCG+TVH +C+R +P EC +G L DI+LP  AVS+PRTS L+E I  + +P Q D       L+D+F+ S    EESGFER++ ++K D+++ D+VR+YDGM R+++ QCRYLSLGK+ SV++VIE+S+KAFQLP  E  + YLVEINE+D S+  L  N PFK+QLQF+ RRPQ+IL+   +   RDYI++YPG L    +IS+  I++ IT  T A  +LVL+L RLG+ +++++KF+LVET +D G+ ERV+  ++  W I++ ++ ES+RA  LTRFYIRSV DPYG G V+++VGNLK+GLSQRLYE IL++RL   N+W+AIEVIYYD GSLV+IYSNAEKA+ AY +LK STF+D  + A+ILPR++   I +   PLLVFVNVKSGGCQG ELI+SFRKLLNPHQVFNLD GGPLPGLHC+R+L+ FKILVCGGDGTVGW LSCLDNVGQDA CP PPMAI+P+GTGNDLARVL WG GYTG EDPL +L+DVVEAEEIRLDRWTV+IKP+++E D QK+ LQ++AN  NTNE+T+RIF+MNNYFGLGIDADLNLDFHLAREENP KF SRIHNK +YFKMGLRKMVN+TKCKDLH  + +EVDGRQ++LPP+EGIIILNILSWGAGANPWG   D   + F+KPTHYDG+LEVVGVTGVVHMGQIFSGLRTGTRLAQGGHIRITLK+ +PVQVDGEPWIQSP QI VLRSALKATMLKKRKRRKVNRR+TEPG+       V   +     +++P
Sbjct:  253 PVHHWREGNLPANSKCSSCKKTCWSAECLTGMRCEWCGVTVHYTCFRNLPMECDYGSLRDIMLPPQAVSIPRTSLLMEHIIGLPKP-QPDFFPGLPALMDEFTSSGESLEESGFERRTNRDKSDRDFDDYVRVYDGMDRYRRHQCRYLSLGKNVSVRKVIELSLKAFQLPPDEEKDFYLVEINERDGSEHPLDSNTPFKRQLQFETRRPQIILRYVEREENRDYINVYPGSLVDYADISVPSIQVSITPTTSAHDVLVLSLHRLGVGYLDANKFNLVETVVDRGLVERVLHPNDRPWEIIDNVRLESVRALRLTRFYIRSVKDPYGQG-VSLFVGNLKRGLSQRLYEIILLERLGYQNKWDAIEVIYYDFGSLVVIYSNAEKADEAYRLLKNSTFEDRPILAMILPRIKPEHILDGTQPLLVFVNVKSGGCQGLELITSFRKLLNPHQVFNLDNGGPLPGLHCFRHLSRFKILVCGGDGTVGWALSCLDNVGQDAACPTPPMAILPIGTGNDLARVLHWGPGYTGTEDPLQILRDVVEAEEIRLDRWTVVIKPDQVESDAQKKQLQIEANTCNTNEDTSRIFVMNNYFGLGIDADLNLDFHLAREENPAKFNSRIHNKSVYFKMGLRKMVNQTKCKDLHQNVLIEVDGRQLDLPPIEGIIILNILSWGAGANPWGMEKD---EAFAKPTHYDGLLEVVGVTGVVHMGQIFSGLRTGTRLAQGGHIRITLKSDIPVQVDGEPWIQSPGQIVVLRSALKATMLKKRKRRKVNRRHTEPGLGANSGVAVDASSGAMLPAILP 1046          

HSP 2 Score: 145.206 bits (365), Expect = 2.607e-31
Identity = 56/96 (58.33%), Postives = 77/96 (80.21%), Query Frame = 2
Query:  449 ICQICNYLVHEKCVPQIIIPCNCVLSFVITEPAAHCWSEISHFKRKFCNVCRKRLEDVAGLRCEICEYYVHTECFDFAISNCKQCAIASTDWPSKE 736
            IC+ICN+L HEKC+ Q++ PC C++ F+I +P AHCWS++ HFKRKFCNVCRKRL+D+  +RCEICEYY H EC +F  ++CK C+I++   PSK+
Sbjct:    2 ICEICNFLAHEKCIRQVVSPCTCIIPFLIQDPMAHCWSDVGHFKRKFCNVCRKRLDDLLSVRCEICEYYTHYECLEFVSADCKVCSIST---PSKD 94          
BLAST of Diacylglycerol kinase vs. Ensembl Cavefish
Match: DGKQ (diacylglycerol kinase theta [Source:HGNC Symbol;Acc:HGNC:2856])

HSP 1 Score: 607.831 bits (1566), Expect = 0.000e+0
Identity = 352/889 (39.60%), Postives = 506/889 (56.92%), Query Frame = 2
Query:  356 GHCFVKKNFHKPLVCHHCAETLWGLLGTTGYICQICNYLVHEKCVPQIIIPCNCVLSFVITEPAAHCWSEISHFKRKFCNVCRKRLEDVAGLRCEICEYYVHTECFDFAISNCKQCAIASTDWPSKEPNHHFREGNLPINSKCFICKKICASVECLTGLRCEWCGITVHTSCYRKIPTECTHGILHDIILPASAVSLPRTSSLIEQIYEIKRPKQEDLMAQTLVDDFSDSDSGREESGFERKSVKEKRDKEYYDFVRLYDGMARFKKKQCRYLSLGKSTSVQRVIEMSMKAFQLPFYEINNIYLVEINEKDN---SDKWLKENEPFKKQLQFDMRRPQVILKLKTKNVERDYISIYPGDLTXXXXXXXXXXXXXXXXXXDATTILVLALRRLGLEHMNSHKFHLVETSLDCGITERVIEKDEILWSILERLQKESLRAFTLTRFYIRSVADPYGTGGVAVYVGNLKKGLSQRLYERILIDRLTPANRWNAIEVIYYDSGSLVLIYSNAEKAESAYNILKESTFDDNALTAIILPRVETSAIPNDIHPLLVFVNVKSGGCQGTELISSFRKLLNPHQVFNLDYGGPLPGLHCYRNLTNFKILVCGGDGTVGWVLSCLDNVGQDAKCPHPPMAIVPLGTGNDLARVLRWGTGYTGAEDPLSLLKDVVEAEEIRLDRWTVMIKPNEMEKDEQKRALQLQXXXXXXXXXXXRIFLMNNYFGLGIDADLNLDFHLAREENPGKFTSRIHNKGIYFKMGLRKMVNRTKCKDLHHKITLEVDGRQXXXXXXXXXXXXXXXSWGAGANPWGFTDDVSNQKFSKPTHYDGMLEVVGVTGVVHMGQIFSGLRTGTRLAQGGHIRITLKTSVPVQVDGEPWIQSPCQITVLRSALKATML 3013
            GH   +    KP  CHHC++ +WGL+G   Y+C++CN++ HEKC+  +   C+C+ + V+  P AHC+   S  K++FC VCRK LE  A LRCE+CE +VH++C  F+ S+C+ C            +HH+REGN+   ++C IC++ C+S + L+G+RCEWCGIT H SCY  IP EC+ G L  +IL  S+V +   +      Y I    Q+  +          +  G +  G  RK+       E+   ++++DG    K+ Q R +S+ + T  + V+E +++AF +P  +    Y ++I+ +     +D  +  N     +  F    P+  L L+ K  E + + I  G L          +    T      ++L   L +LG +    H + L+ T     I                     SLR    TRFY+  V +      V + +G L + L+   Y ++L   L   +    I  +Y   G++ L  S   +AE  Y + ++++ +   LT +++P +  S +     PLLVFVN KSGG +G E++  FRKLLNPHQVF L  GGPLPGLH +R + +F++LVCGGDGTVGWVL  L+ +     CP P ++IVPLGTGNDLARVLRWG GY+G +DP ++L  V EA+E+ +DRWT++    EM +D  +              E  +I  MNNYFGLGIDA+L+LDFH AREE PGKF SR HNKG+Y K+GL+K+   +  ++LH  + LEVD + IELP +EG+I LNI SWG+GA+ WG   D    +F KP   DGMLEVVGVTGVVHMGQ+ SGLR+G R+AQG +IRIT+   +PVQVDGEPWIQ+P QI +  +  K  ML
Sbjct:   58 GHSLRRVTLTKPTFCHHCSDFIWGLVG---YLCEVCNFMSHEKCLKHVRTVCSCMAASVVRVPVAHCFGPASQ-KKRFCCVCRKNLEGTAALRCEVCELHVHSDCAPFSCSDCRLCH-QDGGQEYDMYHHHWREGNIASGARCEICRRACSSSDVLSGMRCEWCGITAHASCYVIIPPECSLGRLRSMILHPSSVRVCSRNFSKMHCYRISESSQQCELG---------NPGGEKRLGPPRKT---PTATEWKQTLKVFDGDDAVKRNQFRLVSIPRITKNEEVVEAALRAFYIP--DEPQDYELQIHTQQQGLLTDDIINRNGTPDNKAVFKDSPPEAWL-LRAKPQEAELLKICAGWLRSGIAYISITVGKSST----VDSVLKEVLIQLGKQVTVLHLYLLINTITGIHI---------------------SLRQMNQTRFYV--VENQNRVVQVELLLGGLPQNLNTEEYTQLLQQHLEIKSHLVTISQVYAGQGAVALQISCFSEAERIYMLARDTSINGKQLTCLVIPEIMKSKLIQGCSPLLVFVNPKSGGLKGREILYGFRKLLNPHQVFELTSGGPLPGLHTFREVPHFRMLVCGGDGTVGWVLGVLEAIRHKLSCPEPAISIVPLGTGNDLARVLRWGAGYSG-DDPYNVLVSVSEADEVEMDRWTILFDAQEMNEDGTQNGF----------LEPPKIVQMNNYFGLGIDAELSLDFHHAREEEPGKFNSRFHNKGVYVKVGLQKL---SHTRNLHKDLKLEVDKQDIELPSIEGLIFLNIPSWGSGADLWGSDSD---SRFEKPRIDDGMLEVVGVTGVVHMGQVQSGLRSGIRIAQGSYIRITVTKPIPVQVDGEPWIQAPGQIIISAAGPKVHML 882          
BLAST of Diacylglycerol kinase vs. Ensembl Cavefish
Match: dgkab (diacylglycerol kinase beta [Source:NCBI gene;Acc:103047572])

HSP 1 Score: 257.684 bits (657), Expect = 1.382e-72
Identity = 152/364 (41.76%), Postives = 212/364 (58.24%), Query Frame = 2
Query: 1982 HPLLVFVNVKSGGCQGTELISSFRKLLNPHQVFNLDYGGPLPGLHCYRNLTNFKILVCGGDGTVGWVLSCLDNVGQDAKCPHPPMAIVPLGTGNDLARVLRWGTGYTGAEDPLSLLKDVVEAEEIRLDRWTVMIKPNEMEKDEQKRALQLQXXXXXXXXXXXRIFLMNNYFGLGIDADLNLDFHLAREENPGKFTSRIHNKGIYFKMGLRKMVNRTKCKDLHHKITLEVDGRQXXXXXXXXXXXXXXX--SWGAGANPWGFTD-----------------DVSNQKFSKPTHYDGMLEVVGVTGVVHMGQIFSGLRT-GTRLAQGGHIRITLKTSVPVQVDGEPWIQSPCQITVLRSALKATML 3013
            +PLLVFVN KSGG QG  ++  F+ LLNP QV+NL  GGP PGLH +RNL  +KILVCGGDGTVGWVL  +D         +PP+AI+PLGTGNDLAR LRWG GY G+ D   +LK++ E+  +++DRW V + PN    DE +    L +             ++NNYF +G+DA +   FH  RE++P KF SR  NK  YF++   + ++ + CK+L   +T++  G +++L       I  +   S   G+N WG T                  D    + S     D +LEVVG+ G + MGQI++GL++ G RLAQ   I I  K ++P+Q+DGEPW+Q PC I +     +A+ML
Sbjct:  378 NPLLVFVNPKSGGKQGGRVLRKFQYLLNPRQVYNLSNGGPNPGLHFFRNLQKYKILVCGGDGTVGWVLDAIDKADMAI---NPPVAILPLGTGNDLARCLRWGGGYEGS-DLSEILKEIEESVVMKMDRWKVQVVPN----DENEVGDPLPSE------------IINNYFSIGVDASIAHRFHTMREKHPQKFNSRAKNKLWYFELATSETISAS-CKNLRECLTIQCCGVRLDLSSHSLEGIAVLNIPSMHGGSNLWGETKKTEDVYKDGGHCPQVITDTDVLERSSQDMSDKLLEVVGLEGAIEMGQIYTGLKSKGHRLAQTTQIMIKTKKALPMQIDGEPWMQPPCTIHITHKN-QASML 719          

HSP 2 Score: 62.3882 bits (150), Expect = 2.333e-9
Identity = 36/116 (31.03%), Postives = 51/116 (43.97%), Query Frame = 2
Query:  359 HCFVKKNFHKPLVCHHCAETLWGLLGTTGYICQICNYLVHEKCVPQIIIPCNCVLSFVITEP----AAHCWSEISHFKRKFCNVCRKRLEDVAGLRCEICEYYVHTECFDFAISNC 694
            H +  K+F++P  C  C   L GL G  G  C +C   VH  C  +   P  C  +F+ ++     A H W        K C +C K+++ +AG RC  C    H EC      NC
Sbjct:  215 HVWRMKHFNRPTYCFVCQNMLLGL-GKQGLSCNVCKCTVHSHCANKYHSP--CAATFITSKEEIGLAVHAWVSADCDSSK-CEICHKKIKALAGKRCVWCHLTRHNECVSVGSVNC 326          

HSP 3 Score: 61.2326 bits (147), Expect = 6.117e-9
Identity = 44/141 (31.21%), Postives = 61/141 (43.26%), Query Frame = 2
Query:  551 HCWSEISHFKR-KFCNVCRKRLEDVA--GLRCEICEYYVHTECFDFAISNCKQCAIASTD--------WPSKEPNHHFREGNLPINSKCFICKKICASVECLTGLRCEWCGITVHTSCYRKIPTECTHGILHDIILPASAV 940
            H W  + HF R  +C VC+  L  +   GL C +C+  VH+ C +   S C    I S +        W S + +          +SKC IC K    ++ L G RC WC +T H  C       C  G L D +LP  A+
Sbjct:  215 HVW-RMKHFNRPTYCFVCQNMLLGLGKQGLSCNVCKCTVHSHCANKYHSPCAATFITSKEEIGLAVHAWVSADCD----------SSKCEICHK---KIKALAGKRCVWCHLTRHNECVSVGSVNCDCGPLKDHVLPPWAI 341          
BLAST of Diacylglycerol kinase vs. Ensembl Cavefish
Match: dgkaa (diacylglycerol kinase, alpha a [Source:ZFIN;Acc:ZDB-GENE-060616-305])

HSP 1 Score: 234.187 bits (596), Expect = 1.997e-64
Identity = 138/354 (38.98%), Postives = 200/354 (56.50%), Query Frame = 2
Query: 2000 VNVKSGGCQGTELISSFRKLLNPHQVFNLDYGGPLPGLHCYRNLTNFKILVCGGDGTVGWVLSCLDNVGQDAKCPHPPMAIVPLGTGNDLARVLRWGTGYTGAEDPLSLLKDVVEAEEIRLDRWTVMIKPNEMEKDEQKRALQLQXXXXXXXXXXXRIFLMNNYFGLGIDADLNLDFHLAREENPGKFTSRIHNKGIYFKMGLRKMVNRTKCKDLHHKITLEVDGRQXXXXXXXXXXXXXXX--SWGAGANPWGFTD--------------DVSNQKFSKPTHYDGMLEVVGVTGVVHMGQIFSGLRTGTRLAQGGHIRITLKTSVPVQVDGEPWIQSPCQITVLRSALKATML 3013
            ++V  GG QG  ++  F+ LLNP QV+NL  GGP PGL  +R+L +++ILVCGGDGTVGW+L  +D      +   PP+A++PLGTGNDLAR LRWG GY G  D   +LKD+  +  +++DRW+V +    + +D Q+R   +               ++NNYF +G+DA +   FH  RE++P KF SR+ NK  YF+    + ++ + CK L   +T+E  G Q++L  L    I  +   S   G+N WG                 D    K S     D  LEVVG+ G + MGQI++GL++  RLA+   I I  K  +P+Q+DGEPW+Q PC I +     +A+ML
Sbjct:  395 MDVSDGGKQGERVLRKFQYLLNPRQVYNLSSGGPGPGLCFFRDLQDYRILVCGGDGTVGWILDAIDKASLPVR---PPVAVLPLGTGNDLARCLRWGGGYDGV-DLGRILKDIEFSTPVQMDRWSVEV----VLEDSQERGDPVPYE------------IINNYFSIGVDASIAHRFHTMREKHPQKFNSRMKNKLWYFEFATSETISAS-CKKLKECLTIECCGVQLDLSNLSLEGIAVLNIPSMHGGSNLWGEAKKSDRGGQDLPEVIVDPEELKVSPQDLSDKRLEVVGLEGAMEMGQIYTGLKSAVRLAKTSQITIRTKKPLPMQIDGEPWMQPPCTIHITHKN-QASML 726          

