Macrophage-expressed gene 1 protein

Overview
NameMacrophage-expressed gene 1 protein
Smed IDSMED30015696
Uniprot Best hitMacrophage-expressed gene 1 protein OS=Bos taurus GN=MPEG1 PE=2 SV=2 (E=1.70656e-118)
Length (bp)2665
Neoblast Clusters

Zeng et. al., 2018


 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




Embryonic Expression

Davies et. al., 2017


Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

Download CSV of Expression Data

 

back to top

Expression Details

Macrophage-expressed gene 1 protein ( MPEG1-like-3 ) is expressed during Stage 2, Stage 3, Stage 4 and Stage 5 in the embryonic digestive system, primitive gut cell, embryonic gut cell and temporary embryonic pharynx

Click to see image symbols and abbreviations
Abbreviation or symbolDefinition
Ooral hemisphere
Aaboral hemisphere
Ddorsal
Vventral
Llateral
black arrowheadembryonic pharynx
red arrowheaddefinitive pharynx
black arrowsprimitive gut
yellow arrowsprimitive ectoderm cells
cyan arrowsbrain
cyan arrowheadsnerve cords
blue arrowheadseye progenitors (trail cells)
purple arrowheadseyes
scale bar100 µm
Homology
BLAST of Macrophage-expressed gene 1 protein vs. Ensembl Human
Match: MPEG1 (macrophage expressed 1 [Source:HGNC Symbol;Acc:HGNC:29619])

HSP 1 Score: 379.407 bits (973), Expect = 1.425e-117
Identity = 209/618 (33.82%), Postives = 333/618 (53.88%), Query Frame = 1
Query:  262 VHECKLTSNQYPVNVLPGSGWDNLENKELGQVLEISYKGCFGSNDGSFLIPDNVVITPIKKSIVELTSDIFDHFSNVTSTTAMSINADASYSTPSYKISGSFSFEKIRIKNDQIKEKSSISRSQLRHELYEVAFQPHSKLDAKFRNRILDIGALLKEGKDTIYPQYLADLIVRDFGTHVIRSVDAGATLIKTDVLKSNYVKGFKGDTTKIAAAASFSMTTMLSVNLKGTYVGDTTSLNEFNSNSASTKVETFGGIPFGSNFKLEDWEKTLETNLVAIDRKGEPLSYAITPKNLPEFDEQAVFKIATLIKEAVNRYYAANTRVGCMNMESENFNDDANVDGGNCEPPNTFYSFGGTFQTCSGPD-----YQCMDVAAKNPVTNSYACPDNYDTIELQSGLN-------KCINYCTKYLFSTQCHYEC--------SQYALYWCSSTNKTKISEGALFGGFYTNTFPNPLTNSYSCPQYYVATRFGVNAKVCTALNKAEAMEHHLPFGGFYSCKVGNPLLDDPLYNITQDPKYWPQGCSTGYSSHVAIVDRACQISYCVKNNALSMREQPPLYRPPFIDLGFGPNMTVITSLDTPMGVRLSVDENGK-W---SHNHQYKL 2043
            V +CK       + VLPG GWDNL N ++G+V+E++Y  C  + DG ++IPD +   P K+S +E+ S+I + ++N  S+T+ SIN + S  +   K++G FS E  R+K  Q+K+++  +R Q+R+ +Y V   P  +L + FR  +LDI   L E   T    YLA+L+V ++GTHV  SVDAGA LI+ D L++++++  +   + + A+A  +    ++   +  Y         + SN  +++V++ GG+PF     L+ W++ +  +LVAIDR G PL + I P  LP+     V K++  ++ AV RYY  NT  GC ++ S NFN  AN D G+CE   T +SFGG +Q C+          C  +  KNP+T  ++CP  Y  + L S ++       +C   CT  +F   C   C        +++  +WC ++++   + G LFGG +++   NP+TN+ SCP  Y   R   N KVC + +        +PFGGF+SC VGNPL+D  +      P    + C  G+S H A++   CQ+SYCVK+   +    PP   PPF      P +    + +T   V ++  EN + W   S  HQ++L
Sbjct:   31 VQKCKNALKLPVLEVLPGGGWDNLRNVDMGRVMELTYSNCRTTEDGQYIIPDEIFTIPQKQSNLEMNSEILESWANYQSSTSYSINTELSLFS---KVNGKFSTEFQRMKTLQVKDQAITTRVQVRNLVYTVKINPTLELSSGFRKELLDISDRL-ENNQTRMATYLAELLVLNYGTHVTTSVDAGAALIQEDHLRASFLQDSQSSRSAVTASAGLAFQNTVNFKFEENYTSQNVLTKSYLSNRTNSRVQSIGGVPFYPGITLQAWQQGITNHLVAIDRSGLPLHFFINPNMLPDLPGPLVKKVSKTVETAVKRYYTFNTYPGCTDLNSPNFNFQANTDDGSCEGKMTNFSFGGVYQECTQLSGNRDVLLCQKLEQKNPLTGDFSCPSGYSPVHLLSQIHEEGYNHLECHRKCTLLVF---CKTVCEDVFQVAKAEFRAFWCVASSQVPENSGLLFGGLFSSKSINPMTNAQSCPAGYFPLRLFENLKVCVSQDYELGSRFAVPFGGFFSCTVGNPLVDPAISRDLGAPSL--KKCPGGFSQHPALISDGCQVSYCVKSGLFTGGSLPPARLPPFTR----PPLMSQAATNT---VIVTNSENARSWIKDSQTHQWRL 632          
BLAST of Macrophage-expressed gene 1 protein vs. Ensembl Zebrafish
Match: mpeg1.1 (macrophage expressed 1, tandem duplicate 1 [Source:ZFIN;Acc:ZDB-GENE-030131-7347])

HSP 1 Score: 352.443 bits (903), Expect = 1.234e-107
Identity = 207/575 (36.00%), Postives = 305/575 (53.04%), Query Frame = 1
Query:  271 CKLTSNQYPVNVLPGSGWDNLENKELGQVLEISYKGCFGSNDGSFLIPDNVVITPIKKSIVELTSDIFDHFSNVTSTTAMSINADASYSTPSYKISGSFSFEKIRIKNDQIKEKSSISRSQLRHELYEVAFQPHSKLDAKFRNRILDIGALLKEGKDTIYPQYLADLIVRDFGTHVIRSVDAGATLIKTDVLKSNYVKGFKGDTTKIAAAASFSMTTMLSVNLKGTYVGDTTSLNEFNSNSASTKVETFGGIPFGSNFKLEDWEKTLETNLVAIDRKGEPLSYAITPKNLPEFDEQAVFKIATLIKEAVNRYYAANTRVGCMNMESENFNDDANVDGGNCEPPNTFYSFGGTFQTCS--GPDYQ--CMDVAAKNPVTNSYACPDNYDTIELQS-----GLN--KCINYCTKYLF---STQCHYEC--------SQYALYWCSSTNKTKISEGALFGGFYTNTFPNPLTNSYSCPQYYVATRFGVNA-KVCTALNKAEAMEHHLPFGGFYSCKVGNPLLDDPLYNITQDPKYWPQGCSTGYSSHVAIVDRACQISYCVKNNALSMREQPPLYRPPF 1926
            C+  S+   + VLPG GWDNL N ++G+V+ +SY  C  + DG +LIPD V + P K S VE  S+I   +    S+T+ S+NAD S+ +    ++  FS E  R+K  Q+KE S  +R Q+R+ LY V   P   LD++F  +  +I   + E   T +  YL++ +V D+GTHVI SVDAGATL++ D LK +Y+   + D + ++A+A  +    +  ++ G     ++  + +  N   + +++ GG  F     L+ W+++   NLVAIDR G PL Y + P   P+     V K+A+ +++A  RYY  NT  GC+N++S NFN  ANVD  +CE P T  SFGG +Q C+   PD    C + A KNP T  Y+CP +Y+T  L S     G N  +C  +C    F   ST C   C        ++    WCSST+KT  + G LFGG +     NPLT S SCP  Y   RF  N   +C + +        +PF GF+SC+ GNPL +                C   +S H+A +   CQ+ YCV++   S     P+  PPF
Sbjct:   33 CRKNSSLTALEVLPGGGWDNLRNIDMGRVMNLSYSQCQTTEDGVYLIPDEVFVIPQKVSGVETNSEIIMSWLEQKSSTSSSVNADVSFFS---VLNAKFSTENQRMKTHQVKEGSVTARVQVRNHLYTVKAYPDFTLDSRFAKQAEEIADAI-ENNQTRHANYLSEKLVLDYGTHVITSVDAGATLVQEDYLKMSYISNSQSDKSSVSASAGANFFDKVKFDIGGNTSQGSSQSSSYQGNITYSLIQSHGGALFYPGITLQKWQQSTLNNLVAIDRSGLPLHYFLNPSTFPDLPTPTVNKLASTVRKAAERYYKVNTIPGCVNVDSPNFNFQANVDDASCEGPITNLSFGGIYQRCTPLTPDGNIICDETAQKNPATGGYSCPQHYNTTLLHSEIVEKGFNHYECHTHCHSCGFLGLSTCCDKTCGDSYHVRRAKLETLWCSSTHKTPENSGYLFGGLFGPGIQNPLTKSSSCPPSYFTQRFLSNGMMICMSNDYEIGTRFSVPFAGFFSCQSGNPLSNG------------QSRCPPQFSQHLAAISDGCQVLYCVQSGVFSGGHLKPVRLPPF 591          
BLAST of Macrophage-expressed gene 1 protein vs. Ensembl Zebrafish
Match: mpeg1.3 (macrophage expressed 1, tandem duplicate 3 [Source:ZFIN;Acc:ZDB-GENE-081105-5])

