Hox class homeodomain protein DjAbd-Ba

Overview
NameHox class homeodomain protein DjAbd-Ba
Smed IDSMED30015704
Length (bp)1444
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Hox class homeodomain protein DjAbd-Ba (SMED30015704) t-SNE clustered cells

Violin plots show distribution of expression levels for Hox class homeodomain protein DjAbd-Ba (SMED30015704) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Hox class homeodomain protein DjAbd-Ba (SMED30015704) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Hox class homeodomain protein DjAbd-Ba (SMED30015704) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30015704

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 43

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
posterior region of the whole animalSMED30015704 EU082823.1smed_ncbi_20200123PMID:23318641
Chen et al., 2013
whole organism asexual adult colorimetric in situ hybridization evidence
posterior poleSMED30015704 EU082823.1smed_ncbi_20200123PMID:23318641
Chen et al., 2013
whole organism asexual adult colorimetric in situ hybridization evidence
posterior region of the whole animalSMED30015704 dd_Smed_v4_12317_0_3dd_Smed_v4PMID:27063937
Scimone et al., 2016
whole organism asexual adult colorimetric in situ hybridization evidence
posterior region of the whole animalSMED30015704 dd_Smed_v4_12317_0_3dd_Smed_v4PMID:27063937
Scimone et al., 2016
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
central nervous systemSMED30015704 SMED30015704smed_20140614PMID:27034770
Currie et al., 2016
whole organism asexual adult fluorescence in situ hybridization evidence
posterior region of the whole animalSMED30015704 SMED30015704smed_20140614PMID:27034770
Currie et al., 2016
whole organism asexual adult fluorescence in situ hybridization evidence
central nervous systemSMED30015704 SmedASXL_012639SmedAsxl_ww_GCZZ01PMID:27034770
Currie et al., 2016
whole organism asexual adult fluorescence in situ hybridization evidence
posterior region of the whole animalSMED30015704 SmedASXL_012639SmedAsxl_ww_GCZZ01PMID:27034770
Currie et al., 2016
whole organism asexual adult fluorescence in situ hybridization evidence
tail regionSMED30015704 SmedASXL_012639SmedAsxl_ww_GCZZ01PMID:27034770
Currie et al., 2016
whole organism asexual adult RNA-sequencing evidence
esophagusSMED30015704 EU082823.1smed_ncbi_20200123PMID:25558068
Reuter et al., 2015
whole organism asexual adult colorimetric in situ hybridization evidence
pharynx pouchSMED30015704 EU082823.1smed_ncbi_20200123PMID:25558068
Reuter et al., 2015
whole organism asexual adult colorimetric in situ hybridization evidence
posterior region of the whole animalSMED30015704 EU082823.1smed_ncbi_20200123PMID:25558068
Reuter et al., 2015
whole organism asexual adult colorimetric in situ hybridization evidence
Category 2 cellSMED30015704 SMED30015704smed_20140614PMID:29100657
Cheng et al., 2018
whole organism asexual adult fluorescence in situ hybridization evidence
epidermisSMED30015704 SMED30015704smed_20140614PMID:29100657
Cheng et al., 2018
whole organism asexual adult fluorescence in situ hybridization evidence
Category 3 cellSMED30015704 SMED30015704smed_20140614PMID:29100657
Cheng et al., 2018
whole organism asexual adult fluorescence in situ hybridization evidence
tail regionSMED30015704 SMED30015704smed_20140614PMID:29100657
Cheng et al., 2018
whole organism asexual adult fluorescence in situ hybridization evidence
neoblastSMED30015704 SMED30015704smed_20140614PMID:29100657
Cheng et al., 2018
whole organism asexual adult fluorescence in situ hybridization evidence
X1 cellSMED30015704 SMED30015704smed_20140614PMID:29100657
Cheng et al., 2018
FACS sorted cell population asexual adult RNA-sequencing evidence
nervous systemSMED30015704SMESG000062714.1 dd_Smed_v4_12317_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
gutSMED30015704SMESG000062714.1 dd_Smed_v4_12317_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
epidermisSMED30015704SMESG000062714.1 dd_Smed_v4_12317_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
cephalic gangliaSMED30015704SMESG000062714.1 dd_Smed_v4_12317_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
muscle cellSMED30015704SMESG000062714.1 dd_Smed_v4_12317_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
neoblastSMED30015704SMESG000062714.1 dd_Smed_v4_12317_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
parenchymal cellSMED30015704SMESG000062714.1 dd_Smed_v4_12317_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
cilated neuronSMED30015704SMESG000062714.1 dd_Smed_v4_12317_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30015704 Contig38083newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30015704 Contig38083uc_Smed_v2PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
posterior region of the whole animalSMED30015704 EU082823.1smed_ncbi_20200123PMID:21282632
Almuedo-Castillo et al., 2011
whole organism asexual adult colorimetric in situ hybridization evidence
tail stripeSMED30015704 EU082823.1smed_ncbi_20200123PMID:21282632
Almuedo-Castillo et al., 2011
whole organism asexual adult colorimetric in situ hybridization evidence
tail regionSMED30015704 OX_Smed_1.0.07158ox_Smed_v2PMID:24238224
Kao et al., 2013
whole organism asexual adult RNA-sequencing evidence
posterior region of the whole animalSMED30015704 EU082823.1smed_ncbi_20200123PMID:18287199
Iglesias et al., 2008
whole organism asexual adult colorimetric in situ hybridization evidence
parapharyngeal regionSMED30015704 EU082823.1smed_ncbi_20200123PMID:18287199
Iglesias et al., 2008
whole organism asexual adult colorimetric in situ hybridization evidence
posterior region of the whole animalSMED30015704 EU082823smed_ncbi_20200123PMID:18287199
Iglesias et al., 2008
whole organism asexual adult colorimetric in situ hybridization evidence
parapharyngeal regionSMED30015704 EU082823smed_ncbi_20200123PMID:18287199
Iglesias et al., 2008
whole organism asexual adult colorimetric in situ hybridization evidence
body wall musculatureSMED30015704SMESG000062714.1 dd_Smed_v4_12317_0_1dd_Smed_v4PMID:30471994
Scimone et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
oocyteSMED30015704 Contig38083newmark_estsPMID:28434803
Rouhana et al., 2017
whole organism adult hermaphrodite RNA-sequencing evidence
oocyteSMED30015704 Contig38083uc_Smed_v2PMID:28434803
Rouhana et al., 2017
whole organism adult hermaphrodite RNA-sequencing evidence
vitelline glandSMED30015704 Contig38083newmark_estsPMID:28434803
Rouhana et al., 2017
whole organism adult hermaphrodite RNA-sequencing evidence
vitelline glandSMED30015704 Contig38083uc_Smed_v2PMID:28434803
Rouhana et al., 2017
whole organism adult hermaphrodite RNA-sequencing evidence
reproductive organSMED30015704 Contig38083newmark_estsPMID:28434803
Rouhana et al., 2017
whole organism adult hermaphrodite RNA-sequencing evidence
reproductive organSMED30015704 Contig38083uc_Smed_v2PMID:28434803
Rouhana et al., 2017
whole organism adult hermaphrodite RNA-sequencing evidence
ovarySMED30015704 PL06013A1D11ncbi_smed_estsPMID:28434803
Rouhana et al., 2017
whole organism adult hermaphrodite colorimetric in situ hybridization evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Hox class homeodomain protein DjAbd-Ba vs. Ensembl Human
Match: AC004080.3 (HOXA10-HOXA9 readthrough)

HSP 1 Score: 82.0333 bits (201), Expect = 2.169e-18
Identity = 36/59 (61.02%), Postives = 50/59 (84.75%), Query Frame = 2
Query: 1049 TRKKRKPYSRYQTMILESEYVGNTYITRQKRWEIACKLHLSERQIKVWFQNRRMKTKKI 1225
            TRKKR PY+++QT+ LE E++ N Y+TR +R+E+A  L+L+ERQ+K+WFQNRRMK KKI
Sbjct:   46 TRKKRCPYTKHQTLELEKEFLFNMYLTRDRRYEVARLLNLTERQVKIWFQNRRMKMKKI 104          
BLAST of Hox class homeodomain protein DjAbd-Ba vs. Ensembl Human
Match: HOXA10 (homeobox A10 [Source:HGNC Symbol;Acc:HGNC:5100])

HSP 1 Score: 80.4925 bits (197), Expect = 5.274e-18
Identity = 38/80 (47.50%), Postives = 57/80 (71.25%), Query Frame = 2
Query: 1052 RKKRKPYSRYQTMILESEYVGNTYITRQKRWEIACKLHLSERQIKVWFQNRRMKTKKIKNRGGYNEITSTGQEYEDINFS 1291
            RKKR PY+++QT+ LE E++ N Y+TR++R EI+  +HL++RQ+K+WFQNRRMK KK+       E+T+      + NFS
Sbjct:   21 RKKRCPYTKHQTLELEKEFLFNMYLTRERRLEISRSVHLTDRQVKIWFQNRRMKLKKMNRENRIRELTA------NFNFS 94          
BLAST of Hox class homeodomain protein DjAbd-Ba vs. Ensembl Human
Match: HOXA9 (homeobox A9 [Source:HGNC Symbol;Acc:HGNC:5109])

HSP 1 Score: 83.9593 bits (206), Expect = 5.388e-18
Identity = 36/59 (61.02%), Postives = 50/59 (84.75%), Query Frame = 2
Query: 1049 TRKKRKPYSRYQTMILESEYVGNTYITRQKRWEIACKLHLSERQIKVWFQNRRMKTKKI 1225
            TRKKR PY+++QT+ LE E++ N Y+TR +R+E+A  L+L+ERQ+K+WFQNRRMK KKI
Sbjct:  147 TRKKRCPYTKHQTLELEKEFLFNMYLTRDRRYEVARLLNLTERQVKIWFQNRRMKMKKI 205          
BLAST of Hox class homeodomain protein DjAbd-Ba vs. Ensembl Human
Match: HOXA9 (homeobox A9 [Source:HGNC Symbol;Acc:HGNC:5109])

HSP 1 Score: 83.9593 bits (206), Expect = 8.153e-18
Identity = 36/59 (61.02%), Postives = 50/59 (84.75%), Query Frame = 2
Query: 1049 TRKKRKPYSRYQTMILESEYVGNTYITRQKRWEIACKLHLSERQIKVWFQNRRMKTKKI 1225
            TRKKR PY+++QT+ LE E++ N Y+TR +R+E+A  L+L+ERQ+K+WFQNRRMK KKI
Sbjct:  159 TRKKRCPYTKHQTLELEKEFLFNMYLTRDRRYEVARLLNLTERQVKIWFQNRRMKMKKI 217          
BLAST of Hox class homeodomain protein DjAbd-Ba vs. Ensembl Human
Match: HOXA9 (homeobox A9 [Source:HGNC Symbol;Acc:HGNC:5109])

