IQ domain-containing protein D

Overview
NameIQ domain-containing protein D
Smed IDSMED30015703
Length (bp)1658
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of IQ domain-containing protein D (SMED30015703) t-SNE clustered cells

Violin plots show distribution of expression levels for IQ domain-containing protein D (SMED30015703) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of IQ domain-containing protein D (SMED30015703) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for IQ domain-containing protein D (SMED30015703) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30015703

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 13

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
head regionSMED30015703SMESG000017912.1 SmedASXL_011353SmedAsxl_ww_GCZZ01PMID:27034770
Currie et al., 2016
whole organism asexual adult RNA-sequencing evidence
pharynxSMED30015703SMESG000017912.1 dd_Smed_v4_7079_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
protonephridiaSMED30015703SMESG000017912.1 dd_Smed_v4_7079_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
nervous systemSMED30015703SMESG000017912.1 dd_Smed_v4_7079_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
epidermisSMED30015703SMESG000017912.1 dd_Smed_v4_7079_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
cephalic gangliaSMED30015703SMESG000017912.1 dd_Smed_v4_7079_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
neuronSMED30015703SMESG000017912.1 dd_Smed_v4_7079_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult colorimetric in situ hybridization evidence
parenchymal cellSMED30015703SMESG000017912.1 dd_Smed_v4_7079_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30015703SMESG000017912.1 Contig39634newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30015703SMESG000017912.1 Contig39634uc_Smed_v2PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
head regionSMED30015703SMESG000017912.1 dd_Smed_v6_7079_0_1dd_Smed_v6PMID:28171748
Stückemann et al., 2017
whole organism asexual adult RNA-sequencing evidence
epidermisSMED30015703SMESG000017912.1 dd_Smed_v4_7079_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
ciliated epithelial cellSMED30015703SMESG000017912.1 dd_Smed_v4_7079_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of IQ domain-containing protein D vs. Ensembl Human
Match: IQCD (IQ motif containing D [Source:HGNC Symbol;Acc:HGNC:25168])

HSP 1 Score: 143.665 bits (361), Expect = 7.079e-37
Identity = 127/429 (29.60%), Postives = 216/429 (50.35%), Query Frame = 1
Query:  214 DCTKALEPTRKKLTTLETQRIMSVLDNCIKQSEIITAIPSVLNNIEDMSIVLTRQLIFLLDNYKMIKLKLDVVISKLDAIRGIRQNRKQEIEEYQREQSLASEDFWTHVKSTRPESAGQRNEFGFISYSYSPEEIERFQNDESNLIKTYEELSEKLKFATRCLFIGFKANPAALTAL---TTGEKDWKIKRSPGDSMFISKLLQLKDILALRLMTTPTEQNENHSYLRQMNEKFKANQMIINDLEIELKAAQEHKKEQISEKNDTIKKFQAEIHQVEKLSDENIKKTKLEMERQKEIDEKNSESVCQKLQQEIFQKKTEYNNILSEGRSGEKEMRANKIKKESALETNLQNYDTLMRQIQTEYEMVDEQYTEEKTQLYEMEERFKTIEEEYLXXXXXXXXXXXXXXXXXXXXXXLTKAVITIQAFWRSY 1491
            D  K L  +R KLTT+E +RIMS+LD  I + E++T +  V +N EDM  +L        D  + ++   D+    L+ +R +++  +Q      +EQ  A E+ W   +    E             S SP                   L +++K +T+ +     +NP A   L   T G       RS     FI  L++L+  L  +L+T+P E  +   +L+ ++ +   NQ II+ LE EL    +++  ++ ++N  I++ +  +HQV K S+ ++ +TK E E+Q++ D + S++   K+QQEI Q ++++ N++ E R  E+ +R  K K E+ +E  +Q YDT M + Q E E +D  + EEK  L E+  R K +  E+ +I EE+ I  +KR  A +E   + +A   IQA W+ Y
Sbjct:   32 DPLKPLVLSRTKLTTIEAKRIMSILDEAIYKVELVTLLSYVASNREDMEGMLGE------DVMRAVREHEDLCQVLLENVRCLKEKERQ-----LQEQKEAEEEGWLRDRLLSIE---------LQKSSLSP-------------------LMQQIKDSTKNVLRLLLSNPQAARLLQMQTQG-------RSAEAQNFIDSLIELRGFLFEKLLTSPMEARDKAQFLQDISRQNSNNQQIIDTLEKELAERMKNRNAEVEKENFVIQELKNHLHQVLKFSENSLVRTKQEAEKQQKADFRASQARVAKIQQEILQLQSQFYNLVMENREAEQALRKKKYKVETEIENWIQKYDTEMGEKQEELEDLDAVHREEKISLEELRRRHKVLVGEFAQIREEREINSKKRMEAEQEMVRMVRAATLIQALWKGY 414          
BLAST of IQ domain-containing protein D vs. Ensembl Human
Match: IQCD (IQ motif containing D [Source:HGNC Symbol;Acc:HGNC:25168])

HSP 1 Score: 107.071 bits (266), Expect = 2.248e-24
Identity = 94/344 (27.33%), Postives = 171/344 (49.71%), Query Frame = 1
Query:  214 DCTKALEPTRKKLTTLETQRIMSVLDNCIKQSEIITAIPSVLNNIEDMSIVLTRQLIFLLDNYKMIKLKLDVVISKLDAIRGIRQNRKQEIEEYQREQSLASEDFWTHVKSTRPESAGQRNEFGFISYSYSPEEIERFQNDESNLIKTYEELSEKLKFATRCLFIGFKANPAALTAL---TTGEKDWKIKRSPGDSMFISKLLQLKDILALRLMTTPTEQNENHSYLRQMNEKFKANQMIINDLEIELKAAQEHKKEQISEKNDTIKKFQAEIHQVEKLSDENIKKTKLEMERQKEIDEKNSESVCQKLQQEIFQKKTEYNNILSEGRSGEKEMRANKIKKESA 1236
            D  K L  +R KLTT+E +RIMS+LD  I + E++T +  V +N EDM  +L        D  + ++   D+    L+ +R +++  +Q      +EQ  A E+ W             R+    I    S                +   L +++K +T+ +     +NP A   L   T G       RS     FI  L++L+  L  +L+T+P E  +   +L+ ++ +   NQ II+ LE EL    +++  ++ ++N  I++ +  +HQV K S+ ++ +TK E E+Q++ D + S++   K+QQEI Q ++++ N++ E R  E+ +R  K+ +E+A
Sbjct:   32 DPLKPLVLSRTKLTTIEAKRIMSILDEAIYKVELVTLLSYVASNREDMEGMLGE------DVMRAVREHEDLCQVLLENVRCLKEKERQ-----LQEQKEAEEEGWL------------RDRLLSIELQKS----------------SLSPLMQQIKDSTKNVLRLLLSNPQAARLLQMQTQG-------RSAEAQNFIDSLIELRGFLFEKLLTSPMEARDKAQFLQDISRQNSNNQQIIDTLEKELAERMKNRNAEVEKENFVIQELKNHLHQVLKFSENSLVRTKQEAEKQQKADFRASQARVAKIQQEILQLQSQFYNLVMENREAEQALR--KVPREAA 327          
BLAST of IQ domain-containing protein D vs. Ensembl Human
Match: IQCD (IQ motif containing D [Source:HGNC Symbol;Acc:HGNC:25168])

HSP 1 Score: 62.7734 bits (151), Expect = 5.212e-10
Identity = 74/286 (25.87%), Postives = 128/286 (44.76%), Query Frame = 1
Query:  214 DCTKALEPTRKKLTTLETQRIMSVLDNCIKQSEIITAIPSVLNNIEDMSIVLTRQLIFLLDNYKMIKLKLDVVISKLDAIRGIRQNRKQEIEEYQREQSLASEDFWTHVKSTRPESAGQRNEFGFISYSYSPEEIERFQNDESNLIKTYEELSEKLKFATRCLFIGFKANPAALTAL---TTGEKDWKIKRSPGDSMFISKLLQLKDILALRLMTTPTEQNENHSYLRQMNEKFKANQMIINDLEIELKAAQEHKKEQISEKNDTIKKFQAEIHQVEKLSDENIKK 1062
            D  K L  +R KLTT+E +RIMS+LD  I + E++T +  V +N EDM  +L        D  + ++   D+    L+ +R +++  +Q      +EQ  A E+ W             R+    I    S                +   L +++K +T+ +     +NP A   L   T G       RS     FI  L++L+  L  +L+T+P E  +   +L+ ++ +   NQ II+ LE EL  A+  K     E+ + +      +H+ EK+S E +++
Sbjct:   32 DPLKPLVLSRTKLTTIEAKRIMSILDEAIYKVELVTLLSYVASNREDMEGMLGE------DVMRAVREHEDLCQVLLENVRCLKEKERQ-----LQEQKEAEEEGWL------------RDRLLSIELQKS----------------SLSPLMQQIKDSTKNVLRLLLSNPQAARLLQMQTQG-------RSAEAQNFIDSLIELRGFLFEKLLTSPMEARDKAQFLQDISRQNSNNQQIIDTLEKEL--AERMKNRNAEEELEDLDA----VHREEKISLEELRR 265          
BLAST of IQ domain-containing protein D vs. Ensembl Zebrafish
Match: iqcd (IQ motif containing D [Source:ZFIN;Acc:ZDB-GENE-060526-200])