HSP 1 Score: 350.517 bits (898), Expect = 1.938e-107
Identity = 214/619 (34.57%), Postives = 327/619 (52.83%), Query Frame = 1
Query:  253 SRRVHECKLTSNQYPVNVLPGSGWDNLENKELGQVLEISYKGCFGSNDGSFLIPDNVVITPIKKSIVELTSDIFDHFSNVTSTTAMSINADASYSTPSYKISGSFSFEKIRIKNDQIKEKSSISRSQLRHELYEVAFQPHSKLDAKFRNRILDIGALLKEGKDTIYPQYLADLIVRDFGTHVIRSVDAGATLIKTDVLKSNYVKGFKGDTTKIAAAASFSMTTMLSVNLKGTY-VGDTTSLNE-FNSNSASTKVETFGGIPFGSNFKLEDWEKTLETNLVAIDRKGEPLSYAITPKNLPEFDEQAVFKIATLIKEAVNRYYAANTRVGCMNMESENFNDDANVDGGNCEPPNTFYSFGGTFQTCSGPDYQ----CMDVAAKNPVTNSYACPDNYDTIELQSGL-------NKCINYCTKYLF---STQCHYEC--------SQYALYWCSSTNKTKISEGALFGGFYTNTFPNPLTNSYSC-PQYYVATRFGVNAKVCTALNKAEAMEHHLPFGGFYSCKVGNPLLDDPLYNITQDPKYWPQGCSTGYSSHVAIVDRACQISYCVKNNALSMRE-----QPPLYRPPFIDLGFGPNMTVITSLDTPMGVRLSVDENGKW 2019
            S  ++EC   SN   + VLPG GWDNL N ++G+V+ +SY  C  + DG +LIPD V + P K++ VE  S++   + +  S+T+ SINAD S+ +    ++G FS E  RIK  Q+KE S  SR Q+R+ LY V   P+  LD++F  ++ +I   +   + T    YL++ ++ D+GTHVI SV+AGA+L++ D LK +Y+   + D + ++A+A F+      V L  +Y  G  TSLN  +  N   + +++ GG  F     L+ W+++   NLVAIDR G PL Y + P   P+  E  V K+A  + +A  +YY  NT  GC+N++S+NFN  ANVD  +CE P T  SFGG +Q C+         C ++A KNP T  Y+C   Y+T  L+S +        +C + C    F   ST C   C        ++    WC ST K     G +FGG Y  +  NP T SY+C P ++V         VC + +  +A +  +PFGGF+SC+ GNPL +                C   +S H+A +   CQ+ YCV++   S  +      PP   PP + +    ++ V+T L+   G  + V ++  W
Sbjct:   27 SNGLNECHKNSNLVALEVLPGGGWDNLRNIDMGRVMNLSYSQCQTTEDGVYLIPDEVFVIPQKENTVETNSEMIMSWLDQKSSTSSSINADVSFFS---WLNGKFSREHQRIKTHQVKESSVTSRVQVRNRLYTVKAYPNFPLDSRFAQQVEEIADAITNDQ-TRLATYLSEKLILDYGTHVITSVEAGASLVQEDYLKMSYILKNQLDLSSVSASAGFNFFD--KVKLDPSYNGGQKTSLNSSYQGNITYSLIQSHGGALFYPGMTLQKWQESTLNNLVAIDRSGLPLHYFLNPSTFPDISEALVRKLALSVSQAAEQYYKVNTIPGCVNVDSKNFNFQANVDDVSCEGPITNLSFGGMYQQCTPLTIDGSTICDEMAQKNPATGGYSCSQKYNTTLLRSEIIERGYTRYECQDNCRSCGFLGWSTCCSQTCNNVNYIRRAKVDTLWCYSTQKIPEYSGYIFGGLYGPSMQNPFTRSYTCPPNFFVQPILSRAIMVCLSNDYVKATKSAVPFGGFFSCQSGNPLSNG------------ESRCPPQFSQHLAAISDGCQVLYCVQSGVFSGGQLKPVLLPPYTSPPLVGMTVTNSVVVMTDLN---GSLVGVGQSRMW 624          
BLAST of Macrophage-expressed gene 1 protein vs. Ensembl Zebrafish
Match: mpeg1.2 (macrophage expressed 1, tandem duplicate 2 [Source:ZFIN;Acc:ZDB-GENE-050522-305])

HSP 1 Score: 329.717 bits (844), Expect = 3.474e-99
Identity = 201/615 (32.68%), Postives = 310/615 (50.41%), Query Frame = 1
Query:  253 SRRVHECKLTSNQYPVNVLPGSGWDNLENKELGQVLEISYKGCFGSNDGSFLIPDNVVITPIKKSIVELTSDIFDHFSNVTSTTAMSINADASYSTPSYKISGSFSFEKIRIKNDQIKEKSSISRSQLRHELYEVAFQPHSKLDAKFRNRILDIGALLKEGKDTIYPQYLADLIVRDFGTHVIRSVDAGATLIKTDVLKSNYVKGFKGDTTKIAAAASFSMTTMLSVNLKGTYVGDTTSLNEFNSNSASTKVETFGGIPFGSNFKLEDWEKTLETNLVAIDRKGEPLSYAITPKNLPEFDEQAVFKIATLIKEAVNRYYAANTRVGCMNMESENFNDDANVDGGNCEPPNTFYSFGGTFQTCS--GPDYQ--CMDVAAKNPVTNSYACPDNYDTIEL-----QSGLN--KCINYC-TKYLFSTQCHYEC--------SQYALYWCSSTNKTKISEGALFGGFYTNTFPNPLTNSYSCPQYYVATRFGVNA-KVCTALNKAEAMEHHLPFGGFYSCKVGNPLLDDPLYNITQDPKYWPQGCSTGYSSHVAIVDRACQISYCVKNNA-----LSMREQPPLYRPPFIDLGFGPNMTVITSLDTPMGVRLSVDENGKW 2019
            S  + EC+  SN   + VLPG GWDNL N ++G+V+ ++Y  C  + DG +LIPD V + P K S VE  S+    + +  S+T+ SINADASY T    ++G FS E  R+K  Q++  S  +R Q+R+ LY V   P   LD++F  +I ++   + E   T    YL++ ++ ++GTHVI S+DAGATL++ D +K +YV     + + ++A+A  +   M++ N        T+    +  N   + V++ GG  F     ++ W+++ + +LVAIDR G P+ Y + P   P+     + K+A  +++A  RYY  NT  GC +  S+NFN  ANV+  +CE P T  +FGG +QTC+   PD    C + A +NP T  + C   Y    L     Q G N  +C   C + +L    CH  C        +Q   YWCS++     + G LFGG +  +  NP T S+ CP  Y    F  N  ++C + +        +PFGG +SC+ GNP   +               C   YS H+A +   CQ+ YCV++       L     PP  +PP I++     + V+T  D      + V    KW
Sbjct:   24 SNGLRECRQNSNLTALEVLPGGGWDNLRNLDVGRVMNLTYSQCQTTEDGLYLIPDEVFVIPRKTSGVETHSETIMSWLDQRSSTSGSINADASYLT---VLNGKFSEENTRMKIHQVRGNSVTTRVQVRNHLYTVNAYPDFTLDSRFSQQISELADAI-ENNQTRQAMYLSEKVILEYGTHVITSIDAGATLVQEDYIKRSYVSDTNSERSSVSASAGINFFNMVNFNFGSKETEQTSETLTYQQNITYSLVQSHGGALFYQGITMQKWQESTQNHLVAIDRSGLPIHYFLNPAVFPDLPVPTLHKLAFSVQKAAERYYNINTTPGCTDQSSQNFNFQANVNDTSCEGPVTNLTFGGVYQTCTPESPDGNVICDEFAQRNPDTGDFTCRQPYSATRLHSENVQQGYNNYECHEECHSCWLILDCCHQVCGNVYYVRQAQIDTYWCSTSQTVPENTGYLFGGLFGPSLQNPQTKSHDCPANYFEQVFLTNGMRICLSNDYEAGTISSVPFGGLFSCQSGNPQAGNQYR------------CPPQYSQHLATISDGCQVLYCVQSGVFTGGQLKPVHLPPFTKPPLINMMATNTVAVMTEGDKAW---MRVGGTKKW 619          
BLAST of Macrophage-expressed gene 1 protein vs. Ensembl Zebrafish
Match: mpeg1.1 (macrophage expressed 1, tandem duplicate 1 [Source:ZFIN;Acc:ZDB-GENE-030131-7347])

HSP 1 Score: 66.2402 bits (160), Expect = 2.960e-12
Identity = 27/59 (45.76%), Postives = 39/59 (66.10%), Query Frame = 1
Query:  271 CKLTSNQYPVNVLPGSGWDNLENKELGQVLEISYKGCFGSNDGSFLIPDNVVITPIKKS 447
            C+  S+   + VLPG GWDNL N ++G+V+ +SY  C  + DG +LIPD V + P KK+
Sbjct:   33 CRKNSSLTALEVLPGGGWDNLRNIDMGRVMNLSYSQCQTTEDGVYLIPDEVFVIPQKKT 91          
BLAST of Macrophage-expressed gene 1 protein vs. Ensembl Mouse
Match: Pfpl (pore forming protein-like [Source:MGI Symbol;Acc:MGI:1860266])