HSP 1 Score: 84.3445 bits (207), Expect = 1.219e-17
Identity = 36/59 (61.02%), Postives = 50/59 (84.75%), Query Frame = 2
Query: 1049 TRKKRKPYSRYQTMILESEYVGNTYITRQKRWEIACKLHLSERQIKVWFQNRRMKTKKI 1225
            TRKKR PY+++QT+ LE E++ N Y+TR +R+E+A  L+L+ERQ+K+WFQNRRMK KKI
Sbjct:  206 TRKKRCPYTKHQTLELEKEFLFNMYLTRDRRYEVARLLNLTERQVKIWFQNRRMKMKKI 264          
BLAST of Hox class homeodomain protein DjAbd-Ba vs. Ensembl Celegans
Match: php-3 (Posterior Hox gene Paralog [Source:UniProtKB/TrEMBL;Acc:Q9XW88])

HSP 1 Score: 95.5153 bits (236), Expect = 7.778e-22
Identity = 41/68 (60.29%), Postives = 55/68 (80.88%), Query Frame = 2
Query: 1031 SSETVKTRKKRKPYSRYQTMILESEYVGNTYITRQKRWEIACKLHLSERQIKVWFQNRRMKTKKIKNR 1234
            +S +   RKKRKPY++ QT+ LE E++ NTY+++QKRWE+A  LHL+ERQ+K+WFQNRRMK KK K R
Sbjct:  193 TSSSHAMRKKRKPYTKAQTLELEKEFLYNTYVSKQKRWELAKYLHLTERQVKIWFQNRRMKDKKQKQR 260          
BLAST of Hox class homeodomain protein DjAbd-Ba vs. Ensembl Celegans
Match: php-3 (Posterior Hox gene Paralog [Source:UniProtKB/TrEMBL;Acc:Q9XW88])

HSP 1 Score: 95.5153 bits (236), Expect = 7.778e-22
Identity = 41/68 (60.29%), Postives = 55/68 (80.88%), Query Frame = 2
Query: 1031 SSETVKTRKKRKPYSRYQTMILESEYVGNTYITRQKRWEIACKLHLSERQIKVWFQNRRMKTKKIKNR 1234
            +S +   RKKRKPY++ QT+ LE E++ NTY+++QKRWE+A  LHL+ERQ+K+WFQNRRMK KK K R
Sbjct:  193 TSSSHAMRKKRKPYTKAQTLELEKEFLYNTYVSKQKRWELAKYLHLTERQVKIWFQNRRMKDKKQKQR 260          
BLAST of Hox class homeodomain protein DjAbd-Ba vs. Ensembl Celegans
Match: mab-5 (Homeobox protein mab-5 [Source:UniProtKB/Swiss-Prot;Acc:P10038])

HSP 1 Score: 76.6406 bits (187), Expect = 5.440e-16
Identity = 37/69 (53.62%), Postives = 52/69 (75.36%), Query Frame = 2
Query: 1046 KTRKKRKPYSRYQTMILESEYVGNTYITRQKRWEIACKLHLSERQIKVWFQNRRMKTKK-IKNRGGYNE 1249
            ++++ R+ YSR QT+ LE E+  + Y+TR++R EI+  LHL+ERQ+K+WFQNRRMK KK  K  GG NE
Sbjct:  116 ESKRTRQTYSRSQTLELEKEFHYHKYLTRKRRQEISETLHLTERQVKIWFQNRRMKHKKEAKGEGGSNE 184          
BLAST of Hox class homeodomain protein DjAbd-Ba vs. Ensembl Celegans
Match: nob-1 (KNOB-like posterior (NO Backside) [Source:UniProtKB/TrEMBL;Acc:G5EFY5])

HSP 1 Score: 72.7886 bits (177), Expect = 2.837e-14
Identity = 32/61 (52.46%), Postives = 45/61 (73.77%), Query Frame = 2
Query: 1052 RKKRKPYSRYQTMILESEYVGNTYITRQKRWEIACKLHLSERQIKVWFQNRRMKTKKIKNR 1234
            +KKR+PY + Q   LE EY  N Y+T ++R E++ +L L E+Q+KVWFQNRRMK KK++ R
Sbjct:  163 KKKRQPYKKDQISRLEYEYSVNQYLTNKRRSELSAQLMLDEKQVKVWFQNRRMKDKKLRQR 223          
BLAST of Hox class homeodomain protein DjAbd-Ba vs. Ensembl Celegans
Match: nob-1 (KNOB-like posterior (NO Backside) [Source:UniProtKB/TrEMBL;Acc:G5EFY5])

HSP 1 Score: 68.1662 bits (165), Expect = 4.828e-14
Identity = 32/61 (52.46%), Postives = 45/61 (73.77%), Query Frame = 2
Query: 1052 RKKRKPYSRYQTMILESEYVGNTYITRQKRWEIACKLHLSERQIKVWFQNRRMKTKKIKNR 1234
            +KKR+PY + Q   LE EY  N Y+T ++R E++ +L L E+Q+KVWFQNRRMK KK++ R
Sbjct:   12 KKKRQPYKKDQISRLEYEYSVNQYLTNKRRSELSAQLMLDEKQVKVWFQNRRMKDKKLRQR 72          
BLAST of Hox class homeodomain protein DjAbd-Ba vs. Ensembl Fly
Match: Abd-B (gene:FBgn0000015 transcript:FBtr0346764)

HSP 1 Score: 91.2781 bits (225), Expect = 3.307e-20
Identity = 38/60 (63.33%), Postives = 50/60 (83.33%), Query Frame = 2
Query: 1043 VKTRKKRKPYSRYQTMILESEYVGNTYITRQKRWEIACKLHLSERQIKVWFQNRRMKTKK 1222
            V  RKKRKPYS++QT+ LE E++ N Y+++QKRWE+A  L L+ERQ+K+WFQNRRMK KK
Sbjct:  162 VSVRKKRKPYSKFQTLELEKEFLFNAYVSKQKRWELARNLQLTERQVKIWFQNRRMKNKK 221          
BLAST of Hox class homeodomain protein DjAbd-Ba vs. Ensembl Fly
Match: Abd-B (gene:FBgn0000015 transcript:FBtr0330709)

HSP 1 Score: 92.0485 bits (227), Expect = 3.380e-20
Identity = 38/60 (63.33%), Postives = 50/60 (83.33%), Query Frame = 2
Query: 1043 VKTRKKRKPYSRYQTMILESEYVGNTYITRQKRWEIACKLHLSERQIKVWFQNRRMKTKK 1222
            V  RKKRKPYS++QT+ LE E++ N Y+++QKRWE+A  L L+ERQ+K+WFQNRRMK KK
Sbjct:  162 VSVRKKRKPYSKFQTLELEKEFLFNAYVSKQKRWELARNLQLTERQVKIWFQNRRMKNKK 221          
BLAST of Hox class homeodomain protein DjAbd-Ba vs. Ensembl Fly
Match: Abd-B (gene:FBgn0000015 transcript:FBtr0083381)

HSP 1 Score: 90.8929 bits (224), Expect = 3.776e-20
Identity = 38/60 (63.33%), Postives = 50/60 (83.33%), Query Frame = 2
Query: 1043 VKTRKKRKPYSRYQTMILESEYVGNTYITRQKRWEIACKLHLSERQIKVWFQNRRMKTKK 1222
            V  RKKRKPYS++QT+ LE E++ N Y+++QKRWE+A  L L+ERQ+K+WFQNRRMK KK
Sbjct:  162 VSVRKKRKPYSKFQTLELEKEFLFNAYVSKQKRWELARNLQLTERQVKIWFQNRRMKNKK 221          
BLAST of Hox class homeodomain protein DjAbd-Ba vs. Ensembl Fly
Match: Abd-B (gene:FBgn0000015 transcript:FBtr0083382)

HSP 1 Score: 90.8929 bits (224), Expect = 3.776e-20
Identity = 38/60 (63.33%), Postives = 50/60 (83.33%), Query Frame = 2
Query: 1043 VKTRKKRKPYSRYQTMILESEYVGNTYITRQKRWEIACKLHLSERQIKVWFQNRRMKTKK 1222
            V  RKKRKPYS++QT+ LE E++ N Y+++QKRWE+A  L L+ERQ+K+WFQNRRMK KK
Sbjct:  162 VSVRKKRKPYSKFQTLELEKEFLFNAYVSKQKRWELARNLQLTERQVKIWFQNRRMKNKK 221          
BLAST of Hox class homeodomain protein DjAbd-Ba vs. Ensembl Fly
Match: Abd-B (gene:FBgn0000015 transcript:FBtr0415465)

HSP 1 Score: 90.8929 bits (224), Expect = 3.776e-20
Identity = 38/60 (63.33%), Postives = 50/60 (83.33%), Query Frame = 2
Query: 1043 VKTRKKRKPYSRYQTMILESEYVGNTYITRQKRWEIACKLHLSERQIKVWFQNRRMKTKK 1222
            V  RKKRKPYS++QT+ LE E++ N Y+++QKRWE+A  L L+ERQ+K+WFQNRRMK KK
Sbjct:  162 VSVRKKRKPYSKFQTLELEKEFLFNAYVSKQKRWELARNLQLTERQVKIWFQNRRMKNKK 221          
BLAST of Hox class homeodomain protein DjAbd-Ba vs. Ensembl Zebrafish
Match: hoxd9a (homeobox D9a [Source:NCBI gene;Acc:30350])

HSP 1 Score: 84.7297 bits (208), Expect = 5.879e-18
Identity = 36/59 (61.02%), Postives = 50/59 (84.75%), Query Frame = 2
Query: 1049 TRKKRKPYSRYQTMILESEYVGNTYITRQKRWEIACKLHLSERQIKVWFQNRRMKTKKI 1225
            TRKKR PY++YQT+ LE E++ N Y+TR +R+E+A  L+L+ERQ+K+WFQNRRMK KK+
Sbjct:  195 TRKKRCPYTKYQTLELEKEFLYNMYLTRDRRYEVARILNLTERQVKIWFQNRRMKMKKM 253          
BLAST of Hox class homeodomain protein DjAbd-Ba vs. Ensembl Zebrafish
Match: hoxa9a (homeobox A9a [Source:NCBI gene;Acc:58047])