HSP 1 Score: 115.931 bits (289), Expect = 1.436e-27
Identity = 119/433 (27.48%), Postives = 215/433 (49.65%), Query Frame = 1
Query:  214 DCTKALEPTRKKLTTLETQRIMSVLDNCIKQSEIITAIPSVLNNIEDMSIVLTRQLIFLLDNYKMIKLKLDVVISKLDAIRGIRQNRKQEIEEYQREQSLASEDFWTHVKSTRPESAGQRNEFGFISYSYSPEEIERFQNDESNLIKTYEELSEKL-KFATRCLFIGFKANPAALTAL------TTGEKDWKIKRSPGDSMFISKLLQLKDILALRLMTTPTEQNENHSYLRQMNEKFKANQMIINDLEIELKAAQEHKKEQISEKNDTIKKFQAEIHQVEKLSDENIKKTKLEMERQKEIDEKNSESVCQKLQQEIFQKKTEYNNILSEGRSGEKEMRANKIKKESALETNLQNYDTLMRQIQTEYEMVDEQYTEEKTQLYEMEERFKTIEEEYLXXXXXXXXXXXXXXXXXXXXXXLTKAVITIQAFWRSY 1491
            D  K + P+RK L+  E + I+ VLD CI             + +E  S++ T     LL + + + L L+      + ++ +++++K E E+YQ   S+A +                                    N + N ++  +  S KL + + R +    +A P     L      TTGE         G     + L +L++++  RL+TTP E+ E+   + +++++  ANQ +I  LE E+  A ++K  +IS  N+ + + +  +HQ+ K  +E + +T+ + E+Q   D K S+    +LQQE  Q +T+ NN +   R  E+++R  K K+E+ +E  +Q YD  + + QTE E +   + E++ +L E+E+RF T++ EY +IMEE++ A+E R    RE +I ++A   IQA+WR +
Sbjct:   16 DSPKTINPSRKVLSCREAKLILGVLDECI-------------HQMETASLLPT-----LLKSSEALSLSLEE-----EVVKALKEHQKLE-EKYQ---SIALDG-----------------------------------NHDQNELQVEKAKSAKLVQDSFRKIIRLLRATPTTKVVLKRIEPNTTGEM--------GSQKIRNGLCELREVVLERLLTTPAEEKESRKMMLEVSQRHSANQKLIEALEKEVAEANKNKDAEISTLNNKVLQLRRTLHQMGKGLEEFVMRTQQDAEKQSHSDRKTSDGKRARLQQEASQLRTQLNNAIKASRGREQDLRKEKYKEETEIENLIQKYDAEIGEKQTELEEMTRMHEEDQMELTELEKRFDTLDLEYSQIMEERQEAQELREQQERERQIQSQAATVIQAYWRGF 378          
BLAST of IQ domain-containing protein D vs. Ensembl Xenopus
Match: iqcd (IQ motif containing D [Source:NCBI gene;Acc:100216273])

HSP 1 Score: 140.584 bits (353), Expect = 7.452e-36
Identity = 129/423 (30.50%), Postives = 218/423 (51.54%), Query Frame = 1
Query:  223 KALEPTRKKLTTLETQRIMSVLDNCIKQSEIITAIPSVLNNIEDMSIVLTRQLIFLLDNYKMIKLKLDVVISKLDAIRGIRQNRKQEIEEYQREQSLASEDFWTHVKSTRPESAGQRNEFGFISYSYSPEEIERFQNDESNLIKTYEELSEKLKFATRCLFIGFKANPAALTALTTGEKDWKIKRSPGDSMFISKLLQLKDILALRLMTTPTEQNENHSYLRQMNEKFKANQMIINDLEIELKAAQEHKKEQISEKNDTIKKFQAEIHQVEKLSDENIKKTKLEMERQKEIDEKNSESVCQKLQQEIFQKKTEYNNILSEGRSGEKEMRANKIKKESALETNLQNYDTLMRQIQTEYEMVDEQYTEEKTQLYEMEERFKTIEEEYLXXXXXXXXXXXXXXXXXXXXXXLTKAVITIQAFWRSY 1491
            K LE  RKKLT++ETQR++SVLD  IK+ E+++     ++N+E   IVL  +L+  L  ++ ++  +++ +++L +  G         EEY        ED     K+T+                           ++S++I  +  + + ++ + R     F +NP A  AL   E      R P     I  + +++  L   L+T+P EQ E   YL  +  + K N+ ++  LE ELK     +  +IS+KN+ I+  +  +HQ+EKLS+  +K+   E E Q++ D + SE  C K+  E+ Q +++ ++ +SE R  E  MR  K K E+ +E  +Q YDT M + Q E E ++ +Y  EK QL E++E+   +EEEY++IMEE+R+A+ +     RE     +A   IQA W+ Y
Sbjct:   39 KMLEQGRKKLTSIETQRVISVLDETIKKLELVSMFQHAVDNLEQYKIVLGSELVGALREHQRLQDNMNLQLTRLHSKEGE--------EEYS-----IVED-----KNTK---------------------------EQSDVI--FARIRQGIQSSIRNTLRLFVSNPPASKALR-AEGHL---RDPAYQELIQTMSEMRGFLFEFLLTSPLEQTEKMRYLHDITIRNKKNRELLLTLEEELKTVVLDRDTEISKKNEIIRHLKVNLHQLEKLSESQVKRIMQEAETQQKSDCRTSEGKCSKIHHELQQLRSQLSSTISENREIELTMRKKKYKIETEIENWIQKYDTDMGEKQDELEELEAEYNLEKAQLAEVQEKLAVMEEEYIQIMEERRLAKLRMEEEERELANKNRAATVIQAHWKGY 410          
BLAST of IQ domain-containing protein D vs. Ensembl Mouse
Match: Iqcd (IQ motif containing D [Source:MGI Symbol;Acc:MGI:1922982])

HSP 1 Score: 124.79 bits (312), Expect = 2.455e-30
Identity = 80/239 (33.47%), Postives = 142/239 (59.41%), Query Frame = 1
Query:  775 RSPGDSMFISKLLQLKDILALRLMTTPTEQNENHSYLRQMNEKFKANQMIINDLEIELKAAQEHKKEQISEKNDTIKKFQAEIHQVEKLSDENIKKTKLEMERQKEIDEKNSESVCQKLQQEIFQKKTEYNNILSEGRSGEKEMRANKIKKESALETNLQNYDTLMRQIQTEYEMVDEQYTEEKTQLYEMEERFKTIEEEYLXXXXXXXXXXXXXXXXXXXXXXLTKAVITIQAFWRSY 1491
            RSPG    +  L++L+  L  +L+T+P E  E + +++ ++ + + NQ +I+DL+ EL    ++K+ ++ ++N  I++ +  +HQV K S+ ++ +TK E E+Q+++D + S+    K QQ+I   + +Y+N++ E R  E+ +R  K K E+ +E  +Q YD  M + Q EYE ++  + EEK QL E+ ER   + EE+ +I  E  I  +KR  A RE   + +A   IQA W+ Y
Sbjct:  173 RSPGAQCLLDGLVELRGFLFEKLLTSPMEVREKNQFIQDISRRSERNQEVIDDLQAELANVLKNKESEVEKENFVIQELKNHLHQVFKFSENSLLRTKQEAEKQQKVDFRASQVRLAKTQQDILALRAQYHNLVMENREAEQALRKKKYKVETEIENWIQKYDMEMGEKQDEYEDLESIHKEEKLQLEELRERHAVLVEEFSQIRAESEINSKKRVEAEREMVRMVRAATLIQAVWKGY 411          
BLAST of IQ domain-containing protein D vs. Ensembl Mouse
Match: Iqcd (IQ motif containing D [Source:MGI Symbol;Acc:MGI:1922982])

HSP 1 Score: 89.3521 bits (220), Expect = 1.204e-18
Identity = 70/239 (29.29%), Postives = 124/239 (51.88%), Query Frame = 1
Query:  775 RSPGDSMFISKLLQLKDILALRLMTTPTEQNENHSYLRQMNEKFKANQMIINDLEIELKAAQEHKKEQISEKNDTIKKFQAEIHQVEKLSDENIKKTKLEMERQKEIDEKNSESVCQKLQQEIFQKKTEYNNILSEGRSGEKEMRANKIKKESALETNLQNYDTLMRQIQTEYEMVDEQYTEEKTQLYEMEERFKTIEEEYLXXXXXXXXXXXXXXXXXXXXXXLTKAVITIQAFWRSY 1491
            RSPG    +  L++L+  L  +L+T+P E  E + +++ ++ + + NQ +I+DL+ EL    ++K+ ++ ++N  I++ +  +HQV K S+ ++ +TK E E+Q+++D + S+                                  K K E+ +E  +Q YD  M + Q EYE ++  + EEK QL E+ ER   + EE+ +I  E  I  +KR  A RE   + +A   IQA W+ Y
Sbjct:  173 RSPGAQCLLDGLVELRGFLFEKLLTSPMEVREKNQFIQDISRRSERNQEVIDDLQAELANVLKNKESEVEKENFVIQELKNHLHQVFKFSENSLLRTKQEAEKQQKVDFRASQ---------------------------------KKYKVETEIENWIQKYDMEMGEKQDEYEDLESIHKEEKLQLEELRERHAVLVEEFSQIRAESEINSKKRVEAEREMVRMVRAATLIQAVWKGY 378          
BLAST of IQ domain-containing protein D vs. UniProt/SwissProt
Match: sp|Q96DY2|DRC10_HUMAN (Dynein regulatory complex protein 10 OS=Homo sapiens OX=9606 GN=IQCD PE=1 SV=2)