HSP 2 Score: 70.8626 bits (172), Expect = 5.194e-12
Identity = 49/150 (32.67%), Postives = 69/150 (46.00%), Query Frame = 2
Query:  503 IPCNCVLSFVITEP-AAHCWSEISHFKRK-FCNVCRKRLEDV--AGLRCEICEYYVHTECFDFAISNCKQCAIASTDWPSKEPNHHFREGNLPINSKCFICKKICASVECLTGLRCEWCGITVHTSCYRKIPTECTHGILHDIILPASAV 940
            +P   +L   +T+    H W  + HF +  +CNVC+  L  +   GL C  C+Y VH  C +     C +  + S         H +  GN   + KC  C+K   S+  LTG RC WC    H  C  + P+EC  G L D ILP  A+
Sbjct:  191 VPLLVLLGLKMTQKDGQHLW-RMKHFNKPVYCNVCQNMLLGLRKQGLCCTCCKYTVHGRCANRNPDPCTRTYVMSKK-DIGVSTHDWVSGNCD-SGKCDRCQKKIKSLHGLTGKRCVWCHTLRHDECVNQEPSECNCGPLRDHILPPWAI 337          

HSP 3 Score: 53.5286 bits (127), Expect = 1.243e-6
Identity = 39/123 (31.71%), Postives = 56/123 (45.53%), Query Frame = 2
Query:  341 TGKIKGHCFVKKNFHKPLVCHHCAETLWGLLGTTGYICQICNYLVHEKCVPQIIIPC--NCVLSFVITEPAAHCWSEISHFKRKFCNVCRKRLEDVAGL---RCEICEYYVHTECFDFAISNC 694
            T K   H +  K+F+KP+ C+ C   L GL    G  C  C Y VH +C  +   PC    V+S      + H W   +    K C+ C+K+++ + GL   RC  C    H EC +   S C
Sbjct:  202 TQKDGQHLWRMKHFNKPVYCNVCQNMLLGLR-KQGLCCTCCKYTVHGRCANRNPDPCTRTYVMSKKDIGVSTHDWVSGNCDSGK-CDRCQKKIKSLHGLTGKRCVWCHTLRHDECVNQEPSEC 322          
BLAST of Diacylglycerol kinase vs. Ensembl Cavefish
Match: dgke (diacylglycerol kinase, epsilon [Source:ZFIN;Acc:ZDB-GENE-090512-7])

HSP 1 Score: 223.016 bits (567), Expect = 5.527e-62
Identity = 149/351 (42.45%), Postives = 197/351 (56.13%), Query Frame = 2
Query: 1985 PLLVFVNVKSGGCQGTELISSFRKLLNPHQVFNLDYGGPLPGLHCYRNLT--NFKILVCGGDGTVGWVLSCLDNV---GQDAKCPHPPMAIVPLGTGNDLARVLRWGTGYTGAEDPLSLLKDVVEAEEIRLDRWTVMIKPNEMEKDEQKRALQLQXXXXXXXXXXXRIFLMNNYFGLGIDADLNLDFHLAREENPGKFTSRIHNKGIYFKMGLRKMVNRTKCKDLHHKITLEVDGRQXXXXXXXXXXXXXXXSWGAGANPW-GFTDDVSNQKFSKPTHY-DGMLEVVGVTGVVHMGQIFSGLRTGTRLAQGGHIRITLKTS-VPVQVDGEPWIQSPCQITVLRSALKATML 3013
            PLLV  N +SG   G  L+  FR LLNP QVF+L    P   L     L   + ++LVCGGDGTVGWVL  +D +   GQD   P   + I+PLGTGNDL+  L WG+GY G      ++++V++AE +++DRW V                  Q  +  T     ++  MNNYF +G DA + L+FH  RE+ P  F+SRI NK +YF  G +  + + +CKDL  +I LE+DG ++ LP LEGII+ NI  WG G   W G  D+        PT   DG+LEVVGV G  H  QI   L    RL Q   +R+ LK+S +P+QVDGEPW Q PC IT+     +A ML
Sbjct:  213 PLLVLANTRSGNNMGEVLLGEFRTLLNPVQVFDLSEIQPAKALQLCTLLPPGSVRVLVCGGDGTVGWVLDAIDTMKLKGQDQFIPR--VTILPLGTGNDLSNSLGWGSGYAGEIPVEQVIRNVLDAELVKMDRWKV------------------QVASKGTYFRKPKVLSMNNYFSVGPDALMALNFHAHREKTPSVFSSRIINKAVYFLYGTKDCLVQ-ECKDLDKRIELELDGERVALPSLEGIIVCNIGYWGGGCRLWEGMGDEP-----CPPTRLDDGLLEVVGVFGSFHCAQIQVKLANPVRLGQAHTVRLVLKSSRMPMQVDGEPWAQGPCTITITHKT-QALML 536          
BLAST of Diacylglycerol kinase vs. Ensembl Cavefish
Match: dgkzb (diacylglycerol kinase zeta [Source:NCBI gene;Acc:103036104])

HSP 1 Score: 228.794 bits (582), Expect = 2.561e-61
Identity = 145/349 (41.55%), Postives = 199/349 (57.02%), Query Frame = 2
Query: 1967 IPNDI-HPLLVFVNVKSGGCQGTELISSFRKLLNPHQVFNLDYGGPLPGLHCYRNLTNFKILVCGGDGTVGWVLSCLDNVGQDAKCPHPPMAIVPLGTGNDLARVLRWGTGYTGAEDPLS-LLKDVVEAEEIRLDRWTVMIKPN----EMEKDEQKRALQLQXXXXXXXXXXXRIFLMNNYFGLGIDADLNLDFHLAREENPGKFTSRIHNKGIYFKMGLRKMVNRTKCKDLHHKITLEVDG----RQXXXXXXXXXXXXXXXSWGAGANPWGFTDDVSNQKFSKPTHYDGMLEVVGVTGVVHMGQIFSGLRTGTRLAQGGHIRITLKTSVPVQVDGEPWIQSPCQITV 2983
            IP+ +  PLLVFVN KSGG QG+++I SF   LNP QVF+L  GGP  GL  YR + N +ILVCGGDGTVGW+LS LD++  +   P P +A++PLGTGNDLAR L WG GYT  ++P+S +L  V +   ++LDRW + ++PN    E EKDE +              +   I + NNYF LG DA + L+FH +RE  P KF SR+ NK  Y        + R+  KDL   I +  DG     +++   L+ ++ LNI  + AG  PWG  +   +  F    H DG +EV+G T +  +  +  G   G RL Q   + +T    +PVQVDGEP   +P  I +
Sbjct:  300 IPSQLMKPLLVFVNPKSGGNQGSKIIRSFMWFLNPRQVFDLSQGGPKDGLEMYRKVPNLRILVCGGDGTVGWILSVLDDLQLN---PQPAVAVLPLGTGNDLARTLNWGAGYT--DEPVSKILSHVEDGNIVQLDRWNLSVEPNPEATEDEKDEHQ-------------TDKLPINVFNNYFSLGFDAHVTLEFHESREAKPEKFNSRLRNKMFYAGTAFSDFLMRSS-KDLSKHIRVVCDGMDLTSKVQELKLQCLLFLNIPRYCAGTTPWG--NPSEHHDFEPQRHDDGCIEVIGFT-MTSLATLQVGGH-GERLHQCREVMLTTFKPIPVQVDGEPCRLAPSIIRI 625          
BLAST of Diacylglycerol kinase vs. Ensembl Sea Lamprey
Match: ENSPMAT00000007062.1 (pep scaffold:Pmarinus_7.0:GL477921:5350:38314:1 gene:ENSPMAG00000006363.1 transcript:ENSPMAT00000007062.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 412.92 bits (1060), Expect = 1.803e-131
Identity = 230/505 (45.54%), Postives = 324/505 (64.16%), Query Frame = 2
Query: 1493 TILVLALRRLGLEHMNSHKFHLVETSLDC-GITERVIEKDEILWSILERLQKE-SLRAFTLTRFYIRSVADPYGTGGVAVYVGNLKKGLSQRLYERILIDRLTPANRWNAIEVIYYDSGSLVLIYSNAEKAESAYNILKES--TFDDNALTAIILPRV----ETSAIPNDIHPLLVFVNVKSGGCQGTELISSFRKLLNPHQVFNLDYGGPLPGLHCYRNLTNFKILVCGGDGTVGWVLSCLDNVGQDAKCPHPPMAIVPLGTGNDLARVLRWGTGYTGAEDPLSLLKDVVEAEEIRLDRWTVMIKPNEMEKDEQKRALQLQXXXXXXXXXXXRIFLMNNYFGLGIDADLNLDFHLAREENPGKFTSRIHNKGIYFKMGLRKMVNRTKCKDLHHKITLEVDGRQXXXXXXXXXXXXXXXSWGAGANPWGFTDDVSNQKFSKPTHYDGMLEVVGVTGVVHMGQIFSGLRTGTRLAQGGHIRITLKTSVPVQVDGEPWIQSPCQITV 2983
            +++   L  LG ++ +   + L E  + C  +  RV+  ++ +   L  ++K+ S++   LTRFYI +  D  G G   + VG L  GL+   Y  +L    +       I  IY   G++ L  S+  +AE  + +  +S  T DD  ++  +LP +    +   +P   HPLLV +N +SGG QG EL+ SFRK +NPHQVF+L  GGPLPGLH +R +  F++LVCGGDGTVGWVLS L+++     C  PP+AI+PLGTGNDLARVLRWG GY+G EDPLS+L +V EA+E+++DRWT+++  NE E  +++ ++              +I  MNNYFG+G+DADL+L FH AREE+PGKF SR+HNK +Y K+GL+K+   T  ++LH  I ++VD   I+LP +EG+I LNI SWG+GA+ WG     S  KFSKP  +DG+LEVVGVTGV+HMGQ+  GLR+G R+AQG  IR+ L+   P+QVDGEPW+Q P  I V
Sbjct:  136 SVITEVLLLLGRKNESPDDYRLTEVMMHCREVQRRVLVMEQSMLDHLHEIRKQLSVQRINLTRFYITAKLD--GDGNTQLLVGGLPPGLAAPDYLSLLHQPGSYKQNTATITQIYSKQGAVALEVSSCAEAERLFRLANDSKITVDDKIISINLLPTLILHPQPEQMPRSCHPLLVLINPRSGGMQGRELLHSFRKAVNPHQVFDLACGGPLPGLHVFREVPRFRLLVCGGDGTVGWVLSLLEDIKLKLACTQPPVAILPLGTGNDLARVLRWGPGYSG-EDPLSVLINVDEAQEVKMDRWTILLDANEPECAQERTSMP----------RPYQIVQMNNYFGIGVDADLSLGFHNAREEDPGKFNSRLHNKSVYVKVGLQKI---THNRNLHRDIKVQVDNVDIDLPSVEGLIFLNIPSWGSGADLWGSD---SEGKFSKPCMHDGLLEVVGVTGVMHMGQVQGGLRSGIRIAQGQFIRVVLQRETPIQVDGEPWLQPPGNIIV 621          
BLAST of Diacylglycerol kinase vs. Ensembl Sea Lamprey
Match: ENSPMAT00000007068.1 (pep scaffold:Pmarinus_7.0:GL477921:19741:38299:1 gene:ENSPMAG00000006363.1 transcript:ENSPMAT00000007068.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 386.726 bits (992), Expect = 3.820e-124
Identity = 214/449 (47.66%), Postives = 291/449 (64.81%), Query Frame = 2
Query: 1649 SLRAFTLTRFYIRSVADPYGTGGVAVYVGNLKKGLSQRLYERILIDRLTPANRWNAIEVIYYDSGSLVLIYSNAEKAESAYNILKESTFDDNALTAIILPRV----ETSAIPNDIHPLLVFVNVKSGGCQGTELISSFRKLLNPHQVFNLDYGGPLPGLHCYRNLTNFKILVCGGDGTVGWVLSCLDNVGQDAKCPHPPMAIVPLGTGNDLARVLRWGTGYTGAEDPLSLLKDVVEAEEIRLDRWTVMIKPNEMEKDEQKRALQLQXXXXXXXXXXXRIFLMNNYFGLGIDADLNLDFHLAREENPGKFTSRIHNKGIYFKMGLRKMVNRTKCKDLHHKITLEVDGRQXXXXXXXXXXXXXXXSWGAGANPWGFTDDVSNQKFSKPTHYDGMLEVVGVTGVVHMGQIFSGLRTGTRLAQGGHIRITLKTSVPVQVDGEPWIQSPCQITV 2983
            S++   LTRFYI +  D  G G   + VG L  GL+   Y  + +     A +   +  + +   S V+    +      +    E    D  +  + LP V    +   +P   HPLLV +N +SGG QG EL+ SFRK +NPHQVF+L  GGPLPGLH +R +  F++LVCGGDGTVGWVLS L+++     C  PP+AI+PLGTGNDLARVLRWG GY+G EDPLS+L +V EA+E+++DRWT+++  NE E  +++ ++       +  E   +I  MNNYFG+G+DADL+L FH AREE+PGKF SR+HNK +Y K+GL+K+   T  ++LH  I ++VD   I+LP +EG+I LNI SWG+GA+ WG     S  KFSKP  +DG+LEVVGVTGV+HMGQ+  GLR+G R+AQG  IR+ L+   P+QVDGEPW+Q P  I V
Sbjct:    1 SVQRINLTRFYITAKLD--GDGNTQLLVGGLPPGLAAPDYLSLRVYLCQSAPKLIKVWALVHAVWSAVIAQETSSLMMVTFLKRHECNCCDRHVITVPLPSVNLHPQPEQMPRSCHPLLVLINPRSGGMQGRELLHSFRKAVNPHQVFDLACGGPLPGLHVFREVPRFRLLVCGGDGTVGWVLSLLEDIKLKLACTQPPVAILPLGTGNDLARVLRWGPGYSG-EDPLSVLINVDEAQEVKMDRWTILLDANEPECAQERTSMP---RLGDETESQYQIVQMNNYFGIGVDADLSLGFHNAREEDPGKFNSRLHNKSVYVKVGLQKI---THNRNLHRDIKVQVDNVDIDLPSVEGLIFLNIPSWGSGADLWGSD---SEGKFSKPCMHDGLLEVVGVTGVMHMGQVQGGLRSGIRIAQGQFIRVVLQRETPIQVDGEPWLQPPGNIIV 437          
BLAST of Diacylglycerol kinase vs. Ensembl Sea Lamprey
Match: ENSPMAT00000007078.1 (pep scaffold:Pmarinus_7.0:GL477921:24257:38296:1 gene:ENSPMAG00000006363.1 transcript:ENSPMAT00000007078.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 362.459 bits (929), Expect = 2.026e-116
Identity = 188/343 (54.81%), Postives = 251/343 (73.18%), Query Frame = 2
Query: 1955 ETSAIPNDIHPLLVFVNVKSGGCQGTELISSFRKLLNPHQVFNLDYGGPLPGLHCYRNLTNFKILVCGGDGTVGWVLSCLDNVGQDAKCPHPPMAIVPLGTGNDLARVLRWGTGYTGAEDPLSLLKDVVEAEEIRLDRWTVMIKPNEMEKDEQKRALQLQXXXXXXXXXXXRIFLMNNYFGLGIDADLNLDFHLAREENPGKFTSRIHNKGIYFKMGLRKMVNRTKCKDLHHKITLEVDGRQXXXXXXXXXXXXXXXSWGAGANPWGFTDDVSNQKFSKPTHYDGMLEVVGVTGVVHMGQIFSGLRTGTRLAQGGHIRITLKTSVPVQVDGEPWIQSPCQITV 2983
            +   +P   HPLLV +N +SGG QG EL+ SFRK +NPHQVF+L  GGPLPGLH +R +  F++LVCGGDGTVGWVLS L+++     C  PP+AI+PLGTGNDLARVLRWG GY+G EDPLS+L +V EA+E+++DRWT+++  NE E  +++ ++    +    +++      MNNYFG+G+DADL+L FH AREE+PGKF SR+HNK +Y K+GL+K+   T  ++LH  I ++VD   I+LP +EG+I LNI SWG+GA+ WG     S  KFSKP  +DG+LEVVGVTGV+HMGQ+  GLR+G R+AQG  IR+ L+   P+QVDGEPW+Q P  I V
Sbjct:    1 QPEQMPRSCHPLLVLINPRSGGMQGRELLHSFRKAVNPHQVFDLACGGPLPGLHVFREVPRFRLLVCGGDGTVGWVLSLLEDIKLKLACTQPPVAILPLGTGNDLARVLRWGPGYSG-EDPLSVLINVDEAQEVKMDRWTILLDANEPECAQERTSMPRSTHTRVYDKDV--CTCMNNYFGIGVDADLSLGFHNAREEDPGKFNSRLHNKSVYVKVGLQKI---THNRNLHRDIKVQVDNVDIDLPSVEGLIFLNIPSWGSGADLWGSD---SEGKFSKPCMHDGLLEVVGVTGVMHMGQVQGGLRSGIRIAQGQFIRVVLQRETPIQVDGEPWLQPPGNIIV 334          
BLAST of Diacylglycerol kinase vs. Ensembl Sea Lamprey
Match: ENSPMAT00000002929.1 (pep scaffold:Pmarinus_7.0:GL476935:158222:277059:-1 gene:ENSPMAG00000002642.1 transcript:ENSPMAT00000002929.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 255.758 bits (652), Expect = 4.277e-73
Identity = 148/370 (40.00%), Postives = 212/370 (57.30%), Query Frame = 2
Query: 1982 HPLLVFVNVKSGGCQGTELISSFRKLLNPHQVFNLDYGGPLPGLHCYRNLTNFKILVCGGDGTVGWVLSCLDNVGQDAKCPHPPMAIVPLGTGNDLARVLRWGTGYTGAEDPLSLLKDVVEAEEIRLDRWTVMIKPNEMEKDEQKRALQLQXXXXXXXXXXXRIFLMNNYFGLGIDADLNLDFHLAREENPGKFTSRIHNKGIYFKMGLRKMVNRTKCKDLHHKITLEVDGRQXXXXXXXXXXXXXXX--SWGAGANPWGFTD-----------------------DVSNQKFSKPTHYDGMLEVVGVTGVVHMGQIFSGLRT-GTRLAQGGHIRITLKTSVPVQVDGEPWIQSPCQITVLRSALKATML 3013
            HPLLVFVN KSGG QG +++  F+ LLNP QV+NL+ GGP PGL+ +R++ +F++L CGGDGTVGWVL C+D +    +   PP+A++PLGTGNDLAR L WG GY G       LKDV  +  + LDRW++ +   ++  DE+   +                 ++NNYF +G+DA +   FHL RE++P KF SR+ NK  YF+ G  + +  T CK L+  + +E DG Q++L       I  +   S   G+N WG T+                       D    KF +    D +LEVVG+ G + MGQI++GL++ G+RLAQ   + I     +P+Q+DGEPW+Q PC I ++    +A ML
Sbjct:  308 HPLLVFVNPKSGGKQGEKILRKFQYLLNPRQVYNLNKGGPFPGLNFFRDVPDFRVLTCGGDGTVGWVLDCIDKLSLPKR---PPVAVLPLGTGNDLARCLHWGGGYEGGS-LRKTLKDVENSTPLMLDRWSIEVIATDL--DEKGDPVPYS--------------IINNYFSIGVDASIAHRFHLMREKHPEKFNSRMKNKLWYFEFGTSETLFAT-CKKLYEFMEVECDGVQLDLANSSLEGITVLNIPSMHGGSNLWGETNTRRVSRRSSMRRSGREKVQATIADQRELKFCQQDLSDHLLEVVGLDGAMEMGQIYTGLKSAGSRLAQCSSVTIRTTKLLPMQIDGEPWMQPPCTIKIIHKN-QAPML 655          