HSP 1 Score: 379.793 bits (974), Expect = 4.923e-118
Identity = 206/611 (33.72%), Postives = 340/611 (55.65%), Query Frame = 1
Query:  169 LNSIILFIFVYGVLSVSCEIEPNRDQPSSRRVHE-----CKLTSNQYPVNVLPGSGWDNLENKELGQVLEISYKGCFGSNDGSFLIPDNVVITPIKKSIVELTSDIFDHFSNVTSTTAMSINADASYSTPSYKISGSFSFEKIRIKNDQIKEKSSISRSQLRHELYEVAFQPHSKLDAKFRNRILDIGALLKEGKDTIYPQYLADLIVRDFGTHVIRSVDAGATLIKTDVLKSNYVKGFKGDTTKIAAAASFSMTTMLSVNLKGTYVGDTTSLNEFNSNSASTKVETFGGIPFGSNFKLEDWEKTLETNLVAIDRKGEPLSYAITPKNLPEFDEQAVFKIATLIKEAVNRYYAANTRVGCMNMESENFNDDANVDGGNCEPPNTFYSFGGTFQTC---SGPDY--QCMDVAAKNPVTNSYACPDNYDTIELQSGLN-------KCINYCTKYLF-STQCHYEC----SQYALYWCSSTNKTKISEGALFGGFYTNTFPNPLTNSYSCPQYYVATRFGVNAKVCTALNKAEAMEHHLPFGGFYSCKVGNPLLDDPLYNITQDPKYWPQGCSTGYSSHVAIVDRACQISYCVKNNALSMREQPPLYRPPFIDL 1935
            +NS I+ + ++  ++ +       ++ + + +HE     C+   N   + VLPG GWDNL N ++GQV++++Y  C  + DG ++IPD+V   P K+S +E+ S+I D + N  STT+ SIN +  Y     +++G FS E  RIK  Q+++++  +R+Q+R+ +Y V   P+++L+  F+  +++I   L E   T    YLA+L++ ++GTH+I SVDAGATL++ D +KS+Y+K  KG+   +AA+A F+   +++  ++  +         +  N   ++V++ GGIPF     +E W+K +  +LVA+DR G PL + I P+ LP F    V ++A  ++ A   YY  NT  GC N+ S NF+  AN D G+C+       FGG +Q C   SG DY   C+D   KNP+T  ++CP +Y  + L S  +       +C + C   +F  T C  E     ++ + YWC+++++   + G LFGG +T+   NP+TN  SCP  Y   +   N KVC +L+     ++ +PFGGF+SC  GNPL      +   +  + P+ C  G+S  +A +   CQ+SYCVK    +     P   PP+  L
Sbjct:    1 MNSFIVTVLIWTTVAYA------EEEKALKEIHEYGFQKCQNALNLPVLEVLPGGGWDNLRNMDMGQVMDLTYNNCKTTEDGQYIIPDDVFTIPQKESNLEMNSEILDSWENYRSTTSFSINLNLDYRP---RVNGKFSSEFQRIKTTQVRDQAVTTRAQVRNLVYTVKANPNAELNLGFKKELMEICDRL-EKNQTKMATYLAELLILNYGTHIITSVDAGATLVQEDHVKSSYLKNNKGNRAAVAASAGFTFAKVVNFKIETGFEYQNNLATGYLQNRTGSRVQSIGGIPFYPGMTIETWQKGIINHLVAVDRAGLPLHFFIKPEKLPAFPRHLVEQLAKTVETAAESYYNFNTYPGCTNINSPNFDFQANTDDGSCDGKLVNAPFGGVYQLCRQLSGHDYDDMCLDFHQKNPLTGDFSCPPDYTPVHLLSQTHEKGYTGMECRDKCILKIFCRTSCKDEFRVAKAEVSSYWCAASSQVPENSGILFGGVFTDKSINPMTNEPSCPTSYFPLKLFENVKVCVSLDHELGPKYSVPFGGFFSCTKGNPLYGS-FTSGDLEKSFLPK-CPGGFSQQLAAIIDGCQVSYCVKAGVFTRASLAPARLPPYTQL 599          
BLAST of Macrophage-expressed gene 1 protein vs. Ensembl Mouse
Match: Mpeg1 (macrophage expressed gene 1 [Source:MGI Symbol;Acc:MGI:1333743])

HSP 1 Score: 373.629 bits (958), Expect = 1.531e-115
Identity = 201/627 (32.06%), Postives = 342/627 (54.55%), Query Frame = 1
Query:  163 CRLNSIILFIFVYGVLSVSCEIEPNRDQPSSRRVHECKLTSNQYPVNVLPGSGWDNLENKELGQVLEISYKGCFGSNDGSFLIPDNVVITPIKKSIVELTSDIFDHFSNVTSTTAMSINADASYSTPSYKISGSFSFEKIRIKNDQIKEKSSISRSQLRHELYEVAFQPHSKLDAKFRNRILDIGALLKEGKDTIYPQYLADLIVRDFGTHVIRSVDAGATLIKTDVLKSNYVKGFKGDTTKIAAAASFSMTTMLSVNLKGTYVGDTTSLNEFNSNSASTKVETFGGIPFGSNFKLEDWEKTLETNLVAIDRKGEPLSYAITPKNLPEFDEQAVFKIATLIKEAVNRYYAANTRVGCMNMESENFNDDANVDGGNCEPPNTFYSFGGTFQTCS--GPDYQCMDVAAKNPVTNSYACPDNYDTIELQSGLN-------KCINYCTKYLFSTQCHYEC--------SQYALYWCSSTNKTKISEGALFGGFYTNTFPNPLTNSYSCPQYYVATRFGVNAKVCTALNKAEAMEHHLPFGGFYSCKVGNPLLDDPLYNITQDPKYWPQGCSTGYSSHVAIVDRACQISYCVK-----NNALSMREQPPLYRPPFIDLGFGPNMTVITSLDT 1977
            C +NS +  + ++ +++ + E +    +  +     CK       + VLPG GWDNL N ++G+V++++Y  C  + DG ++IPD V   P K+S +E+ S++ + + N  STT++SIN + +  +   +++G FS E  R+K  Q+K+++  +R Q+R+ +Y V   P S+L   F   ++DI   L E   T    YLA+L++ ++GTHVI SVDAGA L++ D ++S+++   +     + A+A  +   +++  ++  Y+  T+   ++ SN  +++V++FGG+PF     LE W+K +  +LVAIDR G PL + I P  LP      V K++  ++ AV  YY  NT  GC N++S NFN  AN+D  +C+   T ++FGG +Q C+    D  C ++  KN +T  ++CP  Y  + L S  +       +C   CT  +F   C   C        +++  YWC +  +   + G LFGG +T+   NP+TN+ SCP  Y+      + KVC +L+     +  +PFGGF+SC +GNPL++       + P    + C  G+S H+A++   CQ+SYCVK       +L     PP  +PP +      N  ++T+ +T
Sbjct:    6 CAMNSFMALVLIWMIIACA-EADKPLGETGTTGFQICKNALKLPVLEVLPGGGWDNLRNVDMGRVMDLTYTNCKTTEDGQYIIPDEVYTIPQKESNLEMNSEVLESWMNYQSTTSLSINTELALFS---RVNGKFSTEFQRMKTLQVKDQAVTTRVQVRNRIYTVKTTPTSELSLGFTKALMDICDQL-EKNQTKMATYLAELLILNYGTHVITSVDAGAALVQEDHVRSSFLLDNQNSQNTVTASAGIAFLNIVNFKVETDYISQTSLTKDYLSNRTNSRVQSFGGVPFYPGITLETWQKGITNHLVAIDRAGLPLHFFIKPDKLPGLPGPLVKKLSKTVETAVRHYYTFNTHPGCTNVDSPNFNFQANMDDDSCDAKVTNFTFGGVYQECTELSGDVLCQNLEQKNLLTGDFSCPPGYTPVHLLSQTHEEGYSRLECKKKCTLKIF---CKTVCEDVFRVAKAEFRAYWCVAAGQVPDNSGLLFGGVFTDKTINPMTNAQSCPAGYIPLNLFESLKVCVSLDYELGFKFSVPFGGFFSCIMGNPLVNSDTAKDVRAPSL--KKCPGGFSQHLAVISDGCQVSYCVKAGIFTGGSLLPVRLPPYTKPPLMS-QVATNTVIVTNSET 621          
BLAST of Macrophage-expressed gene 1 protein vs. UniProt
Match: sp|Q2KJC3|MPEG1_BOVIN (Macrophage-expressed gene 1 protein OS=Bos taurus GN=MPEG1 PE=2 SV=2)

HSP 1 Score: 383.645 bits (984), Expect = 1.707e-118
Identity = 200/561 (35.65%), Postives = 317/561 (56.51%), Query Frame = 1
Query:  304 VLPGSGWDNLENKELGQVLEISYKGCFGSNDGSFLIPDNVVITPIKKSIVELTSDIFDHFSNVTSTTAMSINADASYSTPSYKISGSFSFEKIRIKNDQIKEKSSISRSQLRHELYEVAFQPHSKLDAKFRNRILDIGALLKEGKDTIYPQYLADLIVRDFGTHVIRSVDAGATLIKTDVLKSNYVKGFKGDTTKIAAAASFSMTTMLSVNLKGTYVGDTTSLNEFNSNSASTKVETFGGIPFGSNFKLEDWEKTLETNLVAIDRKGEPLSYAITPKNLPEFDEQAVFKIATLIKEAVNRYYAANTRVGCMNMESENFNDDANVDGGNCEPPNTFYSFGGTFQTC---SGPDY--QCMDVAAKNPVTNSYACPDNYDTIEL-----QSGLN--KCINYCTKYLFSTQCHYEC--------SQYALYWCSSTNKTKISEGALFGGFYTNTFPNPLTNSYSCPQYYVATRFGVNAKVCTALNKAEAMEHHLPFGGFYSCKVGNPLLDDPLYNITQDPKYWPQGCSTGYSSHVAIVDRACQISYCVKNNALSMREQPPLYRPPF 1926
            VLPG GWDNL N + G+V+E++Y  C  + DG +++PD +   P K+S +E+ S I + + N  S+T+ SIN + S  +   K++G FS E  RIK  Q+K+++  ++ Q+R+ +Y V   P ++L   F+  ++DI   L E   T    YLA+L+V ++GTHVI SVDAGA LI+ D ++S++++  +   + + A+A  +   +++   +  Y    T    + SN  +++V++FGG+PF     L+ W++ +  +LVA+DR G PL + I P+ LP+     V K++  ++ AV RYYA NT  GC ++ S NFN  AN D G+CE   T +SFGG +Q C   SG +    C ++  KNP+T S +CP  Y  ++L     + G N  +C   CT Y+F   C   C        +++  +WC+++ +   + G LFGG ++    NPLTN+ SCP  Y   +   N KVC +L+        +PFGGF+SC  GNPL+D         P    + C  G+S H+A++   CQ+SYCVK    +    PP+  PP+
Sbjct:   45 VLPGGGWDNLRNVDTGRVMELAYSHCRTTEDGQYIVPDEIFTIPQKQSNLEMNSKILESWVNYQSSTSNSINMELSLFS---KVNGKFSLEFQRIKTLQVKDQAVTTQVQVRNLVYTVKINPDAELSLGFKKALMDISEQL-ENNQTRMATYLAELLVLNYGTHVITSVDAGAALIQEDHIRSSFLQDSQSSRSAVTASAGITFLNIVNFKFEENYTSQNTFTKSYLSNRTNSRVQSFGGLPFYPGITLQAWQQGVSNHLVAMDRAGLPLYFFINPERLPDLPGPLVRKLSKTVEAAVRRYYAVNTYPGCTDLSSPNFNFQANTDDGSCEGKMTNFSFGGVYQECTQFSGNEVVQLCQNLEQKNPLTGSVSCPSGYSPVQLLTQTHEEGYNHLECSRKCTLYIF---CKTVCEDVFRVARAEFRAFWCAASGQVSENSGLLFGGLFSGKSINPLTNAQSCPAGYFQLKLFENLKVCASLDYELGYRFSIPFGGFFSCAAGNPLVDSATSKDLGAPSL--RKCPGGFSQHLALISDGCQVSYCVKAGLFTGGSLPPVRLPPY 596          
BLAST of Macrophage-expressed gene 1 protein vs. UniProt
Match: sp|Q2M385|MPEG1_HUMAN (Macrophage-expressed gene 1 protein OS=Homo sapiens GN=MPEG1 PE=2 SV=1)

