Macrophage-expressed gene 1 protein

Overview
NameMacrophage-expressed gene 1 protein
Smed IDSMED30015696
Uniprot Best hitMacrophage-expressed gene 1 protein OS=Bos taurus OX=9913 GN=MPEG1 PE=2 SV=2 (E=6.54696e-120)
Length (bp)2665
Neoblast Clusters

Zeng et. al., 2018




 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top

Expression Details

Macrophage-expressed gene 1 protein ( MPEG1-like-3 ) is expressed during Stage 2, Stage 3, Stage 4 and Stage 5 in the embryonic digestive system, embryonic pharynx, primitive gut cell and embryonic gut cell

Click to see image symbols and abbreviations
Abbreviation or symbolDefinition
Ooral hemisphere
Aaboral hemisphere
Ddorsal
Vventral
Llateral
black arrowheadembryonic pharynx
red arrowheaddefinitive pharynx
black arrowsprimitive gut
yellow arrowsprimitive ectoderm cells
cyan arrowsbrain
cyan arrowheadsnerve cords
blue arrowheadseye progenitors (trail cells)
purple arrowheadseyes
scale bar100 µm
Anatomical Expression

PAGE et. al., 2020




SMED30015696

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 8

  
PLANA TermReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
embryonic gutSMED30015696SMESG000067839.1 SMED30015696smed_20140614PMID:28072387whole organismStage 4colorimetric in situ hybridization evidence
embryonic gutSMED30015696SMESG000067839.1 SMED30015696smed_20140614PMID:28072387whole organismStage 5colorimetric in situ hybridization evidence
embryonic pharynxSMED30015696SMESG000067839.1 SMED30015696smed_20140614PMID:28072387whole organismStage 4colorimetric in situ hybridization evidence
embryonic gutSMED30015696SMESG000067839.1 SMED30015696smed_20140614PMID:28072387whole organismStage 6colorimetric in situ hybridization evidence
embryonic pharynxSMED30015696SMESG000067839.1 SMED30015696smed_20140614PMID:28072387whole organismStage 3colorimetric in situ hybridization evidence
primitive gutSMED30015696SMESG000067839.1 SMED30015696smed_20140614PMID:28072387whole organismStage 3colorimetric in situ hybridization evidence
primitive gutSMED30015696SMESG000067839.1 SMED30015696smed_20140614PMID:28072387whole organismStage 4colorimetric in situ hybridization evidence
embryonic pharynxSMED30015696SMESG000067839.1 SMED30015696smed_20140614PMID:28072387whole organismStage 2colorimetric in situ hybridization evidence
Homology
BLAST of Macrophage-expressed gene 1 protein vs. Ensembl Human
Match: MPEG1 (macrophage expressed 1 [Source:HGNC Symbol;Acc:HGNC:29619])

HSP 1 Score: 379.407 bits (973), Expect = 6.016e-119
Identity = 209/618 (33.82%), Postives = 333/618 (53.88%), Query Frame = 1
Query:  262 VHECKLTSNQYPVNVLPGSGWDNLENKELGQVLEISYKGCFGSNDGSFLIPDNVVITPIKKSIVELTSDIFDHFSNVTSTTAMSINADASYSTPSYKISGSFSFEKIRIKNDQIKEKSSISRSQLRHELYEVAFQPHSKLDAKFRNRILDIGALLKEGKDTIYPQYLADLIVRDFGTHVIRSVDAGATLIKTDVLKSNYVKGFKGDTTKIAAAASFSMTTMLSVNLKGTYVGDTTSLNEFNSNSASTKVETFGGIPFGSNFKLEDWEKTLETNLVAIDRKGEPLSYAITPKNLPEFDEQAVFKIATLIKEAVNRYYAANTRVGCMNMESENFNDDANVDGGNCEPPNTFYSFGGTFQTCSGPD-----YQCMDVAAKNPVTNSYACPDNYDTIELQSGLN-------KCINYCTKYLFSTQCHYEC--------SQYALYWCSSTNKTKISEGALFGGFYTNTFPNPLTNSYSCPQYYVATRFGVNAKVCTALNKAEAMEHHLPFGGFYSCKVGNPLLDDPLYNITQDPKYWPQGCSTGYSSHVAIVDRACQISYCVKNNALSMREQPPLYRPPFIDLGFGPNMTVITSLDTPMGVRLSVDENGK-W---SHNHQYKL 2043
            V +CK       + VLPG GWDNL N ++G+V+E++Y  C  + DG ++IPD +   P K+S +E+ S+I + ++N  S+T+ SIN + S  +   K++G FS E  R+K  Q+K+++  +R Q+R+ +Y V   P  +L + FR  +LDI   L E   T    YLA+L+V ++GTHV  SVDAGA LI+ D L++++++  +   + + A+A  +    ++   +  Y         + SN  +++V++ GG+PF     L+ W++ +  +LVAIDR G PL + I P  LP+     V K++  ++ AV RYY  NT  GC ++ S NFN  AN D G+CE   T +SFGG +Q C+          C  +  KNP+T  ++CP  Y  + L S ++       +C   CT  +F   C   C        +++  +WC ++++   + G LFGG +++   NP+TN+ SCP  Y   R   N KVC + +        +PFGGF+SC VGNPL+D  +      P    + C  G+S H A++   CQ+SYCVK+   +    PP   PPF      P +    + +T   V ++  EN + W   S  HQ++L
Sbjct:   31 VQKCKNALKLPVLEVLPGGGWDNLRNVDMGRVMELTYSNCRTTEDGQYIIPDEIFTIPQKQSNLEMNSEILESWANYQSSTSYSINTELSLFS---KVNGKFSTEFQRMKTLQVKDQAITTRVQVRNLVYTVKINPTLELSSGFRKELLDISDRL-ENNQTRMATYLAELLVLNYGTHVTTSVDAGAALIQEDHLRASFLQDSQSSRSAVTASAGLAFQNTVNFKFEENYTSQNVLTKSYLSNRTNSRVQSIGGVPFYPGITLQAWQQGITNHLVAIDRSGLPLHFFINPNMLPDLPGPLVKKVSKTVETAVKRYYTFNTYPGCTDLNSPNFNFQANTDDGSCEGKMTNFSFGGVYQECTQLSGNRDVLLCQKLEQKNPLTGDFSCPSGYSPVHLLSQIHEEGYNHLECHRKCTLLVF---CKTVCEDVFQVAKAEFRAFWCVASSQVPENSGLLFGGLFSSKSINPMTNAQSCPAGYFPLRLFENLKVCVSQDYELGSRFAVPFGGFFSCTVGNPLVDPAISRDLGAPSL--KKCPGGFSQHPALISDGCQVSYCVKSGLFTGGSLPPARLPPFTR----PPLMSQAATNT---VIVTNSENARSWIKDSQTHQWRL 632          
BLAST of Macrophage-expressed gene 1 protein vs. Ensembl Zebrafish
Match: mpeg1.1 (macrophage expressed 1, tandem duplicate 1 [Source:ZFIN;Acc:ZDB-GENE-030131-7347])

HSP 1 Score: 352.443 bits (903), Expect = 6.888e-109
Identity = 207/575 (36.00%), Postives = 305/575 (53.04%), Query Frame = 1
Query:  271 CKLTSNQYPVNVLPGSGWDNLENKELGQVLEISYKGCFGSNDGSFLIPDNVVITPIKKSIVELTSDIFDHFSNVTSTTAMSINADASYSTPSYKISGSFSFEKIRIKNDQIKEKSSISRSQLRHELYEVAFQPHSKLDAKFRNRILDIGALLKEGKDTIYPQYLADLIVRDFGTHVIRSVDAGATLIKTDVLKSNYVKGFKGDTTKIAAAASFSMTTMLSVNLKGTYVGDTTSLNEFNSNSASTKVETFGGIPFGSNFKLEDWEKTLETNLVAIDRKGEPLSYAITPKNLPEFDEQAVFKIATLIKEAVNRYYAANTRVGCMNMESENFNDDANVDGGNCEPPNTFYSFGGTFQTCS--GPDYQ--CMDVAAKNPVTNSYACPDNYDTIELQS-----GLN--KCINYCTKYLF---STQCHYEC--------SQYALYWCSSTNKTKISEGALFGGFYTNTFPNPLTNSYSCPQYYVATRFGVNA-KVCTALNKAEAMEHHLPFGGFYSCKVGNPLLDDPLYNITQDPKYWPQGCSTGYSSHVAIVDRACQISYCVKNNALSMREQPPLYRPPF 1926
            C+  S+   + VLPG GWDNL N ++G+V+ +SY  C  + DG +LIPD V + P K S VE  S+I   +    S+T+ S+NAD S+ +    ++  FS E  R+K  Q+KE S  +R Q+R+ LY V   P   LD++F  +  +I   + E   T +  YL++ +V D+GTHVI SVDAGATL++ D LK +Y+   + D + ++A+A  +    +  ++ G     ++  + +  N   + +++ GG  F     L+ W+++   NLVAIDR G PL Y + P   P+     V K+A+ +++A  RYY  NT  GC+N++S NFN  ANVD  +CE P T  SFGG +Q C+   PD    C + A KNP T  Y+CP +Y+T  L S     G N  +C  +C    F   ST C   C        ++    WCSST+KT  + G LFGG +     NPLT S SCP  Y   RF  N   +C + +        +PF GF+SC+ GNPL +                C   +S H+A +   CQ+ YCV++   S     P+  PPF
Sbjct:   33 CRKNSSLTALEVLPGGGWDNLRNIDMGRVMNLSYSQCQTTEDGVYLIPDEVFVIPQKVSGVETNSEIIMSWLEQKSSTSSSVNADVSFFS---VLNAKFSTENQRMKTHQVKEGSVTARVQVRNHLYTVKAYPDFTLDSRFAKQAEEIADAI-ENNQTRHANYLSEKLVLDYGTHVITSVDAGATLVQEDYLKMSYISNSQSDKSSVSASAGANFFDKVKFDIGGNTSQGSSQSSSYQGNITYSLIQSHGGALFYPGITLQKWQQSTLNNLVAIDRSGLPLHYFLNPSTFPDLPTPTVNKLASTVRKAAERYYKVNTIPGCVNVDSPNFNFQANVDDASCEGPITNLSFGGIYQRCTPLTPDGNIICDETAQKNPATGGYSCPQHYNTTLLHSEIVEKGFNHYECHTHCHSCGFLGLSTCCDKTCGDSYHVRRAKLETLWCSSTHKTPENSGYLFGGLFGPGIQNPLTKSSSCPPSYFTQRFLSNGMMICMSNDYEIGTRFSVPFAGFFSCQSGNPLSNG------------QSRCPPQFSQHLAAISDGCQVLYCVQSGVFSGGHLKPVRLPPF 591          
BLAST of Macrophage-expressed gene 1 protein vs. Ensembl Zebrafish
Match: mpeg1.1 (macrophage expressed 1, tandem duplicate 1 [Source:ZFIN;Acc:ZDB-GENE-030131-7347])