HSP 2 Score: 80.4925 bits (197), Expect = 1.040e-15
Identity = 57/177 (32.20%), Postives = 80/177 (45.20%), Query Frame = 2
Query:  533 ITEPAAHCWSEISHF-KRKFCNVCRKRLEDVA--GLRCEICEYYVHTECFDFAISNCKQCAIASTDWPSKEPNHHFREGNLPINSKCFICKKICASVECLTGLRCEWCGITVHTSCYRKIPTECTHGILHDIILPASAVSLPRTSSLIEQIYEIKRPKQEDLMAQTLVDDFSDSDSG 1054
            + +   H W ++ HF K  +CN C+  L  +   GL C  C+Y VH  C   A  NC     A +   +   +H++ EGN P  +KC  C K     + LTGL C WC IT+H  C   +  EC  G L D +LP      P T   +  I  I  P   +   + +    +DS SG
Sbjct:  109 VKDDGQHVW-KLKHFNKPAYCNFCKAMLIGLGKQGLCCTFCKYTVHERCVAKAPLNCIS-TYAKSKKSATVMDHYWVEGNCP--AKCDKCHKSIKCYQGLTGLHCVWCHITLHNKCASHVKPECDCGQLKDHVLP------PNTIFPLVLIMGIPTPNACEPQERQMSVQRTDSGSG 275          

HSP 3 Score: 60.8474 bits (146), Expect = 1.443e-9
Identity = 37/119 (31.09%), Postives = 57/119 (47.90%), Query Frame = 2
Query:  359 HCFVKKNFHKPLVCHHCAETLWGLLGTTGYICQICNYLVHEKCVPQIIIPCNCVLSFVITEPAA----HCWSEISHFKRKFCNVCRKRL---EDVAGLRCEICEYYVHTECFDFAISNC 694
            H +  K+F+KP  C+ C   L GL G  G  C  C Y VHE+CV +   P NC+ ++  ++ +A    H W E +   +  C+ C K +   + + GL C  C   +H +C       C
Sbjct:  115 HVWKLKHFNKPAYCNFCKAMLIGL-GKQGLCCTFCKYTVHERCVAK--APLNCISTYAKSKKSATVMDHYWVEGNCPAK--CDKCHKSIKCYQGLTGLHCVWCHITLHNKCASHVKPEC 228          
BLAST of Diacylglycerol kinase vs. Ensembl Sea Lamprey
Match: dgkzb (diacylglycerol kinase, zeta b [Source:ZFIN;Acc:ZDB-GENE-111104-4])

HSP 1 Score: 217.624 bits (553), Expect = 4.378e-61
Identity = 142/351 (40.46%), Postives = 197/351 (56.13%), Query Frame = 2
Query: 1979 IHPLLVFVNVKSGGCQGTELISSFRKLLNPHQVFNLDYGGPLPGLHCYRNLTNFKILVCGGDGTVGWVLSCLDNVGQDAKCPHPPMAIVPLGTGNDLARVLRWGTGYTGAEDPLS-LLKDVVEAEEIRLDRWTVMIKPN-EMEKDEQKRALQLQXXXXXXXXXXXRIFLMNNYFGLGIDADLNLDFHLAREENPGKFTSRIHNKGIYFKMGLRKMVNRTKCKDLHHKITLEVDG----RQXXXXXXXXXXXXXXXSWGAGANPWGFTDDVSNQKFSKPTHYDGMLEVVGVTGVVHMGQIFSGLRTGTRLAQGGHIRITLKTSVPVQVDGEPWIQSPCQITVLRSALKATML 3013
            + PL+VF+N KSGG QG +++ S   LLNP QVF+L  GGP   L  YR + N ++L CGGDGTVGW+LS LD   Q    P PP+AI+PLGTGNDLAR L WG GYT  ++P+S +L  V E   ++LDRW + ++PN ++ +DEQ++      +  + N     + + NNYF LG DA + L+FH +RE NP KF SR  NK  Y        + R+  +DL   + +  DG     +I+   L+ I+ LNI  + AG  PWG   D  +  F    H DG +EV+G T          G   G RL Q     +    + PVQVDGEP   +P   +++R +L+   L
Sbjct:  203 VKPLVVFINPKSGGNQGNKIMQSLMWLLNPRQVFDLGAGGPQEALELYRKVPNLRVLACGGDGTVGWILSVLD---QLQIVPPPPVAILPLGTGNDLARTLNWGGGYT--DEPISKVLSHVEEGATVQLDRWNLDVRPNPDVGRDEQEQG----TSKPSPNPNQLPLDVFNNYFSLGFDARVTLEFHESREANPEKFNSRFRNKMFYAGAAFSDFLQRSS-RDLAKHVRVMCDGVDLTPKIQELKLQCIVFLNIPRYCAGTVPWGNPAD--HHDFEPQRHDDGYIEVIGFTMASLAALQVGG--HGERLHQCREAVLATLRTTPVQVDGEPCRLAP---SIIRISLRNQAL 536          
BLAST of Diacylglycerol kinase vs. Ensembl Nematostella
Match: EDO34591 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SNX6])

HSP 1 Score: 625.165 bits (1611), Expect = 0.000e+0
Identity = 360/929 (38.75%), Postives = 543/929 (58.45%), Query Frame = 2
Query:  248 FSVSKYDNISALSGLCIEDNSNATFNKANLTTGKIKGHCFVKKNFHKPLVCHHCAETLWGLLGTTGYICQICNYLVHEKCVPQIIIPCNCVLSFVITEPAAHCWSEIS-HFKRKFCNVCRKRLEDVAGLRCEICEYYVHTECFDFAISNCKQCA--IASTDWPSKEPNHHFREGNLPINSKCFICKKICASVECLTGLRCEWCGITVHTSCYRKIPTECTHGILHDIILPASAVSLPRTSSLIEQIYEIKRPKQEDLMAQTLVDDFSDSDSGREESGFERKSVKEKRDKEYYDFVRLYDGMARFKKKQCRYLSLGKSTSVQRVIEMSMKAFQLPFYEINNIYLVE-INEKDNSDKWLKENEPFKKQLQFDMR--RPQVILKLKTKNVERDYISIYPGDLTXXXXXXXXXXXXXXXXXXDATTILVLALRRLGLEHMNSHKFHLVETSLDCGITERVIEKDEILWSILERLQKESLRAFTLTRFYIRSVADPYGTGGVAVYVGNLKKGLSQRLYERILIDRLTPANRWNAIEVIYYDSGSLVLIYSNAEKAE--SAYNILKESTFDDNALTAIILPRVETSAIPNDIHPLLVFVNVKSGGCQGTELISSFRKLLNPHQVFNLDYGGPLPGLHCYRNLTNFKILVCGGDGTVGWVLSCLDNVGQDAKCPHPPMAIVPLGTGNDLARVLRWGTGYTGAEDPLSLLKDVVEAEEIRLDRWTVMIKPNEMEKDEQKRALQLQXXXXXXXXXXXRIFLMNNYFGLGIDADLNLDFHLAREENPGKFTSRIHNKGIYFKMGLRKMVNRTKCKDLHHKITLEVDGRQXXXXXXXXXXXXXXXSWGAGANPWGFTDDVSNQKFSKPTHYDGMLEVVGVTGVVHMGQIFSGLRTGTRLAQGGHIRITLKTSVPVQVDGEPWIQSPCQITVLRSALKATM 3010
             S S Y N S+ S       S    ++A    G+  GH FV+K F +P  CHHC + LWG     G++C +CN++ H++C+  + IPC  + + ++  P AH WS +S  F++KFC+VCR+RLED+   RC++C+YYVH  C DF++++CKQ A  +      + + +HH+REGN   +SKC  CK  C S ECL  L+C WC  + HT+C + +P EC +G LH + LP   VS P  +          +P+     ++  V           + GF R    +K        +++YDG      +  + +++ ++  + +V++ ++K+F +   + +N YL + ++E+       K  +P +  +QF  +  +P + L++K+ +  + YI IY G       +      I  T  +D   I+ +A+++ G+ + N   + L E  L  G+ ERV+E  E  W  L  ++K+S+R   LTRFY+R    P G   V + +G+L   + +  YE +L   L    R  + + ++ + GS  +I+ N +  E  +A   L+ +  D       ILP +    +P +  PLLVFVN KSGG QG +++S+F++LLNPHQV+NL  GGPLPGL+ +++L  F+IL+CGGDGTVGWVLSCLD+V        PP AIVPLGTGND++RVL+WG+GY+  + PLSLL  V  AE + LDRW VM    +   D +     +        EE   +F+MNNY G+GIDADL LDFHL REE P KFTSR+ NKG+YF++GLRKM N+TK      ++ +EVDG +++LP LEGI+ILNI SW AGA+ WG   D    +F   ++ D ++EVVG+TGV+ MGQI SG+R+G RLAQG  I I LK  +PVQ+DGEPW+QSP  + +  + ++ T+
Sbjct:    1 MSFSYYTNTSSQS--LARPLSAPILDEAFQAHGQ-SGHRFVRKTFTRPTYCHHCTDMLWGFT-NQGFMCDVCNFVTHDRCMIFVTIPCVSIATTLVKIPVAHTWSGLSFSFRKKFCSVCRRRLEDIPAFRCQVCDYYVHEACQDFSVTDCKQSATYVPFLGKRAVKQDHHWREGNFSASSKCVSCKHSCGSGECLASLKCSWCAQSSHTNCSQLLPKECHYGYLHRVSLPPFCVSFPDKTP---------KPRHFHTFSERGV-----------QKGFSRFYRMKK--------IKVYDGNLT-SPRASKSVTVPRNAKISKVLDETLKSFHIN-DDPDNYYLAKAVDER-------KPLDPEEIPVQFPEKESKPLIFLRIKSADKRKGYIRIYAGTEIDVPVLFKTLPVIASTSVSD---IISVAMKKFGIWNQNQEDYALTEVHLIKGVQERVMEAHECPWKTLMDIRKQSIRDMKLTRFYLRRRNSPLGP--VTMCIGDLPTSMDRSKYEIMLNGVL--GERMLSSKFLF-EIGSHSIIHKNPDGYEGVTALTKLRRTPIDGKTAFVKILPSMHPEVLPPESDPLLVFVNCKSGGGQGDDILSAFQRLLNPHQVYNLMDGGPLPGLYAFKDLPRFRILICGGDGTVGWVLSCLDDVSTALTYKKPPSAIVPLGTGNDMSRVLQWGSGYSSGDTPLSLLIAVDHAEVVHLDRWFVMFDSVDSLSDMKSNVSAI--GLTAGREEEPNMFVMNNYLGIGIDADLCLDFHLRREEAPEKFTSRLRNKGVYFRVGLRKMANKTKWV-FSEEVEIEVDGEKLQLPTLEGIVILNIGSWAAGADLWGPDKD---DEFRPSSYCDCLVEVVGLTGVMQMGQIQSGIRSGVRLAQGAQINIKLKCEIPVQIDGEPWMQSPGNVIIRPALMQVTI 874          
BLAST of Diacylglycerol kinase vs. Ensembl Nematostella
Match: EDO42510 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S1H8])

HSP 1 Score: 245.358 bits (625), Expect = 8.268e-69
Identity = 156/389 (40.10%), Postives = 219/389 (56.30%), Query Frame = 2
Query: 1862 SNAEKAESAYNILKESTFDDNALTAIILPRVETSAIPNDIHPLLVFVNVKSGGCQGTELISSFRKLLNPHQVFNLDYGGPLPGLHCYRNLTNFKILVCGGDGTVGWVLSCLDNVGQDAKCPHPPMAIVPLGTGNDLARVLRWGTGYTGAEDPLSLLKDVVEAEEIRLDRWTVMIKPNEMEKDEQKRALQLQXXXXXXXXXXXRIFLMNNYFGLGIDADLNLDFHLAREENPGKFTSRIHNKGIYFKMGLRKMVNRTKCKDLHHKITLEVDGRQXXXXXXXXXXXXXXXSWGAGANPWGFTDDV-------------SNQKFSKPTHYDGMLEVVGVTGVVHMGQIFSGLRT-GTRLAQGGHIRITLKTSVPVQVDGEPWIQSPCQITVL 2986
            S+AE  +S         FD   +    LP           HPL VF+N KSGG QG+ L+  F+ LLNP QVFNL  GGP PGL  +++L++F++L CGGDGTVGWVL+ +D +    +   PP+A++PLGTGNDLAR L+WG GY G      +L  V     + +DRW + +   +++  E   +  L               ++NNYF +G+DA + L FHL RE+NP KF SR+ NK  YF+ G  + ++ T CK+L   I +  DG+ +ELP LEGI I+NI S   GAN WG TD               ++  ++     DG LEVVG+   +++GQI +G+RT G RLAQ   I I  K   P+Q+DGEPW+Q    + ++
Sbjct:  331 SSAESPDSTTKPNSYVNFDGMPMQITPLP---------GTHPLAVFINPKSGGRQGSRLMHKFQYLLNPRQVFNLGDGGPAPGLKFFQHLSDFRVLCCGGDGTVGWVLATIDKLQMRFR---PPVAVLPLGTGNDLARCLKWGGGYEGGSIS-KVLSQVQRGSVLSMDRWQIDV--TDVDSSENGDSPPLN--------------IINNYFSIGVDASVALKFHLQREKNPEKFNSRLKNKFRYFECGTSETLSAT-CKNLQDAIQVICDGKILELPNLEGIAIVNIPSVYGGANLWGETDKKKAKKSRSKSGSKDNDLAWAVQDIGDGQLEVVGLESSLYVGQIIAGVRTHGLRLAQCSSIEIKTKRLFPMQIDGEPWMQPAATMKIV 689          

HSP 2 Score: 100.523 bits (249), Expect = 1.265e-21
Identity = 52/141 (36.88%), Postives = 71/141 (50.35%), Query Frame = 2
Query:  533 ITEPAAHCWSEISHFKR-KFCNVCRKRLEDVA---GLRCEICEYYVHTECFDFAISNCKQCAIASTDWPSKEPNHHFREGNLPINSKCFICKKICASVECLTGLRCEWCGITVHTSCYRKIPTECTHGILHDIILPASAVS 943
            I +   H W +  HF R  +CN+C  +L   A   GL+C  C+Y VH  C   A ++C    + S        +HH+ EGN P   KCF C K   S  CLTGLRC WC + VH  C   +  EC  G+  + ILP  +++
Sbjct:  180 IRDDGQHQWRQ-KHFNRPAYCNMCHNQLTGFARKQGLQCLFCKYTVHERCVQRAPASCINTYVKSKRTGKMTMDHHWVEGNCP--GKCFKCNKTVKSTNCLTGLRCAWCQMVVHNKCATNVSPECNLGVHREHILPPMSIT 317          

HSP 3 Score: 61.2326 bits (147), Expect = 1.985e-9
Identity = 35/110 (31.82%), Postives = 54/110 (49.09%), Query Frame = 2
Query:  359 HCFVKKNFHKPLVCHHCAETLWGLLGTTGYICQICNYLVHEKCVPQIIIPCNCVLSFVITEPAA-----HCWSEISHFKRKF-CNVCRKRLEDVAGLRCEICEYYVHTEC 670
            H + +K+F++P  C+ C   L G     G  C  C Y VHE+CV +   P +C+ ++V ++        H W E +   + F CN   K    + GLRC  C+  VH +C
Sbjct:  186 HQWRQKHFNRPAYCNMCHNQLTGFARKQGLQCLFCKYTVHERCVQR--APASCINTYVKSKRTGKMTMDHHWVEGNCPGKCFKCNKTVKSTNCLTGLRCAWCQMVVHNKC 293          
BLAST of Diacylglycerol kinase vs. Ensembl Nematostella
Match: EDO48435 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RJW1])