HSP 1 Score: 379.407 bits (973), Expect = 7.322e-117
Identity = 209/618 (33.82%), Postives = 333/618 (53.88%), Query Frame = 1
Query:  262 VHECKLTSNQYPVNVLPGSGWDNLENKELGQVLEISYKGCFGSNDGSFLIPDNVVITPIKKSIVELTSDIFDHFSNVTSTTAMSINADASYSTPSYKISGSFSFEKIRIKNDQIKEKSSISRSQLRHELYEVAFQPHSKLDAKFRNRILDIGALLKEGKDTIYPQYLADLIVRDFGTHVIRSVDAGATLIKTDVLKSNYVKGFKGDTTKIAAAASFSMTTMLSVNLKGTYVGDTTSLNEFNSNSASTKVETFGGIPFGSNFKLEDWEKTLETNLVAIDRKGEPLSYAITPKNLPEFDEQAVFKIATLIKEAVNRYYAANTRVGCMNMESENFNDDANVDGGNCEPPNTFYSFGGTFQTCSGPD-----YQCMDVAAKNPVTNSYACPDNYDTIELQSGLN-------KCINYCTKYLFSTQCHYEC--------SQYALYWCSSTNKTKISEGALFGGFYTNTFPNPLTNSYSCPQYYVATRFGVNAKVCTALNKAEAMEHHLPFGGFYSCKVGNPLLDDPLYNITQDPKYWPQGCSTGYSSHVAIVDRACQISYCVKNNALSMREQPPLYRPPFIDLGFGPNMTVITSLDTPMGVRLSVDENGK-W---SHNHQYKL 2043
            V +CK       + VLPG GWDNL N ++G+V+E++Y  C  + DG ++IPD +   P K+S +E+ S+I + ++N  S+T+ SIN + S  +   K++G FS E  R+K  Q+K+++  +R Q+R+ +Y V   P  +L + FR  +LDI   L E   T    YLA+L+V ++GTHV  SVDAGA LI+ D L++++++  +   + + A+A  +    ++   +  Y         + SN  +++V++ GG+PF     L+ W++ +  +LVAIDR G PL + I P  LP+     V K++  ++ AV RYY  NT  GC ++ S NFN  AN D G+CE   T +SFGG +Q C+          C  +  KNP+T  ++CP  Y  + L S ++       +C   CT  +F   C   C        +++  +WC ++++   + G LFGG +++   NP+TN+ SCP  Y   R   N KVC + +        +PFGGF+SC VGNPL+D  +      P    + C  G+S H A++   CQ+SYCVK+   +    PP   PPF      P +    + +T   V ++  EN + W   S  HQ++L
Sbjct:   31 VQKCKNALKLPVLEVLPGGGWDNLRNVDMGRVMELTYSNCRTTEDGQYIIPDEIFTIPQKQSNLEMNSEILESWANYQSSTSYSINTELSLFS---KVNGKFSTEFQRMKTLQVKDQAITTRVQVRNLVYTVKINPTLELSSGFRKELLDISDRL-ENNQTRMATYLAELLVLNYGTHVTTSVDAGAALIQEDHLRASFLQDSQSSRSAVTASAGLAFQNTVNFKFEENYTSQNVLTKSYLSNRTNSRVQSIGGVPFYPGITLQAWQQGITNHLVAIDRSGLPLHFFINPNMLPDLPGPLVKKVSKTVETAVKRYYTFNTYPGCTDLNSPNFNFQANTDDGSCEGKMTNFSFGGVYQECTQLSGNRDVLLCQKLEQKNPLTGDFSCPSGYSPVHLLSQIHEEGYNHLECHRKCTLLVF---CKTVCEDVFQVAKAEFRAFWCVASSQVPENSGLLFGGLFSSKSINPMTNAQSCPAGYFPLRLFENLKVCVSQDYELGSRFAVPFGGFFSCTVGNPLVDPAISRDLGAPSL--KKCPGGFSQHPALISDGCQVSYCVKSGLFTGGSLPPARLPPFTR----PPLMSQAATNT---VIVTNSENARSWIKDSQTHQWRL 632          
BLAST of Macrophage-expressed gene 1 protein vs. UniProt
Match: sp|Q5RBP9|MPEG1_PONAB (Macrophage-expressed gene 1 protein OS=Pongo abelii GN=MPEG1 PE=2 SV=1)

HSP 1 Score: 379.022 bits (972), Expect = 8.745e-117
Identity = 208/618 (33.66%), Postives = 334/618 (54.05%), Query Frame = 1
Query:  262 VHECKLTSNQYPVNVLPGSGWDNLENKELGQVLEISYKGCFGSNDGSFLIPDNVVITPIKKSIVELTSDIFDHFSNVTSTTAMSINADASYSTPSYKISGSFSFEKIRIKNDQIKEKSSISRSQLRHELYEVAFQPHSKLDAKFRNRILDIGALLKEGKDTIYPQYLADLIVRDFGTHVIRSVDAGATLIKTDVLKSNYVKGFKGDTTKIAAAASFSMTTMLSVNLKGTYVGDTTSLNEFNSNSASTKVETFGGIPFGSNFKLEDWEKTLETNLVAIDRKGEPLSYAITPKNLPEFDEQAVFKIATLIKEAVNRYYAANTRVGCMNMESENFNDDANVDGGNCEPPNTFYSFGGTFQTCSGPD-----YQCMDVAAKNPVTNSYACPDNYDTIELQSGLN-------KCINYCTKYLFSTQCHYEC--------SQYALYWCSSTNKTKISEGALFGGFYTNTFPNPLTNSYSCPQYYVATRFGVNAKVCTALNKAEAMEHHLPFGGFYSCKVGNPLLDDPLYNITQDPKYWPQGCSTGYSSHVAIVDRACQISYCVKNNALSMREQPPLYRPPFIDLGFGPNMTVITSLDTPMGVRLSVDENGK-W---SHNHQYKL 2043
            V +CK       + VLPG GWDNL N ++G+V+E++Y  C  + DG ++IPD +   P K+S +E+ S+I + ++N  S+T+ SIN + S  +   K++G FS E  R+K  Q+K+++  +R Q+R+ +Y V   P  +L+  FR  +LDI   L E   T    YLA+L+V ++GTHVI SVDAGA LI+ D +++++++  +   + + A+A  +    ++   +  Y         + SN  +++V++ GG+PF     L+ W++ +  +LVAIDR G PL + I P  LP+     V K++  ++ AV RYY  NT  GC ++ S NFN  AN D G+CE   T +SFGG +Q C+          C  +  KNP+T  ++CP  Y  + L S ++       +C   CT  +F   C   C        +++  +WC ++++   + G LFGG +++   NP+TN+ SCP  Y       N KVC + +        +PFGGF+SC VGNPL+D  +      P    + C  G+S H+A++   CQ+SYCVK+   +    PP   PPF      P +    + +T   V ++  EN + W   S  HQ++L
Sbjct:   31 VQKCKNALKLPVLEVLPGGGWDNLRNVDMGRVMELTYSNCRTTEDGQYIIPDEIFTIPQKQSNLEMNSEILESWANYQSSTSYSINTELSLFS---KVNGKFSTEFQRMKTLQLKDQAITTRVQVRNLIYTVKINPALELNWSFRKELLDISDRL-ENNQTRMATYLAELLVLNYGTHVITSVDAGAALIQEDHIRASFLQDSQSSRSAVTASAGLAFQNTVNFKFEENYTSQNVLTKSYLSNRTNSRVQSIGGVPFYPGITLQAWQQGITNHLVAIDRSGLPLHFFINPNMLPDLPGPLVKKVSKTVETAVKRYYTFNTYPGCTDLNSPNFNFQANTDDGSCEGKMTNFSFGGVYQECTQLSGNRDVLLCQKLEQKNPLTGDFSCPSGYSPVRLLSQIHEEGYNHLECHRKCTLLVF---CKTVCEDVFQVAKAEFRAFWCVASSQVPENSGLLFGGLFSSKSINPMTNAQSCPAGYFPLSLFENLKVCVSQDYELGSRFAVPFGGFFSCTVGNPLVDPAISRDLGVPSL--KKCPGGFSQHLALISDGCQVSYCVKSGLFTGGSLPPARLPPFTR----PPLMSQAATNT---VIVTNSENARSWIKDSQTHQWRL 632          
BLAST of Macrophage-expressed gene 1 protein vs. UniProt
Match: sp|Q9WV57|MPEG1_RAT (Macrophage-expressed gene 1 protein OS=Rattus norvegicus GN=Mpeg1 PE=2 SV=2)