HSP 1 Score: 352.443 bits (903), Expect = 6.888e-109
Identity = 207/575 (36.00%), Postives = 305/575 (53.04%), Query Frame = 1
Query:  271 CKLTSNQYPVNVLPGSGWDNLENKELGQVLEISYKGCFGSNDGSFLIPDNVVITPIKKSIVELTSDIFDHFSNVTSTTAMSINADASYSTPSYKISGSFSFEKIRIKNDQIKEKSSISRSQLRHELYEVAFQPHSKLDAKFRNRILDIGALLKEGKDTIYPQYLADLIVRDFGTHVIRSVDAGATLIKTDVLKSNYVKGFKGDTTKIAAAASFSMTTMLSVNLKGTYVGDTTSLNEFNSNSASTKVETFGGIPFGSNFKLEDWEKTLETNLVAIDRKGEPLSYAITPKNLPEFDEQAVFKIATLIKEAVNRYYAANTRVGCMNMESENFNDDANVDGGNCEPPNTFYSFGGTFQTCS--GPDYQ--CMDVAAKNPVTNSYACPDNYDTIELQS-----GLN--KCINYCTKYLF---STQCHYEC--------SQYALYWCSSTNKTKISEGALFGGFYTNTFPNPLTNSYSCPQYYVATRFGVNA-KVCTALNKAEAMEHHLPFGGFYSCKVGNPLLDDPLYNITQDPKYWPQGCSTGYSSHVAIVDRACQISYCVKNNALSMREQPPLYRPPF 1926
            C+  S+   + VLPG GWDNL N ++G+V+ +SY  C  + DG +LIPD V + P K S VE  S+I   +    S+T+ S+NAD S+ +    ++  FS E  R+K  Q+KE S  +R Q+R+ LY V   P   LD++F  +  +I   + E   T +  YL++ +V D+GTHVI SVDAGATL++ D LK +Y+   + D + ++A+A  +    +  ++ G     ++  + +  N   + +++ GG  F     L+ W+++   NLVAIDR G PL Y + P   P+     V K+A+ +++A  RYY  NT  GC+N++S NFN  ANVD  +CE P T  SFGG +Q C+   PD    C + A KNP T  Y+CP +Y+T  L S     G N  +C  +C    F   ST C   C        ++    WCSST+KT  + G LFGG +     NPLT S SCP  Y   RF  N   +C + +        +PF GF+SC+ GNPL +                C   +S H+A +   CQ+ YCV++   S     P+  PPF
Sbjct:   33 CRKNSSLTALEVLPGGGWDNLRNIDMGRVMNLSYSQCQTTEDGVYLIPDEVFVIPQKVSGVETNSEIIMSWLEQKSSTSSSVNADVSFFS---VLNAKFSTENQRMKTHQVKEGSVTARVQVRNHLYTVKAYPDFTLDSRFAKQAEEIADAI-ENNQTRHANYLSEKLVLDYGTHVITSVDAGATLVQEDYLKMSYISNSQSDKSSVSASAGANFFDKVKFDIGGNTSQGSSQSSSYQGNITYSLIQSHGGALFYPGITLQKWQQSTLNNLVAIDRSGLPLHYFLNPSTFPDLPTPTVNKLASTVRKAAERYYKVNTIPGCVNVDSPNFNFQANVDDASCEGPITNLSFGGIYQRCTPLTPDGNIICDETAQKNPATGGYSCPQHYNTTLLHSEIVEKGFNHYECHTHCHSCGFLGLSTCCDKTCGDSYHVRRAKLETLWCSSTHKTPENSGYLFGGLFGPGIQNPLTKSSSCPPSYFTQRFLSNGMMICMSNDYEIGTRFSVPFAGFFSCQSGNPLSNG------------QSRCPPQFSQHLAAISDGCQVLYCVQSGVFSGGHLKPVRLPPF 591          
BLAST of Macrophage-expressed gene 1 protein vs. Ensembl Zebrafish
Match: mpeg1.3 (macrophage expressed 1, tandem duplicate 3 [Source:ZFIN;Acc:ZDB-GENE-081105-5])

HSP 1 Score: 350.517 bits (898), Expect = 1.045e-108
Identity = 214/619 (34.57%), Postives = 327/619 (52.83%), Query Frame = 1
Query:  253 SRRVHECKLTSNQYPVNVLPGSGWDNLENKELGQVLEISYKGCFGSNDGSFLIPDNVVITPIKKSIVELTSDIFDHFSNVTSTTAMSINADASYSTPSYKISGSFSFEKIRIKNDQIKEKSSISRSQLRHELYEVAFQPHSKLDAKFRNRILDIGALLKEGKDTIYPQYLADLIVRDFGTHVIRSVDAGATLIKTDVLKSNYVKGFKGDTTKIAAAASFSMTTMLSVNLKGTY-VGDTTSLNE-FNSNSASTKVETFGGIPFGSNFKLEDWEKTLETNLVAIDRKGEPLSYAITPKNLPEFDEQAVFKIATLIKEAVNRYYAANTRVGCMNMESENFNDDANVDGGNCEPPNTFYSFGGTFQTCSGPDYQ----CMDVAAKNPVTNSYACPDNYDTIELQSGL-------NKCINYCTKYLF---STQCHYEC--------SQYALYWCSSTNKTKISEGALFGGFYTNTFPNPLTNSYSC-PQYYVATRFGVNAKVCTALNKAEAMEHHLPFGGFYSCKVGNPLLDDPLYNITQDPKYWPQGCSTGYSSHVAIVDRACQISYCVKNNALSMRE-----QPPLYRPPFIDLGFGPNMTVITSLDTPMGVRLSVDENGKW 2019
            S  ++EC   SN   + VLPG GWDNL N ++G+V+ +SY  C  + DG +LIPD V + P K++ VE  S++   + +  S+T+ SINAD S+ +    ++G FS E  RIK  Q+KE S  SR Q+R+ LY V   P+  LD++F  ++ +I   +   + T    YL++ ++ D+GTHVI SV+AGA+L++ D LK +Y+   + D + ++A+A F+      V L  +Y  G  TSLN  +  N   + +++ GG  F     L+ W+++   NLVAIDR G PL Y + P   P+  E  V K+A  + +A  +YY  NT  GC+N++S+NFN  ANVD  +CE P T  SFGG +Q C+         C ++A KNP T  Y+C   Y+T  L+S +        +C + C    F   ST C   C        ++    WC ST K     G +FGG Y  +  NP T SY+C P ++V         VC + +  +A +  +PFGGF+SC+ GNPL +                C   +S H+A +   CQ+ YCV++   S  +      PP   PP + +    ++ V+T L+   G  + V ++  W
Sbjct:   27 SNGLNECHKNSNLVALEVLPGGGWDNLRNIDMGRVMNLSYSQCQTTEDGVYLIPDEVFVIPQKENTVETNSEMIMSWLDQKSSTSSSINADVSFFS---WLNGKFSREHQRIKTHQVKESSVTSRVQVRNRLYTVKAYPNFPLDSRFAQQVEEIADAITNDQ-TRLATYLSEKLILDYGTHVITSVEAGASLVQEDYLKMSYILKNQLDLSSVSASAGFNFFD--KVKLDPSYNGGQKTSLNSSYQGNITYSLIQSHGGALFYPGMTLQKWQESTLNNLVAIDRSGLPLHYFLNPSTFPDISEALVRKLALSVSQAAEQYYKVNTIPGCVNVDSKNFNFQANVDDVSCEGPITNLSFGGMYQQCTPLTIDGSTICDEMAQKNPATGGYSCSQKYNTTLLRSEIIERGYTRYECQDNCRSCGFLGWSTCCSQTCNNVNYIRRAKVDTLWCYSTQKIPEYSGYIFGGLYGPSMQNPFTRSYTCPPNFFVQPILSRAIMVCLSNDYVKATKSAVPFGGFFSCQSGNPLSNG------------ESRCPPQFSQHLAAISDGCQVLYCVQSGVFSGGQLKPVLLPPYTSPPLVGMTVTNSVVVMTDLN---GSLVGVGQSRMW 624          
BLAST of Macrophage-expressed gene 1 protein vs. Ensembl Zebrafish
Match: mpeg1.2 (macrophage expressed 1, tandem duplicate 2 [Source:ZFIN;Acc:ZDB-GENE-050522-305])