HSP 1 Score: 82.8037 bits (203), Expect = 2.098e-17
Identity = 35/59 (59.32%), Postives = 49/59 (83.05%), Query Frame = 2
Query: 1049 TRKKRKPYSRYQTMILESEYVGNTYITRQKRWEIACKLHLSERQIKVWFQNRRMKTKKI 1225
            TRKKR PY+++Q + LE E++ NTY+TR +R+E+A  L+L+ERQ+K+WFQNRRMK KK 
Sbjct:  184 TRKKRCPYTKHQILELEKEFLFNTYLTRDRRYEVARLLNLTERQVKIWFQNRRMKMKKF 242          
BLAST of Hox class homeodomain protein DjAbd-Ba vs. Ensembl Zebrafish
Match: hoxa9a (homeobox A9a [Source:NCBI gene;Acc:58047])

HSP 1 Score: 82.8037 bits (203), Expect = 2.098e-17
Identity = 35/59 (59.32%), Postives = 49/59 (83.05%), Query Frame = 2
Query: 1049 TRKKRKPYSRYQTMILESEYVGNTYITRQKRWEIACKLHLSERQIKVWFQNRRMKTKKI 1225
            TRKKR PY+++Q + LE E++ NTY+TR +R+E+A  L+L+ERQ+K+WFQNRRMK KK 
Sbjct:  184 TRKKRCPYTKHQILELEKEFLFNTYLTRDRRYEVARLLNLTERQVKIWFQNRRMKMKKF 242          
BLAST of Hox class homeodomain protein DjAbd-Ba vs. Ensembl Zebrafish
Match: hoxb9a (homeobox B9a [Source:NCBI gene;Acc:30344])

HSP 1 Score: 81.6481 bits (200), Expect = 4.952e-17
Identity = 35/59 (59.32%), Postives = 49/59 (83.05%), Query Frame = 2
Query: 1049 TRKKRKPYSRYQTMILESEYVGNTYITRQKRWEIACKLHLSERQIKVWFQNRRMKTKKI 1225
            +RKKR PY++YQT+ LE E++ N Y+TR +R E+A  L+L+ERQ+K+WFQNRRMK KK+
Sbjct:  184 SRKKRCPYTKYQTLELEKEFLFNMYLTRDRRHEVARLLNLTERQVKIWFQNRRMKMKKM 242          
BLAST of Hox class homeodomain protein DjAbd-Ba vs. Ensembl Zebrafish
Match: hoxd11a (homeobox D11a [Source:NCBI gene;Acc:30405])

HSP 1 Score: 81.6481 bits (200), Expect = 6.741e-17
Identity = 37/77 (48.05%), Postives = 54/77 (70.13%), Query Frame = 2
Query:  995 STVKSITKSENKSSETVKTRKKRKPYSRYQTMILESEYVGNTYITRQKRWEIACKLHLSERQIKVWFQNRRMKTKKI 1225
            S+V +  + +N  S   K+RKKR PYS+YQ   LE E+  N YI ++KR +++  L L++RQ+K+WFQNRRMK KK+
Sbjct:  186 SSVSTCDEEKNSGSSATKSRKKRCPYSKYQIRELEREFFFNVYINKEKRLQLSRMLSLTDRQVKIWFQNRRMKEKKL 262          
BLAST of Hox class homeodomain protein DjAbd-Ba vs. Ensembl Xenopus
Match: ENSXETT00000012547.1 (pep primary_assembly:Xenopus_tropicalis_v9.1:6:32894477:32894749:1 gene:ENSXETG00000005170.1 transcript:ENSXETT00000012547.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 81.6481 bits (200), Expect = 1.470e-18
Identity = 36/69 (52.17%), Postives = 53/69 (76.81%), Query Frame = 2
Query: 1052 RKKRKPYSRYQTMILESEYVGNTYITRQKRWEIACKLHLSERQIKVWFQNRRMKTKKIKNRGGYNEITS 1258
            RKKR PY+++QT+ LE E++ N Y+TR++R EI+  +HLS+RQ+K+WFQNRRMK KK+       E+T+
Sbjct:   17 RKKRCPYTKHQTLELEKEFLFNMYLTRERRLEISRSVHLSDRQVKIWFQNRRMKLKKMNRENRIRELTA 85          
BLAST of Hox class homeodomain protein DjAbd-Ba vs. Ensembl Xenopus
Match: ENSXETT00000012532.1 (pep primary_assembly:Xenopus_tropicalis_v9.1:6:32900780:32902234:1 gene:ENSXETG00000005181.1 transcript:ENSXETT00000012532.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 84.7297 bits (208), Expect = 7.490e-18
Identity = 36/59 (61.02%), Postives = 50/59 (84.75%), Query Frame = 2
Query: 1049 TRKKRKPYSRYQTMILESEYVGNTYITRQKRWEIACKLHLSERQIKVWFQNRRMKTKKI 1225
            TRKKR PY+++QT+ LE E++ N Y+TR +R+E+A  L+L+ERQ+K+WFQNRRMK KKI
Sbjct:  195 TRKKRCPYTKHQTLELEKEFLFNMYLTRDRRYEVARLLNLTERQVKIWFQNRRMKMKKI 253          
BLAST of Hox class homeodomain protein DjAbd-Ba vs. Ensembl Xenopus
Match: ache (acetylcholinesterase (Cartwright blood group) [Source:Xenbase;Acc:XB-GENE-923160])

HSP 1 Score: 83.5741 bits (205), Expect = 1.604e-17
Identity = 36/59 (61.02%), Postives = 49/59 (83.05%), Query Frame = 2
Query: 1049 TRKKRKPYSRYQTMILESEYVGNTYITRQKRWEIACKLHLSERQIKVWFQNRRMKTKKI 1225
            +RKKR PY++YQT+ LE E++ N Y+TR +R E+A  L+LSERQ+K+WFQNRRMK KK+
Sbjct:  181 SRKKRCPYTKYQTLELEKEFLFNMYLTRDRRHEVARLLNLSERQVKIWFQNRRMKMKKL 239          
BLAST of Hox class homeodomain protein DjAbd-Ba vs. Ensembl Xenopus
Match: tollip (toll interacting protein [Source:Xenbase;Acc:XB-GENE-946207])

HSP 1 Score: 82.0333 bits (201), Expect = 1.882e-16
Identity = 41/89 (46.07%), Postives = 62/89 (69.66%), Query Frame = 2
Query: 1001 VKSITKSENKSSE--TVKT-RKKRKPYSRYQTMILESEYVGNTYITRQKRWEIACKLHLSERQIKVWFQNRRMKTKKIKNRGGYNEITS 1258
             K   K+EN +    T K+ RKKR PY+++QT+ LE E++ N Y+TR++R EI+  ++L++RQ+K+WFQNRRMK KK+       E+TS
Sbjct:  258 AKEDIKAENAAGNWLTAKSGRKKRCPYTKHQTLELEKEFLFNMYLTRERRLEISKSINLTDRQVKIWFQNRRMKLKKMNRENRIRELTS 346          
BLAST of Hox class homeodomain protein DjAbd-Ba vs. Ensembl Xenopus
Match: HOXD10 (homeobox D10 [Source:NCBI gene;Acc:100038085])

HSP 1 Score: 81.2629 bits (199), Expect = 2.966e-16
Identity = 34/69 (49.28%), Postives = 53/69 (76.81%), Query Frame = 2
Query: 1052 RKKRKPYSRYQTMILESEYVGNTYITRQKRWEIACKLHLSERQIKVWFQNRRMKTKKIKNRGGYNEITS 1258
            RKKR PY+++QT+ LE E++ N Y+TR++R EI+  ++L++RQ+K+WFQNRRMK KK+       E+T+
Sbjct:  265 RKKRCPYTKHQTLELEKEFLFNMYLTRERRLEISKSVNLTDRQVKIWFQNRRMKLKKMSRENRIRELTA 333          
BLAST of Hox class homeodomain protein DjAbd-Ba vs. Ensembl Mouse
Match: Hoxa10 (homeobox A10 [Source:MGI Symbol;Acc:MGI:96171])

HSP 1 Score: 80.4925 bits (197), Expect = 3.188e-18
Identity = 38/80 (47.50%), Postives = 57/80 (71.25%), Query Frame = 2
Query: 1052 RKKRKPYSRYQTMILESEYVGNTYITRQKRWEIACKLHLSERQIKVWFQNRRMKTKKIKNRGGYNEITSTGQEYEDINFS 1291
            RKKR PY+++QT+ LE E++ N Y+TR++R EI+  +HL++RQ+K+WFQNRRMK KK+       E+T+      + NFS
Sbjct:   21 RKKRCPYTKHQTLELEKEFLFNMYLTRERRLEISRSVHLTDRQVKIWFQNRRMKLKKMNRENRIRELTA------NFNFS 94          
BLAST of Hox class homeodomain protein DjAbd-Ba vs. Ensembl Mouse
Match: Hoxa9 (homeobox A9 [Source:MGI Symbol;Acc:MGI:96180])

HSP 1 Score: 84.3445 bits (207), Expect = 7.633e-18
Identity = 36/59 (61.02%), Postives = 50/59 (84.75%), Query Frame = 2
Query: 1049 TRKKRKPYSRYQTMILESEYVGNTYITRQKRWEIACKLHLSERQIKVWFQNRRMKTKKI 1225
            TRKKR PY+++QT+ LE E++ N Y+TR +R+E+A  L+L+ERQ+K+WFQNRRMK KKI
Sbjct:  205 TRKKRCPYTKHQTLELEKEFLFNMYLTRDRRYEVARLLNLTERQVKIWFQNRRMKMKKI 263          
BLAST of Hox class homeodomain protein DjAbd-Ba vs. Ensembl Mouse
Match: Hoxb9 (homeobox B9 [Source:MGI Symbol;Acc:MGI:96190])

HSP 1 Score: 83.5741 bits (205), Expect = 1.196e-17
Identity = 37/64 (57.81%), Postives = 50/64 (78.12%), Query Frame = 2
Query: 1049 TRKKRKPYSRYQTMILESEYVGNTYITRQKRWEIACKLHLSERQIKVWFQNRRMKTKKIKNRGG 1240
            +RKKR PY++YQT+ LE E++ N Y+TR +R E+A  L+LSERQ+K+WFQNRRMK KK+    G
Sbjct:  185 SRKKRCPYTKYQTLELEKEFLFNMYLTRDRRHEVARLLNLSERQVKIWFQNRRMKMKKMNKEQG 248          
BLAST of Hox class homeodomain protein DjAbd-Ba vs. Ensembl Mouse
Match: Hoxa10 (homeobox A10 [Source:MGI Symbol;Acc:MGI:96171])