HSP 1 Score: 222.246 bits (565), Expect = 1.657e-62
Identity = 141/336 (41.96%), Postives = 192/336 (57.14%), Query Frame = 2
Query: 1985 PLLVFVNVKSGGCQGTELISSFRKLLNPHQVFNLDYGGPLPGLHCYRNLTNFK--ILVCGGDGTVGWVLSCLDNVGQDAKCPHPPMAIVPLGTGNDLARVLRWGTGYTGAEDPLSLLKDVVEAEEIRLDRWTVMIKPNEMEKDEQKRALQLQXXXXXXXXXXXRIFLMNNYFGLGIDADLNLDFHLAREENPGKFTSRIHNKGIYFKMGLRKMVNRTKCKDLHHKITLEVDGRQXXXXXXXXXXXXXXXSWGAGANPWGFTDDVSNQKFSKPTHYDGMLEVVGVTGVVHMGQIFSGLRTGTRLAQGGHIRITLKTS-VPVQVDGEPWIQSPCQITV 2983
            PLLVF N KSG   G  L+ +FR +LNP QV +L    P   L   R L   +  +LVCGGDG+VGWVL  LD V        P + I+PLGTGNDLARVL WG+GY G ED   +L  +++A+   LDRW V ++        + R                + + MNNYF +G DA + L+FH  RE  P  FTSR+ NK +Y   G R ++ + +CK+LH  + LE+D +++ELP LEGI+ILNI SW  G + W   +  S+     PT  DG+LEVVG+   +H+ ++   L    R+ Q   I+ +     +PVQVDGEPW Q+PC IT+
Sbjct:  204 PLLVFANCKSGDNDGERLLQAFRGVLNPVQVIDLHEVPPETALEFCRLLPGHRCRVLVCGGDGSVGWVLDALDKVKLKLS---PYIGILPLGTGNDLARVLGWGSGYAGEEDANDVLNSILKADVTELDRWKVTVECAGFLGVRKPR----------------KTYSMNNYFSVGCDAKVVLNFHRHRESQPTLFTSRLFNKAMYGVYGARDVLQQ-ECKNLHEMVELELDDKKVELPDLEGIVILNISSWCGGCDMW---NSCSDDDGRPPTASDGLLEVVGLYSSLHIARLQVSLADPHRIGQAHKIKASENAKHLPVQVDGEPWEQAPCVITI 516          

HSP 2 Score: 75.485 bits (184), Expect = 6.269e-14
Identity = 64/227 (28.19%), Postives = 89/227 (39.21%), Query Frame = 2
Query:  578 KRKFCNVCRKRLEDVAGLRCEICEYYVHTECFDFA--ISNCKQCAIASTDWPSKEPNHHFREGNLPINSKCFICKKICASVECLTGLRCEWCGITVHTSCYRKIPTECTHGILHDIILPASAVSLP----RTSSLIEQIYEIKRPKQEDLMAQTLVDDF--SDSDSGREESGF-------ERKSVKEKRDKEYYDFVRLYDGMARFKKKQCRYLSLGKSTSVQRVIE 1213
            K  +CN C   L  V GL CE C   VH EC + A  +  CK   ++          HH+  GNLP+ S C +C  +C +   L   RC WC   VH  C R     C  G    +ILP   +SL     R +     + EI  P   +     +  +    D+D  R    F       +   + E   +   +F RL  G       +CR L  G   SV  V++
Sbjct:   59 KPSYCNACENAL--VRGLHCENCTLSVHDECLETANEVFTCKALVLSR----RSSLKHHYIRGNLPLCSYCSVCGCLCGTAPRLCDQRCIWCQEKVHDDCLRNQSMICDFGRYRTLILPPHCISLTLVGWRKNKQRFVVKEITPPNTRNWSPLLVFANCKSGDNDGERLLQAFRGVLNPVQVIDLHEVPPETALEFCRLLPG------HRCRVLVCGGDGSVGWVLD 273          
BLAST of Diacylglycerol kinase vs. Ensembl Nematostella
Match: EDO38287 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SDC5])

HSP 1 Score: 218.779 bits (556), Expect = 1.323e-58
Identity = 135/338 (39.94%), Postives = 188/338 (55.62%), Query Frame = 2
Query: 1985 PLLVFVNVKSGGCQGTELISSFRKLLNPHQVFNLDYGGPLPGLHCYRNLTNFKILVCGGDGTVGWVLSCLDNVGQDAKCPHPPMAIVPLGTGNDLARVLRWGTGYTGAEDPLS-LLKDVVEAEEIRLDRWTVMIKPNEMEKDEQKRALQLQXXXXXXXXXXXRIFLMNNYFGLGIDADLNLDFHLAREENPGKFTSRIHNKGIYFKMGLRKMVNRTKCKDLHHKITLEVDG----RQXXXXXXXXXXXXXXXSWGAGANPWGFTDDVSNQKFSKPTHYDGMLEVVGVTGVVHMGQIFSGLRTGTRLAQGGHIRITLKTSVPVQVDGEPWIQSPCQITV 2983
            PL+VF+N KSGG QG  ++  F+ LLNP QVF+L   GP  GL  YR + N ++L CGGDGTVGW+LS LD +  +   P PP+AI+PLGTGNDL+R L WG GY  A++PLS +L  V E   ++LDRW + + P+     E               E    + +MNNYF LG DA++ L+FH +RE +P KF SR+ NK  Y K      + + K KD +    LE DG     ++       ++ LNI  + AG +PWG  +   + +F      DG +EV+ +T          G   G RLAQ  ++ +T   S+P+QVDGEP    P +I +
Sbjct:  292 PLVVFINPKSGGNQGLRIMHKFQWLLNPRQVFDLSREGPREGLELYRKVPNVRLLACGGDGTVGWILSELDKLKFN---PRPPVAILPLGTGNDLSRALNWGGGY--ADEPLSKILTHVDEGSVVQLDRWDLEVVPSGYTDGE-------------IAESRLPLNVMNNYFSLGFDAEVCLEFHESREAHPAKFNSRVKNKLFYGKASSTTFI-QGKAKDFYKHTKLECDGVDITEKLLEAKPMCLLFLNISKYSAGTSPWG--NPGRDHEFLPQRSDDGYIEVLALTSATLATTRVGG--HGERLAQCRNVIMTTSKSIPMQVDGEPCRLQPSRIRI 606          
BLAST of Diacylglycerol kinase vs. Ensembl Nematostella
Match: EDO40684 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S6N0])

HSP 1 Score: 127.487 bits (319), Expect = 4.912e-30
Identity = 64/134 (47.76%), Postives = 87/134 (64.93%), Query Frame = 2
Query: 1985 PLLVFVNVKSGGCQGTELISSFRKLLNPHQVFNLDYGGPLPGLHCYRNLTNFKILVCGGDGTVGWVLSCLDNVGQDAKCPHPPMAIVPLGTGNDLARVLRWGTGYTGAEDPLSLLKDVVEAEEIRLDRWTVMIK 2386
            PLLVFVN KSG  QG + I  F++LLNP QVF+L  GGP  GL  +R    F+ILVCGGDG+VGWV+  +D +    +C    + ++PLGTGNDL+RVL WGT +         L+ +  A+ + LDRW +M++
Sbjct:  239 PLLVFVNSKSGDNQGVKFIRKFKQLLNPLQVFDLGVGGPTNGLKFFRRFRRFRILVCGGDGSVGWVMKEVDLMKMATQC---QIGVLPLGTGNDLSRVLGWGTSFADENSVPQFLQHLERAKPLMLDRWAIMVQ 369          

HSP 2 Score: 87.4261 bits (215), Expect = 1.691e-17
Identity = 47/136 (34.56%), Postives = 68/136 (50.00%), Query Frame = 2
Query:  551 HCWSEISHFKRKFCNVCRKRLEDVA--GLRCEICEYYVHTECFDFAISNCKQCAIAST-----DWPSKEPN---HHFREGNLPINSKCFICKKICASVECLTGLRCEWCGITVHTSCYRKIPTECTHGILHDIILP 928
            H W   +H +  FCNVC+  L  V   GL CE+C +  H  C   A +NCK   + +      D  + +P    H + EGNL   ++C +C++ C S   L   RC WC +TVH SC   + ++CT G     +LP
Sbjct:   82 HNWYSCAHARPTFCNVCKDILSGVTSKGLSCEVCRFKSHKRCAAKAPNNCKWTTMQAIRKDNEDCDNSDPMSMPHQWLEGNLTPGARCTVCERPCGSKRRLLDFRCLWCNMTVHHSCKLSVVSKCTLGENSLSVLP 217          

HSP 3 Score: 79.7221 bits (195), Expect = 3.692e-15
Identity = 55/124 (44.35%), Postives = 78/124 (62.90%), Query Frame = 2
Query: 2477 LMNNYFGLGIDADLNLDFHLAREENPGKFTSRIHNKGIYFKMGLRKMVNRTKCKDLHHKITLEVDGRQXXXXXXXXXXXXXXXSWGAGANPWGFTDDVSNQKFSKPTHYDGMLEVVGVTGVVHM 2848
            +MNNYFG+GIDA + LDFH  REE+P K+ SR  N   Y  +G +++V RT  K++  ++  + DG +I LP L+GI++LNI S+  GAN WG   D     F+ P+  D +LEV+ V G   M
Sbjct:  602 VMNNYFGIGIDAKITLDFHTRREEHPEKYRSRTRNMIWYGVLGGKEIVQRTY-KNIDQRV--KCDGHRISLPSLQGIVVLNITSYMGGANFWGGGRD---DGFTDPSFDDNILEVIAVLGAKQM 719          
BLAST of Diacylglycerol kinase vs. Ensembl Medaka
Match: DGKQ (diacylglycerol kinase theta [Source:NCBI gene;Acc:101168014])

HSP 1 Score: 574.318 bits (1479), Expect = 0.000e+0
Identity = 329/888 (37.05%), Postives = 506/888 (56.98%), Query Frame = 2
Query:  356 GHCFVKKNFHKPLVCHHCAETLWGLLGTTGYICQICNYLVHEKCVPQIIIPCNCVLSFVITEPAAHCWSEISHFKRKFCNVCRKRLEDVAGLRCEICEYYVHTECFDFAISNCKQCAIAST-DWPSKEPNHHFREGNLPINSKCFICKKICASVECLTGLRCEWCGITVHTSCYRKIPTECTHGILHDIILPASAVSLPRTSSLIEQIYEIKRPKQEDLMAQTLVDDFSDSDSGREESGFERKSVKEKRDKEYYDFVRLYDGMARFKKKQCRYLSLGKSTSVQRVIEMSMKAFQLPFYEINNIYLVEINEKDNSDKWLKENEPFKKQLQFDMRRPQVILKLKTKNVERDYISIYPGDLTXXXXXXXXXXXXXXXXXXDATTILVLALRRLGLEHMNSHKFHLVETSLDCGITER-VIEKDEILWSILERLQKESLRAFTLTRFYIRSVADPYGTGGVAVYVGNLKKGLSQRLYERILIDRLTPANRWNAIEVIYYDSGSLVLIYSNAEKAESAYNILKESTFDDNALTAIILPRVETSAIPNDIHPLLVFVNVKSGGCQGTELISSFRKLLNPHQVFNLDYGGPLPGLHCYRNLTNFKILVCGGDGTVGWVLSCLDNVGQDAKCPHPPMAIVPLGTGNDLARVLRWGTGYTGAEDPLSLLKDVVEAEEIRLDRWTVMIKPNEMEKDEQKRALQLQXXXXXXXXXXXRIFLMNNYFGLGIDADLNLDFHLAREENPGKFTSRIHNKGIYFKMGLRKMVNRTKCKDLHHKITLEVDGRQXXXXXXXXXXXXXXXSWGAGANPWGFTDDVSNQKFSKPTHYDGMLEVVGVTGVVHMGQIFSGLRTGTRLAQGGHIRITLKTSVPVQVDGEPWIQSPCQITVLRSALKATML 3013
            GH F K    KP  CH C++ +WGL    G++C++CN++ HEKC+  +   C+C+    +  P  HC+      K++FC VCRK+ E  + LRCE+CE +VH +C  F  ++C+ C +  T D   +  +HH+REGNLP  S+C +C++ C+S E + G+RCEWC +T H SCY  +P EC  G L  ++L  + V L   +      Y I      +       + F DSD    ++    + ++    +     +R++DG     +   R + L ++   + ++E +++AF LP  +  N  L E++   +       + P  +    D     +   L+ K  ++D I +Y         +    + + +++ +   +++   L +L  +     +F L+E  +     +R  +  +E +   L  ++K SLR    TRFY+  V +      V + +G L   L+   Y +++ + L   +    +  IY   G+  L  S   +AE  Y + ++++ +   L+++++P+++ + +  D+ PLLVFVN KSGG +G EL+ SFRKLLNPHQVF+L  GGPL G H +R +  F+ILVCGGDGTVGWVL  L+ V     C  PP+ IVPLGTGNDLARVLRWG GY+  EDP S+L  V EA+E+ +DRWT+++   ++ +D +               E  +I  MNNYFGLGIDA+L+LDFH ARE++P KFTSR HNKG+Y K+GL+K+   +  + LH ++ L+VD + + LP +EG+I +NI SWG+GA+ WG   D    +F KP   DG+LEVVGVTGVVHMGQ+ SGLR+G R+AQG ++R+T+    PVQVDGEPWIQ P  I +  +  K  ML
Sbjct:   33 GHRFRKVTLTKPTFCHSCSDFVWGL---AGFLCEVCNFMCHEKCLKTLRTVCSCMAPSQVQVPVVHCFGPAGQ-KKRFCGVCRKQTEGSSALRCEVCELHVHADCAPFTCADCRCCHLDGTLDGAQETFHHHWREGNLPSASRCEVCRRSCSSSEAMVGMRCEWCSVTTHPSCYHSVPLECAVGRLRCMLLKPACVRLDSRNFSKMHCYRITESCGHE------PETFDDSD----QAAAAPRDLQPAPAESGKQLLRVFDGDDGVNRGFYRLVPLCRAMRNEELVEAALRAFYLP-GDPQNFELEEVSASQSDITNRNGSGPDNRSSLKDGGESWL---LRAKPRDKDLIQVY----VSLPRVRDTHVSVCVSVRSTVASVIGEVLFQLDKQAEEVSRFRLLEVFMGGKQVQRQTLMSEENILEKLRDIRKVSLRQMNQTRFYL--VENQNLAVNVNLLIGGLPPLLTTEQYLQLIQEHLAIKSHLVTVSQIYSSQGAAELQVSCFSEAERIYMLARDTSCNSKTLSSLVVPQIQINKLERDVSPLLVFVNPKSGGLRGRELLYSFRKLLNPHQVFDLSNGGPLVGFHTFREVPRFRILVCGGDGTVGWVLGVLEAVRHKLVCREPPIGIVPLGTGNDLARVLRWGAGYS-CEDPHSILVSVDEADEVLMDRWTILLDAQDISEDSKDH----------NYLEPPKIVQMNNYFGLGIDAELSLDFHQAREDDPDKFTSRFHNKGVYVKVGLQKI---SHSRSLHKELQLQVDNQNVPLPSIEGLIFINIPSWGSGADLWGSEVD---GRFGKPRIDDGLLEVVGVTGVVHMGQVQSGLRSGIRIAQGNYVRLTVSKPTPVQVDGEPWIQPPGIIIISAAGPKVRML 879          
BLAST of Diacylglycerol kinase vs. Ensembl Medaka
Match: dgkab (diacylglycerol kinase beta [Source:NCBI gene;Acc:101165301])

HSP 1 Score: 262.692 bits (670), Expect = 7.284e-75
Identity = 151/371 (40.70%), Postives = 217/371 (58.49%), Query Frame = 2
Query: 1955 ETSAIPNDIHPLLVFVNVKSGGCQGTELISSFRKLLNPHQVFNLDYGGPLPGLHCYRNLTNFKILVCGGDGTVGWVLSCLDNVGQDAKCPHPPMAIVPLGTGNDLARVLRWGTGYTGAEDPLSLLKDVVEAEEIRLDRWTVMIKPNEMEKDEQKRALQLQXXXXXXXXXXXRIFLMNNYFGLGIDADLNLDFHLAREENPGKFTSRIHNKGIYFKMGLRKMVNRTKCKDLHHKITLEVDGRQXXXXXXXXXXXXXXX--SWGAGANPWGFT---DDVS----NQKFSKPTHY--------DGMLEVVGVTGVVHMGQIFSGLRT-GTRLAQGGHIRITLKTSVPVQVDGEPWIQSPCQITVLRSALKATML 3013
            + + IP D HPLLVFVN KSGG QG  ++  F+ LLNP QV+NL  GGP PGLH +R LT ++ILVCGGDGTVGW+L  +D         HPP+A++PLGTGNDLAR LRWG GY G  D   +LK++ ++E I +DRW+V + PN+ ++       +                ++NNYF +G+DA +   FH  RE++P +F SR+ NK  YF+    + ++ + CK L+  + +E  G++++L  +    I  +   S   G+N WG +   D VS     +  + P H         D   EVVG+ G + MGQI++GL++ G RLAQ   I I    ++P+Q+DGEPW+Q PC I +     +A ML
Sbjct:  317 QIAQIP-DTHPLLVFVNPKSGGKQGERVLRKFQGLLNPRQVYNLSNGGPTPGLHFFRTLTQYRILVCGGDGTVGWLLDAIDRANLQV---HPPVAVLPLGTGNDLARCLRWGGGYEGT-DLREILKEIEKSEVIPVDRWSVRVIPNDPQEAGDPVPQE----------------IINNYFSIGVDASIAHRFHSMREKHPQRFNSRMKNKLWYFEFATSETISAS-CKKLNESLVIECCGKRLDLSRVALEGIAILNIPSMHGGSNLWGESKKPDSVSEVGRGEVITDPEHLKTVTQDMSDKRFEVVGLEGAMEMGQIYTGLKSAGHRLAQASQITIRTTKALPMQIDGEPWMQPPCTIHITHKN-QANML 664          