HSP 1 Score: 329.717 bits (844), Expect = 2.343e-100
Identity = 201/615 (32.68%), Postives = 310/615 (50.41%), Query Frame = 1
Query:  253 SRRVHECKLTSNQYPVNVLPGSGWDNLENKELGQVLEISYKGCFGSNDGSFLIPDNVVITPIKKSIVELTSDIFDHFSNVTSTTAMSINADASYSTPSYKISGSFSFEKIRIKNDQIKEKSSISRSQLRHELYEVAFQPHSKLDAKFRNRILDIGALLKEGKDTIYPQYLADLIVRDFGTHVIRSVDAGATLIKTDVLKSNYVKGFKGDTTKIAAAASFSMTTMLSVNLKGTYVGDTTSLNEFNSNSASTKVETFGGIPFGSNFKLEDWEKTLETNLVAIDRKGEPLSYAITPKNLPEFDEQAVFKIATLIKEAVNRYYAANTRVGCMNMESENFNDDANVDGGNCEPPNTFYSFGGTFQTCS--GPDYQ--CMDVAAKNPVTNSYACPDNYDTIEL-----QSGLN--KCINYC-TKYLFSTQCHYEC--------SQYALYWCSSTNKTKISEGALFGGFYTNTFPNPLTNSYSCPQYYVATRFGVNA-KVCTALNKAEAMEHHLPFGGFYSCKVGNPLLDDPLYNITQDPKYWPQGCSTGYSSHVAIVDRACQISYCVKNNA-----LSMREQPPLYRPPFIDLGFGPNMTVITSLDTPMGVRLSVDENGKW 2019
            S  + EC+  SN   + VLPG GWDNL N ++G+V+ ++Y  C  + DG +LIPD V + P K S VE  S+    + +  S+T+ SINADASY T    ++G FS E  R+K  Q++  S  +R Q+R+ LY V   P   LD++F  +I ++   + E   T    YL++ ++ ++GTHVI S+DAGATL++ D +K +YV     + + ++A+A  +   M++ N        T+    +  N   + V++ GG  F     ++ W+++ + +LVAIDR G P+ Y + P   P+     + K+A  +++A  RYY  NT  GC +  S+NFN  ANV+  +CE P T  +FGG +QTC+   PD    C + A +NP T  + C   Y    L     Q G N  +C   C + +L    CH  C        +Q   YWCS++     + G LFGG +  +  NP T S+ CP  Y    F  N  ++C + +        +PFGG +SC+ GNP   +               C   YS H+A +   CQ+ YCV++       L     PP  +PP I++     + V+T  D      + V    KW
Sbjct:   24 SNGLRECRQNSNLTALEVLPGGGWDNLRNLDVGRVMNLTYSQCQTTEDGLYLIPDEVFVIPRKTSGVETHSETIMSWLDQRSSTSGSINADASYLT---VLNGKFSEENTRMKIHQVRGNSVTTRVQVRNHLYTVNAYPDFTLDSRFSQQISELADAI-ENNQTRQAMYLSEKVILEYGTHVITSIDAGATLVQEDYIKRSYVSDTNSERSSVSASAGINFFNMVNFNFGSKETEQTSETLTYQQNITYSLVQSHGGALFYQGITMQKWQESTQNHLVAIDRSGLPIHYFLNPAVFPDLPVPTLHKLAFSVQKAAERYYNINTTPGCTDQSSQNFNFQANVNDTSCEGPVTNLTFGGVYQTCTPESPDGNVICDEFAQRNPDTGDFTCRQPYSATRLHSENVQQGYNNYECHEECHSCWLILDCCHQVCGNVYYVRQAQIDTYWCSTSQTVPENTGYLFGGLFGPSLQNPQTKSHDCPANYFEQVFLTNGMRICLSNDYEAGTISSVPFGGLFSCQSGNPQAGNQYR------------CPPQYSQHLATISDGCQVLYCVQSGVFTGGQLKPVHLPPFTKPPLINMMATNTVAVMTEGDKAW---MRVGGTKKW 619          
BLAST of Macrophage-expressed gene 1 protein vs. Ensembl Zebrafish
Match: mpeg1.1 (macrophage expressed 1, tandem duplicate 1 [Source:ZFIN;Acc:ZDB-GENE-030131-7347])

HSP 1 Score: 66.2402 bits (160), Expect = 6.124e-13
Identity = 27/59 (45.76%), Postives = 39/59 (66.10%), Query Frame = 1
Query:  271 CKLTSNQYPVNVLPGSGWDNLENKELGQVLEISYKGCFGSNDGSFLIPDNVVITPIKKS 447
            C+  S+   + VLPG GWDNL N ++G+V+ +SY  C  + DG +LIPD V + P KK+
Sbjct:   33 CRKNSSLTALEVLPGGGWDNLRNIDMGRVMNLSYSQCQTTEDGVYLIPDEVFVIPQKKT 91          
BLAST of Macrophage-expressed gene 1 protein vs. Ensembl Mouse
Match: Pfpl (pore forming protein-like [Source:MGI Symbol;Acc:MGI:1860266])

HSP 1 Score: 379.793 bits (974), Expect = 2.132e-119
Identity = 206/611 (33.72%), Postives = 340/611 (55.65%), Query Frame = 1
Query:  169 LNSIILFIFVYGVLSVSCEIEPNRDQPSSRRVHE-----CKLTSNQYPVNVLPGSGWDNLENKELGQVLEISYKGCFGSNDGSFLIPDNVVITPIKKSIVELTSDIFDHFSNVTSTTAMSINADASYSTPSYKISGSFSFEKIRIKNDQIKEKSSISRSQLRHELYEVAFQPHSKLDAKFRNRILDIGALLKEGKDTIYPQYLADLIVRDFGTHVIRSVDAGATLIKTDVLKSNYVKGFKGDTTKIAAAASFSMTTMLSVNLKGTYVGDTTSLNEFNSNSASTKVETFGGIPFGSNFKLEDWEKTLETNLVAIDRKGEPLSYAITPKNLPEFDEQAVFKIATLIKEAVNRYYAANTRVGCMNMESENFNDDANVDGGNCEPPNTFYSFGGTFQTC---SGPDY--QCMDVAAKNPVTNSYACPDNYDTIELQSGLN-------KCINYCTKYLF-STQCHYEC----SQYALYWCSSTNKTKISEGALFGGFYTNTFPNPLTNSYSCPQYYVATRFGVNAKVCTALNKAEAMEHHLPFGGFYSCKVGNPLLDDPLYNITQDPKYWPQGCSTGYSSHVAIVDRACQISYCVKNNALSMREQPPLYRPPFIDL 1935
            +NS I+ + ++  ++ +       ++ + + +HE     C+   N   + VLPG GWDNL N ++GQV++++Y  C  + DG ++IPD+V   P K+S +E+ S+I D + N  STT+ SIN +  Y     +++G FS E  RIK  Q+++++  +R+Q+R+ +Y V   P+++L+  F+  +++I   L E   T    YLA+L++ ++GTH+I SVDAGATL++ D +KS+Y+K  KG+   +AA+A F+   +++  ++  +         +  N   ++V++ GGIPF     +E W+K +  +LVA+DR G PL + I P+ LP F    V ++A  ++ A   YY  NT  GC N+ S NF+  AN D G+C+       FGG +Q C   SG DY   C+D   KNP+T  ++CP +Y  + L S  +       +C + C   +F  T C  E     ++ + YWC+++++   + G LFGG +T+   NP+TN  SCP  Y   +   N KVC +L+     ++ +PFGGF+SC  GNPL      +   +  + P+ C  G+S  +A +   CQ+SYCVK    +     P   PP+  L
Sbjct:    1 MNSFIVTVLIWTTVAYA------EEEKALKEIHEYGFQKCQNALNLPVLEVLPGGGWDNLRNMDMGQVMDLTYNNCKTTEDGQYIIPDDVFTIPQKESNLEMNSEILDSWENYRSTTSFSINLNLDYRP---RVNGKFSSEFQRIKTTQVRDQAVTTRAQVRNLVYTVKANPNAELNLGFKKELMEICDRL-EKNQTKMATYLAELLILNYGTHIITSVDAGATLVQEDHVKSSYLKNNKGNRAAVAASAGFTFAKVVNFKIETGFEYQNNLATGYLQNRTGSRVQSIGGIPFYPGMTIETWQKGIINHLVAVDRAGLPLHFFIKPEKLPAFPRHLVEQLAKTVETAAESYYNFNTYPGCTNINSPNFDFQANTDDGSCDGKLVNAPFGGVYQLCRQLSGHDYDDMCLDFHQKNPLTGDFSCPPDYTPVHLLSQTHEKGYTGMECRDKCILKIFCRTSCKDEFRVAKAEVSSYWCAASSQVPENSGILFGGVFTDKSINPMTNEPSCPTSYFPLKLFENVKVCVSLDHELGPKYSVPFGGFFSCTKGNPLYGS-FTSGDLEKSFLPK-CPGGFSQQLAAIIDGCQVSYCVKAGVFTRASLAPARLPPYTQL 599          
BLAST of Macrophage-expressed gene 1 protein vs. Ensembl Mouse
Match: Mpeg1 (macrophage expressed gene 1 [Source:MGI Symbol;Acc:MGI:1333743])