HSP 1 Score: 84.7297 bits (208), Expect = 2.752e-17
Identity = 40/84 (47.62%), Postives = 62/84 (73.81%), Query Frame = 2
Query: 1013 TKSENKSS-ETVKT-RKKRKPYSRYQTMILESEYVGNTYITRQKRWEIACKLHLSERQIKVWFQNRRMKTKKIKNRGGYNEITS 1258
            +K EN ++  T K+ RKKR PY+++QT+ LE E++ N Y+TR++R EI+  +HL++RQ+K+WFQNRRMK KK+       E+T+
Sbjct:  328 SKGENAANWLTAKSGRKKRCPYTKHQTLELEKEFLFNMYLTRERRLEISRSVHLTDRQVKIWFQNRRMKLKKMNRENRIRELTA 411          
BLAST of Hox class homeodomain protein DjAbd-Ba vs. Ensembl Mouse
Match: Hoxc12 (homeobox C12 [Source:MGI Symbol;Acc:MGI:96194])

HSP 1 Score: 80.1073 bits (196), Expect = 2.552e-16
Identity = 33/60 (55.00%), Postives = 50/60 (83.33%), Query Frame = 2
Query: 1046 KTRKKRKPYSRYQTMILESEYVGNTYITRQKRWEIACKLHLSERQIKVWFQNRRMKTKKI 1225
            ++RKKRKPYS+ Q   LE E++ N +ITRQ+R E++ +L+LS++Q+K+WFQNRRMK K++
Sbjct:  211 RSRKKRKPYSKLQLAELEGEFLVNEFITRQRRRELSDRLNLSDQQVKIWFQNRRMKKKRL 270          
BLAST of Hox class homeodomain protein DjAbd-Ba vs. UniProt/SwissProt
Match: sp|P09087|ABDB_DROME (Homeobox protein abdominal-B OS=Drosophila melanogaster OX=7227 GN=Abd-B PE=1 SV=3)

HSP 1 Score: 92.4337 bits (228), Expect = 9.302e-19
Identity = 38/60 (63.33%), Postives = 50/60 (83.33%), Query Frame = 2
Query: 1043 VKTRKKRKPYSRYQTMILESEYVGNTYITRQKRWEIACKLHLSERQIKVWFQNRRMKTKK 1222
            V  RKKRKPYS++QT+ LE E++ N Y+++QKRWE+A  L L+ERQ+K+WFQNRRMK KK
Sbjct:  385 VSVRKKRKPYSKFQTLELEKEFLFNAYVSKQKRWELARNLQLTERQVKIWFQNRRMKNKK 444          
BLAST of Hox class homeodomain protein DjAbd-Ba vs. UniProt/SwissProt
Match: sp|Q9PWD6|HXA10_MORSA (Homeobox protein Hox-A10 OS=Morone saxatilis OX=34816 GN=hoxa10 PE=3 SV=1)

HSP 1 Score: 87.4261 bits (215), Expect = 7.744e-18
Identity = 44/89 (49.44%), Postives = 65/89 (73.03%), Query Frame = 2
Query:  998 TVKSITKSENKSS-ETVKT-RKKRKPYSRYQTMILESEYVGNTYITRQKRWEIACKLHLSERQIKVWFQNRRMKTKKIKNRGGYNEITS 1258
            + K  TKSEN ++  T K+ RKKR PY+++QT+ LE E++ N Y+TR++R EI+  +HL++RQ+K+WFQNRRMK KK+       E+TS
Sbjct:  196 STKGDTKSENTANWLTAKSGRKKRCPYTKHQTLELEKEFLFNMYLTRERRLEISKSVHLTDRQVKIWFQNRRMKLKKMTRENRIRELTS 284          
BLAST of Hox class homeodomain protein DjAbd-Ba vs. UniProt/SwissProt
Match: sp|P24340|HXD9_CHICK (Homeobox protein Hox-D9 (Fragment) OS=Gallus gallus OX=9031 GN=HOXD9 PE=2 SV=1)

HSP 1 Score: 80.4925 bits (197), Expect = 8.996e-18
Identity = 36/59 (61.02%), Postives = 50/59 (84.75%), Query Frame = 2
Query: 1049 TRKKRKPYSRYQTMILESEYVGNTYITRQKRWEIACKLHLSERQIKVWFQNRRMKTKKI 1225
            TRKKR PY++YQT+ LE E++ N Y+TR +R+E+A  L+L+ERQ+K+WFQNRRMK KK+
Sbjct:    1 TRKKRCPYTKYQTLELEKEFLFNMYLTRDRRYEVARILNLTERQVKIWFQNRRMKMKKM 59          
BLAST of Hox class homeodomain protein DjAbd-Ba vs. UniProt/SwissProt
Match: sp|P50209|HXA9_AMBME (Homeobox protein Hox-A9 (Fragment) OS=Ambystoma mexicanum OX=8296 GN=HOXA9 PE=2 SV=1)

HSP 1 Score: 83.1889 bits (204), Expect = 9.830e-18
Identity = 36/59 (61.02%), Postives = 50/59 (84.75%), Query Frame = 2
Query: 1049 TRKKRKPYSRYQTMILESEYVGNTYITRQKRWEIACKLHLSERQIKVWFQNRRMKTKKI 1225
            TRKKR PY+++QT+ LE E++ N Y+TR +R+E+A  L+L+ERQ+K+WFQNRRMK KKI
Sbjct:   78 TRKKRCPYTKHQTLELEKEFLFNMYLTRDRRYEVARLLNLTERQVKIWFQNRRMKMKKI 136          
BLAST of Hox class homeodomain protein DjAbd-Ba vs. UniProt/SwissProt
Match: sp|Q9PVR2|HXD9_ORYLA (Homeobox protein Hox-D9 OS=Oryzias latipes OX=8090 GN=hoxd9 PE=2 SV=1)

HSP 1 Score: 86.2705 bits (212), Expect = 1.466e-17
Identity = 38/69 (55.07%), Postives = 56/69 (81.16%), Query Frame = 2
Query: 1049 TRKKRKPYSRYQTMILESEYVGNTYITRQKRWEIACKLHLSERQIKVWFQNRRMKTKKI-KNRGGYNEI 1252
            TRKKR PY++YQT+ LE E++ N Y+TR +R+E+A  L L+ERQ+K+WFQNRRMK KK+ + +GG +++
Sbjct:  203 TRKKRCPYTKYQTLELEKEFLYNMYLTRDRRFEVARILSLTERQVKIWFQNRRMKMKKMNREKGGKDQL 271          
BLAST of Hox class homeodomain protein DjAbd-Ba vs. TrEMBL
Match: Q9BLF9 (Hox class homeodomain protein DjAbd-Ba OS=Dugesia japonica OX=6161 GN=DjAbd-Ba PE=2 SV=1)

HSP 1 Score: 492.656 bits (1267), Expect = 5.824e-171
Identity = 271/317 (85.49%), Postives = 290/317 (91.48%), Query Frame = 2
Query:  455 MNEDYHAFSAYTXXXXXXXXXXXXXXXXXXXXECLSRNKSNPFPQCIMGSNFQQSAVINDLNFYNNWYATHAMNSNFADSAFSKSDIKSHIESTPYDQFSTTKSPSLVSSFINKPTPNAHDQLLWSIYNSETDTIFXXXXXXXXXXXXILNNIEMYRLPXXXXXXXXXXXXXXXGNSNICSTVKSITKSENKSSETVKTRKKRKPYSRYQTMILESEYVGNTYITRQKRWEIACKLHLSERQIKVWFQNRRMKTKKIKNRGGYNEITSTGQEYEDINFSSKYDDLEDMEPSNKTYEGIMSYDNPEILINKLNMFKSC 1405
            MNEDYHA SAYTSYHYPNYY HN+  +     +CLSRNKSN FP CIMGSNFQQS VINDLNFYNNWYA HAM+S+F+DSAF KSDIKSHI+ST YDQF+  KSPSLVSSFINKPTPNAHDQLLWSIYNSE DTIFNNRNNYSPYSSNILNNIEMYRLPQT T++ A +     GNSNICST KSITKSENKSSETVKTRKKRKPYSRYQTMILESEYVGNTYITRQKRWEIACKLHLSERQIKVWFQNRRMKTKKIKNRGGYNEITSTGQEYEDINF+SKYDDLE+++PSNK+YEGIMSY+NPEI++NKLNMFKSC
Sbjct:    1 MNEDYHALSAYTSYHYPNYYPHNSIPSY----DCLSRNKSNSFPHCIMGSNFQQSTVINDLNFYNNWYANHAMSSSFSDSAFGKSDIKSHIDSTTYDQFTNNKSPSLVSSFINKPTPNAHDQLLWSIYNSEADTIFNNRNNYSPYSSNILNNIEMYRLPQTATSTAANSQSDS-GNSNICSTTKSITKSENKSSETVKTRKKRKPYSRYQTMILESEYVGNTYITRQKRWEIACKLHLSERQIKVWFQNRRMKTKKIKNRGGYNEITSTGQEYEDINFNSKYDDLEELDPSNKSYEGIMSYENPEIIMNKLNMFKSC 312          
BLAST of Hox class homeodomain protein DjAbd-Ba vs. TrEMBL
Match: B1NTA4 (AbdBa Hox protein (Fragment) OS=Schmidtea mediterranea OX=79327 GN=abdba PE=2 SV=1)