HSP 2 Score: 53.5286 bits (127), Expect = 1.319e-6
Identity = 42/139 (30.22%), Postives = 61/139 (43.88%), Query Frame = 2
Query:  530 VITEPAAHCWSEISHF-KRKFCNVCRKRLEDVAGLRCEICEYYVHTECFDFAISNCKQCAIASTDWPSKEPNHHFR-EGNLPINSKCFICKKICASVECLTGLRCEWCGITVHTSCYRKIPTECTHGILHDIILPASAV 940
            +I +   H W  + HF K  +C+ C   L  + G +   C Y VH +C +  +  C    + S     K  +   + + N   NSKC +C K    ++ LTG RC WC    H +C       C  G L D ILP  A+
Sbjct:  172 MIEKDGQHMW-RMKHFNKPTYCSQCENMLLGL-GKQGLCCSYTVHNQCANKKLETCPPTFVKSKQEIGKSSHGWIKVDCN---NSKCEVCSK---KIKNLTGKRCVWCQEMRHEACVLPGIPRCGCGPLKDHILPPWAI 302          

HSP 3 Score: 52.7582 bits (125), Expect = 1.888e-6
Identity = 36/116 (31.03%), Postives = 57/116 (49.14%), Query Frame = 2
Query:  359 HCFVKKNFHKPLVCHHCAETLWGLLGTTGYICQICNYLVHEKCVPQIIIPCNCVLSFVITE----PAAHCWSEISHFKRKFCNVCRKRLEDVAGLRCEICEYYVHTECFDFAISNC 694
            H +  K+F+KP  C  C   L G LG  G +C  C+Y VH +C  + +    C  +FV ++     ++H W ++     K C VC K+++++ G RC  C+   H  C    I  C
Sbjct:  179 HMWRMKHFNKPTYCSQCENMLLG-LGKQG-LC--CSYTVHNQCANKKLE--TCPPTFVKSKQEIGKSSHGWIKVDCNNSK-CEVCSKKIKNLTGKRCVWCQEMRHEACVLPGIPRC 287          
BLAST of Diacylglycerol kinase vs. Ensembl Medaka
Match: dgkab (diacylglycerol kinase beta [Source:NCBI gene;Acc:101165301])

HSP 1 Score: 263.077 bits (671), Expect = 1.280e-74
Identity = 151/372 (40.59%), Postives = 218/372 (58.60%), Query Frame = 2
Query: 1952 VETSAIPNDIHPLLVFVNVKSGGCQGTELISSFRKLLNPHQVFNLDYGGPLPGLHCYRNLTNFKILVCGGDGTVGWVLSCLDNVGQDAKCPHPPMAIVPLGTGNDLARVLRWGTGYTGAEDPLSLLKDVVEAEEIRLDRWTVMIKPNEMEKDEQKRALQLQXXXXXXXXXXXRIFLMNNYFGLGIDADLNLDFHLAREENPGKFTSRIHNKGIYFKMGLRKMVNRTKCKDLHHKITLEVDGRQXXXXXXXXXXXXXXX--SWGAGANPWGFT---DDVS----NQKFSKPTHY--------DGMLEVVGVTGVVHMGQIFSGLRT-GTRLAQGGHIRITLKTSVPVQVDGEPWIQSPCQITVLRSALKATML 3013
            ++ + IP D HPLLVFVN KSGG QG  ++  F+ LLNP QV+NL  GGP PGLH +R LT ++ILVCGGDGTVGW+L  +D         HPP+A++PLGTGNDLAR LRWG GY G  D   +LK++ ++E I +DRW+V + PN+ ++       +                ++NNYF +G+DA +   FH  RE++P +F SR+ NK  YF+    + ++ + CK L+  + +E  G++++L  +    I  +   S   G+N WG +   D VS     +  + P H         D   EVVG+ G + MGQI++GL++ G RLAQ   I I    ++P+Q+DGEPW+Q PC I +     +A ML
Sbjct:  359 LQIAQIP-DTHPLLVFVNPKSGGKQGERVLRKFQGLLNPRQVYNLSNGGPTPGLHFFRTLTQYRILVCGGDGTVGWLLDAIDRANLQV---HPPVAVLPLGTGNDLARCLRWGGGYEGT-DLREILKEIEKSEVIPVDRWSVRVIPNDPQEAGDPVPQE----------------IINNYFSIGVDASIAHRFHSMREKHPQRFNSRMKNKLWYFEFATSETISAS-CKKLNESLVIECCGKRLDLSRVALEGIAILNIPSMHGGSNLWGESKKPDSVSEVGRGEVITDPEHLKTVTQDMSDKRFEVVGLEGAMEMGQIYTGLKSAGHRLAQASQITIRTTKALPMQIDGEPWMQPPCTIHITHKN-QANML 707          

HSP 2 Score: 60.077 bits (144), Expect = 1.143e-8
Identity = 36/116 (31.03%), Postives = 56/116 (48.28%), Query Frame = 2
Query:  359 HCFVKKNFHKPLVCHHCAETLWGLLGTTGYICQICNYLVHEKCVPQIIIPCNCVLSFVITE----PAAHCWSEISHFKRKFCNVCRKRLEDVAGLRCEICEYYVHTECFDFAISNC 694
            H +  K+F+KP  C  C   L GL G  G  C  C+Y VH +C  + +    C  +FV ++     ++H W ++     K C VC K+++++ G RC  C+   H  C    I  C
Sbjct:  212 HMWRMKHFNKPTYCSQCENMLLGL-GKQGLCCICCSYTVHNQCANKKLE--TCPPTFVKSKQEIGKSSHGWIKVDCNNSK-CEVCSKKIKNLTGKRCVWCQEMRHEACVLPGIPRC 323          

HSP 3 Score: 58.5362 bits (140), Expect = 3.741e-8
Identity = 44/141 (31.21%), Postives = 62/141 (43.97%), Query Frame = 2
Query:  530 VITEPAAHCWSEISHF-KRKFCNVCRKRLEDVA--GLRCEICEYYVHTECFDFAISNCKQCAIASTDWPSKEPNHHFR-EGNLPINSKCFICKKICASVECLTGLRCEWCGITVHTSCYRKIPTECTHGILHDIILPASAV 940
            +I +   H W  + HF K  +C+ C   L  +   GL C  C Y VH +C +  +  C    + S     K  +   + + N   NSKC +C K    ++ LTG RC WC    H +C       C  G L D ILP  A+
Sbjct:  205 MIEKDGQHMW-RMKHFNKPTYCSQCENMLLGLGKQGLCCICCSYTVHNQCANKKLETCPPTFVKSKQEIGKSSHGWIKVDCN---NSKCEVCSK---KIKNLTGKRCVWCQEMRHEACVLPGIPRCGCGPLKDHILPPWAI 338          
BLAST of Diacylglycerol kinase vs. Ensembl Medaka
Match: dgkab (diacylglycerol kinase beta [Source:NCBI gene;Acc:101165301])

HSP 1 Score: 263.077 bits (671), Expect = 1.280e-74
Identity = 151/372 (40.59%), Postives = 218/372 (58.60%), Query Frame = 2
Query: 1952 VETSAIPNDIHPLLVFVNVKSGGCQGTELISSFRKLLNPHQVFNLDYGGPLPGLHCYRNLTNFKILVCGGDGTVGWVLSCLDNVGQDAKCPHPPMAIVPLGTGNDLARVLRWGTGYTGAEDPLSLLKDVVEAEEIRLDRWTVMIKPNEMEKDEQKRALQLQXXXXXXXXXXXRIFLMNNYFGLGIDADLNLDFHLAREENPGKFTSRIHNKGIYFKMGLRKMVNRTKCKDLHHKITLEVDGRQXXXXXXXXXXXXXXX--SWGAGANPWGFT---DDVS----NQKFSKPTHY--------DGMLEVVGVTGVVHMGQIFSGLRT-GTRLAQGGHIRITLKTSVPVQVDGEPWIQSPCQITVLRSALKATML 3013
            ++ + IP D HPLLVFVN KSGG QG  ++  F+ LLNP QV+NL  GGP PGLH +R LT ++ILVCGGDGTVGW+L  +D         HPP+A++PLGTGNDLAR LRWG GY G  D   +LK++ ++E I +DRW+V + PN+ ++       +                ++NNYF +G+DA +   FH  RE++P +F SR+ NK  YF+    + ++ + CK L+  + +E  G++++L  +    I  +   S   G+N WG +   D VS     +  + P H         D   EVVG+ G + MGQI++GL++ G RLAQ   I I    ++P+Q+DGEPW+Q PC I +     +A ML
Sbjct:  359 LQIAQIP-DTHPLLVFVNPKSGGKQGERVLRKFQGLLNPRQVYNLSNGGPTPGLHFFRTLTQYRILVCGGDGTVGWLLDAIDRANLQV---HPPVAVLPLGTGNDLARCLRWGGGYEGT-DLREILKEIEKSEVIPVDRWSVRVIPNDPQEAGDPVPQE----------------IINNYFSIGVDASIAHRFHSMREKHPQRFNSRMKNKLWYFEFATSETISAS-CKKLNESLVIECCGKRLDLSRVALEGIAILNIPSMHGGSNLWGESKKPDSVSEVGRGEVITDPEHLKTVTQDMSDKRFEVVGLEGAMEMGQIYTGLKSAGHRLAQASQITIRTTKALPMQIDGEPWMQPPCTIHITHKN-QANML 707          

HSP 2 Score: 60.077 bits (144), Expect = 1.143e-8
Identity = 36/116 (31.03%), Postives = 56/116 (48.28%), Query Frame = 2
Query:  359 HCFVKKNFHKPLVCHHCAETLWGLLGTTGYICQICNYLVHEKCVPQIIIPCNCVLSFVITE----PAAHCWSEISHFKRKFCNVCRKRLEDVAGLRCEICEYYVHTECFDFAISNC 694
            H +  K+F+KP  C  C   L GL G  G  C  C+Y VH +C  + +    C  +FV ++     ++H W ++     K C VC K+++++ G RC  C+   H  C    I  C
Sbjct:  212 HMWRMKHFNKPTYCSQCENMLLGL-GKQGLCCICCSYTVHNQCANKKLE--TCPPTFVKSKQEIGKSSHGWIKVDCNNSK-CEVCSKKIKNLTGKRCVWCQEMRHEACVLPGIPRC 323          

HSP 3 Score: 58.5362 bits (140), Expect = 3.741e-8
Identity = 44/141 (31.21%), Postives = 62/141 (43.97%), Query Frame = 2
Query:  530 VITEPAAHCWSEISHF-KRKFCNVCRKRLEDVA--GLRCEICEYYVHTECFDFAISNCKQCAIASTDWPSKEPNHHFR-EGNLPINSKCFICKKICASVECLTGLRCEWCGITVHTSCYRKIPTECTHGILHDIILPASAV 940
            +I +   H W  + HF K  +C+ C   L  +   GL C  C Y VH +C +  +  C    + S     K  +   + + N   NSKC +C K    ++ LTG RC WC    H +C       C  G L D ILP  A+
Sbjct:  205 MIEKDGQHMW-RMKHFNKPTYCSQCENMLLGLGKQGLCCICCSYTVHNQCANKKLETCPPTFVKSKQEIGKSSHGWIKVDCN---NSKCEVCSK---KIKNLTGKRCVWCQEMRHEACVLPGIPRCGCGPLKDHILPPWAI 338          
BLAST of Diacylglycerol kinase vs. Ensembl Medaka
Match: dgkg (diacylglycerol kinase beta [Source:NCBI gene;Acc:105356367])

HSP 1 Score: 258.455 bits (659), Expect = 7.155e-74
Identity = 167/448 (37.28%), Postives = 240/448 (53.57%), Query Frame = 2
Query: 1721 AVYVGNLKKGLSQRLYERILIDRLTPANRWNAIEVIYYDSGSLVLIYSNAE---KAESAYNILKESTFDDNALTAIILPRVETSAIPNDIHPLLVFVNVKSGGCQGTELISSFRKLLNPHQVFNLDYGGPLPGLHCYRNLTNFKILVCGGDGTVGWVLSCLDNVGQDAKCPHPPMAIVPLGTGNDLARVLRWGTGYTGAEDPLSLLKDVVEAEEIRLDRWTVMIKPNEMEKDEQKRALQLQXXXXXXXXXXXRIFLMNNYFGLGIDADLNLDFHLAREENPGKFTSRIHNKGIYFKMGLRKMVNRTKCKDLHHKITLEVDG--RQXXXXXXXXXXXXXXXSWGAGANPWGFTDDVSNQ----------------------KFSKPTHYDGMLEVVGVTGVVHMGQIFSGLRT-GTRLAQGGHIRITLKTSVPVQVDGEPWIQSPCQIT 2980
             V +G  K+GL   L +  + +R    +    I   Y  S     +++      K E    +L++ T     L + I P V  + +P    PLLV VN KSGG QG  ++  FR LLNP QV++L+ GGP+ GL+ + ++ +F++L CGGDGTVGW+L C++         HPP+AI+PLGTGNDLAR LRWG GY G    L +L+D+  +EE+ LDRW + I P + E++                       ++NNYF +G+DA +   FHL RE++P KF SR+ NK  YF+ G  + ++ T CK L+  I +E DG    +    LEGI +LNI S   G+N WG T    N                       KF      D +LEVVG+ G + MGQI++GL++ G RLAQ   + I     +P+Q+DGEPW+Q PC ++
Sbjct:  184 TVLLGVRKQGLCCSLCKYTVHERCVSKDIAACIST-YAKSRRHTNLHNKCASHVKPECDGGVLRDHTL----LPSYICPVVLITPLPGTC-PLLVLVNPKSGGRQGERVLRKFRYLLNPRQVYSLEQGGPMVGLNFFHDVPDFRVLACGGDGTVGWILDCIEKANFSK---HPPVAILPLGTGNDLARCLRWGGGYEGG-SLLKVLRDIEHSEEVVLDRWHIDIVPCDQEENGDPVPNS----------------IVNNYFSIGVDASIAHRFHLMREKHPEKFNSRMKNKLWYFEFGTTETISAT-CKKLNECIEVECDGVTLDLSNTSLEGIAVLNIPSMHGGSNLWGETKKRRNYSRMSKKVTDKIPSITVTGAKVLKFCMQDFSDQLLEVVGLEGAIEMGQIYTGLKSAGRRLAQCASVTIRTSRRLPMQIDGEPWMQPPCTVS 604          
BLAST of Diacylglycerol kinase vs. Planmine SMEST
Match: SMESG000017153.1 (SMESG000017153.1)