HSP 1 Score: 373.629 bits (958), Expect = 7.024e-117
Identity = 201/627 (32.06%), Postives = 342/627 (54.55%), Query Frame = 1
Query:  163 CRLNSIILFIFVYGVLSVSCEIEPNRDQPSSRRVHECKLTSNQYPVNVLPGSGWDNLENKELGQVLEISYKGCFGSNDGSFLIPDNVVITPIKKSIVELTSDIFDHFSNVTSTTAMSINADASYSTPSYKISGSFSFEKIRIKNDQIKEKSSISRSQLRHELYEVAFQPHSKLDAKFRNRILDIGALLKEGKDTIYPQYLADLIVRDFGTHVIRSVDAGATLIKTDVLKSNYVKGFKGDTTKIAAAASFSMTTMLSVNLKGTYVGDTTSLNEFNSNSASTKVETFGGIPFGSNFKLEDWEKTLETNLVAIDRKGEPLSYAITPKNLPEFDEQAVFKIATLIKEAVNRYYAANTRVGCMNMESENFNDDANVDGGNCEPPNTFYSFGGTFQTCS--GPDYQCMDVAAKNPVTNSYACPDNYDTIELQSGLN-------KCINYCTKYLFSTQCHYEC--------SQYALYWCSSTNKTKISEGALFGGFYTNTFPNPLTNSYSCPQYYVATRFGVNAKVCTALNKAEAMEHHLPFGGFYSCKVGNPLLDDPLYNITQDPKYWPQGCSTGYSSHVAIVDRACQISYCVK-----NNALSMREQPPLYRPPFIDLGFGPNMTVITSLDT 1977
            C +NS +  + ++ +++ + E +    +  +     CK       + VLPG GWDNL N ++G+V++++Y  C  + DG ++IPD V   P K+S +E+ S++ + + N  STT++SIN + +  +   +++G FS E  R+K  Q+K+++  +R Q+R+ +Y V   P S+L   F   ++DI   L E   T    YLA+L++ ++GTHVI SVDAGA L++ D ++S+++   +     + A+A  +   +++  ++  Y+  T+   ++ SN  +++V++FGG+PF     LE W+K +  +LVAIDR G PL + I P  LP      V K++  ++ AV  YY  NT  GC N++S NFN  AN+D  +C+   T ++FGG +Q C+    D  C ++  KN +T  ++CP  Y  + L S  +       +C   CT  +F   C   C        +++  YWC +  +   + G LFGG +T+   NP+TN+ SCP  Y+      + KVC +L+     +  +PFGGF+SC +GNPL++       + P    + C  G+S H+A++   CQ+SYCVK       +L     PP  +PP +      N  ++T+ +T
Sbjct:    6 CAMNSFMALVLIWMIIACA-EADKPLGETGTTGFQICKNALKLPVLEVLPGGGWDNLRNVDMGRVMDLTYTNCKTTEDGQYIIPDEVYTIPQKESNLEMNSEVLESWMNYQSTTSLSINTELALFS---RVNGKFSTEFQRMKTLQVKDQAVTTRVQVRNRIYTVKTTPTSELSLGFTKALMDICDQL-EKNQTKMATYLAELLILNYGTHVITSVDAGAALVQEDHVRSSFLLDNQNSQNTVTASAGIAFLNIVNFKVETDYISQTSLTKDYLSNRTNSRVQSFGGVPFYPGITLETWQKGITNHLVAIDRAGLPLHFFIKPDKLPGLPGPLVKKLSKTVETAVRHYYTFNTHPGCTNVDSPNFNFQANMDDDSCDAKVTNFTFGGVYQECTELSGDVLCQNLEQKNLLTGDFSCPPGYTPVHLLSQTHEEGYSRLECKKKCTLKIF---CKTVCEDVFRVAKAEFRAYWCVAAGQVPDNSGLLFGGVFTDKTINPMTNAQSCPAGYIPLNLFESLKVCVSLDYELGFKFSVPFGGFFSCIMGNPLVNSDTAKDVRAPSL--KKCPGGFSQHLAVISDGCQVSYCVKAGIFTGGSLLPVRLPPYTKPPLMS-QVATNTVIVTNSET 621          
BLAST of Macrophage-expressed gene 1 protein vs. UniProt
Match: sp|Q2KJC3|MPEG1_BOVIN (Macrophage-expressed gene 1 protein OS=Bos taurus OX=9913 GN=MPEG1 PE=2 SV=2)

HSP 1 Score: 383.645 bits (984), Expect = 6.547e-120
Identity = 200/561 (35.65%), Postives = 317/561 (56.51%), Query Frame = 1
Query:  304 VLPGSGWDNLENKELGQVLEISYKGCFGSNDGSFLIPDNVVITPIKKSIVELTSDIFDHFSNVTSTTAMSINADASYSTPSYKISGSFSFEKIRIKNDQIKEKSSISRSQLRHELYEVAFQPHSKLDAKFRNRILDIGALLKEGKDTIYPQYLADLIVRDFGTHVIRSVDAGATLIKTDVLKSNYVKGFKGDTTKIAAAASFSMTTMLSVNLKGTYVGDTTSLNEFNSNSASTKVETFGGIPFGSNFKLEDWEKTLETNLVAIDRKGEPLSYAITPKNLPEFDEQAVFKIATLIKEAVNRYYAANTRVGCMNMESENFNDDANVDGGNCEPPNTFYSFGGTFQTC---SGPDY--QCMDVAAKNPVTNSYACPDNYDTIEL-----QSGLN--KCINYCTKYLFSTQCHYEC--------SQYALYWCSSTNKTKISEGALFGGFYTNTFPNPLTNSYSCPQYYVATRFGVNAKVCTALNKAEAMEHHLPFGGFYSCKVGNPLLDDPLYNITQDPKYWPQGCSTGYSSHVAIVDRACQISYCVKNNALSMREQPPLYRPPF 1926
            VLPG GWDNL N + G+V+E++Y  C  + DG +++PD +   P K+S +E+ S I + + N  S+T+ SIN + S  +   K++G FS E  RIK  Q+K+++  ++ Q+R+ +Y V   P ++L   F+  ++DI   L E   T    YLA+L+V ++GTHVI SVDAGA LI+ D ++S++++  +   + + A+A  +   +++   +  Y    T    + SN  +++V++FGG+PF     L+ W++ +  +LVA+DR G PL + I P+ LP+     V K++  ++ AV RYYA NT  GC ++ S NFN  AN D G+CE   T +SFGG +Q C   SG +    C ++  KNP+T S +CP  Y  ++L     + G N  +C   CT Y+F   C   C        +++  +WC+++ +   + G LFGG ++    NPLTN+ SCP  Y   +   N KVC +L+        +PFGGF+SC  GNPL+D         P    + C  G+S H+A++   CQ+SYCVK    +    PP+  PP+
Sbjct:   45 VLPGGGWDNLRNVDTGRVMELAYSHCRTTEDGQYIVPDEIFTIPQKQSNLEMNSKILESWVNYQSSTSNSINMELSLFS---KVNGKFSLEFQRIKTLQVKDQAVTTQVQVRNLVYTVKINPDAELSLGFKKALMDISEQL-ENNQTRMATYLAELLVLNYGTHVITSVDAGAALIQEDHIRSSFLQDSQSSRSAVTASAGITFLNIVNFKFEENYTSQNTFTKSYLSNRTNSRVQSFGGLPFYPGITLQAWQQGVSNHLVAMDRAGLPLYFFINPERLPDLPGPLVRKLSKTVEAAVRRYYAVNTYPGCTDLSSPNFNFQANTDDGSCEGKMTNFSFGGVYQECTQFSGNEVVQLCQNLEQKNPLTGSVSCPSGYSPVQLLTQTHEEGYNHLECSRKCTLYIF---CKTVCEDVFRVARAEFRAFWCAASGQVSENSGLLFGGLFSGKSINPLTNAQSCPAGYFQLKLFENLKVCASLDYELGYRFSIPFGGFFSCAAGNPLVDSATSKDLGAPSL--RKCPGGFSQHLALISDGCQVSYCVKAGLFTGGSLPPVRLPPY 596          
BLAST of Macrophage-expressed gene 1 protein vs. UniProt
Match: sp|Q2M385|MPEG1_HUMAN (Macrophage-expressed gene 1 protein OS=Homo sapiens OX=9606 GN=MPEG1 PE=1 SV=1)

HSP 1 Score: 379.407 bits (973), Expect = 2.889e-118
Identity = 209/618 (33.82%), Postives = 333/618 (53.88%), Query Frame = 1
Query:  262 VHECKLTSNQYPVNVLPGSGWDNLENKELGQVLEISYKGCFGSNDGSFLIPDNVVITPIKKSIVELTSDIFDHFSNVTSTTAMSINADASYSTPSYKISGSFSFEKIRIKNDQIKEKSSISRSQLRHELYEVAFQPHSKLDAKFRNRILDIGALLKEGKDTIYPQYLADLIVRDFGTHVIRSVDAGATLIKTDVLKSNYVKGFKGDTTKIAAAASFSMTTMLSVNLKGTYVGDTTSLNEFNSNSASTKVETFGGIPFGSNFKLEDWEKTLETNLVAIDRKGEPLSYAITPKNLPEFDEQAVFKIATLIKEAVNRYYAANTRVGCMNMESENFNDDANVDGGNCEPPNTFYSFGGTFQTCSGPD-----YQCMDVAAKNPVTNSYACPDNYDTIELQSGLN-------KCINYCTKYLFSTQCHYEC--------SQYALYWCSSTNKTKISEGALFGGFYTNTFPNPLTNSYSCPQYYVATRFGVNAKVCTALNKAEAMEHHLPFGGFYSCKVGNPLLDDPLYNITQDPKYWPQGCSTGYSSHVAIVDRACQISYCVKNNALSMREQPPLYRPPFIDLGFGPNMTVITSLDTPMGVRLSVDENGK-W---SHNHQYKL 2043
            V +CK       + VLPG GWDNL N ++G+V+E++Y  C  + DG ++IPD +   P K+S +E+ S+I + ++N  S+T+ SIN + S  +   K++G FS E  R+K  Q+K+++  +R Q+R+ +Y V   P  +L + FR  +LDI   L E   T    YLA+L+V ++GTHV  SVDAGA LI+ D L++++++  +   + + A+A  +    ++   +  Y         + SN  +++V++ GG+PF     L+ W++ +  +LVAIDR G PL + I P  LP+     V K++  ++ AV RYY  NT  GC ++ S NFN  AN D G+CE   T +SFGG +Q C+          C  +  KNP+T  ++CP  Y  + L S ++       +C   CT  +F   C   C        +++  +WC ++++   + G LFGG +++   NP+TN+ SCP  Y   R   N KVC + +        +PFGGF+SC VGNPL+D  +      P    + C  G+S H A++   CQ+SYCVK+   +    PP   PPF      P +    + +T   V ++  EN + W   S  HQ++L
Sbjct:   31 VQKCKNALKLPVLEVLPGGGWDNLRNVDMGRVMELTYSNCRTTEDGQYIIPDEIFTIPQKQSNLEMNSEILESWANYQSSTSYSINTELSLFS---KVNGKFSTEFQRMKTLQVKDQAITTRVQVRNLVYTVKINPTLELSSGFRKELLDISDRL-ENNQTRMATYLAELLVLNYGTHVTTSVDAGAALIQEDHLRASFLQDSQSSRSAVTASAGLAFQNTVNFKFEENYTSQNVLTKSYLSNRTNSRVQSIGGVPFYPGITLQAWQQGITNHLVAIDRSGLPLHFFINPNMLPDLPGPLVKKVSKTVETAVKRYYTFNTYPGCTDLNSPNFNFQANTDDGSCEGKMTNFSFGGVYQECTQLSGNRDVLLCQKLEQKNPLTGDFSCPSGYSPVHLLSQIHEEGYNHLECHRKCTLLVF---CKTVCEDVFQVAKAEFRAFWCVASSQVPENSGLLFGGLFSSKSINPMTNAQSCPAGYFPLRLFENLKVCVSQDYELGSRFAVPFGGFFSCTVGNPLVDPAISRDLGAPSL--KKCPGGFSQHPALISDGCQVSYCVKSGLFTGGSLPPARLPPFTR----PPLMSQAATNT---VIVTNSENARSWIKDSQTHQWRL 632          
BLAST of Macrophage-expressed gene 1 protein vs. UniProt
Match: sp|Q5RBP9|MPEG1_PONAB (Macrophage-expressed gene 1 protein OS=Pongo abelii OX=9601 GN=MPEG1 PE=2 SV=1)