HSP 1 Score: 376.326 bits (965), Expect = 1.131e-115
Identity = 212/625 (33.92%), Postives = 339/625 (54.24%), Query Frame = 1
Query:  169 LNSIILFIFVYGVLSVSCEIEPNRDQPSSRRVHECKLTSNQYPVNVLPGSGWDNLENKELGQVLEISYKGCFGSNDGSFLIPDNVVITPIKKSIVELTSDIFDHFSNVTSTTAMSINADASYSTPSYKISGSFSFEKIRIKNDQIKEKSSISRSQLRHELYEVAFQPHSKLDAKFRNRILDIGALLKEGKDTIYPQYLADLIVRDFGTHVIRSVDAGATLIKTDVLKSNYVKGFKGDTTKIAAAASFSMTTMLSVNLKGTYVGDTTSLNEFNSNSASTKVETFGGIPFGSNFKLEDWEKTLETNLVAIDRKGEPLSYAITPKNLPEFDEQAVFKIATLIKEAVNRYYAANTRVGCMNMESENFNDDANVDGGNCEPPNTFYSFGGTFQTCS--GPDYQCMDVAAKNPVTNSYACPDNYDTIELQSGLN-------KCINYCTKYLFSTQCHYEC--------SQYALYWCSSTNKTKISEGALFGGFYTNTFPNPLTNSYSCPQYYVATRFGVNAKVCTALNKAEAMEHHLPFGGFYSCKVGNPLLDDPLYNITQDPKYWPQGCSTGYSSHVAIVDRACQISYCVK-----NNALSMREQPPLYRPPFIDLGFGPNMTVITSLDT 1977
            +NS +    ++ +++ +   +P RD P       CK T     + VLPG GWDNL N ++G+V++++Y  C  + DG ++IPD V   P K+S +E+ S+I D + N  STT+ SIN + S  +   K++G FS E  R+K  Q+K+++  +R Q+R+ +Y V   P S+L   F N ++DI   L E   T    YLA+L+V ++GTHVI SVDAGA L++ D ++S+++   +     + A+A  +   +++  ++  +   T     + SN  +++V++FGGIPF     LE W+K +  +LVAIDR G PL + I P  LP      V K++  ++ AV  YY  NT  GC N++S NFN  AN++  +C+   T ++FGG +Q C+    D  C ++  KN +T  ++CP  Y  + L S  +       +C   CT  +F   C   C        +Q+  YWC +T +   + G LFGG +T+   NP+TN+ SCP  Y+      + KVC +L+     +  +PFGGF+SC +GNPL++         P    + C  G+S H+A++   CQ+SYCVK       +L     PP  +PP +      N  ++TS +T
Sbjct:    1 MNSFMAIALIWMMIACAEADKPLRD-PGMTGFQTCKDTLKLPVLEVLPGGGWDNLRNIDMGRVIDLTYTNCKTTEDGQYIIPDEVYTIPQKESNLEMNSEIRDSWVNYQSTTSFSINTELSLFS---KVNGKFSTEFQRMKTLQVKDQAVTTRVQVRNRIYTVKNSPTSELSFGFTNALMDICDQL-EKNQTKMATYLAELLVLNYGTHVITSVDAGAALVQEDHIRSSFLLDNQNSENTVTASAGIAFLNIVNFKVETDHTSQTLLTKSYLSNRTNSRVQSFGGIPFYPGITLETWQKGITNHLVAIDRAGLPLHFFIKPDKLPGLPGGLVKKLSKTVETAVRHYYTFNTHPGCTNVDSPNFNFQANMEDDSCDAKVTNFTFGGLYQECTELSGDALCQNLEQKNLLTGDFSCPSGYTPVHLLSQTHEEGYSRLECKKKCTLKIF---CKTVCEDVFRVAKAQFRAYWCVATGQVPDNSGLLFGGLFTDKSINPMTNAQSCPAGYIPLNLFESLKVCVSLDYELGYKFSVPFGGFFSCIMGNPLVNSDTAKDIGAPSL--KKCPGGFSQHLAVISDGCQVSYCVKAGIFTGGSLLPVRLPPYTKPPLMS-QVATNTVIVTSSET 614          
BLAST of Macrophage-expressed gene 1 protein vs. UniProt
Match: sp|A1L314|MPEG1_MOUSE (Macrophage-expressed gene 1 protein OS=Mus musculus GN=Mpeg1 PE=1 SV=1)

HSP 1 Score: 370.933 bits (951), Expect = 1.181e-113
Identity = 200/625 (32.00%), Postives = 341/625 (54.56%), Query Frame = 1
Query:  169 LNSIILFIFVYGVLSVSCEIEPNRDQPSSRRVHECKLTSNQYPVNVLPGSGWDNLENKELGQVLEISYKGCFGSNDGSFLIPDNVVITPIKKSIVELTSDIFDHFSNVTSTTAMSINADASYSTPSYKISGSFSFEKIRIKNDQIKEKSSISRSQLRHELYEVAFQPHSKLDAKFRNRILDIGALLKEGKDTIYPQYLADLIVRDFGTHVIRSVDAGATLIKTDVLKSNYVKGFKGDTTKIAAAASFSMTTMLSVNLKGTYVGDTTSLNEFNSNSASTKVETFGGIPFGSNFKLEDWEKTLETNLVAIDRKGEPLSYAITPKNLPEFDEQAVFKIATLIKEAVNRYYAANTRVGCMNMESENFNDDANVDGGNCEPPNTFYSFGGTFQTCS--GPDYQCMDVAAKNPVTNSYACPDNYDTIELQSGLN-------KCINYCTKYLFSTQCHYEC--------SQYALYWCSSTNKTKISEGALFGGFYTNTFPNPLTNSYSCPQYYVATRFGVNAKVCTALNKAEAMEHHLPFGGFYSCKVGNPLLDDPLYNITQDPKYWPQGCSTGYSSHVAIVDRACQISYCVK-----NNALSMREQPPLYRPPFIDLGFGPNMTVITSLDT 1977
            +NS +  + ++ +++ + E +    +  +     CK       + VLPG GWDNL N ++G+V++++Y  C  + DG ++IPD V   P K+S +E+ S++ + + N  STT++SIN + +  +   +++G FS E  R+K  Q+K+++  +R Q+R+ +Y V   P S+L   F   ++DI   L E   T    YLA+L++ ++GTHVI SVDAGA L++ D ++S+++   +     + A+A  +   +++  ++  Y+  T+   ++ SN  +++V++FGG+PF     LE W+K +  +LVAIDR G PL + I P  LP      V K++  ++ AV  YY  NT  GC N++S NFN  AN+D  +C+   T ++FGG +Q C+    D  C ++  KN +T  ++CP  Y  + L S  +       +C   CT  +F   C   C        +++  YWC +  +   + G LFGG +T+   NP+TN+ SCP  Y+      + KVC +L+     +  +PFGGF+SC +GNPL++       + P    + C  G+S H+A++   CQ+SYCVK       +L     PP  +PP +      N  ++T+ +T
Sbjct:    1 MNSFMALVLIWMIIACA-EADKPLGETGTTGFQICKNALKLPVLEVLPGGGWDNLRNVDMGRVMDLTYTNCKTTEDGQYIIPDEVYTIPQKESNLEMNSEVLESWMNYQSTTSLSINTELALFS---RVNGKFSTEFQRMKTLQVKDQAVTTRVQVRNRIYTVKTTPTSELSLGFTKALMDICDQL-EKNQTKMATYLAELLILNYGTHVITSVDAGAALVQEDHVRSSFLLDNQNSQNTVTASAGIAFLNIVNFKVETDYISQTSLTKDYLSNRTNSRVQSFGGVPFYPGITLETWQKGITNHLVAIDRAGLPLHFFIKPDKLPGLPGPLVKKLSKTVETAVRHYYTFNTHPGCTNVDSPNFNFQANMDDDSCDAKVTNFTFGGVYQECTELSGDVLCQNLEQKNLLTGDFSCPPGYSPVHLLSQTHEEGYSRLECKKKCTLKIF---CKTVCEDVFRVAKAEFRAYWCVAAGQVPDNSGLLFGGVFTDKTINPMTNAQSCPAGYIPLNLFESLKVCVSLDYELGFKFSVPFGGFFSCIMGNPLVNSDTAKDVRAPSL--KKCPGGFSQHLAVISDGCQVSYCVKAGIFTGGSLLPVRLPPYTKPPLMS-QVATNTVIVTNSET 614          
BLAST of Macrophage-expressed gene 1 protein vs. TrEMBL
Match: tr|A7SEK6|A7SEK6_NEMVE (Predicted protein (Fragment) OS=Nematostella vectensis GN=v1g115372 PE=4 SV=1)

HSP 1 Score: 421.009 bits (1081), Expect = 2.938e-132
Identity = 220/551 (39.93%), Postives = 319/551 (57.89%), Query Frame = 1
Query:  304 VLPGSGWDNLENKELGQVLEISYKGCFGSNDGSFLIPDNVVITPIKKSIVELTSDIFDHFSNVTSTTAMSINADASYSTPSYKISGSFSFEKIRIKNDQIKEKSSISRSQLRHELYEVAFQPHSKLDAKFRNRILDIGALLKEGKDTIYPQYLADLIVRDFGTHVIRSVDAGATLIKTDVLKSNYVKGFKGDTTKIAAAASFSMTTMLSVNLKGTYVGDTTSLNEFNSNSASTKVETFGGIPFGSNFKLEDWEKTLETNLVAIDRKGEPLSYAITPKNLPEFDEQAVFKIATLIKEAVNRYYAANTRVGCMNMESENFNDDANVDGGNCEPPNTFYSFGGTFQTC----SGPDYQCMDVAAKNPVTNSYACPDNYDTIELQSGL--NKCINYCTK-YLFSTQCHYEC--SQYALYWCSSTNKTKISEGALFGGFYTNTFPNPLTNSYSCPQYYVATRFGVNAKVCTALNKAEAMEHHLPFGGFYSCKVGNPLLDDPLYNITQDPKYWPQGCSTGYSSHVAIVDRACQISYCVKNNALSMREQPPLYRPPFI 1929
            VLPG GWDNL N  +G V  ++Y  C  S+DG FL+PDNV + P+KKS V   ++ +DH++N +STT  SINA+A  S     +SGSFS E   +K  Q+++K+  +R QLRH  Y    QP S L   F++R+L+I + L+   +T Y  +LA ++VRDFGTH + SVDAGA L K D L   +V     D +KI A+AS S       +   +   DT +L+E+   +  +   T+GG PF  NF + +WE  +   LVA+DR G+PL Y ITP +LPE  EQA F++A ++K A+ +YY  NT  GC  M+S NF+  AN+D G+C+ P   Y+FGG +QTC    S     C  +A KNP+T  Y C   Y+ + +  G     C   C + +LF  +C  +C    ++ YWC + +    + G LFGG Y++   NPLT  +SCP  + A +FG   KVC + +     +  LPFGGF+SC  GNPL         + P    +GC TG+S H+  ++  C+I YCVK+N  +++  P + RPP++
Sbjct:    2 VLPGGGWDNLRNLHMGAVSAMNYSLCRSSDDGKFLVPDNVFLYPVKKSKVNTFAEFYDHWNNYSSTTTKSINAEAKASFGFGSVSGSFSSEYESVKKHQVEDKTVTTRVQLRHVFYTAKLQPDSPLQPAFKDRLLEIASHLQH-NNTAYASFLAQVLVRDFGTHYVSSVDAGAVLAKVDHLTKKFVADSNEDKSKITASASASFFHFFGASGSYSKSTDTKTLDEYTKATVYSTTYTYGGPPFRVNFTINEWEDKMLDELVAVDRSGDPLHYTITPGSLPELCEQATFQLAAVVKNAIKQYYIHNTIKGCTKMDSPNFSFQANMDDGSCQSPTNNYTFGGVYQTCQTDGSPSSDPCAPLAQKNPLTADYTCTPGYEPVLVHQGRTPQSCHKDCHRVWLFFKRCSVQCGFGSFSTYWCVAKSAVPANSGYLFGGLYSDVLKNPLTQDHSCPLKFYALKFGATMKVCVSDDYELGYQQSLPFGGFFSCNAGNPL-------AFKKPPTGDKGCPTGFSQHLGAIEANCEIQYCVKSNVFNLQGLPIVRRPPYL 544          
BLAST of Macrophage-expressed gene 1 protein vs. TrEMBL
Match: tr|K1RDW7|K1RDW7_CRAGI (Uncharacterized protein OS=Crassostrea gigas GN=CGI_10027905 PE=4 SV=1)