HSP 1 Score: 143.665 bits (361), Expect = 3.400e-36
Identity = 127/429 (29.60%), Postives = 216/429 (50.35%), Query Frame = 1
Query:  214 DCTKALEPTRKKLTTLETQRIMSVLDNCIKQSEIITAIPSVLNNIEDMSIVLTRQLIFLLDNYKMIKLKLDVVISKLDAIRGIRQNRKQEIEEYQREQSLASEDFWTHVKSTRPESAGQRNEFGFISYSYSPEEIERFQNDESNLIKTYEELSEKLKFATRCLFIGFKANPAALTAL---TTGEKDWKIKRSPGDSMFISKLLQLKDILALRLMTTPTEQNENHSYLRQMNEKFKANQMIINDLEIELKAAQEHKKEQISEKNDTIKKFQAEIHQVEKLSDENIKKTKLEMERQKEIDEKNSESVCQKLQQEIFQKKTEYNNILSEGRSGEKEMRANKIKKESALETNLQNYDTLMRQIQTEYEMVDEQYTEEKTQLYEMEERFKTIEEEYLXXXXXXXXXXXXXXXXXXXXXXLTKAVITIQAFWRSY 1491
            D  K L  +R KLTT+E +RIMS+LD  I + E++T +  V +N EDM  +L        D  + ++   D+    L+ +R +++  +Q      +EQ  A E+ W   +    E             S SP                   L +++K +T+ +     +NP A   L   T G       RS     FI  L++L+  L  +L+T+P E  +   +L+ ++ +   NQ II+ LE EL    +++  ++ ++N  I++ +  +HQV K S+ ++ +TK E E+Q++ D + S++   K+QQEI Q ++++ N++ E R  E+ +R  K K E+ +E  +Q YDT M + Q E E +D  + EEK  L E+  R K +  E+ +I EE+ I  +KR  A +E   + +A   IQA W+ Y
Sbjct:   32 DPLKPLVLSRTKLTTIEAKRIMSILDEAIYKVELVTLLSYVASNREDMEGMLGE------DVMRAVREHEDLCQVLLENVRCLKEKERQ-----LQEQKEAEEEGWLRDRLLSIE---------LQKSSLSP-------------------LMQQIKDSTKNVLRLLLSNPQAARLLQMQTQG-------RSAEAQNFIDSLIELRGFLFEKLLTSPMEARDKAQFLQDISRQNSNNQQIIDTLEKELAERMKNRNAEVEKENFVIQELKNHLHQVLKFSENSLVRTKQEAEKQQKADFRASQARVAKIQQEILQLQSQFYNLVMENREAEQALRKKKYKVETEIENWIQKYDTEMGEKQEELEDLDAVHREEKISLEELRRRHKVLVGEFAQIREEREINSKKRMEAEQEMVRMVRAATLIQALWKGY 414          
BLAST of IQ domain-containing protein D vs. UniProt/SwissProt
Match: sp|Q17QH9|DRC10_BOVIN (Dynein regulatory complex protein 10 OS=Bos taurus OX=9913 GN=IQCD PE=2 SV=1)

HSP 1 Score: 133.265 bits (334), Expect = 1.703e-32
Identity = 119/428 (27.80%), Postives = 214/428 (50.00%), Query Frame = 1
Query:  223 KALEPTRKKLTTLETQRIMSVLDNCIKQSEIITAIPSVLNNIEDMSIVLTRQLIFLLDNYKMIKLKLDVVISKLDAIRGIRQNRK--QEIEEYQREQSLASEDFWTHVKSTRPESAGQRNEFGFISYSYSPEEIERFQNDESNLIKTYEELSEKLKFATRCLFIGFKANPAA---LTALTTGEKDWKIKRSPGDSMFISKLLQLKDILALRLMTTPTEQNENHSYLRQMNEKFKANQMIINDLEIELKAAQEHKKEQISEKNDTIKKFQAEIHQVEKLSDENIKKTKLEMERQKEIDEKNSESVCQKLQQEIFQKKTEYNNILSEGRSGEKEMRANKIKKESALETNLQNYDTLMRQIQTEYEMVDEQYTEEKTQLYEMEERFKTIEEEYLXXXXXXXXXXXXXXXXXXXXXXLTKAVITIQAFWRSY 1491
            KAL P R KLTT+ET+RIMSVLD  I + E+++ +    +  +      T + +   D  K ++   D+  + LD +  +++  +  QE E+++ E                               ++  E +      +S L    +E+ E  K   R L     +NP A   L A T G       RS     FI  L++L+  L  +L+T+P E  +   +++ +  + + +Q II+ LE EL A   ++  ++ ++N  I++ +  +HQV + S+ ++ +TK E E+Q++ D + S++    +QQEI   ++++ N++ E R  E+ +R  K K E+ +E  +Q YD+ M + Q EYE +D  + EE+ QL E+++R   + EE+ +I  E+ I  +KR    +E   + +A   IQA W+ Y
Sbjct:   35 KALTPARSKLTTIETKRIMSVLDETIHKVELVSLLSHAASESK------TSEGMLGPDIAKAVREHEDLCQALLDRVSYLQEEERKLQEAEDFEDE-------------------------------AWFRERLFAMDLQKSQLPPLMQEIKESTKNVVRLLL----SNPQAASLLQAQTLG-------RSKEAQCFIDSLVELRGFLFEKLLTSPMEARDKIQFIQDITRRNRRHQEIIDTLENELAACVRNRNAEVEKENFVIQELKNHLHQVLRFSENSLLRTKQEAEKQQKADFRASQARVATVQQEILVLQSQFYNLVMENRDTEQALRKKKYKVETEIENWIQKYDSEMSEKQDEYEELDIIHKEEQLQLEELKKRHDVLVEEFSQIQAEREILTKKRLEDEQEMVRMVRAATLIQALWKGY 414          
BLAST of IQ domain-containing protein D vs. UniProt/SwissProt
Match: sp|Q5XIR6|DRC10_RAT (Dynein regulatory complex protein 10 OS=Rattus norvegicus OX=10116 GN=Iqcd PE=2 SV=2)

HSP 1 Score: 125.176 bits (313), Expect = 1.191e-29
Identity = 81/239 (33.89%), Postives = 144/239 (60.25%), Query Frame = 1
Query:  775 RSPGDSMFISKLLQLKDILALRLMTTPTEQNENHSYLRQMNEKFKANQMIINDLEIELKAAQEHKKEQISEKNDTIKKFQAEIHQVEKLSDENIKKTKLEMERQKEIDEKNSESVCQKLQQEIFQKKTEYNNILSEGRSGEKEMRANKIKKESALETNLQNYDTLMRQIQTEYEMVDEQYTEEKTQLYEMEERFKTIEEEYLXXXXXXXXXXXXXXXXXXXXXXLTKAVITIQAFWRSY 1491
            RSPG    ++ L++L+  L  +L+T+P E  E + +++ ++ + K NQ II+ L+ EL    ++K+ ++ ++N  I++ +  +HQV K S+ ++ +TK E E+Q+++D + S++   K QQ+I   + +Y+N++ E R  E+ +R  K K E+ +E  +Q YD  M + Q EYE ++  + EEK QL E++ER   + EE+ +I  E  I  +KR  A RE   + +A   IQA W+ Y
Sbjct:  173 RSPGAQCLLTSLVELRGFLFEKLLTSPMEVREKNQFIQDISRRSKRNQEIIDALQAELAEVLKNKEAEVEKENFVIQELKNHLHQVFKFSENSLLRTKQEAEKQQKVDYRASQARQAKTQQDILALRAQYHNLVMENREAEQALRKKKYKVETEIENWIQKYDMEMNEKQEEYEDLETIHKEEKLQLEELKERHAVLVEEFSQIRAESEINSKKRVEAEREMVRMVRAATLIQAMWKGY 411          
BLAST of IQ domain-containing protein D vs. UniProt/SwissProt
Match: sp|Q9D3V1|DRC10_MOUSE (Dynein regulatory complex protein 10 OS=Mus musculus OX=10090 GN=Iqcd PE=2 SV=1)

HSP 1 Score: 124.79 bits (312), Expect = 1.717e-29
Identity = 80/239 (33.47%), Postives = 142/239 (59.41%), Query Frame = 1
Query:  775 RSPGDSMFISKLLQLKDILALRLMTTPTEQNENHSYLRQMNEKFKANQMIINDLEIELKAAQEHKKEQISEKNDTIKKFQAEIHQVEKLSDENIKKTKLEMERQKEIDEKNSESVCQKLQQEIFQKKTEYNNILSEGRSGEKEMRANKIKKESALETNLQNYDTLMRQIQTEYEMVDEQYTEEKTQLYEMEERFKTIEEEYLXXXXXXXXXXXXXXXXXXXXXXLTKAVITIQAFWRSY 1491
            RSPG    +  L++L+  L  +L+T+P E  E + +++ ++ + + NQ +I+DL+ EL    ++K+ ++ ++N  I++ +  +HQV K S+ ++ +TK E E+Q+++D + S+    K QQ+I   + +Y+N++ E R  E+ +R  K K E+ +E  +Q YD  M + Q EYE ++  + EEK QL E+ ER   + EE+ +I  E  I  +KR  A RE   + +A   IQA W+ Y
Sbjct:  173 RSPGAQCLLDGLVELRGFLFEKLLTSPMEVREKNQFIQDISRRSERNQEVIDDLQAELANVLKNKESEVEKENFVIQELKNHLHQVFKFSENSLLRTKQEAEKQQKVDFRASQVRLAKTQQDILALRAQYHNLVMENREAEQALRKKKYKVETEIENWIQKYDMEMGEKQDEYEDLESIHKEEKLQLEELRERHAVLVEEFSQIRAESEINSKKRVEAEREMVRMVRAATLIQAVWKGY 411          
BLAST of IQ domain-containing protein D vs. UniProt/SwissProt
Match: sp|Q4R8Y5|DRC10_MACFA (Dynein regulatory complex protein 10 OS=Macaca fascicularis OX=9541 GN=IQCD PE=2 SV=1)