HSP 1 Score: 379.022 bits (972), Expect = 3.455e-118
Identity = 208/618 (33.66%), Postives = 334/618 (54.05%), Query Frame = 1
Query:  262 VHECKLTSNQYPVNVLPGSGWDNLENKELGQVLEISYKGCFGSNDGSFLIPDNVVITPIKKSIVELTSDIFDHFSNVTSTTAMSINADASYSTPSYKISGSFSFEKIRIKNDQIKEKSSISRSQLRHELYEVAFQPHSKLDAKFRNRILDIGALLKEGKDTIYPQYLADLIVRDFGTHVIRSVDAGATLIKTDVLKSNYVKGFKGDTTKIAAAASFSMTTMLSVNLKGTYVGDTTSLNEFNSNSASTKVETFGGIPFGSNFKLEDWEKTLETNLVAIDRKGEPLSYAITPKNLPEFDEQAVFKIATLIKEAVNRYYAANTRVGCMNMESENFNDDANVDGGNCEPPNTFYSFGGTFQTCSGPD-----YQCMDVAAKNPVTNSYACPDNYDTIELQSGLN-------KCINYCTKYLFSTQCHYEC--------SQYALYWCSSTNKTKISEGALFGGFYTNTFPNPLTNSYSCPQYYVATRFGVNAKVCTALNKAEAMEHHLPFGGFYSCKVGNPLLDDPLYNITQDPKYWPQGCSTGYSSHVAIVDRACQISYCVKNNALSMREQPPLYRPPFIDLGFGPNMTVITSLDTPMGVRLSVDENGK-W---SHNHQYKL 2043
            V +CK       + VLPG GWDNL N ++G+V+E++Y  C  + DG ++IPD +   P K+S +E+ S+I + ++N  S+T+ SIN + S  +   K++G FS E  R+K  Q+K+++  +R Q+R+ +Y V   P  +L+  FR  +LDI   L E   T    YLA+L+V ++GTHVI SVDAGA LI+ D +++++++  +   + + A+A  +    ++   +  Y         + SN  +++V++ GG+PF     L+ W++ +  +LVAIDR G PL + I P  LP+     V K++  ++ AV RYY  NT  GC ++ S NFN  AN D G+CE   T +SFGG +Q C+          C  +  KNP+T  ++CP  Y  + L S ++       +C   CT  +F   C   C        +++  +WC ++++   + G LFGG +++   NP+TN+ SCP  Y       N KVC + +        +PFGGF+SC VGNPL+D  +      P    + C  G+S H+A++   CQ+SYCVK+   +    PP   PPF      P +    + +T   V ++  EN + W   S  HQ++L
Sbjct:   31 VQKCKNALKLPVLEVLPGGGWDNLRNVDMGRVMELTYSNCRTTEDGQYIIPDEIFTIPQKQSNLEMNSEILESWANYQSSTSYSINTELSLFS---KVNGKFSTEFQRMKTLQLKDQAITTRVQVRNLIYTVKINPALELNWSFRKELLDISDRL-ENNQTRMATYLAELLVLNYGTHVITSVDAGAALIQEDHIRASFLQDSQSSRSAVTASAGLAFQNTVNFKFEENYTSQNVLTKSYLSNRTNSRVQSIGGVPFYPGITLQAWQQGITNHLVAIDRSGLPLHFFINPNMLPDLPGPLVKKVSKTVETAVKRYYTFNTYPGCTDLNSPNFNFQANTDDGSCEGKMTNFSFGGVYQECTQLSGNRDVLLCQKLEQKNPLTGDFSCPSGYSPVRLLSQIHEEGYNHLECHRKCTLLVF---CKTVCEDVFQVAKAEFRAFWCVASSQVPENSGLLFGGLFSSKSINPMTNAQSCPAGYFPLSLFENLKVCVSQDYELGSRFAVPFGGFFSCTVGNPLVDPAISRDLGVPSL--KKCPGGFSQHLALISDGCQVSYCVKSGLFTGGSLPPARLPPFTR----PPLMSQAATNT---VIVTNSENARSWIKDSQTHQWRL 632          
BLAST of Macrophage-expressed gene 1 protein vs. UniProt
Match: sp|Q9WV57|MPEG1_RAT (Macrophage-expressed gene 1 protein OS=Rattus norvegicus OX=10116 GN=Mpeg1 PE=2 SV=2)

HSP 1 Score: 376.326 bits (965), Expect = 4.553e-117
Identity = 212/625 (33.92%), Postives = 339/625 (54.24%), Query Frame = 1
Query:  169 LNSIILFIFVYGVLSVSCEIEPNRDQPSSRRVHECKLTSNQYPVNVLPGSGWDNLENKELGQVLEISYKGCFGSNDGSFLIPDNVVITPIKKSIVELTSDIFDHFSNVTSTTAMSINADASYSTPSYKISGSFSFEKIRIKNDQIKEKSSISRSQLRHELYEVAFQPHSKLDAKFRNRILDIGALLKEGKDTIYPQYLADLIVRDFGTHVIRSVDAGATLIKTDVLKSNYVKGFKGDTTKIAAAASFSMTTMLSVNLKGTYVGDTTSLNEFNSNSASTKVETFGGIPFGSNFKLEDWEKTLETNLVAIDRKGEPLSYAITPKNLPEFDEQAVFKIATLIKEAVNRYYAANTRVGCMNMESENFNDDANVDGGNCEPPNTFYSFGGTFQTCS--GPDYQCMDVAAKNPVTNSYACPDNYDTIELQSGLN-------KCINYCTKYLFSTQCHYEC--------SQYALYWCSSTNKTKISEGALFGGFYTNTFPNPLTNSYSCPQYYVATRFGVNAKVCTALNKAEAMEHHLPFGGFYSCKVGNPLLDDPLYNITQDPKYWPQGCSTGYSSHVAIVDRACQISYCVK-----NNALSMREQPPLYRPPFIDLGFGPNMTVITSLDT 1977
            +NS +    ++ +++ +   +P RD P       CK T     + VLPG GWDNL N ++G+V++++Y  C  + DG ++IPD V   P K+S +E+ S+I D + N  STT+ SIN + S  +   K++G FS E  R+K  Q+K+++  +R Q+R+ +Y V   P S+L   F N ++DI   L E   T    YLA+L+V ++GTHVI SVDAGA L++ D ++S+++   +     + A+A  +   +++  ++  +   T     + SN  +++V++FGGIPF     LE W+K +  +LVAIDR G PL + I P  LP      V K++  ++ AV  YY  NT  GC N++S NFN  AN++  +C+   T ++FGG +Q C+    D  C ++  KN +T  ++CP  Y  + L S  +       +C   CT  +F   C   C        +Q+  YWC +T +   + G LFGG +T+   NP+TN+ SCP  Y+      + KVC +L+     +  +PFGGF+SC +GNPL++         P    + C  G+S H+A++   CQ+SYCVK       +L     PP  +PP +      N  ++TS +T
Sbjct:    1 MNSFMAIALIWMMIACAEADKPLRD-PGMTGFQTCKDTLKLPVLEVLPGGGWDNLRNIDMGRVIDLTYTNCKTTEDGQYIIPDEVYTIPQKESNLEMNSEIRDSWVNYQSTTSFSINTELSLFS---KVNGKFSTEFQRMKTLQVKDQAVTTRVQVRNRIYTVKNSPTSELSFGFTNALMDICDQL-EKNQTKMATYLAELLVLNYGTHVITSVDAGAALVQEDHIRSSFLLDNQNSENTVTASAGIAFLNIVNFKVETDHTSQTLLTKSYLSNRTNSRVQSFGGIPFYPGITLETWQKGITNHLVAIDRAGLPLHFFIKPDKLPGLPGGLVKKLSKTVETAVRHYYTFNTHPGCTNVDSPNFNFQANMEDDSCDAKVTNFTFGGLYQECTELSGDALCQNLEQKNLLTGDFSCPSGYTPVHLLSQTHEEGYSRLECKKKCTLKIF---CKTVCEDVFRVAKAQFRAYWCVATGQVPDNSGLLFGGLFTDKSINPMTNAQSCPAGYIPLNLFESLKVCVSLDYELGYKFSVPFGGFFSCIMGNPLVNSDTAKDIGAPSL--KKCPGGFSQHLAVISDGCQVSYCVKAGIFTGGSLLPVRLPPYTKPPLMS-QVATNTVIVTSSET 614          
BLAST of Macrophage-expressed gene 1 protein vs. UniProt
Match: sp|A1L314|MPEG1_MOUSE (Macrophage-expressed gene 1 protein OS=Mus musculus OX=10090 GN=Mpeg1 PE=1 SV=1)