HSP 1 Score: 390.963 bits (1003), Expect = 9.144e-119
Identity = 208/581 (35.80%), Postives = 316/581 (54.39%), Query Frame = 1
Query:  274 KLTSNQYPVNVLPGSGWDNLENKELGQVLEISYKGCFGSNDGSFLIPDNVVITPIKKSIVELTSDIFDHFSNVTSTTAMSINADASYSTPSYKISGSFSFEKIRIKNDQIKEKSSISRSQLRHELYEVAFQPHSKLDAKFRNRILDIGALLKEGKDTIYPQYLADLIVRDFGTHVIRSVDAGATLIKTDVLKSNYVKGFKGDTTKIAAAASFSMTTMLSVNLKGTYVGDTTSLNEFNSNSASTKVETFGGIPFG-SNFKLEDWEKTLETNLVAIDRKGEPLSYAITPKNLPEFDEQAVFKIATLIKEAVNRYYAANTRVGCMNMESENFNDDANVDGGNCEPPNTFYSFGGTFQTC--SGPDYQ--CMDVAAKNPVTNSYACPDNYDTIELQSGL------NKCINYCTKYLFSTQCH----YECSQYALYWCSSTNKTKISEGALFGGFYTNTFPNPLTNSYSCPQYYVATRFGVNAKVCTALNKAEAMEHHLPFGGFYSCKVGNPLL---------DDPLYNITQDPKY---WPQGCSTGYSSHVAIVDRACQISYCVKNNALSMREQPPLYRPPFIDL 1935
            K+  N     VLPG GWDNL+NKE G +++ +Y  C  ++DG +LIPD V   P+K S +E+  ++F H++N TSTT+ S+N +A     S+ ISG +S E   ++  QI ++S  +R Q R+  Y    QP + L+  FR+R+ +I   ++  K T   +Y + L+VRD+GTHVI SV AGA + + D +K+ +   +  D  ++ AAAS S   + +V  +  +   T  ++++  N   + +   GG  F  +NF L  W   L  +LVA+D+ G P+   I+ + LPE     +F +   +K AV  YY  N   GC +++S NF+  ANVD G CE P T Y FGG +Q C  SG   Q  C  +  KNP+T + +CP  Y+++ L  G        +  ++C     S  C     Y  ++Y  +WC + +      G  FGG YTN   NPLT S  CP Y+   + G+  +VC + +      + +PF G +SC  GNPL           D L +++  PK    WP+GC TGYS H+A ++ +C+I+YCVK NA S +  PP+  PPF+DL
Sbjct:   46 KMGGNVARFEVLPGLGWDNLQNKEAGMLVQYNYSECRTTDDGRYLIPDGVFTVPLKSSQLEVFGELFQHWNNFTSTTSSSVNVEAGLHLGSFGISGKYSHESESVRKHQIMDRSVTTRVQARYARYSALLQPDTPLNPAFRDRLRNIAYYMQTNK-TNMARYHSQLLVRDYGTHVISSVQAGAIISQLDQIKTTFSNSYSMDRRQVVAAASASFMNVFNVGAEYKHSTSTEVIDQYLGNRTHSVINAIGGPVFQPNNFTLNQWASGLSGDLVAVDKSGYPIYELISAQTLPELPPSILFPLIQTVKSAVEEYYKFNIYRGCTDLDSPNFSFIANVDDGTCESPETNYKFGGVYQQCKQSGQLSQNLCNGLVQKNPLTGAQSCPSGYESVLLNEGTRSATESRRSCHHCGFLGLSHCCDNNNVYGSAKYQSFWCVAQDHVNQQSGFQFGGIYTNKIDNPLTQSRGCPLYFHPLKLGLGMQVCVSDDYELGFRYSVPFAGLFSCMTGNPLAVHQDTSFKNPDILQSLSSYPKASNNWPRGCPTGYSMHLATIENSCEINYCVKANAFSDKGLPPVRHPPFMDL 625          
BLAST of Macrophage-expressed gene 1 protein vs. TrEMBL
Match: tr|K1PUA9|K1PUA9_CRAGI (Uncharacterized protein OS=Crassostrea gigas GN=CGI_10002181 PE=4 SV=1)

HSP 1 Score: 390.193 bits (1001), Expect = 1.319e-118
Identity = 207/581 (35.63%), Postives = 316/581 (54.39%), Query Frame = 1
Query:  274 KLTSNQYPVNVLPGSGWDNLENKELGQVLEISYKGCFGSNDGSFLIPDNVVITPIKKSIVELTSDIFDHFSNVTSTTAMSINADASYSTPSYKISGSFSFEKIRIKNDQIKEKSSISRSQLRHELYEVAFQPHSKLDAKFRNRILDIGALLKEGKDTIYPQYLADLIVRDFGTHVIRSVDAGATLIKTDVLKSNYVKGFKGDTTKIAAAASFSMTTMLSVNLKGTYVGDTTSLNEFNSNSASTKVETFGGIPFG-SNFKLEDWEKTLETNLVAIDRKGEPLSYAITPKNLPEFDEQAVFKIATLIKEAVNRYYAANTRVGCMNMESENFNDDANVDGGNCEPPNTFYSFGGTFQTC--SGPDYQ--CMDVAAKNPVTNSYACPDNYDTIELQSGLNKCI------NYCTKYLFSTQCH----YECSQYALYWCSSTNKTKISEGALFGGFYTNTFPNPLTNSYSCPQYYVATRFGVNAKVCTALNKAEAMEHHLPFGGFYSCKVGNPLL---------DDPLYNITQDPKY---WPQGCSTGYSSHVAIVDRACQISYCVKNNALSMREQPPLYRPPFIDL 1935
            K+  N     VLPG GWDNL+NK+ G +++ +Y  C  ++DG +LIPD V   P+K S +E+  ++F H++N TSTT+ S+N +A     S+ ISG +S E   ++  QI ++S  +R Q R+  Y    QP + L+  FR+R+ +I   ++  K T   +Y + L+VRD+GTHVI SV AGA + + D +K+ +   +  D  ++ AAAS S  ++ +V  +  +   T  ++++  N   + +   GG  F  +NF L  W   L  +LVA+D+ G P+   I+ + LPE     +F +   +K AV  YY  N   GC N++S NF+  ANVD G CE P T Y+FGG +Q C  SG   Q  C  +  KNP+T + +CP  Y+++ L  G           ++C        C     Y  ++Y  +WC +        G  FGG YTN   NPLT S  CP Y+   + G+  +VC + +      + +PF G +SC  GNPL           D L++++   K    WP+GC TGYS H+A ++ +C+I+YCVK NA S +  PP+ RPPF+DL
Sbjct:   46 KMGGNVARFEVLPGLGWDNLQNKDAGMLVQYNYSECRTTDDGRYLIPDGVFTVPLKSSKLEVFGELFQHWNNFTSTTSSSVNVEAGLHLGSFGISGKYSHESESVRKHQIMDRSVTTRVQARYARYSALLQPDTPLNPAFRDRLRNIAYYIQTNK-TNMARYQSQLLVRDYGTHVISSVQAGAIISQLDQIKTTFSNSYSMDRRQVVAAASASFMSVFNVGAEYKHSTSTEVIDQYLGNRTHSVINAIGGPVFQPNNFTLNQWASGLSGDLVAVDKSGYPIYELISAQTLPELPPSILFPLVQTVKSAVEEYYKFNIYRGCTNLDSPNFSFIANVDDGTCESPETNYTFGGVYQQCKQSGQLSQNLCNGLVQKNPLTGAQSCPSGYESVLLNEGTRSATESRRRCHHCGFLGLRHCCDNYNVYGSAKYQSFWCVAQGHVDQQSGFQFGGIYTNKIDNPLTQSRGCPLYFYPLKLGLGMQVCVSDDYELGFRYSVPFAGLFSCMTGNPLAVHQDTSFKNPDMLHSLSSYLKASNNWPRGCPTGYSMHLATIENSCEINYCVKANAFSDKGLPPVRRPPFMDL 625          
BLAST of Macrophage-expressed gene 1 protein vs. TrEMBL
Match: tr|G1KFN1|G1KFN1_ANOCA (Uncharacterized protein OS=Anolis carolinensis GN=MPEG1 PE=4 SV=1)