HSP 1 Score: 122.094 bits (305), Expect = 1.052e-28
Identity = 88/275 (32.00%), Postives = 158/275 (57.45%), Query Frame = 1
Query:  667 LSEKLKFATRCLFIGFKANPAALTALTTGEKDWKIKRSPGDSMFISKLLQLKDILALRLMTTPTEQNENHSYLRQMNEKFKANQMIINDLEIELKAAQEHKKEQISEKNDTIKKFQAEIHQVEKLSDENIKKTKLEMERQKEIDEKNSESVCQKLQQEIFQKKTEYNNILSEGRSGEKEMRANKIKKESALETNLQNYDTLMRQIQTEYEMVDEQYTEEKTQLYEMEERFKTIEEEYLXXXXXXXXXXXXXXXXXXXXXXLTKAVITIQAFWRSY 1491
            L++++K +T+ +     +NP A   L    +     RS     FI  L++L+  L  +L+T+P E  +   +++ +N +   NQ II+ LE EL    + +  ++ ++N  I++ +  +HQV K S+ ++ +TK E E+Q++ D + S++   K+QQEI Q ++++ N++ E R  E+ +R  K K E+ +E  +Q YDT M + Q E E ++  + EEK  L E++ R K + EE+++I EE+ I  +KR  A +E   + +A   IQAFW+ Y
Sbjct:  121 LTQQIKDSTKNVLRLLLSNPQAARLLQMQTQS----RSAEAQNFIDSLIELRGFLFEKLVTSPMEARDKAQFIQDINRQNSNNQQIIDTLENELAERMKKRNAEVEKENFVIQELKNHLHQVLKFSENSLLRTKQEAEKQQKADFRASQARVAKIQQEILQLQSQFYNLVMENREAEQALRKKKYKVETEIENWIQKYDTEMGEKQEELEDLEAVHKEEKIALEELKRRHKVLVEEFVQIREEREINSKKRMEAEQEMVRMVRAATLIQAFWKGY 391          
BLAST of IQ domain-containing protein D vs. TrEMBL
Match: A0A267EP97 (Uncharacterized protein (Fragment) OS=Macrostomum lignano OX=282301 GN=BOX15_Mlig027354g1 PE=4 SV=1)

HSP 1 Score: 251.906 bits (642), Expect = 9.853e-74
Identity = 174/422 (41.23%), Postives = 264/422 (62.56%), Query Frame = 1
Query:  229 LEPTRKKLTTLETQRIMSVLDNCIKQSEIITAIPSVLNNIEDMSIVLTRQLIFLLDNYKMIKLKLDVVISKLDAIRGIRQNRKQEIEEYQREQSLA-SEDFWTHVKSTRPESAGQRNEFGFISYSYSPEEIERFQNDESNLIKTYEELSEKLKFATRCLFIGFKANPAALTALTTGEKDWKIKRSPGDSMFISKLLQLKDILALRLMTTPTEQNENHSYLRQMNEKFKANQMIINDLEIELKAAQEHKKEQISEKNDTIKKFQAEIHQVEKLSDENIKKTKLEMERQKEIDEKNSESVCQKLQQEIFQKKTEYNNILSEGRSGEKEMRANKIKKESALETNLQNYDTLMRQIQTEYEMVDEQYTEEKTQLYEMEERFKTIEEEYLXXXXXXXXXXXXXXXXXXXXXXLTKAVITIQAFWRSY 1491
            LEP RKKLTTLETQRIM V+ +  K+ E++ A+P++L N++D  IVL R+L  LL  +  +  + D+V +KLD I     +RK     Y+  + +A +EDFW+  +   PE+    +E   ++ S   EE+   Q   + L      L  +L+F+ R L   F++NP A+TA+    +  K+K        + ++  L+DI+ +RLMTTP E+ +  +YL +M+E+ +    +I  LE EL AA   K+ ++ +KND I+K Q++IH VEK ++E+IK  + E E+Q++ D KNSE    KL QE  Q +T+ +N+++E R  E+++R+ K K E+ +E  +  YD+ M   Q EYE VD  YTEEK QL E+EERFKT+EEEYL+IMEE+R+AEE+R AA  E +++  A  TIQ+FWRSY
Sbjct:   52 LEPARKKLTTLETQRIMGVMIDGSKRVELLAALPALLRNLDDFQIVLGRELTALLVEHGNLSRQFDLVSAKLDVI----HDRK-----YEAPKPVALTEDFWS--QEAEPEA----DEAPVVTQSK--EELLPLQ---AELEAEAASLLPRLQFSARVLLRAFRSNPPAVTAVL---QSAKLKPQTETKEMLDRMEHLRDIMVVRLMTTPVEKQDKLTYLHEMSERERQQAEVIKKLEAELSAATADKEAEVKKKNDVIRKIQSDIHHVEKYAEESIKNIRSEAEKQQQTDSKNSEGKVHKLTQERNQLRTQLDNLIAEHRDSEQQLRSKKFKLETEIENIISKYDSEMGTRQEEYEDVDAAYTEEKKQLSELEERFKTLEEEYLQIMEERRVAEERRRAAEHEMQMMISAATTIQSFWRSY 450          
BLAST of IQ domain-containing protein D vs. TrEMBL
Match: A0A1I8HTE4 (Uncharacterized protein OS=Macrostomum lignano OX=282301 PE=4 SV=1)

HSP 1 Score: 251.521 bits (641), Expect = 1.009e-73
Identity = 174/422 (41.23%), Postives = 264/422 (62.56%), Query Frame = 1
Query:  229 LEPTRKKLTTLETQRIMSVLDNCIKQSEIITAIPSVLNNIEDMSIVLTRQLIFLLDNYKMIKLKLDVVISKLDAIRGIRQNRKQEIEEYQREQSLA-SEDFWTHVKSTRPESAGQRNEFGFISYSYSPEEIERFQNDESNLIKTYEELSEKLKFATRCLFIGFKANPAALTALTTGEKDWKIKRSPGDSMFISKLLQLKDILALRLMTTPTEQNENHSYLRQMNEKFKANQMIINDLEIELKAAQEHKKEQISEKNDTIKKFQAEIHQVEKLSDENIKKTKLEMERQKEIDEKNSESVCQKLQQEIFQKKTEYNNILSEGRSGEKEMRANKIKKESALETNLQNYDTLMRQIQTEYEMVDEQYTEEKTQLYEMEERFKTIEEEYLXXXXXXXXXXXXXXXXXXXXXXLTKAVITIQAFWRSY 1491
            LEP RKKLTTLETQRIM V+ +  K+ E++ A+P++L N++D  IVL R+L  LL  +  +  + D+V +KLD I     +RK     Y+  + +A +EDFW+  +   PE+    +E   ++ S   EE+   Q   + L      L  +L+F+ R L   F++NP A+TA+    +  K+K        + ++  L+DI+ +RLMTTP E+ +  +YL +M+E+ +    +I  LE EL AA   K+ ++ +KND I+K Q++IH VEK ++E+IK  + E E+Q++ D KNSE    KL QE  Q +T+ +N+++E R  E+++R+ K K E+ +E  +  YD+ M   Q EYE VD  YTEEK QL E+EERFKT+EEEYL+IMEE+R+AEE+R AA  E +++  A  TIQ+FWRSY
Sbjct:   41 LEPARKKLTTLETQRIMGVMIDGSKRVELLAALPALLRNLDDFQIVLGRELTALLVEHGNLSRQFDLVSAKLDVI----HDRK-----YEAPKPVALTEDFWS--QEAEPEA----DEAPVVTQSK--EELLPLQ---AELEAEAASLLPRLQFSARVLLRAFRSNPPAVTAVL---QSAKLKPQTETKEMLDRMEHLRDIMVVRLMTTPVEKQDKLTYLHEMSERERQQAEVIKKLEAELSAATADKEAEVKKKNDVIRKIQSDIHHVEKYAEESIKNIRSEAEKQQQTDSKNSEGKVHKLTQERNQLRTQLDNLIAEHRDSEQQLRSKKFKLETEIENIISKYDSEMGTRQEEYEDVDAAYTEEKKQLSELEERFKTLEEEYLQIMEERRVAEERRRAAEHEMQMMISAATTIQSFWRSY 439          
BLAST of IQ domain-containing protein D vs. TrEMBL
Match: A0A1I8IRL0 (Uncharacterized protein OS=Macrostomum lignano OX=282301 PE=4 SV=1)