HSP 1 Score: 2034.22 bits (5269), Expect = 0.000e+0
Identity = 1067/1068 (99.91%), Postives = 1068/1068 (100.00%), Query Frame = 2
Query:   74 MSDXXXXXXXXXXXXXWKLQTPHNTIKLEKKQNYSNQLIESSPNPKELEIDDIEEFTCFSVSKYDNISALSGLCIEDNSNATFNKANLTTGKIKGHCFVKKNFHKPLVCHHCAETLWGLLGTTGYICQICNYLVHEKCVPQIIIPCNCVLSFVITEPAAHCWSEISHFKRKFCNVCRKRLEDVAGLRCEICEYYVHTECFDFAISNCKQCAIASTDWPSKEPNHHFREGNLPINSKCFICKKICASVECLTGLRCEWCGITVHTSCYRKIPTECTHGILHDIILPASAVSLPRTSSLIEQIYEIKRPKQEDLMAQTLVDDFSDSDSGREESGFERKSVKEKRDKEYYDFVRLYDGMARFKKKQCRYLSLGKSTSVQRVIEMSMKAFQLPFYEINNIYLVEINEKDNSDKWLKENEPFKKQLQFDMRRPQVILKLKTKNVERDYISIYPGDLTXXXXXXXXXXXXXXXXXXDATTILVLALRRLGLEHMNSHKFHLVETSLDCGITERVIEKDEILWSILERLQKESLRAFTLTRFYIRSVADPYGTGGVAVYVGNLKKGLSQRLYERILIDRLTPANRWNAIEVIYYDSGSLVLIYSNAEKAESAYNILKESTFDDNALTAIILPRVETSAIPNDIHPLLVFVNVKSGGCQGTELISSFRKLLNPHQVFNLDYGGPLPGLHCYRNLTNFKILVCGGDGTVGWVLSCLDNVGQDAKCPHPPMAIVPLGTGNDLARVLRWGTGYTGAEDPLSLLKDVVEAEEIRLDRWTVMIKPNEMEKDEQKRALQLQXXXXXXXXXXXRIFLMNNYFGLGIDADLNLDFHLAREENPGKFTSRIHNKGIYFKMGLRKMVNRTKCKDLHHKITLEVDGRQXXXXXXXXXXXXXXXSWGAGANPWGFTDDVSNQKFSKPTHYDGMLEVVGVTGVVHMGQIFSGLRTGTRLAQGGHIRITLKTSVPVQVDGEPWIQSPCQITVLRSALKATMLXXXXXXXXXXXXTEPGIPPTDNKIVPNETARTQISVIPGKSTFDYHPTSPILSDQKASPLHVDTYWDDADEENDEEILKTTETSNPLL 3277
            MSDNESNSNINNENSIWKLQTPHNTIKLEKKQNYSNQLIESSPNPKELEIDDIEEFTCFSVSKYDNISALSGLCIEDNSNATFNKANLTTGKIKGHCFVKKNFHKPLVCHHCAETLWGLLGTTGYICQICNYLVHEKCVPQIIIPCNCVLSFVITEPAAHCWSEISHFKRKFCNVCRKRLEDVAGLRCEICEYYVHTECFDFAISNCKQCAIASTDWPSKEPNHHFREGNLPINSKCFICKKICASVECLTGLRCEWCGITVHTSCYRKIPTECTHGILHDIILPASAVSLPRTSSLIEQIYEIKRPKQEDLMAQTLVDDFSDSDSGREESGFERKSVKEKRDKEYYDFVRLYDGMARFKKKQCRYLSLGKSTSVQRVIEMSMKAFQLPFYEINNIYLVEINEKDNSDKWLKENEPFKKQLQFDMRRPQVILKLKTKNVERDYISIYPGDLTKSCNISINPIKIPITIETDATTILVLALRRLGLEHMNSHKFHLVETSLDCGITERVIEKDEILWSILERLQKESLRAFTLTRFYIRSVADPYGTGGVAVYVGNLKKGLSQRLYERILIDRLTPANRWNAIEVIYYDSGSLVLIYSNAEKAESAYNILKESTFDDNALTAIILPRVETSAIPNDIHPLLVFVNVKSGGCQGTELISSFRKLLNPHQVFNLDYGGPLPGLHCYRNLTNFKILVCGGDGTVGWVLSCLDNVGQDAKCPHPPMAIVPLGTGNDLARVLRWGTGYTGAEDPLSLLKDVVEAEEIRLDRWTVMIKPNEMEKDEQKRALQLQANAANTNEETTRIFLMNNYFGLGIDADLNLDFHLAREENPGKFTSRIHNKGIYFKMGLRKMVNRTKCKDLHHKITLEVDGRQIELPPLEGIIILNILSWGAGANPWGFTDDVSNQKFSKPTHYDGMLEVVGVTGVVHMGQIFSGLRTGTRLAQGGHIRITLKTSVPVQVDGEPWIQSPCQITVLRSALKATMLKKRKRRKVNRRNTEPGIPPTDNKIVPNETARTQISVIPGKSTFDYHPTSPILSDQKASPLHVDTYWDDADEENDEEILKTT+TSNPLL
Sbjct:    1 MSDNESNSNINNENSIWKLQTPHNTIKLEKKQNYSNQLIESSPNPKELEIDDIEEFTCFSVSKYDNISALSGLCIEDNSNATFNKANLTTGKIKGHCFVKKNFHKPLVCHHCAETLWGLLGTTGYICQICNYLVHEKCVPQIIIPCNCVLSFVITEPAAHCWSEISHFKRKFCNVCRKRLEDVAGLRCEICEYYVHTECFDFAISNCKQCAIASTDWPSKEPNHHFREGNLPINSKCFICKKICASVECLTGLRCEWCGITVHTSCYRKIPTECTHGILHDIILPASAVSLPRTSSLIEQIYEIKRPKQEDLMAQTLVDDFSDSDSGREESGFERKSVKEKRDKEYYDFVRLYDGMARFKKKQCRYLSLGKSTSVQRVIEMSMKAFQLPFYEINNIYLVEINEKDNSDKWLKENEPFKKQLQFDMRRPQVILKLKTKNVERDYISIYPGDLTKSCNISINPIKIPITIETDATTILVLALRRLGLEHMNSHKFHLVETSLDCGITERVIEKDEILWSILERLQKESLRAFTLTRFYIRSVADPYGTGGVAVYVGNLKKGLSQRLYERILIDRLTPANRWNAIEVIYYDSGSLVLIYSNAEKAESAYNILKESTFDDNALTAIILPRVETSAIPNDIHPLLVFVNVKSGGCQGTELISSFRKLLNPHQVFNLDYGGPLPGLHCYRNLTNFKILVCGGDGTVGWVLSCLDNVGQDAKCPHPPMAIVPLGTGNDLARVLRWGTGYTGAEDPLSLLKDVVEAEEIRLDRWTVMIKPNEMEKDEQKRALQLQANAANTNEETTRIFLMNNYFGLGIDADLNLDFHLAREENPGKFTSRIHNKGIYFKMGLRKMVNRTKCKDLHHKITLEVDGRQIELPPLEGIIILNILSWGAGANPWGFTDDVSNQKFSKPTHYDGMLEVVGVTGVVHMGQIFSGLRTGTRLAQGGHIRITLKTSVPVQVDGEPWIQSPCQITVLRSALKATMLKKRKRRKVNRRNTEPGIPPTDNKIVPNETARTQISVIPGKSTFDYHPTSPILSDQKASPLHVDTYWDDADEENDEEILKTTDTSNPLL 1068          
BLAST of Diacylglycerol kinase vs. Planmine SMEST
Match: SMESG000017153.1 (SMESG000017153.1)

HSP 1 Score: 2033.07 bits (5266), Expect = 0.000e+0
Identity = 1067/1068 (99.91%), Postives = 1068/1068 (100.00%), Query Frame = 2
Query:   74 MSDXXXXXXXXXXXXXWKLQTPHNTIKLEKKQNYSNQLIESSPNPKELEIDDIEEFTCFSVSKYDNISALSGLCIEDNSNATFNKANLTTGKIKGHCFVKKNFHKPLVCHHCAETLWGLLGTTGYICQICNYLVHEKCVPQIIIPCNCVLSFVITEPAAHCWSEISHFKRKFCNVCRKRLEDVAGLRCEICEYYVHTECFDFAISNCKQCAIASTDWPSKEPNHHFREGNLPINSKCFICKKICASVECLTGLRCEWCGITVHTSCYRKIPTECTHGILHDIILPASAVSLPRTSSLIEQIYEIKRPKQEDLMAQTLVDDFSDSDSGREESGFERKSVKEKRDKEYYDFVRLYDGMARFKKKQCRYLSLGKSTSVQRVIEMSMKAFQLPFYEINNIYLVEINEKDNSDKWLKENEPFKKQLQFDMRRPQVILKLKTKNVERDYISIYPGDLTXXXXXXXXXXXXXXXXXXDATTILVLALRRLGLEHMNSHKFHLVETSLDCGITERVIEKDEILWSILERLQKESLRAFTLTRFYIRSVADPYGTGGVAVYVGNLKKGLSQRLYERILIDRLTPANRWNAIEVIYYDSGSLVLIYSNAEKAESAYNILKESTFDDNALTAIILPRVETSAIPNDIHPLLVFVNVKSGGCQGTELISSFRKLLNPHQVFNLDYGGPLPGLHCYRNLTNFKILVCGGDGTVGWVLSCLDNVGQDAKCPHPPMAIVPLGTGNDLARVLRWGTGYTGAEDPLSLLKDVVEAEEIRLDRWTVMIKPNEMEKDEQKRALQLQXXXXXXXXXXXRIFLMNNYFGLGIDADLNLDFHLAREENPGKFTSRIHNKGIYFKMGLRKMVNRTKCKDLHHKITLEVDGRQXXXXXXXXXXXXXXXSWGAGANPWGFTDDVSNQKFSKPTHYDGMLEVVGVTGVVHMGQIFSGLRTGTRLAQGGHIRITLKTSVPVQVDGEPWIQSPCQITVLRSALKATMLXXXXXXXXXXXXTEPGIPPTDNKIVPNETARTQISVIPGKSTFDYHPTSPILSDQKASPLHVDTYWDDADEENDEEILKTTETSNPLL 3277
            MSDNESNSNINNENSIWKLQTPHNTIKLEKKQNYSNQLIESSPNPKELEIDDIEEFTCFSVSKYDNISALSGLCIEDNSNATFNKANLTTGKIKGHCFVKKNFHKPLVCHHCAETLWGLLGTTGYICQICNYLVHEKCVPQIIIPCNCVLSFVITEPAAHCWSEISHFKRKFCNVCRKRLEDVAGLRCEICEYYVHTECFDFAISNCKQCAIASTDWPSKEPNHHFREGNLPINSKCFICKKICASVECLTGLRCEWCGITVHTSCYRKIPTECTHGILHDIILPASAVSLPRTSSLIEQIYEIKRPKQEDLMAQTLVDDFSDSDSGREESGFERKSVKEKRDKEYYDFVRLYDGMARFKKKQCRYLSLGKSTSVQRVIEMSMKAFQLPFYEINNIYLVEINEKDNSDKWLKENEPFKKQLQFDMRRPQVILKLKTKNVERDYISIYPGDLTKSCNISINPIKIPITIETDATTILVLALRRLGLEHMNSHKFHLVETSLDCGITERVIEKDEILWSILERLQKESLRAFTLTRFYIRSVADPYGTGGVAVYVGNLKKGLSQRLYERILIDRLTPANRWNAIEVIYYDSGSLVLIYSNAEKAESAYNILKESTFDDNALTAIILPRVETSAIPNDIHPLLVFVNVKSGGCQGTELISSFRKLLNPHQVFNLDYGGPLPGLHCYRNLTNFKILVCGGDGTVGWVLSCLDNVGQDAKCPHPPMAIVPLGTGNDLARVLRWGTGYTGAEDPLSLLKDVVEAEEIRLDRWTVMIKPNEMEKDEQKRALQLQANAANTNEETTRIFLMNNYFGLGIDADLNLDFHLAREENPGKFTSRIHNKGIYFKMGLRKMVNRTKCKDLHHKITLEVDGRQIELPPLEGIIILNILSWGAGANPWGFTDDVSNQKFSKPTHYDGMLEVVGVTGVVHMGQIFSGLRTGTRLAQGGHIRITLKTSVPVQVDGEPWIQSPCQITVLRSALKATMLKKRKRRKVNRRNTEPGIPPTDNKIVPNETARTQISVIPGKSTFDYHPTSPILSDQKASPLHVDTYWDDADEENDEEILKTT+TSNPLL
Sbjct:    1 MSDNESNSNINNENSIWKLQTPHNTIKLEKKQNYSNQLIESSPNPKELEIDDIEEFTCFSVSKYDNISALSGLCIEDNSNATFNKANLTTGKIKGHCFVKKNFHKPLVCHHCAETLWGLLGTTGYICQICNYLVHEKCVPQIIIPCNCVLSFVITEPAAHCWSEISHFKRKFCNVCRKRLEDVAGLRCEICEYYVHTECFDFAISNCKQCAIASTDWPSKEPNHHFREGNLPINSKCFICKKICASVECLTGLRCEWCGITVHTSCYRKIPTECTHGILHDIILPASAVSLPRTSSLIEQIYEIKRPKQEDLMAQTLVDDFSDSDSGREESGFERKSVKEKRDKEYYDFVRLYDGMARFKKKQCRYLSLGKSTSVQRVIEMSMKAFQLPFYEINNIYLVEINEKDNSDKWLKENEPFKKQLQFDMRRPQVILKLKTKNVERDYISIYPGDLTKSCNISINPIKIPITIETDATTILVLALRRLGLEHMNSHKFHLVETSLDCGITERVIEKDEILWSILERLQKESLRAFTLTRFYIRSVADPYGTGGVAVYVGNLKKGLSQRLYERILIDRLTPANRWNAIEVIYYDSGSLVLIYSNAEKAESAYNILKESTFDDNALTAIILPRVETSAIPNDIHPLLVFVNVKSGGCQGTELISSFRKLLNPHQVFNLDYGGPLPGLHCYRNLTNFKILVCGGDGTVGWVLSCLDNVGQDAKCPHPPMAIVPLGTGNDLARVLRWGTGYTGAEDPLSLLKDVVEAEEIRLDRWTVMIKPNEMEKDEQKRALQLQANAANTNEETTRIFLMNNYFGLGIDADLNLDFHLAREENPGKFTSRIHNKGIYFKMGLRKMVNRTKCKDLHHKITLEVDGRQIELPPLEGIIILNILSWGAGANPWGFTDDVSNQKFSKPTHYDGMLEVVGVTGVVHMGQIFSGLRTGTRLAQGGHIRITLKTSVPVQVDGEPWIQSPCQITVLRSALKATMLKKRKRRKVNRRNTEPGIPPTDNKIVPNETARTQISVIPGKSTFDYHPTSPILSDQKASPLHVDTYWDDADEENDEEILKTTDTSNPLL 1068          
BLAST of Diacylglycerol kinase vs. Planmine SMEST
Match: SMESG000020956.1 (SMESG000020956.1)

HSP 1 Score: 973.385 bits (2515), Expect = 0.000e+0
Identity = 490/921 (53.20%), Postives = 661/921 (71.77%), Query Frame = 2
Query:  269 NISALSGLCIEDNSNATFN-KANLTTGKIKGHCFVKKNFHKPLVCHHCAETLWGLLGTTGYICQICNYLVHEKCVPQIIIPCNCVLSFVITEPAAHCWSEISHFKRKFCNVCRKRLEDVAGLRCEICEYYVHTECFDFAISNCKQCAIAST--DWPSKEPNHHFREGNLPINSKCFICKKICASVECLTGLRCEWCGITVHTSCYRKIPTECTHGILHDIILPASAVSLPRTSSLIEQIYEIKRPKQEDLMAQTLVDDFSDSDSGREESGFERKSVKEKRDKEYYD-FVRLYDGMARFKKKQCRYLSLGKSTSVQRVIEMSMKAFQLPFYEINNIYLVEINEKDNSDKWLKENEPFKKQLQFDMRRPQVILKLK-TKNVERDYISIYPGDLTXXXXXXXXXXXXXXXXXXDAT-TILVLALRRLGLEHMNSHKFHLVETSLDCGITERVIEKDEILWSILERLQKESLRAFTLTRFYIRSVADPYGTGGVAVYVGNLKKGLSQRLYERILIDRLTPANRWNAIEVIYYDSGSLVLIYSNAEKAESAYNILKESTFDDNALTAIILPRVETSAIPNDIHPLLVFVNVKSGGCQGTELISSFRKLLNPHQVFNLDYGGPLPGLHCYRNLTNFKILVCGGDGTVGWVLSCLDNVGQDAKCPHPPMAIVPLGTGNDLARVLRWGTGYTGAEDPLSLLKDVVEAEEIRLDRWTVMIKPNEMEKDEQKRALQLQXXXXXXXXXXXRIFLMNNYFGLGIDADLNLDFHLAREENPGKFTSRIHNKGIYFKMGLRKMVNRTKCKDLHHKITLEVDGRQXXXXXXXXXXXXXXXSWGAGANPWGFTDDVSNQKFSKPTHYDGMLEVVGVTGVVHMGQIFSGLRTGTRLAQGGHIRITLKTSVPVQVDGEPWIQSPCQITVLRSALKATML 3013
            NI AL     +D  ++T N K++ ++    GH F+KK FH+P  CHHCAE + G+L  TGY C++CN++VHE+C+P ++  C+ V   ++T+P +HCWSE ++FKRKFCNVCRKRL++    RCEICEY+ H +C D+ IS+CK+ A  +   +  S    HH+REGNLP NSKC IC+K+C S ECLTG RCEWCGIT H  C ++IP ECT G L +I+LP   V LPRT   +E I  + RP        T    +S  +  +E+S  E++S KE+ +KE  D +V+++DG +  K+K  R  +  K+ S Q  +E  +K+F LP  + +  Y+VEINEKD S + + +   FK QL++D +RP ++L+ K TK    + + +YPGD+T   NIS +  K     +  A   +L+ ALR+   EH++  KFHLVE  +D  +TER I  DE  W I++RL+++S+R+  LTRFYI++  DP+G G VA++VGNL + L ++ YER+LI++L P N+W+ ++VIYY++G L+L YS+ EKAE AY ILK++   +  +  I+LPR+ +S IP+DI PLLVFVN+KSGG QG  LI++FRKLLNPHQVFNLD+GGPLPGL+C+RNL ++KILVCGGDGTVGW LSCLD+  QDA C  PP+A++P+GTGNDLARVL WG GYT  EDP S+LKDVV AE ++LDRWT++++ ++ EKDE K ALQL+ N  NTNE+ + + +MNNYFG+GIDADL LDFH AR ENP KF SR+HNK +Y KMGLRKM+ RT CKDLH +I +E D + ++LPP+EG+I+LNI+SW  GANPW    D    +F KPTHYDGMLEVVGV+GVVHMGQI SGLR+G R+ Q  H++ITLK  +PVQVDGEP+IQSP QI VL+SALKATML
Sbjct:   60 NIQALVNEPNKDYVDSTSNNKSDESSNNFHGHNFIKKTFHRPAYCHHCAEVMLGIL-RTGYYCEVCNFMVHERCLPNVVSYCSTVAVSLVTKPVSHCWSEKNYFKRKFCNVCRKRLDESLAYRCEICEYHTHVDCKDYVISDCKETAAYTPYLNLSSYNQFHHWREGNLPSNSKCEICRKVCWSNECLTGFRCEWCGITSHAGCLKQIPEECTFGDLKEILLPPRVVCLPRTKVSMENIIGVPRPSNSRFAPGT----WSSDEESKEDSFVEKRSPKEQSEKESSDEYVKVFDGNSSLKRKSYRCFNFNKAMSSQNAVEQCLKSFYLPG-KTDEYYMVEINEKDGSQRTITDVASFKSQLKYDNKRPAIMLRHKETKEHNTEKLKVYPGDITSHVNISSSHYKEIPVTKETAAREVLITALRKFNCEHLDHLKFHLVEVCMDKNVTEREIPSDEHPWDIIQRLKQDSVRSLRLTRFYIKACDDPHGPG-VAIFVGNLMENLDEKTYERMLIEKLGPQNKWDKMDVIYYENGCLILCYSSGEKAELAYEILKDTVLMERQIMVILLPRIISSLIPDDIQPLLVFVNIKSGGGQGNHLITAFRKLLNPHQVFNLDFGGPLPGLYCFRNLKSYKILVCGGDGTVGWALSCLDSTSQDAACDSPPIAVLPVGTGNDLARVLNWGGGYT-TEDPYSILKDVVLAENVKLDRWTLVVRSDDGEKDEAKLALQLETNVCNTNEDNSILIIMNNYFGIGIDADLALDFHNARSENPEKFNSRMHNKSVYLKMGLRKMMYRTTCKDLHKQIIVEADSKILDLPPIEGLIVLNIMSWAGGANPWATERD---DRFHKPTHYDGMLEVVGVSGVVHMGQIHSGLRSGIRIGQASHLKITLKNDLPVQVDGEPFIQSPGQIVVLKSALKATML 969          
BLAST of Diacylglycerol kinase vs. Planmine SMEST
Match: SMESG000023623.1 (SMESG000023623.1)