HSP 1 Score: 388.267 bits (996), Expect = 4.209e-118
Identity = 224/652 (34.36%), Postives = 359/652 (55.06%), Query Frame = 1
Query:  181 ILFIFVYGVLSVSCEIEPNRDQPSSRR-VHECKLTSNQYPVNVLPGSGWDNLENKELGQVLEISYKGCFGSNDGSFLIPDNVVITPIKKSIVELTSDIFDHFSNVTSTTAMSINADASYSTPSYKISGSFSFEKIRIKNDQIKEKSSISRSQLRHELYEVAFQPHSKLDAKFRNRILDIGALLKEGKDTIYPQYLADLIVRDFGTHVIRSVDAGATLIKTDVLKSNYVKGFKGDTTKIAAAASFSMTTMLSVNLKGTYVGDTTSLNEFNSNSASTKVETFGGIPFGSNFKLEDWEKTLETNLVAIDRKGEPLSYAITPKNLPEFDEQAVFKIATLIKEAVNRYYAANTRVGCMNMESENFNDDANVDGGNCEPPNTFYSFGGTFQTCS---GPDYQ--CMDVAAKNPVTNSYACPDNYDTI-----ELQSGLNK--CINYCTKYLFSTQCHYECS--------QYALYWCSSTNKTKISEGALFGGFYTNTFPNPLTNSYSCPQYYVATRFGVNAKVCTALNKAEAMEHHLPFGGFYSCKVGNPLLDDPLYNITQDPKYWPQGCSTGYSSHVAIVDRACQISYCV-----KNNALSMREQPPLYRPPFIDLGFGPNMTVITSLDTPMGVRLSVDENGKW---SHNHQYKLSN 2049
            ++FIF       S  +E +  QPSS     EC+ T  +  + VLPG GWDNL+N+ +G+V+ ++Y  C  + DG++LIP++V   P+K++ +EL S+I + + +  S T+ SINA+ S S     I+G FS +   +K  Q+K+++  +R Q+R+ +Y V F P ++ D  F+ +++ I + L E   T    YLA+++V ++GTHVI  VDAGA+LI+ D ++S +VK  K   + I AAA  S   +++     +   D + + ++ +N  +++VE+ GG+PF     L+ W++++   LVAIDR G PL + ITP+ LP      V +++  +  A+ RYY  NT  GC N  S NFN  AN+D G CE     ++FGG +Q C+   GPD    C  +A +NP+T +Y+CP  Y +I     EL+ G N   C N C  +++   C   C         Q++ YWC++T     + G LFGG ++    NP+TN+ SCP  Y   +     KVC + ++     + +PFGGF+SC+VGNPL+    +N T +  Y P+ C TG+S H+A++   C++ YCV        +L     PP  R P I+L           +DT   + ++ +    W   S  H +K+ N
Sbjct:    7 LVFIFW-----TSWALESHPVQPSSASGFQECRQTLGRPALEVLPGGGWDNLQNRAMGRVIHLNYSLCRTTEDGAYLIPNDVFTIPLKETYLELNSEIIESWMDYQSATSASINAELSTSF----INGKFSSDFRWMKTHQVKDQTVTTRVQVRNRMYTVKFDPAARFDEGFQQQLVAIASHL-ENNQTRAADYLAEILVLNYGTHVITGVDAGASLIQEDQVRSTFVKDSKFMRSSITAAAGVSFHKVVNFQSSLSVGIDDSFIKQYEANRTNSRVESIGGLPFYPGITLKTWQESIPNRLVAIDRFGLPLEFFITPEKLPGLPNPIVKRLSKTVASAITRYYTFNTYPGCTNAASPNFNFYANMDDGTCEGTGNNFTFGGAYQVCAQLEGPDAATLCAGLAQRNPLTGAYSCPTGYISIQLGSQELEEGYNHWDCHNDC--FVWKLFCKRVCKDIFTLSKVQFSTYWCAATGIVPKNSGFLFGGLFSTKNNNPMTNAQSCPSMYYQLKLFDQLKVCVSRDE-RGQRYSVPFGGFFSCQVGNPLVG--FHNGTDNDPY-PKRCPTGFSQHLALISDGCEVDYCVPAGRFTEGSLPQARLPPFNRKPTINL-----------IDTDTILVMNSNSGQTWIKDSQTHLWKIGN 631          
BLAST of Macrophage-expressed gene 1 protein vs. TrEMBL
Match: tr|F8RU73|F8RU73_CRAGI (Macrophage expressed protein OS=Crassostrea gigas PE=2 SV=1)

HSP 1 Score: 388.267 bits (996), Expect = 7.109e-118
Identity = 205/581 (35.28%), Postives = 315/581 (54.22%), Query Frame = 1
Query:  274 KLTSNQYPVNVLPGSGWDNLENKELGQVLEISYKGCFGSNDGSFLIPDNVVITPIKKSIVELTSDIFDHFSNVTSTTAMSINADASYSTPSYKISGSFSFEKIRIKNDQIKEKSSISRSQLRHELYEVAFQPHSKLDAKFRNRILDIGALLKEGKDTIYPQYLADLIVRDFGTHVIRSVDAGATLIKTDVLKSNYVKGFKGDTTKIAAAASFSMTTMLSVNLKGTYVGDTTSLNEFNSNSASTKVETFGGIPFG-SNFKLEDWEKTLETNLVAIDRKGEPLSYAITPKNLPEFDEQAVFKIATLIKEAVNRYYAANTRVGCMNMESENFNDDANVDGGNCEPPNTFYSFGGTFQTC--SGPDYQ--CMDVAAKNPVTNSYACPDNYDTIELQSGLNKCI------NYCTKYLFSTQCH----YECSQYALYWCSSTNKTKISEGALFGGFYTNTFPNPLTNSYSCPQYYVATRFGVNAKVCTALNKAEAMEHHLPFGGFYSCKVGNPLL---------DDPLYNITQDPKY---WPQGCSTGYSSHVAIVDRACQISYCVKNNALSMREQPPLYRPPFIDL 1935
            K+  N     VLPG GWDNL+NK+ G +++ +Y  C  ++DG +LIPD V   P+K S +E+  ++F H++N TSTT+ S+N +A     S+ ISG +S E   ++  QI ++S  +R Q R+  Y    QP + L+  FR+R+ +I   ++  K  +  +Y + L+VRD+GTHVI  V AGA + + D +K+ +   +  D  ++ AAAS S  ++ +V  +  +   T  ++++  N   + +   GG  F  +NF L  W   L  +LVA+D+ G P+   I+ + LPE     +F +   +K AV  YY  N   GC N++S NF+  ANVD G CE P T Y+FGG +Q C  SG   Q  C  +  KNP+T + +CP  Y+++ L  G           ++C        C     Y  ++Y  +WC +        G  FGG YTN   NPLT S  CP Y+   + G+  +VC + +      + +PF G +SC  GNPL           D L++++   K    WP+GC TGYS H+A ++ +C+I+YCVK NA S +  PP+ RPPF+DL
Sbjct:   46 KMGGNVARFEVLPGLGWDNLQNKDAGMLVQYNYSECRTTDDGRYLIPDGVYTVPLKSSKLEVFGELFQHWNNFTSTTSSSVNVEAGLHLGSFGISGKYSHESESVRKHQIMDRSVTTRVQARYARYSALLQPDTPLNPAFRDRLRNIAYYIQTNKTNM-ARYQSQLLVRDYGTHVISDVQAGAIISQLDQIKTTFSNSYSMDRRQVVAAASASFMSVFNVGAEYKHSTSTEVIDQYLGNRTHSVINAIGGPVFQPNNFTLNQWASGLSGDLVAVDKSGYPIYELISAQTLPELPPSILFPLVQTVKSAVEEYYKFNIYRGCTNLDSPNFSFIANVDDGTCESPETNYTFGGVYQQCKQSGQLSQNLCNGLVQKNPLTGAQSCPSGYESVLLNEGTRSATESRRRCHHCGFLGLRHCCDNYNVYGSAKYQSFWCVAQGHVDQQSGFQFGGIYTNKIDNPLTQSRGCPLYFYPLKLGLGMQVCVSDDYELGFRYSVPFAGLFSCMTGNPLAVHQDTSFKNPDMLHSLSSYLKASNNWPRGCPTGYSMHLATIENSCEINYCVKANAFSDKGLPPVRRPPFMDL 625          
The following BLAST results are available for this feature:
BLAST of Macrophage-expressed gene 1 protein vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Ensembl Human)
Total hits: 1
Match NameE-valueIdentityDescription
MPEG11.425e-11733.82macrophage expressed 1 [Source:HGNC Symbol;Acc:HGN... [more]
back to top
BLAST of Macrophage-expressed gene 1 protein vs. Ensembl Celegans
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Ensembl Celegan)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Macrophage-expressed gene 1 protein vs. Ensembl Fly
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Ensembl Drosophila)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Macrophage-expressed gene 1 protein vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Ensembl Zebrafish)
Total hits: 4
Match NameE-valueIdentityDescription
mpeg1.11.234e-10736.00macrophage expressed 1, tandem duplicate 1 [Source... [more]
mpeg1.31.938e-10734.57macrophage expressed 1, tandem duplicate 3 [Source... [more]
mpeg1.23.474e-9932.68macrophage expressed 1, tandem duplicate 2 [Source... [more]
mpeg1.12.960e-1245.76macrophage expressed 1, tandem duplicate 1 [Source... [more]
back to top
BLAST of Macrophage-expressed gene 1 protein vs. Ensembl Xenopus
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Ensembl Xenopus)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Macrophage-expressed gene 1 protein vs. Ensembl Mouse
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Ensembl Mouse)
Total hits: 2
Match NameE-valueIdentityDescription
Pfpl4.923e-11833.72pore forming protein-like [Source:MGI Symbol;Acc:M... [more]
Mpeg11.531e-11532.06macrophage expressed gene 1 [Source:MGI Symbol;Acc... [more]
back to top
BLAST of Macrophage-expressed gene 1 protein vs. UniProt
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q2KJC3|MPEG1_BOVIN1.707e-11835.65Macrophage-expressed gene 1 protein OS=Bos taurus ... [more]
sp|Q2M385|MPEG1_HUMAN7.322e-11733.82Macrophage-expressed gene 1 protein OS=Homo sapien... [more]
sp|Q5RBP9|MPEG1_PONAB8.745e-11733.66Macrophage-expressed gene 1 protein OS=Pongo abeli... [more]
sp|Q9WV57|MPEG1_RAT1.131e-11533.92Macrophage-expressed gene 1 protein OS=Rattus norv... [more]
sp|A1L314|MPEG1_MOUSE1.181e-11332.00Macrophage-expressed gene 1 protein OS=Mus musculu... [more]
back to top
BLAST of Macrophage-expressed gene 1 protein vs. TrEMBL
Analysis Date: 2017-05-17 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
tr|A7SEK6|A7SEK6_NEMVE2.938e-13239.93Predicted protein (Fragment) OS=Nematostella vecte... [more]
tr|K1RDW7|K1RDW7_CRAGI9.144e-11935.80Uncharacterized protein OS=Crassostrea gigas GN=CG... [more]
tr|K1PUA9|K1PUA9_CRAGI1.319e-11835.63Uncharacterized protein OS=Crassostrea gigas GN=CG... [more]
tr|G1KFN1|G1KFN1_ANOCA4.209e-11834.36Uncharacterized protein OS=Anolis carolinensis GN=... [more]
tr|F8RU73|F8RU73_CRAGI7.109e-11835.28Macrophage expressed protein OS=Crassostrea gigas ... [more]
back to top
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2016-09-29
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
NoneNo IPR availableTMHMMTMhelixcoord: 21..38
NoneNo IPR availableTMHMMTMhelixcoord: 7..29
NoneNo IPR availableTMHMMTMhelixcoord: 10..29
NoneNo IPR availableTMHMMTMhelixcoord: 7..28
NoneNo IPR availableTMHMMTMhelixcoord: 7..26
NoneNo IPR availableTMHMMTMhelixcoord: 5..22
NoneNo IPR availableTMHMMTMhelixcoord: 27..49
NoneNo IPR availableCOILSCoilCoilcoord: 710..714
NoneNo IPR availableTMHMMTMhelixcoord: 644..666
NoneNo IPR availableTMHMMTMhelixcoord: 4..23
IPR020864Membrane attack complex component/perforin (MACPF) domainSMARTSM00457MACPF_8coord: 162..362
e-value: 0.0013
score: 24.8
IPR020864Membrane attack complex component/perforin (MACPF) domainPFAMPF01823MACPFcoord: 144..349
e-value: 9.9E-22
score: 77.9
IPR020864Membrane attack complex component/perforin (MACPF) domainPROSITEPS51412MACPF_2coord: 35..364
score: 15.284

Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: INTERPRO
TermDefinition
IPR020864MACPF
Vocabulary: cellular component
TermDefinition
GO:0016020membrane
GO:0016021integral component of membrane
Vocabulary: Schmidtea mediterranea Developmental Stages
TermDefinition
PLANA:0000004Stage 4
PLANA:0000002Stage 2
PLANA:0000003Stage 3
PLANA:0000005Stage 5
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000023temporary embryonic pharynx
PLANA:0000085primitive gut cell
PLANA:0000059embryonic gut cell
PLANA:0000058embryonic digestive system
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30015696 ID=SMED30015696|Name=Macrophage-expressed gene 1 protein|organism=Schmidtea mediterranea sexual|type=transcript|length=2665bp
AGTCGCGATAGCACGCAACGTCGACATTGCGATGACGTAATCATTGTGAA
TCTCTACTACAATCGGATCATTCTAATCACGTGCATCCTAAAACAATATA
AATCTTACAAACGGGAATCCAATTGAACATTTATTTACTCAAGCGTGAAA
CCAATGATACCGTGTAGACTTAATAGTATAATATTGTTTATATTTGTTTA
TGGAGTTCTATCGGTTTCATGTGAAATTGAACCTAACCGAGATCAACCAT
CTTCAAGACGAGTTCATGAGTGTAAACTCACCAGCAACCAATATCCAGTG
AATGTTCTTCCCGGATCTGGGTGGGATAATCTTGAAAACAAAGAACTCGG
TCAAGTTTTAGAAATTTCATATAAAGGATGTTTTGGATCGAATGATGGAA
GCTTTCTCATTCCAGACAATGTGGTGATCACCCCAATAAAGAAATCTATT
GTCGAGTTAACTTCAGATATATTTGACCATTTCTCAAATGTCACCTCTAC
AACGGCGATGTCTATCAACGCCGATGCCAGTTACTCAACACCAAGCTACA
AAATCAGTGGATCATTTTCATTTGAAAAAATAAGAATAAAAAACGATCAA
ATCAAAGAAAAGTCGTCGATTTCGAGATCCCAGTTAAGACATGAATTATA
TGAAGTAGCGTTCCAACCACACTCAAAACTAGACGCAAAATTCAGAAACA
GAATTCTAGATATTGGAGCGTTATTGAAAGAAGGAAAAGACACAATTTAT
CCACAATATTTAGCGGATTTAATTGTCCGTGACTTCGGCACTCACGTCAT
TCGGTCGGTGGATGCGGGAGCGACACTAATAAAGACTGATGTTTTAAAAT
CGAATTATGTCAAAGGTTTTAAAGGGGATACAACTAAGATTGCAGCTGCG
GCATCATTCAGTATGACAACAATGCTTTCAGTCAACCTCAAAGGAACCTA
TGTTGGTGATACCACGAGTCTCAATGAATTCAATAGTAATAGTGCAAGTA
CAAAAGTCGAAACTTTTGGTGGTATACCGTTTGGTTCGAATTTTAAGTTG
GAAGATTGGGAGAAAACCCTTGAAACGAATTTGGTAGCAATTGATCGCAA
AGGTGAACCGTTGTCCTATGCTATCACACCAAAAAATCTTCCAGAATTCG
ATGAACAAGCAGTTTTCAAAATAGCTACGCTCATCAAAGAAGCAGTCAAT
AGATATTATGCAGCCAACACGAGAGTGGGATGTATGAATATGGAGTCAGA
AAATTTCAATGACGACGCAAATGTTGACGGTGGAAACTGCGAACCTCCTA
ATACATTTTACAGTTTTGGAGGAACTTTTCAAACCTGCTCAGGCCCTGAT
TATCAGTGTATGGATGTCGCGGCAAAAAACCCAGTGACCAATAGTTATGC
TTGTCCTGATAACTATGATACCATTGAATTACAAAGTGGATTGAATAAAT
GCATAAATTATTGCACCAAATACTTATTTTCCACTCAATGTCATTACGAG
TGTTCCCAATATGCATTGTATTGGTGTTCTTCTACAAACAAAACGAAAAT
ATCAGAAGGCGCACTTTTCGGGGGATTCTACACTAATACATTTCCGAATC
CACTTACAAATTCCTATAGTTGTCCACAATACTATGTAGCGACAAGATTC
GGCGTAAACGCCAAGGTTTGCACTGCACTCAATAAGGCAGAGGCTATGGA
ACACCATTTGCCGTTTGGAGGATTTTATAGTTGCAAAGTTGGAAATCCTC
TACTAGATGATCCTCTCTACAACATTACACAGGATCCCAAATATTGGCCT
CAAGGTTGTTCAACCGGATATTCATCACATGTAGCTATTGTCGACAGAGC
TTGTCAAATTTCCTATTGCGTTAAAAATAACGCCCTTAGCATGAGAGAGC
AACCGCCTCTCTACCGACCACCTTTTATTGATTTGGGATTTGGACCCAAT
ATGACAGTAATTACCTCTCTGGACACTCCAATGGGGGTCCGATTATCTGT
TGATGAAAACGGGAAATGGAGTCATAATCACCAATACAAATTATCCAATT
ACAATATTATAATAATATCAGTCATTATGGCGGCAGGAGCCAGCATTGCA
ATTATTATTATAATTCTTGGAGTTCAAAGATTCAGCAGAAACCGAAAAGG
TCAAGTCTCACCGGAATCTCATGAATTTGATAGCAGATATGATTCTACTA
AAGATGTTGCCAATCTTGCGTTACCCGGCGAGGTTCCACCGTTTCGTGTT
ATAATTGACGGAGCGAAATGATGCTTGGAACCTTTTATTATTTCTGTTGA
ATCTGATCTGTAAATGTTTTCAGAATATTTTTCTAATAAAATCGTTCTGA
AATTTTAAAGTGATCCTTGATGCTATTAAATGATGGACTTTATTGTACCC
CGAATTGGGTCACCCTTGTTCACGCAAATTCGTGCTTAGGATATTTGTAC
GGGCTTATGCAACTTTTTAAATTTTTATTTTTCCTTATTTTTATTAGCAA
TCCGTTTTATTTATAACGACAAATGCTTGATGTTTGAATCAAATTTTTAT
TATGTTTCTTAATGAAACATAGTGAACAATGTGCCACTAATTTCATAACC
AAGGTCTAATCAAATAGTTTGGGTAGTGAAAGCAATATTACAGAGTTTAG
GTTTGTCATTCATAT
back to top

protein sequence of SMED30015696-orf-1

>SMED30015696-orf-1 ID=SMED30015696-orf-1|Name=SMED30015696-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=706bp
MIPCRLNSIILFIFVYGVLSVSCEIEPNRDQPSSRRVHECKLTSNQYPVN
VLPGSGWDNLENKELGQVLEISYKGCFGSNDGSFLIPDNVVITPIKKSIV
ELTSDIFDHFSNVTSTTAMSINADASYSTPSYKISGSFSFEKIRIKNDQI
KEKSSISRSQLRHELYEVAFQPHSKLDAKFRNRILDIGALLKEGKDTIYP
QYLADLIVRDFGTHVIRSVDAGATLIKTDVLKSNYVKGFKGDTTKIAAAA
SFSMTTMLSVNLKGTYVGDTTSLNEFNSNSASTKVETFGGIPFGSNFKLE
DWEKTLETNLVAIDRKGEPLSYAITPKNLPEFDEQAVFKIATLIKEAVNR
YYAANTRVGCMNMESENFNDDANVDGGNCEPPNTFYSFGGTFQTCSGPDY
QCMDVAAKNPVTNSYACPDNYDTIELQSGLNKCINYCTKYLFSTQCHYEC
SQYALYWCSSTNKTKISEGALFGGFYTNTFPNPLTNSYSCPQYYVATRFG
VNAKVCTALNKAEAMEHHLPFGGFYSCKVGNPLLDDPLYNITQDPKYWPQ
GCSTGYSSHVAIVDRACQISYCVKNNALSMREQPPLYRPPFIDLGFGPNM
TVITSLDTPMGVRLSVDENGKWSHNHQYKLSNYNIIIISVIMAAGASIAI
IIIILGVQRFSRNRKGQVSPESHEFDSRYDSTKDVANLALPGEVPPFRVI
IDGAK*
back to top
Aliases
The feature 'Macrophage-expressed gene 1 protein' has the following synonyms
Synonym
MPEG1-like-3