HSP 1 Score: 251.521 bits (641), Expect = 1.171e-73
Identity = 174/422 (41.23%), Postives = 264/422 (62.56%), Query Frame = 1
Query:  229 LEPTRKKLTTLETQRIMSVLDNCIKQSEIITAIPSVLNNIEDMSIVLTRQLIFLLDNYKMIKLKLDVVISKLDAIRGIRQNRKQEIEEYQREQSLA-SEDFWTHVKSTRPESAGQRNEFGFISYSYSPEEIERFQNDESNLIKTYEELSEKLKFATRCLFIGFKANPAALTALTTGEKDWKIKRSPGDSMFISKLLQLKDILALRLMTTPTEQNENHSYLRQMNEKFKANQMIINDLEIELKAAQEHKKEQISEKNDTIKKFQAEIHQVEKLSDENIKKTKLEMERQKEIDEKNSESVCQKLQQEIFQKKTEYNNILSEGRSGEKEMRANKIKKESALETNLQNYDTLMRQIQTEYEMVDEQYTEEKTQLYEMEERFKTIEEEYLXXXXXXXXXXXXXXXXXXXXXXLTKAVITIQAFWRSY 1491
            LEP RKKLTTLETQRIM V+ +  K+ E++ A+P++L N++D  IVL R+L  LL  +  +  + D+V +KLD I     +RK     Y+  + +A +EDFW+  +   PE+    +E   ++ S   EE+   Q   + L      L  +L+F+ R L   F++NP A+TA+    +  K+K        + ++  L+DI+ +RLMTTP E+ +  +YL +M+E+ +    +I  LE EL AA   K+ ++ +KND I+K Q++IH VEK ++E+IK  + E E+Q++ D KNSE    KL QE  Q +T+ +N+++E R  E+++R+ K K E+ +E  +  YD+ M   Q EYE VD  YTEEK QL E+EERFKT+EEEYL+IMEE+R+AEE+R AA  E +++  A  TIQ+FWRSY
Sbjct:   41 LEPARKKLTTLETQRIMGVMIDGSKRVELLAALPALLRNLDDFQIVLGRELTALLVEHGNLSRQFDLVSAKLDVI----HDRK-----YEAPKPVALTEDFWS--QEAEPEA----DEAPVVTQSK--EELLPLQ---AELEAEAASLLPRLQFSARVLLRAFRSNPPAVTAVL---QSAKLKPQTETKEMLDRMEHLRDIMVVRLMTTPVEKQDKLTYLHEMSERERQQAEVIKKLEAELSAATADKEAEVKKKNDVIRKIQSDIHHVEKYAEESIKNIRSEAEKQQQTDSKNSEGKVHKLTQERNQLRTQLDNLIAEHRDSEQQLRSKKFKLETEIENIISKYDSEMGTRQEEYEDVDAAYTEEKKQLSELEERFKTLEEEYLQIMEERRVAEERRRAAEHEMQMMISAATTIQSFWRSY 439          
BLAST of IQ domain-containing protein D vs. TrEMBL
Match: V4A4P4 (Uncharacterized protein (Fragment) OS=Lottia gigantea OX=225164 GN=LOTGIDRAFT_83213 PE=4 SV=1)

HSP 1 Score: 230.72 bits (587), Expect = 1.869e-66
Identity = 151/426 (35.45%), Postives = 253/426 (59.39%), Query Frame = 1
Query:  214 DCTKALEPTRKKLTTLETQRIMSVLDNCIKQSEIITAIPSVLNNIEDMSIVLTRQLIFLLDNYKMIKLKLDVVISKLDAIRGIRQNRKQEIEEYQREQSLASEDFWTHVKSTRPESAGQRNEFGFISYSYSPEEIERFQNDESNLIKTYEELSEKLKFATRCLFIGFKANPAALTALTTGEKDWKIKRSPGDSMFISKLLQLKDILALRLMTTPTEQNENHSYLRQMNEKFKANQMIINDLEIELKAAQEHKKEQISEKNDTIKKFQAEIHQVEKLSDENIKKTKLEMERQKEIDEKNSESVCQKLQQEIFQKKTEYNNILSEGRSGEKEMRANKIKKESALETNLQNYDTLMRQIQTEYEMVDEQYTEEKTQLYEMEERFKTIEEEYLXXXXXXXXXXXXXXXXXXXXXXLTKAVITIQAFWRSY 1491
            D ++ALEP+RKK++T+E QR+MSV +  I++ EIIT +P ++ N++   I L   L  LL ++++I+   + + ++LD                             H+    P  + + N    +S     +  E        +I+    ++++L F+ + +   F+ NP+A  ++  GE  ++++    + M +S + +L+DIL  +L+TTP E+ E  +YL +++++ + N  II  LE E KA  E K+E+I +KN+ I++ QA++HQ+EK S+E+I++ K E E+Q+  D KNSE   QKLQQ+I   +T++ ++ +E R  E+E+R  K K E+ +E  +Q +D  M + Q EYE +DE YTEEK QL+E+EERFKT+E EY +I EE+R+A E+R  A +E   + +A  TIQAFWRS+
Sbjct:    1 DPSRALEPSRKKISTIEAQRVMSVFEETIRRVEIITLLPHIIENLDRFRISLGSDLADLLQHHQVIQESYNEIRAELD----------------------------KHLAKRTPTQSAKSN----VSRKTDAQLEE--------IIRNLSLVAQQLSFSCKNILRAFQINPSACNSVL-GE--FRVRNENCNEMVVS-MQELRDILMGKLLTTPEEEKERMAYLTEISQRERYNAGIIQKLEAEYKAGMEDKEEEIRKKNEVIRRLQADLHQIEKFSEEHIRRVKAEAEKQETSDVKNSEGKRQKLQQDINHLRTQFQSMTAEHRENEQELRRRKFKVETEVENWIQKFDQDMGERQDEYEEIDEIYTEEKKQLHELEERFKTLEAEYKQIQEERRLARERREKAEQEMARMVRASTTIQAFWRSF 382          
BLAST of IQ domain-containing protein D vs. TrEMBL
Match: A0A1I8HTQ3 (Uncharacterized protein OS=Macrostomum lignano OX=282301 PE=4 SV=1)

HSP 1 Score: 229.18 bits (583), Expect = 1.919e-65
Identity = 166/422 (39.34%), Postives = 253/422 (59.95%), Query Frame = 1
Query:  229 LEPTRKKLTTLETQRIMSVLDNCIKQSEIITAIPSVLNNIEDMSIVLTRQLIFLLDNYKMIKLKLDVVISKLDAIRGIRQNRKQEIEEYQREQSLA-SEDFWTHVKSTRPESAGQRNEFGFISYSYSPEEIERFQNDESNLIKTYEELSEKLKFATRCLFIGFKANPAALTALTTGEKDWKIKRSPGDSMFISKLLQLKDILALRLMTTPTEQNENHSYLRQMNEKFKANQMIINDLEIELKAAQEHKKEQISEKNDTIKKFQAEIHQVEKLSDENIKKTKLEMERQKEIDEKNSESVCQKLQQEIFQKKTEYNNILSEGRSGEKEMRANKIKKESALETNLQNYDTLMRQIQTEYEMVDEQYTEEKTQLYEMEERFKTIEEEYLXXXXXXXXXXXXXXXXXXXXXXLTKAVITIQAFWRSY 1491
            LEP RKKLTTLETQRIM V+ +  K+ E++ A+P++L N++D  IVL R+L  LL  +  +  + D+V +KLD I     +RK     Y+  + +A +EDFW+  +   PE+    +E   ++ S   EE+   Q   + L      L  +L+F+ R L   F++NP A+TA+    +  K+K        + ++  L+DI+ +RLMTTP E+ +  +YL +M+E+ +    +I  LE EL AA   K+ ++ +KND I+K Q++IH VEK ++E+IK  + E E+Q++ D KNSE    KL QE  Q +T+ +N+++E R  E+++R+                       + EYE VD  YTEEK QL E+EERFKT+EEEYL+IMEE+R+AEE+R AA  E +++  A  TIQ+FWRSY
Sbjct:   41 LEPARKKLTTLETQRIMGVMIDGSKRVELLAALPALLRNLDDFQIVLGRELTALLVEHGNLSRQFDLVSAKLDVI----HDRK-----YEAPKPVALTEDFWS--QEAEPEA----DEAPVVTQSK--EELLPLQ---AELEAEAASLLPRLQFSARVLLRAFRSNPPAVTAVL---QSAKLKPQTETKEMLDRMEHLRDIMVVRLMTTPVEKQDKLTYLHEMSERERQQAEVIKKLEAELSAATADKEAEVKKKNDVIRKIQSDIHHVEKYAEESIKNIRSEAEKQQQTDSKNSEGKVHKLTQERNQLRTQLDNLIAEHRDSEQQLRSK----------------------EEEYEDVDAAYTEEKKQLSELEERFKTLEEEYLQIMEERRVAEERRRAAEHEMQMMISAATTIQSFWRSY 417          
BLAST of IQ domain-containing protein D vs. Ensembl Cavefish
Match: iqcd (IQ motif containing D [Source:NCBI gene;Acc:103032804])

HSP 1 Score: 82.0333 bits (201), Expect = 2.689e-16
Identity = 73/222 (32.88%), Postives = 124/222 (55.86%), Query Frame = 1
Query:  826 ILALRLMTTPTEQNENHSYLRQMNEKFKANQMIINDLEIELKAAQEHKKEQISEKNDTIKKFQAEIHQVEKLSDENIKKTKLEMERQKEIDEKNSESVCQKLQQEIFQKKTEYNNILSEGRSGEKEMRANKIKKESALETNLQNYDTLMRQIQTEYEMVDEQYTEEKTQLYEMEERFKTIEEEYLXXXXXXXXXXXXXXXXXXXXXXLTKAVITIQAFWRSY 1491
            +L  RL  TP E+      +++   +  +NQ ++  LE E  AA + + ++IS  N  I+  ++ I + EK SD+ + + + E ER  E  +K SE    +LQ+E+ Q K +  N++ + R  E  +R    K E+ ++  ++ YD  M + QT+ E + + + EE  +L E++E +   E E+ KIMEE RI +E+R    RE E+ ++A I IQAFWR +
Sbjct:  162 VLLKRLFMTPMEERVRIQRMQEDTLRHNSNQKVLATLEKEAAAAVKDRDKEISWMNKVIQWLRSSILKTEKCSDDFVVRKQKEAERHDESVQKTSELKQTRLQEEVNQLKVQLKNLIIQHRDAELALRKKSYKVETEVQNWIEKYDAEMGEKQTKLEEITQIHEEEMAELSELQEYYAVRELEFSKIMEEHRIEQERRDEEEREREVQSRAAIIIQAFWRGW 383          
BLAST of IQ domain-containing protein D vs. Ensembl Cavefish
Match: iqcd (IQ motif containing D [Source:NCBI gene;Acc:103032804])