HSP 1 Score: 259.61 bits (662), Expect = 2.842e-81
Identity = 180/180 (100.00%), Postives = 180/180 (100.00%), Query Frame = 2
Query:  476 FSAYTXXXXXXXXXXXXXXXXXXXXECLSRNKSNPFPQCIMGSNFQQSAVINDLNFYNNWYATHAMNSNFADSAFSKSDIKSHIESTPYDQFSTTKSPSLVSSFINKPTPNAHDQLLWSIYNSETDTIFXXXXXXXXXXXXILNNIEMYRLPXXXXXXXXXXXXXXXGNSNICSTVKSIT 1015
            FSAYTSYHYPNYYHHNNPHNSNPSYECLSRNKSNPFPQCIMGSNFQQSAVINDLNFYNNWYATHAMNSNFADSAFSKSDIKSHIESTPYDQFSTTKSPSLVSSFINKPTPNAHDQLLWSIYNSETDTIFNNRNNYSPYSSNILNNIEMYRLPQTTTTSTAANSQSDSGNSNICSTVKSIT
Sbjct:    7 FSAYTSYHYPNYYHHNNPHNSNPSYECLSRNKSNPFPQCIMGSNFQQSAVINDLNFYNNWYATHAMNSNFADSAFSKSDIKSHIESTPYDQFSTTKSPSLVSSFINKPTPNAHDQLLWSIYNSETDTIFNNRNNYSPYSSNILNNIEMYRLPQTTTTSTAANSQSDSGNSNICSTVKSIT 186          
BLAST of Hox class homeodomain protein DjAbd-Ba vs. TrEMBL
Match: T1EF40 (Homeobox domain-containing protein OS=Helobdella robusta OX=6412 GN=20195192 PE=4 SV=1)

HSP 1 Score: 119.783 bits (299), Expect = 8.492e-29
Identity = 55/88 (62.50%), Postives = 70/88 (79.55%), Query Frame = 2
Query: 1031 SSETVKTRKKRKPYSRYQTMILESEYVGNTYITRQKRWEIACKLHLSERQIKVWFQNRRMKTKKIKNRGGYNEITSTGQEYEDINFSS 1294
            ++E  + RKKRKPY+RYQTM+LE+E+V N+YITRQKRWEI+CKLHLSERQ+KVWFQNRRMK KK+ +R      T+  +E +D   SS
Sbjct:   14 AAEQARQRKKRKPYTRYQTMVLENEFVSNSYITRQKRWEISCKLHLSERQVKVWFQNRRMKRKKLNDRA-----TTMTKEPKDTPHSS 96          
BLAST of Hox class homeodomain protein DjAbd-Ba vs. TrEMBL
Match: A0A0F6QL13 (MaPost2 Hox protein OS=Maculaura alaskensis OX=187798 GN=Post2 PE=2 SV=1)

HSP 1 Score: 122.094 bits (305), Expect = 5.004e-28
Identity = 63/117 (53.85%), Postives = 81/117 (69.23%), Query Frame = 2
Query:  983 SNICSTVKSITK--------SENKSSETVKTRKKRKPYSRYQTMILESEYVGNTYITRQKRWEIACKLHLSERQIKVWFQNRRMKTKKIKNR-----------GGYNEITSTGQEYE 1276
            S++ +TV SI +        SEN S    +TRKKRKPY+RYQTM+LE+E++ N+YITRQKRWEI+CKLHL+ERQ+KVWFQNRRMK KK+ +R           G  N +T T  +YE
Sbjct:  129 SDLNTTVPSIPRLSHEEVNISENNSCTEPRTRKKRKPYTRYQTMVLENEFMTNSYITRQKRWEISCKLHLTERQVKVWFQNRRMKRKKLNSRAKVKSEVENTNGMQNNLTPTNVKYE 245          
BLAST of Hox class homeodomain protein DjAbd-Ba vs. TrEMBL
Match: Q9U9T2 (Post2 homeobox protein (Fragment) OS=Alitta virens OX=880429 GN=Post2 PE=4 SV=2)

HSP 1 Score: 115.161 bits (287), Expect = 3.180e-27
Identity = 49/64 (76.56%), Postives = 59/64 (92.19%), Query Frame = 2
Query: 1046 KTRKKRKPYSRYQTMILESEYVGNTYITRQKRWEIACKLHLSERQIKVWFQNRRMKTKKIKNRG 1237
            + RKKRKPY+RYQTM+LE+E++GN+YITRQKRWEI+CKLHLSERQ+KVWFQNRRMK KK+  R 
Sbjct:    5 RQRKKRKPYTRYQTMVLENEFMGNSYITRQKRWEISCKLHLSERQVKVWFQNRRMKRKKLNERA 68          
BLAST of Hox class homeodomain protein DjAbd-Ba vs. Ensembl Cavefish
Match: ENSAMXT00000005320.2 (homeobox protein Hox-A9a-like [Source:NCBI gene;Acc:103022020])

HSP 1 Score: 85.5001 bits (210), Expect = 2.055e-18
Identity = 37/67 (55.22%), Postives = 53/67 (79.10%), Query Frame = 2
Query: 1049 TRKKRKPYSRYQTMILESEYVGNTYITRQKRWEIACKLHLSERQIKVWFQNRRMKTKKIKNRGGYNE 1249
            TRKKR PY+++Q + LE E++ NTY+TR +R+E+A  L+L+ERQ+K+WFQNRRMK KK+   G  +E
Sbjct:  191 TRKKRCPYTKHQILELEKEFLFNTYLTRDRRYEVARLLNLTERQVKIWFQNRRMKMKKLNKDGTKDE 257          
BLAST of Hox class homeodomain protein DjAbd-Ba vs. Ensembl Cavefish
Match: hoxd9a (homeobox protein Hox-D9a [Source:NCBI gene;Acc:103033248])

HSP 1 Score: 85.5001 bits (210), Expect = 2.781e-18
Identity = 38/64 (59.38%), Postives = 53/64 (82.81%), Query Frame = 2
Query: 1049 TRKKRKPYSRYQTMILESEYVGNTYITRQKRWEIACKLHLSERQIKVWFQNRRMKTKKI-KNRG 1237
            TRKKR PY++YQT+ LE E++ N Y+TR +R+E+A  L+L+ERQ+K+WFQNRRMK KK+ + RG
Sbjct:  195 TRKKRCPYTKYQTLELEKEFLYNMYLTRDRRYEVARILNLTERQVKIWFQNRRMKMKKMNRERG 258          
BLAST of Hox class homeodomain protein DjAbd-Ba vs. Ensembl Cavefish
Match: hoxd9a (homeobox protein Hox-D9a [Source:NCBI gene;Acc:103033248])

HSP 1 Score: 85.5001 bits (210), Expect = 2.781e-18
Identity = 38/64 (59.38%), Postives = 53/64 (82.81%), Query Frame = 2
Query: 1049 TRKKRKPYSRYQTMILESEYVGNTYITRQKRWEIACKLHLSERQIKVWFQNRRMKTKKI-KNRG 1237
            TRKKR PY++YQT+ LE E++ N Y+TR +R+E+A  L+L+ERQ+K+WFQNRRMK KK+ + RG
Sbjct:  195 TRKKRCPYTKYQTLELEKEFLYNMYLTRDRRYEVARILNLTERQVKIWFQNRRMKMKKMNRERG 258          
BLAST of Hox class homeodomain protein DjAbd-Ba vs. Ensembl Cavefish
Match: ENSAMXT00000043089.1 (pep primary_assembly:Astyanax_mexicanus-2.0:APWO02000050.1:1458192:1460142:1 gene:ENSAMXG00000035583.1 transcript:ENSAMXT00000043089.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 83.9593 bits (206), Expect = 2.224e-17
Identity = 35/70 (50.00%), Postives = 53/70 (75.71%), Query Frame = 2
Query: 1052 RKKRKPYSRYQTMILESEYVGNTYITRQKRWEIACKLHLSERQIKVWFQNRRMKTKKIKNRGGYNEITST 1261
            RKKR PY++YQT+ LE E++ N Y+TR++R EI+  +HL++RQ+K+WFQNRRMK KK+       +++ T
Sbjct:  262 RKKRCPYTKYQTLELEKEFLFNMYLTRERRLEISRSVHLTDRQVKIWFQNRRMKLKKMSRESRIRDLSHT 331          
BLAST of Hox class homeodomain protein DjAbd-Ba vs. Ensembl Cavefish
Match: hoxb9a (homeobox B9 [Source:NCBI gene;Acc:103044445])