HSP 1 Score: 370.933 bits (951), Expect = 4.932e-115
Identity = 200/625 (32.00%), Postives = 341/625 (54.56%), Query Frame = 1
Query:  169 LNSIILFIFVYGVLSVSCEIEPNRDQPSSRRVHECKLTSNQYPVNVLPGSGWDNLENKELGQVLEISYKGCFGSNDGSFLIPDNVVITPIKKSIVELTSDIFDHFSNVTSTTAMSINADASYSTPSYKISGSFSFEKIRIKNDQIKEKSSISRSQLRHELYEVAFQPHSKLDAKFRNRILDIGALLKEGKDTIYPQYLADLIVRDFGTHVIRSVDAGATLIKTDVLKSNYVKGFKGDTTKIAAAASFSMTTMLSVNLKGTYVGDTTSLNEFNSNSASTKVETFGGIPFGSNFKLEDWEKTLETNLVAIDRKGEPLSYAITPKNLPEFDEQAVFKIATLIKEAVNRYYAANTRVGCMNMESENFNDDANVDGGNCEPPNTFYSFGGTFQTCS--GPDYQCMDVAAKNPVTNSYACPDNYDTIELQSGLN-------KCINYCTKYLFSTQCHYEC--------SQYALYWCSSTNKTKISEGALFGGFYTNTFPNPLTNSYSCPQYYVATRFGVNAKVCTALNKAEAMEHHLPFGGFYSCKVGNPLLDDPLYNITQDPKYWPQGCSTGYSSHVAIVDRACQISYCVK-----NNALSMREQPPLYRPPFIDLGFGPNMTVITSLDT 1977
            +NS +  + ++ +++ + E +    +  +     CK       + VLPG GWDNL N ++G+V++++Y  C  + DG ++IPD V   P K+S +E+ S++ + + N  STT++SIN + +  +   +++G FS E  R+K  Q+K+++  +R Q+R+ +Y V   P S+L   F   ++DI   L E   T    YLA+L++ ++GTHVI SVDAGA L++ D ++S+++   +     + A+A  +   +++  ++  Y+  T+   ++ SN  +++V++FGG+PF     LE W+K +  +LVAIDR G PL + I P  LP      V K++  ++ AV  YY  NT  GC N++S NFN  AN+D  +C+   T ++FGG +Q C+    D  C ++  KN +T  ++CP  Y  + L S  +       +C   CT  +F   C   C        +++  YWC +  +   + G LFGG +T+   NP+TN+ SCP  Y+      + KVC +L+     +  +PFGGF+SC +GNPL++       + P    + C  G+S H+A++   CQ+SYCVK       +L     PP  +PP +      N  ++T+ +T
Sbjct:    1 MNSFMALVLIWMIIACA-EADKPLGETGTTGFQICKNALKLPVLEVLPGGGWDNLRNVDMGRVMDLTYTNCKTTEDGQYIIPDEVYTIPQKESNLEMNSEVLESWMNYQSTTSLSINTELALFS---RVNGKFSTEFQRMKTLQVKDQAVTTRVQVRNRIYTVKTTPTSELSLGFTKALMDICDQL-EKNQTKMATYLAELLILNYGTHVITSVDAGAALVQEDHVRSSFLLDNQNSQNTVTASAGIAFLNIVNFKVETDYISQTSLTKDYLSNRTNSRVQSFGGVPFYPGITLETWQKGITNHLVAIDRAGLPLHFFIKPDKLPGLPGPLVKKLSKTVETAVRHYYTFNTHPGCTNVDSPNFNFQANMDDDSCDAKVTNFTFGGVYQECTELSGDVLCQNLEQKNLLTGDFSCPPGYSPVHLLSQTHEEGYSRLECKKKCTLKIF---CKTVCEDVFRVAKAEFRAYWCVAAGQVPDNSGLLFGGVFTDKTINPMTNAQSCPAGYIPLNLFESLKVCVSLDYELGFKFSVPFGGFFSCIMGNPLVNSDTAKDVRAPSL--KKCPGGFSQHLAVISDGCQVSYCVKAGIFTGGSLLPVRLPPYTKPPLMS-QVATNTVIVTNSET 614          
BLAST of Macrophage-expressed gene 1 protein vs. TrEMBL
Match: gnl|BL_ORD_ID|23441982 (tr|A0A2B4RFA8|A0A2B4RFA8_STYPI Macrophage-expressed gene 1 protein OS=Stylophora pistillata OX=50429 GN=Mpeg1 PE=4 SV=1)

HSP 1 Score: 432.565 bits (1111), Expect = 1.445e-135
Identity = 225/606 (37.13%), Postives = 336/606 (55.45%), Query Frame = 1
Query:  190 IFVYGVLSVSCEIEPNRDQPSSR----RVHECKLTSNQYPVNVLPGSGWDNLENKELGQVLEISYKGCFGSNDGSFLIPDNVVITPIKKSIVELTSDIFDHFSNVTSTTAMSINADASYSTPSYKISGSFSFEKIRIKNDQIKEKSSISRSQLRHELYEVAFQPHSKLDAKFRNRILDIGALLKEGKDTIYPQYLADLIVRDFGTHVIRSVDAGATLIKTDVLKSNYVKGFKGDTTKIAAAASFSMTTMLSVNLKGTYVGDTTSLNEFNSNSASTKVETFGGIPFGSNFKLEDWEKTLETNLVAIDRKGEPLSYAITPKNLPEFDEQAVFKIATLIKEAVNRYYAANTRVGCMNMESENFNDDANVDGGNCEPPNTFYSFGGTFQTC----SGPDYQCMDVAAKNPVTNSYACPDNYDTIELQSGL--NKCINYCTKYLFSTQCHYEC--SQYALYWCSSTNKTKISEGALFGGFYTNTFPNPLTNSYSCPQYYVATRFGVNAKVCTALNKAEAMEHHLPFGGFYSCKVGNPL---------------LDDPLYNITQDPKYWPQGCSTGYSSHVAIVDRACQISYCVKNNALSMREQPPLYRPPF 1926
            +F   ++ + C +  + +  S R        C L S  Y   VLPG GWDNL N  +G V  ++Y  C  S+DG +LIPD+V + P+K+S V + ++++DH++N +STT  SINA+AS +     +SGS+S E   +K  Q+++KS  +R+QLRH+LY V  QP + L   F++R+L+I + L+   +T Y  +LA ++VRDFGTH + SV AGA L K D L   +V  F  D +KI AAAS S   +   +   T   D   L+++  N+A + V TFGG PF  NF + +WE  +   LVA+DR G+PL +AIT  ++PE  E+ VFK+A+++++A+ +YY  NT  GC  M+S +F+  AN+D G+CE P   Y+FGG +QTC    S     C     KNP+T  Y C + Y+ + +  G     C   C  +     C   C  + Y  YWC +      + G LFGG Y+N   NP+T  +SCP  + A RFG    VC + +     +  +PFGGF+SC  GNPL                   L+        WP+ C  GYS H+  ++  C+I++CVK+N  + +  P + RPP+
Sbjct:   15 LFQISLVVLGCGLVSSENDSSPRFPVGDPRNCPLASGVYRFEVLPGGGWDNLRNLHMGAVSVMNYSKCKTSDDGKYLIPDDVFLYPVKESKVHVFAEMYDHWNNYSSTTTKSINAEASGTFGFGSVSGSYSSEFESVKKHQVEDKSVTTRAQLRHDLYTVKLQPDAPLQPAFKSRLLEIASHLQH-NNTAYASFLAQVLVRDFGTHYVTSVMAGAALAKVDHLTKKFVADFDEDKSKITAAASASFFGVFGASASYTQTTDKKVLDQYTKNTAYSTVYTFGGPPFRVNFTINEWEDQMADELVAVDRSGDPLHFAITHGSVPELSEELVFKLASVVEKAIKQYYEHNTIKGCTKMDSPDFSFQANLDDGSCESPTNNYTFGGVYQTCQCEGSPSSNPCGSFVQKNPLTADYTCSNGYEPVMVHQGRTPQTCHRECHGWWIFKSCDTYCGFANYYTYWCVAKGAVPPNTGYLFGGLYSNVLKNPVTQDHSCPLKFYALRFGATMHVCVSDDYELGFQQSVPFGGFFSCNTGNPLGVKKSSSRAKGSNGHSSLELFVKQSGSSVWPKTCPIGYSQHLGAIEENCEINFCVKSNVFNSKGFPIIKRPPY 619          
BLAST of Macrophage-expressed gene 1 protein vs. TrEMBL
Match: gnl|BL_ORD_ID|17533042 (tr|A7SEK6|A7SEK6_NEMVE Predicted protein (Fragment) OS=Nematostella vectensis OX=45351 GN=v1g115372 PE=4 SV=1)