HSP 1 Score: 82.0333 bits (201), Expect = 2.689e-16
Identity = 73/222 (32.88%), Postives = 124/222 (55.86%), Query Frame = 1
Query:  826 ILALRLMTTPTEQNENHSYLRQMNEKFKANQMIINDLEIELKAAQEHKKEQISEKNDTIKKFQAEIHQVEKLSDENIKKTKLEMERQKEIDEKNSESVCQKLQQEIFQKKTEYNNILSEGRSGEKEMRANKIKKESALETNLQNYDTLMRQIQTEYEMVDEQYTEEKTQLYEMEERFKTIEEEYLXXXXXXXXXXXXXXXXXXXXXXLTKAVITIQAFWRSY 1491
            +L  RL  TP E+      +++   +  +NQ ++  LE E  AA + + ++IS  N  I+  ++ I + EK SD+ + + + E ER  E  +K SE    +LQ+E+ Q K +  N++ + R  E  +R    K E+ ++  ++ YD  M + QT+ E + + + EE  +L E++E +   E E+ KIMEE RI +E+R    RE E+ ++A I IQAFWR +
Sbjct:  162 VLLKRLFMTPMEERVRIQRMQEDTLRHNSNQKVLATLEKEAAAAVKDRDKEISWMNKVIQWLRSSILKTEKCSDDFVVRKQKEAERHDESVQKTSELKQTRLQEEVNQLKVQLKNLIIQHRDAELALRKKSYKVETEVQNWIEKYDAEMGEKQTKLEEITQIHEEEMAELSELQEYYAVRELEFSKIMEEHRIEQERRDEEEREREVQSRAAIIIQAFWRGW 383          
BLAST of IQ domain-containing protein D vs. Ensembl Cavefish
Match: ENSAMXT00000008878.2 (IQ domain-containing protein D-like [Source:NCBI gene;Acc:107196985])

HSP 1 Score: 55.8398 bits (133), Expect = 7.087e-8
Identity = 64/233 (27.47%), Postives = 119/233 (51.07%), Query Frame = 1
Query:  820 KDILALRLMTTPTEQNENHSYLRQMNEKFKANQMIINDLEIELKAAQEHKKEQISEKNDTIKKFQAEIHQVEKLSDENIKKTKLEMERQKEIDEKNSESVCQKLQQEIFQKKTEYNNILSEGRSGEKEMRANKIKKESALETNLQNYDTLMRQIQTEYEMVDEQYTEEKTQLYEME-------ERFKTIEE-EYLXXXXXXXXXXXXXXXXXXXXXXLTK-AVITIQAFWRSY 1491
            +  L  +L  TP E+  +   +R+   ++++NQ  +  LE E+ A  E   ++IS  +  I   +  + ++EK +++ + + K   ER+ E  +K S+    ++ +EI Q + +  +++  G   E+E R    K    +E  +  YDT + Q QTE         EE TQLYEME       +++  + E EYL+++E +RI +E R    RE  +  + A + +Q+FW+ +
Sbjct:  159 RSFLLQQLYMTPREERLHLQQMREAPLRYESNQEALAALEREMAATIEAMDKEISWLSKVIDWLKRSMDRIEKRAEDFVAQKKNNAERRNESLQKTSQLKQAQILEEISQLELQLESLIKRGLEDEREQRKRCTKLRGMVEDWIDVYDTEIEQKQTEL--------EETTQLYEMEMAELSDLQKYHAVREVEYLQVVERRRIEKELREKEERERGLRIRAAAVILQSFWKGW 383          
BLAST of IQ domain-containing protein D vs. Ensembl Nematostella
Match: EDO44929 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RUM4])

HSP 1 Score: 152.525 bits (384), Expect = 4.134e-41
Identity = 130/426 (30.52%), Postives = 220/426 (51.64%), Query Frame = 1
Query:  214 DCTKALEPTRKKLTTLETQRIMSVLDNCIKQSEIITAIPSVLNNIEDMSIVLTRQLIFLLDNYKMIKLKLDVVISKLDAIRGIRQNRKQEIEEYQREQSLASEDFWTHVKSTRPESAGQRNEFGFISYSYSPEEIERFQNDESNLIKTYEELSEKLKFATRCLFIGFKANPAALTALTTGEKDWKIKRSPGDSMFISKLLQLKDILALRLMTTPTEQNENHSYLRQMNEKFKANQMIINDLEIELKAAQEHKKEQISEKNDTIKKFQAEIHQVEKLSDENIKKTKLEMERQKEIDEKNSESVCQKLQQEIFQKKTEYNNILSEGRSGEKEMRANKIKKESALETNLQNYDTLMRQIQTEYEMVDEQYTEEKTQLYEMEERFKTIEEEYLXXXXXXXXXXXXXXXXXXXXXXLTKAVITIQAFWRSY 1491
            D  K L+P RKKL+++E+QR++SVLD+ I++ EI + +P +  N+E  S++L  +L  L+  +  ++      +SK                 ++ EQ  A        +S  P+++                                  LS  L+ + R L   F  NP A+TA+ T   +    RS   +  I +L  ++ +L  RL+TTP+E  +   YL  + E+ K +  + + L+ EL+ A + +  +I+++N+ I++ + +I  V+K ++E  K+   E  +Q   + KNS+    KLQQE+ + K +     +  R  E  +R  K K E+ +E  +Q +D  M + Q E++ +D  YTEEK QL E+EERFKT+E EY++I+EE+RIA+EK  AA RE  +  +A   IQA WR++
Sbjct:    6 DPLKVLDPARKKLSSVESQRVISVLDDTIRRIEIGSLLPFIAENLERYSVILGSELSLLISEHDKLQHAYQKAVSK-----------------FELEQKRA--------RSASPQTS----------------------------------LSMMLQQSLRTLLRQFSRNPTAMTAIRTERHE----RSFESNSMIDELSAIRAVLFERLLTTPSELKDRDKYLMAVAERQKRSSQMADKLQDELQNAIDDRDNEIAKRNEIIRRLKNDIFNVDKNAEEQNKRIVTEASKQDAAEMKNSDGKKAKLQQELIETKKKLEAQTAAHRESELALRKRKYKIETEVENWIQKFDNDMGERQDEFDALDVVYTEEKKQLQELEERFKTLEAEYVQIVEERRIAKEKAEAAERELNLKIRAARLIQAMWRAH 368          
BLAST of IQ domain-containing protein D vs. Ensembl Nematostella
Match: EDO49121 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RGV7])

HSP 1 Score: 63.5438 bits (153), Expect = 7.652e-11
Identity = 70/271 (25.83%), Postives = 127/271 (46.86%), Query Frame = 1
Query:  679 LKFATRCLFIGFKANPAALTALTTGEKDWKIKRSPGDSMFISKLLQLKDILALRLMTTPTEQNENHSYLRQMNEKFKANQMIINDLEIELKAAQEHKKEQISEKNDTIKKFQAEIHQVEKLSDENIKKTKLEMERQKEIDEKNSESVCQKLQQEIFQKKTEYNNILSEGRSGEKEMRANKIKKESALETNLQNYDTLMRQIQTEYEMVDEQYTEEKTQLYEMEERFKTIEEEYLXXXXXXXXXXXXXXXXXXXXXXLTKAVITIQAFWRSY 1491
            LKF+   +   FK NP A+  +       K K  P     +  + QL  ++  RL+TTPTE+ +   Y+  +  + +        L+   + A   K+ ++S++N  I + ++E+  +  ++ E  +KT  +  +Q   + K SE+    +++++  K+    +   E R  E  +R    K  + +   +Q YD  M   Q     + + Y EEK  L EME+ F+ +E +Y  I+EE+R+A E      +E      A + IQA WR +
Sbjct:  100 LKFSLMDILRHFKKNPKAVEVILGS----KHKTDPVHQELLQFMTQLSMVMKERLLTTPTEEFDRKGYIVDILTRERKTNAAKGRLQARCREAVRDKEHEVSKRNTIIAQLKSELSMINNVTHEAQRKTLSDAAKQCSTEIKTSENKKMTIREDMITKRKHVRDRRREHREEETVLRKRAFKIGTEVYNWIQKYDADMGAKQA----IAKLYEEEKQDLREMEQEFQNMEAKYNAILEERRLAAEAEKKRQQELVQRNYAAVRIQAVWRGF 362          

HSP 2 Score: 48.9062 bits (115), Expect = 3.183e-6
Identity = 25/63 (39.68%), Postives = 38/63 (60.32%), Query Frame = 1
Query:  214 DCTKALEPTRKKLTTLETQRIMSVLDNCIKQSEIITAIPSVLNNIEDMSIVLTRQLIFLLDNY 402
            D  + LEP +K L  LE+QRIM+VL++ I + E+ T +  V+   E   +VL   L+ LLD +
Sbjct:    1 DPCRILEPNKKNLHMLESQRIMAVLEDTILRLELATILGHVMRERERFGVVLGTDLVELLDYH 63          
BLAST of IQ domain-containing protein D vs. Planmine SMEST
Match: SMESG000017912.1 (SMESG000017912.1)