HSP 1 Score: 81.6481 bits (200), Expect = 3.709e-17
Identity = 35/59 (59.32%), Postives = 49/59 (83.05%), Query Frame = 2
Query: 1049 TRKKRKPYSRYQTMILESEYVGNTYITRQKRWEIACKLHLSERQIKVWFQNRRMKTKKI 1225
            +RKKR PY++YQT+ LE E++ N Y+TR +R E+A  L+L+ERQ+K+WFQNRRMK KK+
Sbjct:  184 SRKKRCPYTKYQTLELEKEFLFNMYLTRDRRHEVARLLNLTERQVKIWFQNRRMKMKKM 242          
BLAST of Hox class homeodomain protein DjAbd-Ba vs. Ensembl Sea Lamprey
Match: ENSPMAT00000011242.1 (pep scaffold:Pmarinus_7.0:GL476758:607601:607780:-1 gene:ENSPMAG00000010215.1 transcript:ENSPMAT00000011242.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 77.411 bits (189), Expect = 2.701e-18
Identity = 36/59 (61.02%), Postives = 49/59 (83.05%), Query Frame = 2
Query: 1052 RKKRKPYSRYQTMILESEYVGNTYITRQKRWEIACKLHLSERQIKVWFQNRRMKTKKIK 1228
            RKKR PYS+ QT+ LE E++ N Y+TR +R+E+A  L+L+ERQ+K+WFQNRRMK KK+K
Sbjct:    2 RKKRCPYSKQQTLELEKEFLFNMYLTRDRRYEVARGLNLTERQVKIWFQNRRMKLKKMK 60          
BLAST of Hox class homeodomain protein DjAbd-Ba vs. Ensembl Sea Lamprey
Match: ENSPMAT00000011060.1 (pep scaffold:Pmarinus_7.0:GL482503:5543:5722:1 gene:ENSPMAG00000010033.1 transcript:ENSPMAT00000011060.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 77.411 bits (189), Expect = 2.701e-18
Identity = 36/59 (61.02%), Postives = 49/59 (83.05%), Query Frame = 2
Query: 1052 RKKRKPYSRYQTMILESEYVGNTYITRQKRWEIACKLHLSERQIKVWFQNRRMKTKKIK 1228
            RKKR PYS+ QT+ LE E++ N Y+TR +R+E+A  L+L+ERQ+K+WFQNRRMK KK+K
Sbjct:    2 RKKRCPYSKQQTLELEKEFLFNMYLTRDRRYEVARGLNLTERQVKIWFQNRRMKLKKMK 60          
BLAST of Hox class homeodomain protein DjAbd-Ba vs. Ensembl Sea Lamprey
Match: ENSPMAT00000011221.1 (pep scaffold:Pmarinus_7.0:GL477881:55654:55833:1 gene:ENSPMAG00000010194.1 transcript:ENSPMAT00000011221.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 75.485 bits (184), Expect = 1.174e-17
Identity = 33/58 (56.90%), Postives = 49/58 (84.48%), Query Frame = 2
Query: 1052 RKKRKPYSRYQTMILESEYVGNTYITRQKRWEIACKLHLSERQIKVWFQNRRMKTKKI 1225
            RKKR PY++YQT+ LE E++ N Y+TR++R EI+  ++L++RQ+K+WFQNRRMK KK+
Sbjct:    2 RKKRCPYTKYQTLELEKEFLFNMYLTRERRLEISRGVNLTDRQVKIWFQNRRMKLKKL 59          
BLAST of Hox class homeodomain protein DjAbd-Ba vs. Ensembl Sea Lamprey
Match: ENSPMAT00000005057.1 (pep scaffold:Pmarinus_7.0:GL483321:9136:13526:-1 gene:ENSPMAG00000004598.1 transcript:ENSPMAT00000005057.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 75.485 bits (184), Expect = 2.840e-17
Identity = 36/64 (56.25%), Postives = 49/64 (76.56%), Query Frame = 2
Query: 1052 RKKRKPYSRYQTMILESEYVGNTYITRQKRWEIACKLHLSERQIKVWFQNRRMKTKKIKNRGGY 1243
            R+ R+ YSRYQT+ LE E++ N Y+TR++R E++  L LSERQ+K+WFQNRRMK KK  NR  +
Sbjct:   28 RRGRQTYSRYQTLELEKEFLFNPYLTRKRRIEVSHVLGLSERQVKIWFQNRRMKWKKENNRDKF 91          
BLAST of Hox class homeodomain protein DjAbd-Ba vs. Ensembl Sea Lamprey
Match: ENSPMAT00000011449.1 (pep scaffold:Pmarinus_7.0:GL493006:3300:3479:1 gene:ENSPMAG00000010422.1 transcript:ENSPMAT00000011449.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 74.3294 bits (181), Expect = 3.216e-17
Identity = 33/59 (55.93%), Postives = 49/59 (83.05%), Query Frame = 2
Query: 1049 TRKKRKPYSRYQTMILESEYVGNTYITRQKRWEIACKLHLSERQIKVWFQNRRMKTKKI 1225
            TRKKR PY+++QT+ LE E++ + Y+TR++R EI+  L L++RQ+K+WFQNRRMK KK+
Sbjct:    1 TRKKRCPYTKHQTLELEKEFLFSMYLTRERRLEISHLLSLTDRQVKIWFQNRRMKLKKM 59          
BLAST of Hox class homeodomain protein DjAbd-Ba vs. Ensembl Yeast
Match: YOX1 (Homeobox transcriptional repressor; binds to Mcm1p and to early cell cycle boxes (ECBs) in the promoters of cell cycle-regulated genes expressed in M/G1 phase; expression is cell cycle-regulated; phosphorylated by Cdc28p; relocalizes from nucleus to cytoplasm upon DNA replication stress; YOX1 has a paralog, YHP1, that arose from the whole genome duplication [Source:SGD;Acc:S000004489])

HSP 1 Score: 48.1358 bits (113), Expect = 1.799e-6
Identity = 23/78 (29.49%), Postives = 44/78 (56.41%), Query Frame = 2
Query:  989 ICSTVKSITKSENKSSETVKTRKKRKPYSRYQTMILESEYVGNTYITRQKRWEIACKLHLSERQIKVWFQNRRMKTKK 1222
            I  + ++  K E K       R+KR+  S  +  IL++E+      +++KR E+A   H++E+ +++WFQN+R   K+
Sbjct:  156 ITHSQETFPKKEPKIDNAPLARRKRRRTSSQELSILQAEFEKCPAPSKEKRIELAESCHMTEKAVQIWFQNKRQAVKR 233          
BLAST of Hox class homeodomain protein DjAbd-Ba vs. Ensembl Nematostella
Match: MOXB (MoxB; Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SR28])

HSP 1 Score: 73.1738 bits (178), Expect = 4.978e-16
Identity = 36/73 (49.32%), Postives = 55/73 (75.34%), Query Frame = 2
Query: 1019 SENKSSETV-KTRKKRKPYSRYQTMILESEYVGNTYITRQKRWEIACKLHLSERQIKVWFQNRRMKTKKIKNR 1234
            S+ KS++ + K RK+R  ++++Q   LE+E+  N Y+TR +R+EIA  L L+ERQ+KVWFQNRRMK K++K +
Sbjct:    5 SDPKSAKNLGKKRKERTAFTKHQIQELENEFQRNNYLTRLRRYEIAVSLDLTERQVKVWFQNRRMKWKRVKGK 77          
BLAST of Hox class homeodomain protein DjAbd-Ba vs. Ensembl Nematostella
Match: MOXC (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SR27])

HSP 1 Score: 70.4774 bits (171), Expect = 2.902e-15
Identity = 37/73 (50.68%), Postives = 47/73 (64.38%), Query Frame = 2
Query: 1022 ENKSSETVKTRKKRKPYSRYQTMILESEYVGNTYITRQKRWEIACKLHLSERQIKVWFQNRRMKTKKIKNRGG 1240
            E       + RK+R  +S+YQ   LE E+  N Y+TR +R+EIA  L L ERQ+KVWFQNRRMK K  + RGG
Sbjct:    5 ERNEDAKSRKRKERTVFSKYQLTELEREFCRNNYLTRLRRYEIAVSLDLGERQVKVWFQNRRMKWK--RGRGG 75          
BLAST of Hox class homeodomain protein DjAbd-Ba vs. Ensembl Nematostella
Match: MOX1 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SR25])

HSP 1 Score: 64.6994 bits (156), Expect = 2.877e-13
Identity = 29/50 (58.00%), Postives = 39/50 (78.00%), Query Frame = 2
Query: 1079 YQTMILESEYVGNTYITRQKRWEIACKLHLSERQIKVWFQNRRMKTKKIK 1228
            +Q   LE+E+  N Y+TR +R+EIA  L L+ERQ+KVWFQNRRMK K++K
Sbjct:    2 HQLRELENEFTRNNYLTRLRRYEIAVSLDLTERQVKVWFQNRRMKWKRVK 51          
BLAST of Hox class homeodomain protein DjAbd-Ba vs. Ensembl Nematostella
Match: EDO33847 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SR26])

HSP 1 Score: 63.929 bits (154), Expect = 3.334e-13
Identity = 29/50 (58.00%), Postives = 40/50 (80.00%), Query Frame = 2
Query: 1079 YQTMILESEYVGNTYITRQKRWEIACKLHLSERQIKVWFQNRRMKTKKIK 1228
            +Q   LE+E++ N Y+TR +R+EIA  L L+ERQ+KVWFQNRRMK K++K
Sbjct:    1 HQLQELENEFIRNNYLTRLRRYEIAVSLDLTERQVKVWFQNRRMKWKRVK 50          
BLAST of Hox class homeodomain protein DjAbd-Ba vs. Ensembl Nematostella
Match: EDO42196 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S291])

HSP 1 Score: 61.2326 bits (147), Expect = 3.550e-12
Identity = 29/60 (48.33%), Postives = 44/60 (73.33%), Query Frame = 2
Query: 1046 KTRKKRKPYSRYQTMILESEYVGNTYITRQKRWEIACKLHLSERQIKVWFQNRRMKTKKI 1225
            K R++R  ++  QT+ LE E+  N YITR +R+E+A  L+L+E Q+K+WFQNRR K K++
Sbjct:    8 KPRRQRTTFTSEQTLKLELEFHQNEYITRSRRFELAACLNLTETQVKIWFQNRRAKDKRL 67          
BLAST of Hox class homeodomain protein DjAbd-Ba vs. Ensembl Medaka
Match: hoxd9 (homeobox D10 [Source:NCBI gene;Acc:101163860])

HSP 1 Score: 86.2705 bits (212), Expect = 1.391e-18
Identity = 38/69 (55.07%), Postives = 56/69 (81.16%), Query Frame = 2
Query: 1049 TRKKRKPYSRYQTMILESEYVGNTYITRQKRWEIACKLHLSERQIKVWFQNRRMKTKKI-KNRGGYNEI 1252
            TRKKR PY++YQT+ LE E++ N Y+TR +R+E+A  L L+ERQ+K+WFQNRRMK KK+ + +GG +++
Sbjct:  203 TRKKRCPYTKYQTLELEKEFLYNMYLTRDRRFEVARILSLTERQVKIWFQNRRMKMKKMNREKGGKDQL 271          
BLAST of Hox class homeodomain protein DjAbd-Ba vs. Ensembl Medaka
Match: hoxa9 (homeobox A9 [Source:NCBI gene;Acc:100049208])

HSP 1 Score: 84.3445 bits (207), Expect = 6.698e-18
Identity = 36/63 (57.14%), Postives = 50/63 (79.37%), Query Frame = 2
Query: 1049 TRKKRKPYSRYQTMILESEYVGNTYITRQKRWEIACKLHLSERQIKVWFQNRRMKTKKIKNRG 1237
            TRKKR PY+++Q + LE E++ NTY+TR +R+E+A  L+L+ERQ+K+WFQNRRMK KK    G
Sbjct:  196 TRKKRCPYTKHQILELEKEFLFNTYLTRDRRYEVARLLNLTERQVKIWFQNRRMKMKKFNKDG 258          
BLAST of Hox class homeodomain protein DjAbd-Ba vs. Ensembl Medaka
Match: ENSORLT00000006345.2 (homeobox protein Hox-A10 [Source:NCBI gene;Acc:101161418])

HSP 1 Score: 85.5001 bits (210), Expect = 8.923e-18
Identity = 42/88 (47.73%), Postives = 64/88 (72.73%), Query Frame = 2
Query: 1001 VKSITKSENKSS-ETVKT-RKKRKPYSRYQTMILESEYVGNTYITRQKRWEIACKLHLSERQIKVWFQNRRMKTKKIKNRGGYNEITS 1258
            +K   K+EN ++  T K+ RKKR PY+++QT+ LE E++ N Y+TR++R EI+  +HL++RQ+K+WFQNRRMK KK+       E+TS
Sbjct:  287 IKGGAKTENMANWLTAKSGRKKRCPYTKHQTLELEKEFLFNMYLTRERRLEISKSVHLTDRQVKIWFQNRRMKLKKMTRENRIRELTS 374          
BLAST of Hox class homeodomain protein DjAbd-Ba vs. Ensembl Medaka
Match: ENSORLT00000001667.2 (homeobox protein Hox-D9b [Source:NCBI gene;Acc:101175260])