HSP 1 Score: 421.009 bits (1081), Expect = 1.942e-133
Identity = 220/551 (39.93%), Postives = 319/551 (57.89%), Query Frame = 1
Query:  304 VLPGSGWDNLENKELGQVLEISYKGCFGSNDGSFLIPDNVVITPIKKSIVELTSDIFDHFSNVTSTTAMSINADASYSTPSYKISGSFSFEKIRIKNDQIKEKSSISRSQLRHELYEVAFQPHSKLDAKFRNRILDIGALLKEGKDTIYPQYLADLIVRDFGTHVIRSVDAGATLIKTDVLKSNYVKGFKGDTTKIAAAASFSMTTMLSVNLKGTYVGDTTSLNEFNSNSASTKVETFGGIPFGSNFKLEDWEKTLETNLVAIDRKGEPLSYAITPKNLPEFDEQAVFKIATLIKEAVNRYYAANTRVGCMNMESENFNDDANVDGGNCEPPNTFYSFGGTFQTC----SGPDYQCMDVAAKNPVTNSYACPDNYDTIELQSGL--NKCINYCTK-YLFSTQCHYEC--SQYALYWCSSTNKTKISEGALFGGFYTNTFPNPLTNSYSCPQYYVATRFGVNAKVCTALNKAEAMEHHLPFGGFYSCKVGNPLLDDPLYNITQDPKYWPQGCSTGYSSHVAIVDRACQISYCVKNNALSMREQPPLYRPPFI 1929
            VLPG GWDNL N  +G V  ++Y  C  S+DG FL+PDNV + P+KKS V   ++ +DH++N +STT  SINA+A  S     +SGSFS E   +K  Q+++K+  +R QLRH  Y    QP S L   F++R+L+I + L+   +T Y  +LA ++VRDFGTH + SVDAGA L K D L   +V     D +KI A+AS S       +   +   DT +L+E+   +  +   T+GG PF  NF + +WE  +   LVA+DR G+PL Y ITP +LPE  EQA F++A ++K A+ +YY  NT  GC  M+S NF+  AN+D G+C+ P   Y+FGG +QTC    S     C  +A KNP+T  Y C   Y+ + +  G     C   C + +LF  +C  +C    ++ YWC + +    + G LFGG Y++   NPLT  +SCP  + A +FG   KVC + +     +  LPFGGF+SC  GNPL         + P    +GC TG+S H+  ++  C+I YCVK+N  +++  P + RPP++
Sbjct:    2 VLPGGGWDNLRNLHMGAVSAMNYSLCRSSDDGKFLVPDNVFLYPVKKSKVNTFAEFYDHWNNYSSTTTKSINAEAKASFGFGSVSGSFSSEYESVKKHQVEDKTVTTRVQLRHVFYTAKLQPDSPLQPAFKDRLLEIASHLQH-NNTAYASFLAQVLVRDFGTHYVSSVDAGAVLAKVDHLTKKFVADSNEDKSKITASASASFFHFFGASGSYSKSTDTKTLDEYTKATVYSTTYTYGGPPFRVNFTINEWEDKMLDELVAVDRSGDPLHYTITPGSLPELCEQATFQLAAVVKNAIKQYYIHNTIKGCTKMDSPNFSFQANMDDGSCQSPTNNYTFGGVYQTCQTDGSPSSDPCAPLAQKNPLTADYTCTPGYEPVLVHQGRTPQSCHKDCHRVWLFFKRCSVQCGFGSFSTYWCVAKSAVPANSGYLFGGLYSDVLKNPLTQDHSCPLKFYALKFGATMKVCVSDDYELGYQQSLPFGGFFSCNAGNPL-------AFKKPPTGDKGCPTGFSQHLGAIEANCEIQYCVKSNVFNLQGLPIVRRPPYL 544          
BLAST of Macrophage-expressed gene 1 protein vs. TrEMBL
Match: gnl|BL_ORD_ID|23535608 (tr|A0A210Q242|A0A210Q242_MIZYE Macrophage-expressed gene 1 protein OS=Mizuhopecten yessoensis OX=6573 GN=KP79_PYT10885 PE=4 SV=1)

HSP 1 Score: 424.476 bits (1090), Expect = 1.244e-132
Identity = 228/627 (36.36%), Postives = 343/627 (54.70%), Query Frame = 1
Query:  256 RRVHECKLTSNQYPVNVLPGSGWDNLENKELGQVLEISYKGCFGSNDGSFLIPDNVVITPIKKSIVELTSDIFDHFSNVTSTTAMSINADASYSTPSYKISGSFSFEKIRIKNDQIKEKSSISRSQLRHELYEVAFQPHSKLDAKFRNRILDIGALLKEGKDTIYPQYLADLIVRDFGTHVIRSVDAGATLIKTDVLKSNYVKGFKGDTTKIAAAASFSMTTMLSVNLKGTYVGDTTSLNEFNSNSASTKVETFGGIPFG-SNFKLEDWEKTLETNLVAIDRKGEPLSYAITPKNLPEFDEQAVFKIATLIKEAVNRYYAANTRVGCMNMESENFNDDANVDGGNCEPPNTFYSFGGTFQTCSGP----DYQCMDVAAKNPVTNSYACPDNYDTIELQSGLNKCINY------CTKYLFSTQC-HYECSQYALY---WCSSTNKTKISEGALFGGFYTNTFPNPLTNSYSCPQYYVATRFGVNAKVCTALNKAEAMEHHLPFGGFYSCKVGNPLL-----DDPLYNITQD------------PKYWPQGCSTGYSSHVAIVDRACQISYCVKNNALSMREQPPLYRPPFIDL---GFGPNMTVITSLDTPMGVRLSVDENGKWSHNH 2031
            +R  +  L  N     VLPG GWDNL NK  GQV+  +Y  C  ++DG +L+PD +   P+KKS +E  +++F H+ N TSTT+ ++NA+A +    + I GSFS E   +++ Q+ ++S  +R Q+R+  Y    QP +  + KF+ R+L I   + + + T   +Y + L+VRDFGTHVI SVDAGA L++ D +K+ Y + +  D +K+ A+AS S  ++  +     +      ++++  N   ++ +T GG  F   NF L DW +++  NLVA+DR G+PL + ITP  LPE     V+++   +K+A+N YY  N   GC N +S NF+  ANVD G C+  +  Y+FGG +QTCS         C D+   NP+T   +CP NY+ + +  G+ +  N       C    FST C  Y  SQ A Y   WC +T K     G LFGG +T+T  NPLT   +CP Y+ A +   + +VC + +      + +PF GF+SC+ GNPL      +D       D            P +WP+GC TGYS H+A+V   C+ISYC+K NALS    P + RPPF+++   GF  N +V+ S D      +    NG  +  H
Sbjct:   41 QRCMQRSLNKNVIRYEVLPGGGWDNLRNKHGGQVIYYNYSLCQTTDDGQYLLPDGINTVPLKKSKLETFAELFTHWQNYTSTTSSTVNAEAGFHIEHFGIGGSFSHETGSVRSRQMMDESVTTRVQMRYVRYSAKLQPDTAFNPKFKARLLTIATQIAKNQ-TNMARYESQLLVRDFGTHVITSVDAGAALVQQDQIKTTYARSYSMDKSKVMASASASFGSVFGIKTGYDHSTSNEMIDQYLGNRTHSETDTIGGSVFQPQNFSLNDWAESVAENLVAVDRAGDPLHFVITPMALPELPSSVVYELIMHVKDAINLYYKHNIYKGCTNADSPNFSFQANVDDGTCQSLSNNYTFGGVYQTCSLSGNIRSNTCADLRQMNPLTGDDSCPPNYEAVMIDKGIKRTPNTVRRCHSCGFLGFSTCCGDYAASQTASYTGFWCVTTGKVPADSGYLFGGLFTSTIGNPLTGGRTCPPYFYALKVSSSLRVCVSDDYELGYRYSVPFAGFFSCRTGNPLKLTSDEEDRHKRSNTDMFVLETFLKSAGPSHWPRGCPTGYSEHMAVVANGCEISYCIKANALSGEGLPTIVRPPFMEIPITGFSDNSSVMISEDGLTWTDVVESRNGFETARH 666          
BLAST of Macrophage-expressed gene 1 protein vs. TrEMBL
Match: gnl|BL_ORD_ID|18713006 (tr|A0A0X3NYC1|A0A0X3NYC1_SCHSO MACPF domain-containing protein OS=Schistocephalus solidus OX=70667 GN=TR158025 PE=4 SV=1)

HSP 1 Score: 398.282 bits (1022), Expect = 2.910e-122
Identity = 238/680 (35.00%), Postives = 344/680 (50.59%), Query Frame = 1
Query:  241 DQPSSRRVHECKLTSNQYPVNVLPGSGWDNLENKELGQVLEIS-YKGCFGSNDGSFLIPDNVVITPIKKSIVELTSDIFDHFSNVTSTTAMSINADASYSTPSYKISGSFSFEKIRIKNDQIKEKSSISRSQLRHELYEVAFQPHSKLDAKFRNRILDIGALLKE------------------------GK------DTIYPQYLADLIVRDFGTHVIRSVDAGATLIKTDVLKSNYVKGFKGDTTKIAAAASFSMTTMLSVNLKGTYVGDTTSLNEFNSNSASTKVETFGGIPF-GSNFKLEDWEKTLETNLVAIDRKGEPLSYAITPKNLPEFDEQAVFKIATLIKEAVNRYYAANTRVGCMNMESENFNDDANVDGGNCEPP----------NTFYSFGGTFQTCSGPDYQCMDVAAKNPVTNSYACPDNYDTIE-LQSGLNKCINYCTKYLF-STQCHYECSQYALYWCSSTNKTKISEGA-----LFGGFYTNTFPNPLTNSYSCPQYYVATRFGVNAKVCTALNKAEAMEHHLPFGGFYSCKVGNPLLDDPLYNITQDP-----------------------------KYWPQGCSTGYSSHVAIVDRACQISYCVKNNALSMREQPPLYRPPFIDL----GFGPNMTVITSLDTPMGVRLSVDE-----NGKW 2019
            + P   R  +C+L  +Q  ++VLPGSGWDNL N+E G  ++   Y  C  S+DG  L+PD+V +  ++ S +ELTSD+F HF+N TS T+ S+N           +SG FSFEK  I+  +   +    RSQLRH +Y V   P S L  +FRNR+LDI A L+                         GK      D I   YLADLIVRD+GTH + SV+AGA + K D L  +       D  ++ A AS +      ++   +      S++++NS  + + V + GG     S+  +  WE ++E+NLVAIDR+G  +   ITP+ LPE  E    ++A +IK AV RYYAANT VGC++  S +++ DANV    C+ P          N     GG ++TCSG D  C    + NP T    CP  Y  ++ L+  +  C N C + LF ++ C  EC+    YWC+   + + S G      LFGG +T+   NP+TN+ SCP YY A   G   +VC + +K     + LPFGGFY+C+ GNPL+D     ++ DP                               WP+ C TGY+SH+A+++  CQ++YC   N++ + ++  L RPPFI L        + TV   LD P   R +        NG+W
Sbjct:   43 ESPRQVRSVQCQLRPDQQLLSVLPGSGWDNLINEERGLTIDRERYTLCRFSSDGKLLLPDDVFVENLRSSNIELTSDVFSHFTNYTSLTSYSMNTATDVKMNFASVSGDFSFEKEYIRKAENVNRGLTVRSQLRHRIYAVHQLPDSTLHPRFRNRLLDIAAHLEASNTTVLFNTSDARRDAITQGGEYTGKHFGALVDHIRAAYLADLIVRDYGTHTVTSVEAGAVIAKVDSLSGSSRLLTSSDRLQLRATASSAFMGFFKISTGASTSNVEQSVDKYNSMVSESTVISHGGTHLKASDLNISHWEDSIESNLVAIDRRGRLIFDLITPRTLPELSETMALRLAGVIKAAVERYYAANTVVGCLDPTSSSYDMDANVAADQCDDPLGNGDDPAAENKRMPLGGVYETCSGSDELCAGRPSLNPATGKAECPYGYMAVQLLEPQVRVCSNKCQQNLFWASNCKQECAVTTAYWCAINPQLENSTGGSDLGFLFGGLFTDATTNPVTNAMSCPLYYDAYPLGRRLRVCLSSDKEMGRRYSLPFGGFYACQSGNPLVD----ALSGDPAASKRVRIERKLRRMDLWMTGRGSPDIFQAAWPKRCPTGYTSHLAVIEDICQVNYCTPANSIKVIQERRLKRPPFIQLPELTARNVDPTVEKILDGPETFRSASGHNYQNINGEW 718          
BLAST of Macrophage-expressed gene 1 protein vs. TrEMBL
Match: gnl|BL_ORD_ID|23415889 (tr|A0A2B4REP2|A0A2B4REP2_STYPI Macrophage-expressed gene 1 protein OS=Stylophora pistillata OX=50429 GN=MPEG1 PE=4 SV=1)