HSP 1 Score: 863.218 bits (2229), Expect = 0.000e+0
Identity = 451/457 (98.69%), Postives = 452/457 (98.91%), Query Frame = 1
Query:  121 RQTTISKKSDFNKDAELKSSVSYKNASNINIDCTKALEPTRKKLTTLETQRIMSVLDNCIKQSEIITAIPSVLNNIEDMSIVLTRQLIFLLDNYKMIKLKLDVVISKLDAIRGIRQNRKQEIEEYQREQSLASEDFWTHVKSTRPESAGQRNEFGFISYSYSPEEIERFQNDESNLIKTYEELSEKLKFATRCLFIGFKANPAALTALTTGEKDWKIKRSPGDSMFISKLLQLKDILALRLMTTPTEQNENHSYLRQMNEKFKANQMIINDLEIELKAAQEHKKEQISEKNDTIKKFQAEIHQVEKLSDENIKKTKLEMERQKEIDEKNSESVCQKLQQEIFQKKTEYNNILSEGRSGEKEMRANKIKKESALETNLQNYDTLMRQIQTEYEMVDEQYTEEKTQLYEMEERFKTIEEEYLXXXXXXXXXXXXXXXXXXXXXXLTKAVITIQAFWRSY 1491
            RQTTISKKSDFNKD ELK SVSYKNASNI IDCTKALEPTRKKLTTLETQRIM VLDNCIKQSEIITAIPSVLNNIEDMSIVLTRQLIFLLDNYKMIKLKLDVVISKLDAIRGIRQNRKQEIEEYQREQSLASEDFWTHVKSTRPESAGQRNEFGFISYSYSPEEIE+FQNDESNLIKTYEELSEKLKFATRCLFIGFKANPAALTALTTGEKDWKIKRSPGDSMFISKLLQLKDIL LRLMTTPTEQNENHSYLRQMNEKFKANQMIINDLEIELKAAQEHKKEQISEKNDTIKKFQAEIHQVEKLSDENIKKTKLEMERQKEIDEKNSESVCQKLQQEIFQKKTEYNNILSEGRSGEKEMRANKIKKESALETNLQNYDTLMRQIQTEYEMVDEQYTEEKTQLYEMEERFKTIEEEYLKIMEEKRIAEEKRAAAAREEEILTKAVITIQAFWRSY
Sbjct:   10 RQTTISKKSDFNKDTELKLSVSYKNASNIKIDCTKALEPTRKKLTTLETQRIMGVLDNCIKQSEIITAIPSVLNNIEDMSIVLTRQLIFLLDNYKMIKLKLDVVISKLDAIRGIRQNRKQEIEEYQREQSLASEDFWTHVKSTRPESAGQRNEFGFISYSYSPEEIEKFQNDESNLIKTYEELSEKLKFATRCLFIGFKANPAALTALTTGEKDWKIKRSPGDSMFISKLLQLKDILTLRLMTTPTEQNENHSYLRQMNEKFKANQMIINDLEIELKAAQEHKKEQISEKNDTIKKFQAEIHQVEKLSDENIKKTKLEMERQKEIDEKNSESVCQKLQQEIFQKKTEYNNILSEGRSGEKEMRANKIKKESALETNLQNYDTLMRQIQTEYEMVDEQYTEEKTQLYEMEERFKTIEEEYLKIMEEKRIAEEKRAAAAREEEILTKAVITIQAFWRSY 466          
BLAST of IQ domain-containing protein D vs. Planmine SMEST
Match: SMESG000036536.1 (SMESG000036536.1)

HSP 1 Score: 147.902 bits (372), Expect = 1.317e-38
Identity = 127/429 (29.60%), Postives = 231/429 (53.85%), Query Frame = 1
Query:  229 LEPTRKKLTTLETQRIMSVLDNCIKQSEIITAIPSVLNNIEDMSIVLTRQLIFLLDNYKMIKLKLDVVISKLDAIRGIRQNRKQEIE-EYQREQSLASEDFWT-----HVKSTRPESAGQRNEFGFISYSYSPEEIERFQNDESNLIKTYEELSEKLKFATRCLFIGFKANPAALTALTTGEKDWKIKRSPGDSMFISKLLQLKDILALRLMTTPTEQNENHSYLRQMNEKFKANQMIINDLEIELKAAQEHKKEQISEKNDTIKKFQAEIHQVEKLSDENIKKTKLEMERQKEIDEKN--SESVCQKLQQEIFQKKTEYNNILSEGRSGEKEMRANKIKKESALETNLQNYDTLMRQIQTEYEMVDEQYTEEKTQLYEMEERFKTIEEEYLXXXXXXXXXXXXXXXXXXXXXXLTKAVITIQAFWRSY 1491
            L+P  + L T+E++RI+ +LD+ IK   +I +  S++ ++ED + +L +QL  L  N+K   +    +  ++   +G  Q    ++E E Q++     EDFWT      +K    +SA   ++   ++       +E  +     L +  ++++  ++F  R + I F+ NP A+  +   ++ W+IK +      I  + QL+ +L  RL+TTP E++E   YL  + +K KA+Q++INDL+  L+  +  K++ I++ N  I   Q EI+++E      I   K+E + ++E+DE     E     L  ++   K +YN ++   R+ E E+R  K K E+  E  +  YD+ M + QT+++ +   Y  EK  L E+ + F+ +E+EYL+++EE+RIA+EKR A   E E L      IQ+FWR++
Sbjct:   29 LKPKSRHLETIESERILLILDDAIKNFNLIGSFESIMEDLEDYAFLLGKQLYRLFVNFKPFYMDYMKITIQILECKGQFQKSCLDVETENQKDVYNLPEDFWTIPINKLMKHELKQSAPSADDVQKVN-------VEEIREKLPELEEKKKKMTPIIQFYVRSIVIAFRNNPHAVNCVMKHKEIWQIKYNVSLIRLIELMTQLRGLLFQRLLTTPQERDEKARYLAAVCKKEKAHQIVINDLKSTLENMKIDKEKMITQMNFNIIDLQKEIYKLEIAGKNEI--YKIEKKSEEELDEIRLAHEETKAMLTGQLNDLKVKYNELVERNRNNELEIRRRKWKLETETENWINKYDSEMAEYQTQFDKLQTDYDNEKKSLQELLKIFEPLEKEYLQVLEEQRIAKEKREAERAENEALVYWATVIQSFWRAW 448          
BLAST of IQ domain-containing protein D vs. Planmine SMEST
Match: SMESG000036536.1 (SMESG000036536.1)