HSP 1 Score: 84.3445 bits (207), Expect = 1.382e-17
Identity = 39/69 (56.52%), Postives = 53/69 (76.81%), Query Frame = 2
Query: 1049 TRKKRKPYSRYQTMILESEYVGNTYITRQKRWEIACKLHLSERQIKVWFQNRRMKTKK--IKNRGGYNE 1249
            TRKKR PY+++QT+ LE E++ N Y+TR +R E+A  L+L+ERQ+K+WFQNRRMK KK  I+ R   NE
Sbjct:  247 TRKKRCPYTKHQTLELEKEFLYNMYLTRDRRLEVAGLLNLTERQVKIWFQNRRMKMKKLMIRERRSMNE 315          
BLAST of Hox class homeodomain protein DjAbd-Ba vs. Ensembl Medaka
Match: hoxb9a (homeobox B9 [Source:NCBI gene;Acc:100049206])

HSP 1 Score: 82.8037 bits (203), Expect = 3.115e-17
Identity = 35/58 (60.34%), Postives = 48/58 (82.76%), Query Frame = 2
Query: 1049 TRKKRKPYSRYQTMILESEYVGNTYITRQKRWEIACKLHLSERQIKVWFQNRRMKTKK 1222
            +RKKR PY++YQT+ LE E++ N Y+TR +R E+A  L+L+ERQ+K+WFQNRRMK KK
Sbjct:  217 SRKKRCPYTKYQTLELEKEFLFNMYLTRDRRHEVARALNLTERQVKIWFQNRRMKMKK 274          
BLAST of Hox class homeodomain protein DjAbd-Ba vs. Planmine SMEST
Match: SMESG000033048.1 (SMESG000033048.1)

HSP 1 Score: 121.709 bits (304), Expect = 3.952e-30
Identity = 53/76 (69.74%), Postives = 66/76 (86.84%), Query Frame = 2
Query: 1007 SITKSENKSSETVKTRKKRKPYSRYQTMILESEYVGNTYITRQKRWEIACKLHLSERQIKVWFQNRRMKTKKIKNR 1234
            S+T++E      +++RKKRKPY+RYQTM+LESE+ GN YITRQKRWEI+CKLHLSERQ+KVWFQNRRMK KK++ R
Sbjct:  318 SLTEAE------MRSRKKRKPYTRYQTMVLESEFTGNAYITRQKRWEISCKLHLSERQVKVWFQNRRMKKKKLQTR 387          
BLAST of Hox class homeodomain protein DjAbd-Ba vs. Planmine SMEST
Match: SMESG000022668.1 (SMESG000022668.1)

HSP 1 Score: 107.457 bits (267), Expect = 2.845e-27
Identity = 51/86 (59.30%), Postives = 64/86 (74.42%), Query Frame = 2
Query:  977 GNSNICSTVKSITKSENKSSETVKTRKKRKPYSRYQTMILESEYVGNTYITRQKRWEIACKLHLSERQIKVWFQNRRMKTKKIKNR 1234
             + N+ S+  +  KS  K  +  K R KR+PYSRYQ M+LESEY+   YI+RQKRW+IACKL+LSERQIK+WFQNRRMK KK K +
Sbjct:   78 ASENLPSSCPNSNKSVEKEEKDQKERTKRRPYSRYQLMVLESEYINTEYISRQKRWDIACKLNLSERQIKIWFQNRRMKHKKNKEK 163          
BLAST of Hox class homeodomain protein DjAbd-Ba vs. Planmine SMEST
Match: SMESG000054107.1 (SMESG000054107.1)

HSP 1 Score: 100.908 bits (250), Expect = 1.595e-23
Identity = 43/55 (78.18%), Postives = 51/55 (92.73%), Query Frame = 2
Query: 1046 KTRKKRKPYSRYQTMILESEYVGNTYITRQKRWEIACKLHLSERQIKVWFQNRRM 1210
            + RKKRKPY+RYQ ++LESE+  N+YITRQKRWEI+CKL+LSERQIKVWFQNRRM
Sbjct:  240 RCRKKRKPYTRYQNLVLESEFNSNSYITRQKRWEISCKLNLSERQIKVWFQNRRM 294          
BLAST of Hox class homeodomain protein DjAbd-Ba vs. Planmine SMEST
Match: SMESG000044469.1 (SMESG000044469.1)

HSP 1 Score: 77.0258 bits (188), Expect = 2.298e-16
Identity = 37/67 (55.22%), Postives = 50/67 (74.63%), Query Frame = 2
Query: 1022 ENKSSETVKTRKKRKPYSRYQTMILESEYVGNTYITRQKRWEIACKLHLSERQIKVWFQNRRMKTKK 1222
            +NKS  + + ++ R+ YSR QT+ LE E+  N Y+TR++R EIA  + LSERQIK+WFQNRRMK KK
Sbjct:   96 KNKSDRSAEYKRSRQAYSRQQTLELEKEFYYNQYLTRRRRIEIANSVCLSERQIKIWFQNRRMKYKK 162          
BLAST of Hox class homeodomain protein DjAbd-Ba vs. Planmine SMEST
Match: SMESG000043155.1 (SMESG000043155.1)