HSP 1 Score: 962.6 bits (2487), Expect = 0.000e+0
Identity = 476/890 (53.48%), Postives = 644/890 (72.36%), Query Frame = 2
Query:  356 GHCFVKKNFHKPLVCHHCAETLWGLLGTTGYICQICNYLVHEKCVPQIIIPCNCVLSFVITEPAAHCWSEISHFKRKFCNVCRKRLEDVAGLRCEICEYYVHTECFDFAISNCKQCAIASTDWP--SKEPNHHFREGNLPINSKCFICKKICASVECLTGLRCEWCGITVHTSCYRKIPTECTHGILHDIILPASAVSLPRTSSLIEQIYEIKRPKQEDLMAQTLVDDFSDSDSGREESGFERKSVKEKRDKEYY-DFVRLYDGMARFKKKQCRYLSLGKSTSVQRVIEMSMKAFQLPFYEINNIYLVEINEKDNSDKWLKENEPFKKQLQFDMRRPQVILKLKTKNVE-RDYISIYPGDLTXXXXXXXXXXXXXXXXXXDATTILVLALRRLGLEHMNSHKFHLVETSLDCGITERVIEKDEILWSILERLQKESLRAFTLTRFYIRSVADPYGTGGVAVYVGNLKKGLSQRLYERILIDRLTPANRWNAIEVIYYDSGSLVLIYSNAEKAESAYNILKESTFDDNALTAIILPRVETSAIPNDIHPLLVFVNVKSGGCQGTELISSFRKLLNPHQVFNLDYGGPLPGLHCYRNLTNFKILVCGGDGTVGWVLSCLDNVGQDAKCPHPPMAIVPLGTGNDLARVLRWGTGYTGAEDPLSLLKDVVEAEEIRLDRWTVMIKPNEMEKDEQKRALQLQXXXXXXXXXXXRIFLMNNYFGLGIDADLNLDFHLAREENPGKFTSRIHNKGIYFKMGLRKMVNRTKCKDLHHKITLEVDGRQXXXXXXXXXXXXXXXSWGAGANPWGFTDDVSNQKFSKPTHYDGMLEVVGVTGVVHMGQIFSGLRTGTRLAQGGHIRITLKTSVPVQVDGEPWIQSPCQITVLRSALKATML 3013
             H F+KK+FH+P  CHHC+E +WGL+ T G++C++CN+LVHEKC+ Q+   C  + S  +  P +HCW+E   FKRKFCNVCRK+L+D   +RCEICEY+ H EC D+ ++NCK+ A  + +    + +  HH+ EGNLP NSKC IC K C S EC+ G RCEWCG   HT C+++IP EC  G L +IILP S+V +PRT   +E I  + +        ++  +D++D DS +EES  +++S+K++ +KE + D+ +++DG    K++  RY +  KS S Q VIE  +KAF + F + +   + EINEKD  +  L +   FK QL FD +RP +IL+    N E R  + IYPGDL     ++    ++PI  +T +  ++++A+RR   E +N + F LVE  LD  +TER I  DE  W I++RL+K+S+R+  LTRFY++++ DP+G G V ++VGNL + L+Q +YE++L+++L   N+W +IEVIYY+SG LVL Y+  EKAE  Y ILK++   D  L  +ILPR+    IP+DI PLLVFVN+KSGGCQGT+LI++FRKLLNPHQVFNL+YGGPLPGL+C+R + N+KILVCGGDGTVGW LSCLD+ GQDA C  PP+A++PLGTGNDLARVLRWG GYT  E PL +LKDVV AEE++LDRWT+++K ++ +KDE K ALQ++ N  NTNE+++ + +MNNYFG+G+DADL LDFH AR ENP KF SR+HNK +Y KMGLRKMV RT CKDLH +I LE DG  I+LP +EG+IILNI+SWG GANPWG   D    KF KPTHYDG+LEV+GV+G++HMGQI+SG+R G R+ Q GH++ITLK  +PVQVDGEP+IQSP  ITVL+SAL+A ML
Sbjct:  130 AHTFIKKSFHRPAYCHHCSEVMWGLM-TVGFVCEVCNFLVHEKCLSQVFTLCTTIASTAVARPLSHCWTEPGTFKRKFCNVCRKKLDDNPAIRCEICEYHSHIECQDYVVNNCKEGAAYTPNLSLLNFKQFHHWLEGNLPPNSKCIICNKNCYSSECMAGYRCEWCGNASHTICFKQIPIECKFGPLKNIILPPSSVCIPRTKISMESIIGVSKRSN----VKSTSEDWTDEDS-KEESYIDKRSLKDQNEKEKHEDYAKVFDGNGSLKRRVYRYFNFNKSMSSQTVIEQCLKAFHI-FGKSDEYCMCEINEKDGRENPLDDKSNFKSQLTFDSKRPIIILRHNESNKETRGKLKIYPGDLVYCAQVTSKYKEVPINKKTTSKEVIIMAMRRFQCESLNINNFQLVEVCLDRSVTERPIGNDEFPWDIIQRLRKDSIRSLRLTRFYLKAIEDPHGPG-VTIFVGNLVENLNQNVYEKMLLEKLGVNNKWTSIEVIYYESGCLVLSYTCGEKAEICYEILKDTEIKDRPLMVMILPRIIPRMIPDDIIPLLVFVNLKSGGCQGTQLITAFRKLLNPHQVFNLEYGGPLPGLYCFRQVKNYKILVCGGDGTVGWTLSCLDSTGQDAACNSPPIAVLPLGTGNDLARVLRWGGGYTSGETPLQILKDVVIAEELKLDRWTLVVKSDDPDKDEAKLALQIETNTLNTNEDSSILIIMNNYFGVGLDADLALDFHNARSENPNKFNSRMHNKTVYLKMGLRKMVYRTTCKDLHKQIVLEADGHTIDLPQIEGLIILNIMSWGGGANPWGPEKD---DKFVKPTHYDGLLEVIGVSGMIHMGQIYSGIRNGIRICQAGHLKITLKNDLPVQVDGEPFIQSPGTITVLKSALRAIML 1008          
BLAST of Diacylglycerol kinase vs. Planmine SMEST
Match: SMESG000063920.1 (SMESG000063920.1)

HSP 1 Score: 219.935 bits (559), Expect = 1.451e-60
Identity = 162/431 (37.59%), Postives = 227/431 (52.67%), Query Frame = 2
Query: 1946 PRVETSAIPNDIHPLLVFVNVKSGGCQGTELISSFRKLLNPHQVFNLDYGGPLPGLHCYRNLTNFKILVCGGDGTVGWVLSCLDNVGQDAKCPHPPMAIVPLGTGNDLARVLRWGTGYTGAEDPLS-LLKDVVEAEEIRLDRWTVMIKPNEMEKDEQKRALQLQXXXXXXXXXXXRIFLMNNYFGLGIDADLNLDFHLAREENPGKFTSRIHNKGIYFKMGLRKMVNRTKCKDLHHKITLEVDG----RQXXXXXXXXXXXXXXXSWGAGANPWGFTDDVSNQKFSKPTHYDGMLEVVGVTGVVHMGQIFSGLRTGTRLAQGGHIRITLKTSVPVQVDGEPWIQSPCQITVLRSALKATMLXXXXXXXXXXXXTEPGIPPTDNKIVPNETARTQISVIPGKSTFDYHPTSPILSDQKASPLHVDTYWDDAD 3223
            P V  +   + IHP+LVFVN KSGG QG +LI  F  LLNP QVF+L   GP   L  Y+ L NF+IL+CGGDGTV WVLS +D   +    P PP +I+PLGTGNDLAR L WG+GY  A++PLS +L+ V E + + +DRW V I+ N    D    A     +          I + NNYF LG DA   ++FH +RE  P KF +R+ NK  Y  +G + ++ R+  KDL   I L  D     ++++   L  ++ LNI  + AG NPWG  +   +  +S  +  DG+LEV+G T    +  I  G   G R+ Q    ++    ++PVQVDGEP    P  I +        +LK ++R  ++  N +  I       +  E  R Q+SVI      D       L  Q ++PL +    +DAD
Sbjct:   59 PFVIKAPSSSHIHPILVFVNPKSGGNQGAKLIQEFHWLLNPRQVFDLTICGPTIALEFYKKLPNFRILICGGDGTVCWVLSAID---RAEISPFPPCSILPLGTGNDLARSLNWGSGY--ADEPLSKILQAVEEGKVLNMDRWNVWIEYNNFA-DGSSNA---NDDEIEGAVTDLPINVFNNYFSLGADAAAAMEFHESREAKPEKFNNRLKNKIFYAGVGGKDLLKRS-WKDLSEFIVLTCDDVEMTQKVKDLKLHCLLFLNIPRYSAGTNPWG--NPAYSMDYSPQSIDDGLLEVIGFTS-TSLATIQVGGH-GERICQCRKAQLITTKTIPVQVDGEPCRLKPSIININHRNTAKVILKMKRRGSLSLINEDSCIFNCSTSEIFLERLRLQVSVISITDYEDLLFEKERLK-QSSTPLGIIVVDNDAD 474          
The following BLAST results are available for this feature:
BLAST of Diacylglycerol kinase vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
DGKQ0.000e+038.31diacylglycerol kinase theta [Source:HGNC Symbol;Ac... [more]
DGKQ0.000e+038.21diacylglycerol kinase theta [Source:HGNC Symbol;Ac... [more]
DGKB3.007e-7742.01diacylglycerol kinase beta [Source:HGNC Symbol;Acc... [more]
DGKB3.344e-7742.01diacylglycerol kinase beta [Source:HGNC Symbol;Acc... [more]
DGKB4.095e-7742.01diacylglycerol kinase beta [Source:HGNC Symbol;Acc... [more]
back to top
BLAST of Diacylglycerol kinase vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
dgk-10.000e+044.57Diacylglycerol kinase [Source:UniProtKB/TrEMBL;Ac... [more]
dgk-10.000e+044.46Diacylglycerol kinase [Source:UniProtKB/TrEMBL;Ac... [more]
dgk-10.000e+043.82Diacylglycerol kinase [Source:UniProtKB/TrEMBL;Ac... [more]
dgk-12.019e-14753.81Diacylglycerol kinase [Source:UniProtKB/TrEMBL;Ac... [more]
dgk-12.666e-14753.81Diacylglycerol kinase [Source:UniProtKB/TrEMBL;Ac... [more]
back to top
BLAST of Diacylglycerol kinase vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
CG311407.757e-7250.99gene:FBgn0051140 transcript:FBtr0300963[more]
CG311401.110e-7049.48gene:FBgn0051140 transcript:FBtr0330371[more]
CG311408.415e-7149.48gene:FBgn0051140 transcript:FBtr0113392[more]
CG311408.969e-7147.08gene:FBgn0051140 transcript:FBtr0084497[more]
CG311406.029e-7147.08gene:FBgn0051140 transcript:FBtr0305041[more]
back to top
BLAST of Diacylglycerol kinase vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
dgkg5.032e-7340.47diacylglycerol kinase, gamma [Source:ZFIN;Acc:ZDB-... [more]
BX548053.11.981e-7241.50diacylglycerol kinase beta-like [Source:NCBI gene;... [more]
BX548053.21.981e-7241.50diacylglycerol kinase beta-like [Source:NCBI gene;... [more]
BX548053.12.095e-7241.50diacylglycerol kinase beta-like [Source:NCBI gene;... [more]
BX548053.22.434e-7241.50diacylglycerol kinase beta-like [Source:NCBI gene;... [more]
back to top
BLAST of Diacylglycerol kinase vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
DGKQ0.000e+038.95diacylglycerol kinase theta [Source:NCBI gene;Acc:... [more]
DGKQ4.198e-11446.53diacylglycerol kinase theta [Source:NCBI gene;Acc:... [more]
DGKQ5.975e-11446.53diacylglycerol kinase theta [Source:NCBI gene;Acc:... [more]
DGKQ2.675e-10746.21diacylglycerol kinase theta [Source:NCBI gene;Acc:... [more]
DGKA7.095e-6839.79diacylglycerol kinase alpha [Source:NCBI gene;Acc:... [more]
back to top
BLAST of Diacylglycerol kinase vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Dgkq0.000e+038.63diacylglycerol kinase, theta [Source:MGI Symbol;Ac... [more]
Dgkb7.078e-7841.42diacylglycerol kinase, beta [Source:MGI Symbol;Acc... [more]
Dgkb7.078e-7841.42diacylglycerol kinase, beta [Source:MGI Symbol;Acc... [more]
Dgkg1.107e-7141.27diacylglycerol kinase, gamma [Source:MGI Symbol;Ac... [more]
Dgkg1.920e-7143.21diacylglycerol kinase, gamma [Source:MGI Symbol;Ac... [more]
back to top
BLAST of Diacylglycerol kinase vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q6P5E8|DGKQ_MOUSE0.000e+038.63Diacylglycerol kinase theta OS=Mus musculus OX=100... [more]
sp|P52824|DGKQ_HUMAN0.000e+038.31Diacylglycerol kinase theta OS=Homo sapiens OX=960... [more]
sp|Q6NS52|DGKB_MOUSE4.715e-7741.42Diacylglycerol kinase beta OS=Mus musculus OX=1009... [more]
sp|P49621|DGKB_RAT4.722e-7741.69Diacylglycerol kinase beta OS=Rattus norvegicus OX... [more]
sp|Q9Y6T7|DGKB_HUMAN1.967e-7642.01Diacylglycerol kinase beta OS=Homo sapiens OX=9606... [more]
back to top
BLAST of Diacylglycerol kinase vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
G7YB490.000e+067.22Diacylglycerol kinase (Fragment) OS=Clonorchis sin... [more]
A0A4E0RM775.221e-5068.39Diacylglycerol kinase OS=Fasciola hepatica OX=6192... [more]
W6USM41.033e-4867.74Diacylglycerol kinase OS=Echinococcus granulosus O... [more]
A0A068YC641.258e-3166.00Diacylglycerol kinase OS=Echinococcus multilocular... [more]
A0A068WIB22.607e-3166.21Diacylglycerol kinase OS=Echinococcus granulosus O... [more]
back to top
BLAST of Diacylglycerol kinase vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
DGKQ0.000e+039.60diacylglycerol kinase theta [Source:HGNC Symbol;Ac... [more]
dgkab1.382e-7241.76diacylglycerol kinase beta [Source:NCBI gene;Acc:1... [more]
dgkaa1.997e-6438.98diacylglycerol kinase, alpha a [Source:ZFIN;Acc:ZD... [more]
dgke5.527e-6242.45diacylglycerol kinase, epsilon [Source:ZFIN;Acc:ZD... [more]
dgkzb2.561e-6141.55diacylglycerol kinase zeta [Source:NCBI gene;Acc:1... [more]
back to top
BLAST of Diacylglycerol kinase vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ENSPMAT00000007062.11.803e-13145.54pep scaffold:Pmarinus_7.0:GL477921:5350:38314:1 ge... [more]
ENSPMAT00000007068.13.820e-12447.66pep scaffold:Pmarinus_7.0:GL477921:19741:38299:1 g... [more]
ENSPMAT00000007078.12.026e-11654.81pep scaffold:Pmarinus_7.0:GL477921:24257:38296:1 g... [more]
ENSPMAT00000002929.14.277e-7340.00pep scaffold:Pmarinus_7.0:GL476935:158222:277059:-... [more]
dgkzb4.378e-6140.46diacylglycerol kinase, zeta b [Source:ZFIN;Acc:ZDB... [more]
back to top
BLAST of Diacylglycerol kinase vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Diacylglycerol kinase vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
EDO345910.000e+038.75Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO425108.268e-6940.10Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO484351.657e-6241.96Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO382871.323e-5839.94Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO406844.912e-3047.76Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Diacylglycerol kinase vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
DGKQ0.000e+037.05diacylglycerol kinase theta [Source:NCBI gene;Acc:... [more]
dgkab7.284e-7540.70diacylglycerol kinase beta [Source:NCBI gene;Acc:1... [more]
dgkab1.280e-7440.59diacylglycerol kinase beta [Source:NCBI gene;Acc:1... [more]
dgkab1.280e-7440.59diacylglycerol kinase beta [Source:NCBI gene;Acc:1... [more]
dgkg7.155e-7437.28diacylglycerol kinase beta [Source:NCBI gene;Acc:1... [more]
back to top
BLAST of Diacylglycerol kinase vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000017153.10.000e+099.91SMESG000017153.1[more]
SMESG000017153.10.000e+099.91SMESG000017153.1[more]
SMESG000020956.10.000e+053.20SMESG000020956.1[more]
SMESG000023623.10.000e+053.48SMESG000023623.1[more]
SMESG000063920.11.451e-6037.59SMESG000063920.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30015721 ID=SMED30015721|Name=Diacylglycerol kinase|organism=Schmidtea mediterranea sexual|type=transcript|length=3371bp
TTAAAGACATCGTAAAAAGTTGTTATTCGATTATAAATTATATACATGGA
ATTCTAAATTCTTTTTCTCTATCATGTCTGATAATGAGTCAAATAGTAAT
ATAAACAATGAAAATTCAATTTGGAAATTACAGACTCCACATAATACTAT
TAAACTAGAAAAAAAGCAAAATTATTCAAATCAGTTAATTGAATCATCTC
CAAATCCAAAGGAGTTAGAAATCGATGATATTGAAGAGTTTACTTGCTTC
TCTGTATCTAAATATGACAACATATCAGCACTGAGTGGGTTATGCATTGA
AGACAATTCTAATGCAACTTTTAACAAAGCTAACCTCACAACTGGTAAAA
TCAAGGGCCATTGTTTTGTCAAAAAGAATTTCCACAAACCTCTTGTATGT
CATCATTGTGCTGAAACATTGTGGGGGTTATTGGGCACAACTGGCTATAT
TTGCCAAATATGCAATTATTTGGTTCATGAAAAATGTGTTCCGCAGATTA
TTATTCCATGCAATTGTGTTTTATCATTTGTAATAACTGAGCCAGCTGCA
CACTGTTGGTCAGAAATTAGTCATTTCAAAAGAAAATTTTGCAATGTTTG
CCGAAAACGTCTTGAAGATGTAGCTGGCTTACGATGCGAAATCTGCGAAT
ATTATGTGCACACAGAATGTTTTGATTTCGCCATCAGTAATTGTAAACAA
TGTGCAATCGCTTCAACGGATTGGCCATCGAAAGAACCAAATCATCACTT
TCGTGAAGGCAATTTACCAATTAATTCCAAATGCTTTATTTGTAAAAAAA
TCTGTGCATCAGTTGAATGTTTAACTGGACTCAGGTGTGAATGGTGTGGC
ATAACGGTTCATACTAGTTGTTACAGAAAAATTCCTACAGAATGTACACA
TGGTATTTTGCACGATATTATTTTACCTGCATCAGCTGTCTCTTTACCAA
GAACCAGTTCATTAATTGAACAAATTTATGAAATCAAACGACCGAAACAA
GAAGATTTGATGGCTCAAACATTAGTTGATGACTTCAGTGATAGTGATTC
TGGCAGAGAAGAATCTGGATTTGAAAGAAAATCTGTTAAAGAGAAAAGGG
ATAAAGAATATTATGATTTTGTACGTCTTTATGATGGAATGGCGAGATTT
AAGAAAAAACAATGTCGTTATTTGAGTCTTGGTAAAAGCACTTCAGTTCA
ACGAGTAATTGAAATGTCAATGAAAGCATTTCAGTTACCATTCTATGAAA
TAAATAATATATACCTTGTGGAAATAAATGAAAAAGATAATTCAGATAAA
TGGTTGAAAGAAAATGAACCATTTAAAAAACAGTTACAATTTGATATGCG
TCGACCTCAGGTTATTTTAAAATTGAAAACGAAAAATGTCGAACGAGATT
ATATTTCTATCTATCCAGGAGATTTGACAAAATCATGCAATATAAGTATT
AATCCAATTAAAATTCCAATTACTATTGAAACAGATGCAACAACAATATT
AGTATTGGCTCTTCGACGTCTAGGATTAGAGCATATGAACAGTCACAAAT
TTCATTTAGTAGAAACTTCCTTAGATTGTGGGATAACTGAACGTGTCATC
GAAAAGGATGAAATACTGTGGTCAATACTTGAAAGATTACAGAAGGAAAG
TTTGCGAGCTTTTACTTTAACCAGATTTTATATTCGATCTGTTGCTGATC
CATATGGAACGGGAGGGGTAGCTGTTTATGTAGGAAACCTAAAAAAGGGT
CTAAGTCAACGACTATATGAAAGAATTTTGATCGATAGATTAACACCTGC
AAATCGATGGAATGCAATCGAAGTTATTTATTATGACTCTGGGAGTTTAG
TTCTTATATATTCAAACGCAGAAAAAGCTGAATCAGCCTATAATATTTTA
AAAGAAAGTACTTTCGATGACAATGCTTTAACTGCAATTATTCTGCCTAG
AGTAGAGACATCTGCTATTCCAAATGATATACATCCTTTATTAGTGTTCG
TCAATGTTAAATCTGGAGGTTGTCAGGGTACGGAACTTATTAGTTCATTT
AGAAAACTATTAAATCCACATCAAGTGTTTAATCTTGATTATGGTGGACC
TTTGCCTGGTTTGCATTGTTATAGAAATCTTACTAATTTTAAAATACTGG
TTTGTGGGGGAGATGGAACAGTTGGCTGGGTGTTATCTTGCCTCGATAAT
GTTGGTCAAGATGCTAAATGTCCACATCCACCAATGGCCATTGTACCATT
GGGTACCGGGAATGATCTCGCTCGAGTTCTTCGATGGGGTACAGGATATA
CGGGTGCTGAAGATCCACTGTCTCTTTTAAAAGATGTTGTAGAAGCGGAG
GAAATCAGATTAGACCGTTGGACAGTGATGATAAAGCCGAATGAAATGGA
GAAAGATGAACAGAAAAGAGCTCTACAACTGCAAGCGAATGCAGCAAATA
CGAATGAAGAAACTACTCGTATTTTCTTGATGAACAACTATTTTGGCTTA
GGGATAGATGCTGACTTGAACTTAGATTTTCATTTAGCTAGAGAAGAAAA
TCCCGGAAAATTTACTAGCAGGATACATAATAAAGGAATTTATTTCAAAA
TGGGATTGCGAAAAATGGTAAATAGAACAAAATGCAAAGACTTGCATCAT
AAAATCACTTTGGAAGTTGATGGACGACAAATTGAATTACCACCTTTAGA
AGGAATAATAATTTTAAACATTCTCAGTTGGGGTGCTGGAGCGAATCCCT
GGGGATTTACTGACGATGTTTCAAATCAAAAATTCAGCAAACCAACTCAC
TACGATGGCATGTTAGAAGTCGTAGGTGTGACAGGGGTAGTTCATATGGG
TCAAATATTCTCAGGATTGCGCACAGGGACAAGACTGGCTCAAGGAGGCC
ATATTCGCATAACCTTGAAAACTTCAGTTCCTGTACAAGTTGATGGTGAA
CCATGGATTCAGTCTCCATGCCAAATAACAGTTCTTCGGTCTGCATTAAA
AGCAACTATGCTAAAAAAGCGAAAGCGCCGAAAAGTTAATAGAAGAAATA
CAGAACCTGGAATTCCACCGACAGATAATAAAATTGTTCCCAACGAAACC
GCCAGAACTCAAATTTCTGTTATTCCTGGCAAATCAACATTTGATTATCA
CCCAACTAGTCCTATATTATCTGATCAAAAAGCATCTCCACTACATGTTG
ATACTTATTGGGATGATGCTGATGAAGAAAATGACGAAGAGATTCTGAAA
ACCACAGAGACCAGCAATCCTTTATTGTAGTACGGATTTAGTTGGAATAT
TCGATGCCAACTAAAACTTATTGACCATGTACCAATACTACCACTTAGTT
GTAGCTCGTTTTTCTGTTCTT
back to top