HSP 1 Score: 117.857 bits (294), Expect = 4.600e-28
Identity = 129/452 (28.54%), Postives = 224/452 (49.56%), Query Frame = 1
Query:  229 LEPTRKKLTTLETQRIMSVLDNCIKQSEIITAIPSVLNNIEDMSIVLTRQLIFLLDNYKMIKLKLDVVISKLDAIRGIRQNRKQEIE-EYQREQSLASEDFWT-----HVKSTRPESAGQRNEFGFISYSYSPEEI-ERFQNDESNLIKTYEELSEKLKFATRCLFIGFKANPAALTALTTGEKDWKIKRSPGDSMFISKLL----------------------QLKDILALRLMTTPTEQNENHSYLRQMNEKFKANQMIINDLEIELKAAQEHKKEQISEKNDTIKKFQAEIHQVEKLSDENIKKTKLEMERQKEIDEKN--SESVCQKLQQEIFQKKTEYNNILSEGRSGEKEMRANKIKKESALETNLQNYDTLMRQIQTEYEMVDEQYTEEKTQLYEMEERFKTIEEEYLXXXXXXXXXXXXXXXXXXXXXXLTKAVITIQAFWRSY 1491
            L+P  + L T+E++RI+ +LD+ IK   +I +  S++ ++ED + +L +QL  L  N+K   +    +  ++   +G  Q    ++E E Q++     EDFWT      +K    +SA   ++   ++     EEI E+    E    K  ++  EK      C    F            G+ +  +K  P +S+  SK                        +L+ +L  RL+TTP E++E   YL  + +K KA+Q++INDL+  L+  +  K++ I++ N  I   Q EI+++E      I   K+E + ++E+DE     E     L  ++   K +YN ++   R+ E E+R  K K E+  E  +  YD+ M + QT+++ +   Y  EK  L E+ + F+ +E+EYL+++EE+RIA+EKR A   E E L      IQ+FWR++
Sbjct:   29 LKPKSRHLETIESERILLILDDAIKNFNLIGSFESIMEDLEDYAFLLGKQLYRLFVNFKPFYMDYMKITIQILECKGQFQKSCLDVETENQKDVYNLPEDFWTIPINKLMKHELKQSAPSADDVQKVNV----EEIREKLPELEEKKKKVNQKQLEKPNAENLCYTGNFSIYDC------NGKFNLSVKDDPNNSILRSKYSYCIQKQSPCRKLCHETQRDMANKLRGLLFQRLLTTPQERDEKARYLAAVCKKEKAHQIVINDLKSTLENMKIDKEKMITQMNFNIIDLQKEIYKLEIAGKNEI--YKIEKKSEEELDEIRLAHEETKAMLTGQLNDLKVKYNELVERNRNNELEIRRRKWKLETETENWINKYDSEMAEYQTQFDKLQTDYDNEKKSLQELLKIFEPLEKEYLQVLEEQRIAKEKREAERAENEALVYWATVIQSFWRAW 468          
The following BLAST results are available for this feature:
BLAST of IQ domain-containing protein D vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 3
Match NameE-valueIdentityDescription
IQCD7.079e-3729.60IQ motif containing D [Source:HGNC Symbol;Acc:HGNC... [more]
IQCD2.248e-2427.33IQ motif containing D [Source:HGNC Symbol;Acc:HGNC... [more]
IQCD5.212e-1025.87IQ motif containing D [Source:HGNC Symbol;Acc:HGNC... [more]
back to top
BLAST of IQ domain-containing protein D vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of IQ domain-containing protein D vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of IQ domain-containing protein D vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 1
Match NameE-valueIdentityDescription
iqcd1.436e-2727.48IQ motif containing D [Source:ZFIN;Acc:ZDB-GENE-06... [more]
back to top
BLAST of IQ domain-containing protein D vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 1
Match NameE-valueIdentityDescription
iqcd7.452e-3630.50IQ motif containing D [Source:NCBI gene;Acc:100216... [more]
back to top
BLAST of IQ domain-containing protein D vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 2
Match NameE-valueIdentityDescription
Iqcd2.455e-3033.47IQ motif containing D [Source:MGI Symbol;Acc:MGI:1... [more]
Iqcd1.204e-1829.29IQ motif containing D [Source:MGI Symbol;Acc:MGI:1... [more]
back to top
BLAST of IQ domain-containing protein D vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q96DY2|DRC10_HUMAN3.400e-3629.60Dynein regulatory complex protein 10 OS=Homo sapie... [more]
sp|Q17QH9|DRC10_BOVIN1.703e-3227.80Dynein regulatory complex protein 10 OS=Bos taurus... [more]
sp|Q5XIR6|DRC10_RAT1.191e-2933.89Dynein regulatory complex protein 10 OS=Rattus nor... [more]
sp|Q9D3V1|DRC10_MOUSE1.717e-2933.47Dynein regulatory complex protein 10 OS=Mus muscul... [more]
sp|Q4R8Y5|DRC10_MACFA1.052e-2832.00Dynein regulatory complex protein 10 OS=Macaca fas... [more]
back to top
BLAST of IQ domain-containing protein D vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A267EP979.853e-7441.23Uncharacterized protein (Fragment) OS=Macrostomum ... [more]
A0A1I8HTE41.009e-7341.23Uncharacterized protein OS=Macrostomum lignano OX=... [more]
A0A1I8IRL01.171e-7341.23Uncharacterized protein OS=Macrostomum lignano OX=... [more]
V4A4P41.869e-6635.45Uncharacterized protein (Fragment) OS=Lottia gigan... [more]
A0A1I8HTQ31.919e-6539.34Uncharacterized protein OS=Macrostomum lignano OX=... [more]
back to top
BLAST of IQ domain-containing protein D vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 3
Match NameE-valueIdentityDescription
iqcd2.689e-1632.88IQ motif containing D [Source:NCBI gene;Acc:103032... [more]
iqcd2.689e-1632.88IQ motif containing D [Source:NCBI gene;Acc:103032... [more]
ENSAMXT00000008878.27.087e-827.47IQ domain-containing protein D-like [Source:NCBI g... [more]
back to top
BLAST of IQ domain-containing protein D vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of IQ domain-containing protein D vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of IQ domain-containing protein D vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 2
Match NameE-valueIdentityDescription
EDO449294.134e-4130.52Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO491217.652e-1125.83Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of IQ domain-containing protein D vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of IQ domain-containing protein D vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 3
Match NameE-valueIdentityDescription
SMESG000017912.10.000e+098.69SMESG000017912.1[more]
SMESG000036536.11.317e-3829.60SMESG000036536.1[more]
SMESG000036536.14.600e-2828.54SMESG000036536.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30015703 ID=SMED30015703|Name=IQ domain-containing protein D|organism=Schmidtea mediterranea sexual|type=transcript|length=1658bp
TTTAAATATAAAATTTTATACATTTAATTTAAATACATTTATTACTTTAT
AATCTGCTGTATATTTTTATTTACTAATTACCTTTCTGATTTTATGTCTT
CTTTATCTGCTTCATTGTCTCGGCAAACGACGATAAGCAAAAAAAGTGAT
TTCAATAAAGATGCTGAGTTGAAGTCATCAGTAAGTTATAAAAATGCATC
GAATATAAACATCGACTGTACAAAAGCTCTTGAGCCCACCAGAAAAAAAT
TAACAACATTAGAAACCCAAAGAATTATGAGCGTGTTGGATAATTGTATA
AAACAAAGTGAAATAATAACCGCCATCCCGTCAGTTTTGAACAATATCGA
GGATATGTCAATCGTACTGACAAGGCAGCTGATATTCCTGTTGGACAATT
ACAAAATGATAAAATTGAAACTCGACGTTGTTATTTCAAAATTGGATGCG
ATTCGAGGAATCCGACAGAACAGAAAACAGGAAATCGAAGAATACCAACG
AGAGCAAAGTTTAGCCAGCGAAGATTTCTGGACCCATGTTAAATCAACTC
GACCAGAGTCTGCTGGTCAGAGAAATGAGTTCGGCTTCATCAGTTATTCC
TATAGTCCAGAGGAAATTGAAAGATTCCAAAACGACGAATCAAACCTCAT
CAAAACTTACGAAGAACTGAGTGAGAAACTTAAATTCGCCACGAGATGTT
TATTTATCGGATTCAAGGCCAATCCGGCAGCATTGACCGCTTTGACAACA
GGTGAAAAAGATTGGAAAATCAAAAGATCTCCTGGAGATTCGATGTTTAT
TAGCAAATTATTGCAACTAAAGGATATTTTAGCATTACGTTTGATGACAA
CTCCAACTGAGCAAAACGAAAATCATTCCTACCTTCGACAAATGAATGAA
AAGTTTAAGGCGAATCAAATGATTATTAATGATTTAGAAATAGAATTAAA
AGCTGCACAAGAACATAAAAAAGAACAAATATCTGAAAAAAATGATACAA
TTAAAAAATTCCAAGCGGAAATTCATCAAGTTGAAAAGCTATCCGACGAG
AATATTAAGAAAACAAAGTTGGAAATGGAAAGGCAGAAGGAAATAGATGA
GAAAAATAGCGAAAGTGTTTGCCAAAAATTACAACAAGAAATCTTTCAAA
AGAAAACAGAATACAACAACATTCTTTCGGAAGGTCGTTCGGGTGAGAAA
GAAATGAGAGCGAATAAAATAAAAAAAGAATCTGCATTGGAAACTAATCT
ACAAAATTATGACACCTTGATGAGACAAATACAAACTGAATATGAAATGG
TAGATGAACAATACACAGAGGAAAAGACACAATTATATGAAATGGAAGAA
AGATTTAAAACAATTGAAGAAGAATATCTAAAGATTATGGAAGAAAAACG
AATCGCTGAAGAAAAGAGGGCAGCAGCAGCCCGCGAAGAGGAAATCCTCA
CGAAAGCTGTGATAACAATTCAAGCTTTCTGGCGTTCTTATAAGGTGCGT
AAAGGAGTACGTGGAAGCACAAGAAAAGGAAAAGGCAAAGGCAAAAAGAA
GAAATAAATGATAATAATAATGACAATTTTATTTTGTTAATGAAGATAGA
TCCAATGCGTTATTTATCTTTCACTAAAATAAATATCAGGACAACTATTG
AAAAAAAA
back to top

protein sequence of SMED30015703-orf-1

>SMED30015703-orf-1 ID=SMED30015703-orf-1|Name=SMED30015703-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=488bp
MSSLSASLSRQTTISKKSDFNKDAELKSSVSYKNASNINIDCTKALEPTR
KKLTTLETQRIMSVLDNCIKQSEIITAIPSVLNNIEDMSIVLTRQLIFLL
DNYKMIKLKLDVVISKLDAIRGIRQNRKQEIEEYQREQSLASEDFWTHVK
STRPESAGQRNEFGFISYSYSPEEIERFQNDESNLIKTYEELSEKLKFAT
RCLFIGFKANPAALTALTTGEKDWKIKRSPGDSMFISKLLQLKDILALRL
MTTPTEQNENHSYLRQMNEKFKANQMIINDLEIELKAAQEHKKEQISEKN
DTIKKFQAEIHQVEKLSDENIKKTKLEMERQKEIDEKNSESVCQKLQQEI
FQKKTEYNNILSEGRSGEKEMRANKIKKESALETNLQNYDTLMRQIQTEY
EMVDEQYTEEKTQLYEMEERFKTIEEEYLKIMEEKRIAEEKRAAAAREEE
ILTKAVITIQAFWRSYKVRKGVRGSTRKGKGKGKKKK*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000016pharynx
PLANA:0000020protonephridia
PLANA:0000034epidermis
PLANA:0000099neuron
PLANA:0000106ciliated epithelial cell
PLANA:0000418head
PLANA:0002032epidermal cell
Vocabulary: INTERPRO
TermDefinition
IPR042815DRC10
IPR000048IQ_motif_EF-hand-BS
Vocabulary: molecular function
TermDefinition
GO:0005515protein binding
GO:0003674molecular_function
Vocabulary: cellular component
TermDefinition
GO:0005575cellular_component
Vocabulary: biological process
TermDefinition
GO:0008150biological_process
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
NoneNo IPR availableCOILSCoilCoilcoord: 407..449
NoneNo IPR availableCOILSCoilCoilcoord: 278..316
NoneNo IPR availableCOILSCoilCoilcoord: 117..144
NoneNo IPR availableCOILSCoilCoilcoord: 343..363
NoneNo IPR availableCOILSCoilCoilcoord: 175..195
IPR000048IQ motif, EF-hand binding siteSMARTSM00015iq_5coord: 451..473
e-value: 0.0051
score: 26.0
IPR000048IQ motif, EF-hand binding sitePFAMPF00612IQcoord: 453..471
e-value: 1.5E-5
score: 24.4
IPR000048IQ motif, EF-hand binding sitePROSITEPS50096IQcoord: 452..481
score: 8.462
IPR042815Dynein regulatory complex protein 10PANTHERPTHR31598FAMILY NOT NAMEDcoord: 16..487