HSP 1 Score: 80.1073 bits (196), Expect = 4.196e-16
Identity = 37/61 (60.66%), Postives = 48/61 (78.69%), Query Frame = 2
Query: 1040 TVKTRKKRKPYSRYQTMILESEYVGNTYITRQKRWEIACKLHLSERQIKVWFQNRRMKTKK 1222
            +V+ R+ R+ YSR+QT+ LE E+  N Y+TR++R EIA  L LSERQIK+WFQNRRMK KK
Sbjct:  248 SVQKRRGRQTYSRHQTLELEKEFQFNHYLTRRRRIEIAHNLCLSERQIKIWFQNRRMKLKK 308          
The following BLAST results are available for this feature:
BLAST of Hox class homeodomain protein DjAbd-Ba vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
AC004080.32.169e-1861.02HOXA10-HOXA9 readthrough[more]
HOXA105.274e-1847.50homeobox A10 [Source:HGNC Symbol;Acc:HGNC:5100][more]
HOXA95.388e-1861.02homeobox A9 [Source:HGNC Symbol;Acc:HGNC:5109][more]
HOXA98.153e-1861.02homeobox A9 [Source:HGNC Symbol;Acc:HGNC:5109][more]
HOXA91.219e-1761.02homeobox A9 [Source:HGNC Symbol;Acc:HGNC:5109][more]
back to top
BLAST of Hox class homeodomain protein DjAbd-Ba vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
php-37.778e-2260.29Posterior Hox gene Paralog [Source:UniProtKB/TrEM... [more]
php-37.778e-2260.29Posterior Hox gene Paralog [Source:UniProtKB/TrEM... [more]
mab-55.440e-1653.62Homeobox protein mab-5 [Source:UniProtKB/Swiss-Pr... [more]
nob-12.837e-1452.46KNOB-like posterior (NO Backside) [Source:UniProt... [more]
nob-14.828e-1452.46KNOB-like posterior (NO Backside) [Source:UniProt... [more]
back to top
BLAST of Hox class homeodomain protein DjAbd-Ba vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Abd-B3.307e-2063.33gene:FBgn0000015 transcript:FBtr0346764[more]
Abd-B3.380e-2063.33gene:FBgn0000015 transcript:FBtr0330709[more]
Abd-B3.776e-2063.33gene:FBgn0000015 transcript:FBtr0083381[more]
Abd-B3.776e-2063.33gene:FBgn0000015 transcript:FBtr0083382[more]
Abd-B3.776e-2063.33gene:FBgn0000015 transcript:FBtr0415465[more]
back to top
BLAST of Hox class homeodomain protein DjAbd-Ba vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
hoxd9a5.879e-1861.02homeobox D9a [Source:NCBI gene;Acc:30350][more]
hoxa9a2.098e-1759.32homeobox A9a [Source:NCBI gene;Acc:58047][more]
hoxa9a2.098e-1759.32homeobox A9a [Source:NCBI gene;Acc:58047][more]
hoxb9a4.952e-1759.32homeobox B9a [Source:NCBI gene;Acc:30344][more]
hoxd11a6.741e-1748.05homeobox D11a [Source:NCBI gene;Acc:30405][more]
back to top
BLAST of Hox class homeodomain protein DjAbd-Ba vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ENSXETT00000012547.11.470e-1852.17pep primary_assembly:Xenopus_tropicalis_v9.1:6:328... [more]
ENSXETT00000012532.17.490e-1861.02pep primary_assembly:Xenopus_tropicalis_v9.1:6:329... [more]
ache1.604e-1761.02acetylcholinesterase (Cartwright blood group) [Sou... [more]
tollip1.882e-1646.07toll interacting protein [Source:Xenbase;Acc:XB-GE... [more]
HOXD102.966e-1649.28homeobox D10 [Source:NCBI gene;Acc:100038085][more]
back to top
BLAST of Hox class homeodomain protein DjAbd-Ba vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Hoxa103.188e-1847.50homeobox A10 [Source:MGI Symbol;Acc:MGI:96171][more]
Hoxa97.633e-1861.02homeobox A9 [Source:MGI Symbol;Acc:MGI:96180][more]
Hoxb91.196e-1757.81homeobox B9 [Source:MGI Symbol;Acc:MGI:96190][more]
Hoxa102.752e-1747.62homeobox A10 [Source:MGI Symbol;Acc:MGI:96171][more]
Hoxc122.552e-1655.00homeobox C12 [Source:MGI Symbol;Acc:MGI:96194][more]
back to top
BLAST of Hox class homeodomain protein DjAbd-Ba vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|P09087|ABDB_DROME9.302e-1963.33Homeobox protein abdominal-B OS=Drosophila melanog... [more]
sp|Q9PWD6|HXA10_MORSA7.744e-1849.44Homeobox protein Hox-A10 OS=Morone saxatilis OX=34... [more]
sp|P24340|HXD9_CHICK8.996e-1861.02Homeobox protein Hox-D9 (Fragment) OS=Gallus gallu... [more]
sp|P50209|HXA9_AMBME9.830e-1861.02Homeobox protein Hox-A9 (Fragment) OS=Ambystoma me... [more]
sp|Q9PVR2|HXD9_ORYLA1.466e-1755.07Homeobox protein Hox-D9 OS=Oryzias latipes OX=8090... [more]
back to top
BLAST of Hox class homeodomain protein DjAbd-Ba vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
Q9BLF95.824e-17185.49Hox class homeodomain protein DjAbd-Ba OS=Dugesia ... [more]
B1NTA42.842e-81100.00AbdBa Hox protein (Fragment) OS=Schmidtea mediterr... [more]
T1EF408.492e-2962.50Homeobox domain-containing protein OS=Helobdella r... [more]
A0A0F6QL135.004e-2853.85MaPost2 Hox protein OS=Maculaura alaskensis OX=187... [more]
Q9U9T23.180e-2776.56Post2 homeobox protein (Fragment) OS=Alitta virens... [more]
back to top
BLAST of Hox class homeodomain protein DjAbd-Ba vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ENSAMXT00000005320.22.055e-1855.22homeobox protein Hox-A9a-like [Source:NCBI gene;Ac... [more]
hoxd9a2.781e-1859.38homeobox protein Hox-D9a [Source:NCBI gene;Acc:103... [more]
hoxd9a2.781e-1859.38homeobox protein Hox-D9a [Source:NCBI gene;Acc:103... [more]
ENSAMXT00000043089.12.224e-1750.00pep primary_assembly:Astyanax_mexicanus-2.0:APWO02... [more]
hoxb9a3.709e-1759.32homeobox B9 [Source:NCBI gene;Acc:103044445][more]
back to top
BLAST of Hox class homeodomain protein DjAbd-Ba vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ENSPMAT00000011242.12.701e-1861.02pep scaffold:Pmarinus_7.0:GL476758:607601:607780:-... [more]
ENSPMAT00000011060.12.701e-1861.02pep scaffold:Pmarinus_7.0:GL482503:5543:5722:1 gen... [more]
ENSPMAT00000011221.11.174e-1756.90pep scaffold:Pmarinus_7.0:GL477881:55654:55833:1 g... [more]
ENSPMAT00000005057.12.840e-1756.25pep scaffold:Pmarinus_7.0:GL483321:9136:13526:-1 g... [more]
ENSPMAT00000011449.13.216e-1755.93pep scaffold:Pmarinus_7.0:GL493006:3300:3479:1 gen... [more]
back to top
BLAST of Hox class homeodomain protein DjAbd-Ba vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 1
Match NameE-valueIdentityDescription
YOX11.799e-629.49Homeobox transcriptional repressor; binds to Mcm1p... [more]
back to top
BLAST of Hox class homeodomain protein DjAbd-Ba vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
MOXB4.978e-1649.32MoxB; Predicted protein [Source:UniProtKB/TrEMBL;... [more]
MOXC2.902e-1550.68Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
MOX12.877e-1358.00Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO338473.334e-1358.00Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO421963.550e-1248.33Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Hox class homeodomain protein DjAbd-Ba vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
hoxd91.391e-1855.07homeobox D10 [Source:NCBI gene;Acc:101163860][more]
hoxa96.698e-1857.14homeobox A9 [Source:NCBI gene;Acc:100049208][more]
ENSORLT00000006345.28.923e-1847.73homeobox protein Hox-A10 [Source:NCBI gene;Acc:101... [more]
ENSORLT00000001667.21.382e-1756.52homeobox protein Hox-D9b [Source:NCBI gene;Acc:101... [more]
hoxb9a3.115e-1760.34homeobox B9 [Source:NCBI gene;Acc:100049206][more]
back to top
BLAST of Hox class homeodomain protein DjAbd-Ba vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000033048.13.952e-3069.74SMESG000033048.1[more]
SMESG000022668.12.845e-2759.30SMESG000022668.1[more]
SMESG000054107.11.595e-2378.18SMESG000054107.1[more]
SMESG000044469.12.298e-1655.22SMESG000044469.1[more]
SMESG000043155.14.196e-1660.66SMESG000043155.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30015704 ID=SMED30015704|Name=Hox class homeodomain protein DjAbd-Ba|organism=Schmidtea mediterranea sexual|type=transcript|length=1444bp
GTGCGCGATTTTACTTCAGAAATTGGACCGACAATTCACTCGTATGCACA
TACACAGTTGTACATTTTTCTAAAAATTGAAAGCAGGCAAAAATCAACTG
CTACCTTCGTCTGCATCAAGCCAGTTACTCTAACCAATCTGCCATCAAAT
ATCGATAAGAAAAATTAAATAAATTATATGTTTTCCGCCTGACGCTAACA
ATTATTGGATAGATGCGACGTCTTCACTGCCAATGAGTTAGATATATAGT
AAACGCTGAGAGTCTGTTAGAGTCTCTAACGAAATTTTCCATAAAGATTT
TTCAAAGACATTTTAGATTGGTCCATTGCAATAAAATTCGCGCCGATTAT
AATCGTTTTCTGTTGATTGGTATTTTAAAACTTCTAATAAAAATTGTTGA
GAAGAATTCTTTCACTTTTAAAGCATTGGATTTTCACGTGGTTTACAACT
GGAAATGAATGAAGATTATCATGCCTTCTCTGCTTATACGTCATATCATT
ATCCGAATTATTATCATCACAATAATCCACACAATTCCAATCCCAGTTAC
GAATGTCTGTCAAGGAATAAGTCAAATCCTTTTCCTCAGTGCATAATGGG
ATCGAATTTTCAACAGTCTGCAGTGATAAACGATTTAAACTTTTATAACA
ATTGGTATGCGACCCATGCAATGAATTCCAATTTCGCCGATTCTGCTTTC
AGCAAGTCCGATATCAAATCCCACATCGAGTCGACACCCTATGATCAATT
TTCAACGACGAAAAGCCCTTCCTTGGTTTCATCGTTCATCAACAAACCGA
CCCCAAACGCCCACGATCAGCTGTTGTGGAGTATCTATAACTCAGAAACC
GACACGATTTTCAACAACCGGAATAACTACTCCCCATACTCCAGCAATAT
CCTAAATAATATTGAAATGTATCGTCTTCCACAAACCACTACTACATCGA
CGGCAGCAAATTCGCAGAGCGACAGTGGAAACTCCAATATCTGTTCTACT
GTGAAATCAATAACAAAATCTGAAAATAAATCATCAGAAACTGTGAAAAC
ACGTAAAAAACGGAAACCATATTCACGATATCAAACAATGATTTTAGAAT
CTGAATACGTAGGCAATACTTATATCACCAGGCAAAAACGATGGGAAATT
GCTTGCAAATTACATTTATCGGAAAGACAGATCAAAGTTTGGTTTCAAAA
TAGAAGAATGAAAACAAAAAAGATCAAAAATCGAGGAGGTTACAATGAAA
TAACATCCACTGGCCAGGAATATGAAGACATTAATTTTAGTTCCAAATAT
GATGACCTTGAAGATATGGAGCCTTCAAACAAAACATATGAAGGAATCAT
GTCCTATGATAACCCAGAAATCCTAATCAACAAGCTTAATATGTTTAAAA
GTTGTTAGAGATGTTGTACAAAATATCAATATTAATTAAGATTG
back to top

protein sequence of SMED30015704-orf-1

>SMED30015704-orf-1 ID=SMED30015704-orf-1|Name=SMED30015704-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=318bp
MNEDYHAFSAYTSYHYPNYYHHNNPHNSNPSYECLSRNKSNPFPQCIMGS
NFQQSAVINDLNFYNNWYATHAMNSNFADSAFSKSDIKSHIESTPYDQFS
TTKSPSLVSSFINKPTPNAHDQLLWSIYNSETDTIFNNRNNYSPYSSNIL
NNIEMYRLPQTTTTSTAANSQSDSGNSNICSTVKSITKSENKSSETVKTR
KKRKPYSRYQTMILESEYVGNTYITRQKRWEIACKLHLSERQIKVWFQNR
RMKTKKIKNRGGYNEITSTGQEYEDINFSSKYDDLEDMEPSNKTYEGIMS
YDNPEILINKLNMFKSC*
back to top
Aliases
The feature 'Hox class homeodomain protein DjAbd-Ba' has the following synonyms
Synonym
abdBa
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000028Category 2 cell
PLANA:0000034epidermis
PLANA:0000035Category 3 cell
PLANA:0000062esophagus
PLANA:0000074oocyte
PLANA:0000081pharynx pouch
PLANA:0000099neuron
PLANA:0000101muscle cell
PLANA:0000103central nervous system
PLANA:0000142posterior region of the whole animal
PLANA:0000204ovary
PLANA:0000231vitelline gland
PLANA:0000240body wall musculature
PLANA:0000420parapharyngeal region
PLANA:0000421tail
PLANA:0000422tail stripe
PLANA:0000429neoblast
PLANA:0002032epidermal cell
PLANA:0002089reproductive organ
PLANA:0002109X1 cell
PLANA:0007525posterior pole
Vocabulary: INTERPRO
TermDefinition
IPR020479Homeobox_metazoa
IPR001356Homeobox_dom
IPR009057Homeobox-like_sf
IPR017970Homeobox_CS
Vocabulary: molecular function
TermDefinition
GO:0003677DNA binding
GO:0043565sequence-specific DNA binding
Vocabulary: biological process
TermDefinition
GO:0006355regulation of transcription, DNA-templated
Vocabulary: cellular component
TermDefinition
GO:0005634nucleus
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR020479Homeobox domain, metazoaPRINTSPR00024HOMEOBOXcoord: 245..254
score: 80.22
coord: 220..231
score: 36.59
coord: 235..245
score: 57.54
IPR001356Homeobox domainSMARTSM00389HOX_1coord: 198..260
e-value: 2.6E-22
score: 90.1
IPR001356Homeobox domainPFAMPF00046Homeodomaincoord: 199..255
e-value: 1.3E-19
score: 69.7
IPR001356Homeobox domainPROSITEPS50071HOMEOBOX_2coord: 196..256
score: 18.819
IPR001356Homeobox domainCDDcd00086homeodomaincoord: 199..257
e-value: 8.23326E-20
score: 79.5948
NoneNo IPR availableGENE3DG3DSA:1.10.10.60coord: 195..263
e-value: 4.8E-23
score: 82.5
NoneNo IPR availablePANTHERPTHR45874FAMILY NOT NAMEDcoord: 138..259
NoneNo IPR availablePANTHERPTHR45874:SF4HOMEOBOX PROTEIN ABDOMINAL-Bcoord: 138..259
IPR017970Homeobox, conserved sitePROSITEPS00027HOMEOBOX_1coord: 231..254
IPR009057Homeobox-like domain superfamilySUPERFAMILYSSF46689Homeodomain-likecoord: 187..256