protein sequence of SMED30015721-orf-1

>SMED30015721-orf-1 ID=SMED30015721-orf-1|Name=SMED30015721-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=1069bp
MSDNESNSNINNENSIWKLQTPHNTIKLEKKQNYSNQLIESSPNPKELEI
DDIEEFTCFSVSKYDNISALSGLCIEDNSNATFNKANLTTGKIKGHCFVK
KNFHKPLVCHHCAETLWGLLGTTGYICQICNYLVHEKCVPQIIIPCNCVL
SFVITEPAAHCWSEISHFKRKFCNVCRKRLEDVAGLRCEICEYYVHTECF
DFAISNCKQCAIASTDWPSKEPNHHFREGNLPINSKCFICKKICASVECL
TGLRCEWCGITVHTSCYRKIPTECTHGILHDIILPASAVSLPRTSSLIEQ
IYEIKRPKQEDLMAQTLVDDFSDSDSGREESGFERKSVKEKRDKEYYDFV
RLYDGMARFKKKQCRYLSLGKSTSVQRVIEMSMKAFQLPFYEINNIYLVE
INEKDNSDKWLKENEPFKKQLQFDMRRPQVILKLKTKNVERDYISIYPGD
LTKSCNISINPIKIPITIETDATTILVLALRRLGLEHMNSHKFHLVETSL
DCGITERVIEKDEILWSILERLQKESLRAFTLTRFYIRSVADPYGTGGVA
VYVGNLKKGLSQRLYERILIDRLTPANRWNAIEVIYYDSGSLVLIYSNAE
KAESAYNILKESTFDDNALTAIILPRVETSAIPNDIHPLLVFVNVKSGGC
QGTELISSFRKLLNPHQVFNLDYGGPLPGLHCYRNLTNFKILVCGGDGTV
GWVLSCLDNVGQDAKCPHPPMAIVPLGTGNDLARVLRWGTGYTGAEDPLS
LLKDVVEAEEIRLDRWTVMIKPNEMEKDEQKRALQLQANAANTNEETTRI
FLMNNYFGLGIDADLNLDFHLAREENPGKFTSRIHNKGIYFKMGLRKMVN
RTKCKDLHHKITLEVDGRQIELPPLEGIIILNILSWGAGANPWGFTDDVS
NQKFSKPTHYDGMLEVVGVTGVVHMGQIFSGLRTGTRLAQGGHIRITLKT
SVPVQVDGEPWIQSPCQITVLRSALKATMLKKRKRRKVNRRNTEPGIPPT
DNKIVPNETARTQISVIPGKSTFDYHPTSPILSDQKASPLHVDTYWDDAD
EENDEEILKTTETSNPLL*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: molecular function
TermDefinition
GO:0003951NAD+ kinase activity
GO:0046872metal ion binding
GO:0004143diacylglycerol kinase activity
GO:0016301kinase activity
GO:0000166nucleotide binding
GO:0005216ion channel activity
GO:0005249voltage-gated potassium channel activity
GO:0005267potassium channel activity
GO:0005524ATP binding
GO:0016740transferase activity
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000099neuron
PLANA:0000101muscle cell
PLANA:0000418head
Vocabulary: INTERPRO
TermDefinition
IPR017438ATP-NAD_kinase_N
IPR037607DGK
IPR020454DAG/PE-bd
IPR002219PE/DAG-bd
IPR000756Diacylglycerol_kin_accessory
IPR001206Diacylglycerol_kinase_cat_dom
IPR000159RA_dom
IPR029071Ubiquitin-like_domsf
IPR016064NAD/diacylglycerol_kinase_sf
Vocabulary: biological process
TermDefinition
GO:0035556intracellular signal transduction
GO:0007205protein kinase C-activating G-protein coupled receptor signaling pathway
GO:0007165signal transduction
GO:0006810transport
GO:0006811ion transport
GO:0006813potassium ion transport
GO:0016310phosphorylation
GO:0055085transmembrane transport
GO:0071805potassium ion transmembrane transport
Vocabulary: cellular component
TermDefinition
GO:0005622intracellular
GO:0008076voltage-gated potassium channel complex
GO:0016020membrane
GO:0016021integral component of membrane
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
NoneNo IPR availableCOILSCoilCoilcoord: 776..796
NoneNo IPR availableGENE3DG3DSA:3.30.60.20coord: 83..148
e-value: 4.4E-14
score: 54.0
NoneNo IPR availableGENE3DG3DSA:2.60.200.40coord: 801..972
e-value: 1.4E-16
score: 62.8
NoneNo IPR availableGENE3DG3DSA:3.30.60.20coord: 222..275
e-value: 2.0E-20
score: 74.2
NoneNo IPR availableGENE3DG3DSA:3.30.60.20coord: 158..209
e-value: 7.5E-8
score: 34.1
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 1048..1068
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 983..1009
NoneNo IPR availablePANTHERPTHR11255:SF34DIACYLGLYCEROL KINASE THETAcoord: 94..995
NoneNo IPR availableCDDcd17111RA1_DAGK-thetacoord: 350..437
e-value: 6.65418E-19
score: 80.3207
NoneNo IPR availableCDDcd01783RA2_DAGK-thetacoord: 443..538
e-value: 6.42646E-25
score: 97.6821
NoneNo IPR availableSUPERFAMILYSSF57889Cysteine-rich domaincoord: 158..208
NoneNo IPR availableSUPERFAMILYSSF57889Cysteine-rich domaincoord: 87..147
NoneNo IPR availableSUPERFAMILYSSF57889Cysteine-rich domaincoord: 223..278
IPR020454Diacylglycerol/phorbol-ester bindingPRINTSPR00008DAGPEDOMAINcoord: 263..275
score: 31.45
coord: 93..107
score: 32.67
coord: 251..262
score: 39.36
coord: 109..118
score: 47.03
IPR002219Protein kinase C-like, phorbol ester/diacylglycerol-binding domainSMARTSM00109c1_12coord: 160..207
e-value: 9.9E-9
score: 45.0
coord: 224..274
e-value: 1.2E-8
score: 44.7
coord: 96..146
e-value: 1.0E-9
score: 48.3
IPR002219Protein kinase C-like, phorbol ester/diacylglycerol-binding domainPFAMPF00130C1_1coord: 224..276
e-value: 6.1E-10
score: 38.8
coord: 96..148
e-value: 6.4E-11
score: 42.0
IPR002219Protein kinase C-like, phorbol ester/diacylglycerol-binding domainPROSITEPS00479ZF_DAG_PE_1coord: 96..148
IPR002219Protein kinase C-like, phorbol ester/diacylglycerol-binding domainPROSITEPS00479ZF_DAG_PE_1coord: 224..274
IPR002219Protein kinase C-like, phorbol ester/diacylglycerol-binding domainPROSITEPS50081ZF_DAG_PE_2coord: 159..207
score: 11.201
IPR002219Protein kinase C-like, phorbol ester/diacylglycerol-binding domainPROSITEPS50081ZF_DAG_PE_2coord: 95..146
score: 13.752
IPR002219Protein kinase C-like, phorbol ester/diacylglycerol-binding domainPROSITEPS50081ZF_DAG_PE_2coord: 223..274
score: 11.88
IPR002219Protein kinase C-like, phorbol ester/diacylglycerol-binding domainCDDcd00029C1coord: 96..146
e-value: 2.38812E-12
score: 60.5836
IPR002219Protein kinase C-like, phorbol ester/diacylglycerol-binding domainCDDcd00029C1coord: 224..274
e-value: 6.07567E-11
score: 56.3464
IPR002219Protein kinase C-like, phorbol ester/diacylglycerol-binding domainCDDcd00029C1coord: 160..207
e-value: 1.58255E-7
score: 46.7164
IPR000756Diacylglycerol kinase, accessory domainSMARTSM00045dagk_c4b_2coord: 802..960
e-value: 1.1E-79
score: 280.7
IPR000756Diacylglycerol kinase, accessory domainPFAMPF00609DAGK_acccoord: 803..960
e-value: 1.6E-53
score: 181.3
IPR001206Diacylglycerol kinase, catalytic domainSMARTSM00046dagk_c4a_7coord: 638..766
e-value: 6.6E-59
score: 211.7
IPR001206Diacylglycerol kinase, catalytic domainPFAMPF00781DAGK_catcoord: 638..743
e-value: 1.0E-24
score: 86.5
IPR001206Diacylglycerol kinase, catalytic domainPROSITEPS50146DAGKcoord: 634..772
score: 39.864
IPR000159Ras-associating (RA) domainPFAMPF00788RAcoord: 444..537
e-value: 2.3E-5
score: 25.0
IPR017438Inorganic polyphosphate/ATP-NAD kinase, N-terminalGENE3DG3DSA:3.40.50.10330coord: 636..759
e-value: 5.7E-10
score: 40.7
IPR037607Diacylglycerol kinasePANTHERPTHR11255DIACYLGLYCEROL KINASEcoord: 94..995
IPR016064NAD kinase/diacylglycerol kinase-like domain superfamilySUPERFAMILYSSF111331NAD kinase/diacylglycerol kinase-likecoord: 638..978
IPR029071Ubiquitin-like domain superfamilySUPERFAMILYSSF54236Ubiquitin-likecoord: 460..538