HSP 1 Score: 408.683 bits (1049), Expect = 6.192e-121
Identity = 217/583 (37.22%), Postives = 321/583 (55.06%), Query Frame = 1
Query:  169 LNSIILFIFVYGVLSVSCEIEPNRDQPSSRRVHECKLTSNQYPVNVLPGSGWDNLENKELGQVLEISYKGCFGSNDGSFLIPDNVVITPIKKSIVELTSDIFDHFSNVTSTTAMSINADASYSTPSYKISGSFSFEKIRIKNDQIKEKSSISRSQLRHELYEVAFQPHSKLDAKFRNRILDIGALLKEGKDTIYPQYLADLIVRDFGTHVIRSVDAGATLIKTDVLKSNYVKGFKGDTTKIAAAASFSMTTMLSVNLKGTYVGDTTSLNEFNSNSASTKVETFGGIPFGSNFKLEDWEKTLETNLVAIDRKGEPLSYAITPKNLPEFDEQAVFKIATLIKEAVNRYYAANTRVGCMNMESENFNDDANVDGGNCEPPNTFYSFGGTFQTC----SGPDYQCMDVAAKNPVTNSYACPDNYDTIELQSGL--NKCINYCTKYLFSTQCHYEC--SQYALYWCSSTNKTKISEGALFGGFYTNTFPNPLTNSYSCPQYYVATRFGVNAKVCTALNKAEAMEHHLPFGGFYSCKVGNPL-----LDDP----------LYNITQDPKYWPQGCSTGYSSHVAIVDR 1848
            L  + L +   G++S   +  P      SR    C LTS  Y   VLPG GWDNL N  +G V  ++Y  C  S+DG +LIPD+V + P+K+S V   ++++DH+++ +STTA SIN +AS      +ISGS+S E   +K  Q++ K+  +R+Q+RH LY V  QP++ L   F++R+L+I + L+   +T +  +LA ++V DFGTH + +V AGA L K D LK  +V  F  D +KIAA AS S   +   +   T+  D   L+++  N+  + V TFGG PF +NF +  WE  +   LVA+DR G+PL +AITP ++PE  E+ +FK+  ++++A+N+YY  NT  GC  M+S NF+  AN+D G+C  P   Y+FGG +QTC    S     C     KNP+T  + C + Y+ + +  G     C   C  +     CH  C  S Y  YWC +      + G LFGG Y++   NP+T  +SCP  + A RFG    VC + +    ++  +PFGGF+SC  GNPL      D            L+     P  WP+ C  GYS H+  +D 
Sbjct:   27 LFQVSLVLLGCGLVSAENDSSPRFLVGDSRN---CPLTSGVYRFEVLPGGGWDNLRNLHMGAVSVMNYSNCKTSDDGKYLIPDDVFLYPVKESKVHEFAEMYDHWNDYSSTTAKSINDEASGKFHFARISGSYSSEFESVKKHQVEGKTVSTRAQVRHHLYTVKLQPNAPLQLGFKSRLLEIASHLQHN-NTAFASFLAQVLVGDFGTHYVTTVKAGAVLAKVDHLKKKFVGDFDKDKSKIAAGASASFFGVFGASASYTHTTDKKVLDQYKQNTVYSTVYTFGGPPFRANFTINKWEDQMADELVAVDRSGDPLHFAITPGSVPELSEELLFKLTKVVEKAINQYYEHNTIRGCTKMDSPNFSFQANLDDGSCGSPTNNYTFGGVYQTCQCEGSPASNPCGSFVQKNPLTADFTCSNGYEAVMVHQGRTPQSCHRECHGWFVFKSCHNLCGFSNYYTYWCVAKGLAPPNTGYLFGGLYSDVLKNPVTQDHSCPLKFYALRFGATMHVCVSDDYELGVQRSVPFGGFFSCNAGNPLGVKKSADSAKGSNGHSSLELFVEQSSPSVWPKTCPIGYSQHLGAIDE 605          

HSP 2 Score: 87.4261 bits (215), Expect = 1.331e-13
Identity = 41/102 (40.20%), Postives = 62/102 (60.78%), Query Frame = 1
Query: 1132 KNLPEFDEQAVFKIATLIKEAVNRYYAANTRVGCMNMESENFNDDANVDGGNCEPPNTFYSFGGTFQTC----SGPDYQCMDVAAKNPVTNSYACPDNYDTI 1425
            K++PE  E+ VFK+A ++++A+ +YY  NTR GC  + S +F+  AN+D G+CE P   Y+FGG +QTC    S     C     KNP+T  Y C + Y+ +
Sbjct:  687 KSVPELSEELVFKLANVVEKAIKQYYEHNTR-GCTKLNSPDFSFQANLDDGSCESPTNNYTFGGVYQTCQCEGSPSSNPCGSFVQKNPLTADYTCSNGYEAV 787          

HSP 3 Score: 68.5514 bits (166), Expect = 7.000e-8
Identity = 37/82 (45.12%), Postives = 49/82 (59.76%), Query Frame = 1
Query:  262 VHE--CKLTSNQYPVNVLPGSGWDNLENKELGQVLEISYKGCFGSNDGSFLIPDNVVITPIK--KSIVELTSDIFDHFSNVT 495
            +HE  C LTS  Y   VLPG GWDNL N  +G V  ++Y  C  S+D  +LIPD+V   PIK  KS+ EL+ ++    +NV 
Sbjct:  623 IHETGCPLTSGVYHFEVLPGGGWDNLRNVHIGAVSVMNYSKCKTSDDVKYLIPDDVFPYPIKESKSVPELSEELVFKLANVV 704          
BLAST of Macrophage-expressed gene 1 protein vs. Ensembl Cavefish
Match: MPEG1 (macrophage expressed 1 [Source:HGNC Symbol;Acc:HGNC:29619])

HSP 1 Score: 301.597 bits (771), Expect = 1.460e-90
Identity = 191/571 (33.45%), Postives = 285/571 (49.91%), Query Frame = 1
Query:  346 LGQVLEISYKGCFGSNDGSFLIPDNVVITPIKKSIVELTSDIFDHFSNVTSTTAMSINADASYSTPSYKISGSFSFEKIRIKNDQIKEKSSISRSQLRHELYEVAFQPHSKLDAKFRNRILDIGALLKEGKDTIYPQYLADLIVRDFGTHVIRSVDAGATLIKTDVLKSNYVKGFKGDTTKIAAAASFSMTTMLSVNLKGTYVGDTTSLNEFNSNSASTKVETFGGIPFGSNFKLEDWEKTLETNLVAIDRKGEPLSYAITPKNLPEFDEQAVFKIATLIKEAVNRYYAANTRVGCMNMESENFNDDANVDGGNCEPPNTFYSFGGTFQTC----SGPDYQCMDVAAKNPVTNSYACPDNYDTIELQSGLNK-------CINYC--TKYLFSTQC---------HYECSQYALYWCSSTNKTKISEGALFGGFYTNTFPNPLTNSYSC-PQYYVATRFGVNAKVCTALNKAEAMEHHLPFGGFYSCKVGNPLLDDPLYNITQDPKYWPQGCSTGYSSHVAIVDRACQISYCVKNNALSMRE-----QPPLYRPPFIDLGFGPNMTVITSLD 1974
            +G+V+ ISY  C  + DG +LIPD V + P K S VE+ S+I   +    S+T+ SINAD S+ +    ++  FS E  R+K  Q+K  S  +R Q+R+ LY V   P   LD++F  +  +I   + E   T + +YL++ +V D+GTHVI SVD GATL++ D LKS+YV   +   + ++A+A  +    +  ++       T+    +  N   +   + GG  F     L+ W+++   NLVAIDR G PL Y + P   P+     V K+A  + +A+ RYY  NT  GC+  +S+NFN  ANVD  +CE PNT  SFGG +Q C    S  D  C ++A+KNP T SY+C   Y    L+S   +       C  +C    +L+   C         H   +Q   YWC++   T    G LFGG +  +  NPLT S SC P ++  T      K+C + +   A    +PFGGF+SC+  N L                  C   +S H+  +   CQI +CV++   +  E      PP  RPP I +     + V+T  D
Sbjct:    1 MGRVMNISYSQCQTTEDGVYLIPDEVFVIPQKVSKVEMNSEIISSWLEQKSSTSSSINADVSFFS---VVNAKFSTENQRMKTHQVKGNSVTARVQVRNHLYTVKAYPDFTLDSRFARQAEEIADAI-ENNQTRHAEYLSEKMVLDYGTHVITSVDTGATLVEEDYLKSSYVSDAQSSQSSVSASAGANFFDKVKFDIGTKDSQGTSETRNYQGNITYSITLSHGGALFYPGITLQKWQESTLNNLVAIDRSGLPLHYFLNPSVFPDLPLPTVNKLAVSVSQAIERYYKVNTHPGCVKPDSKNFNFQANVDDASCEGPNTNLSFGGVYQQCTPLNSYGDAICQELASKNPATGSYSCQQPYIATLLRSETQERPYDQYVCHRHCYGCGFLWLDTCCENICGNVYHVRRAQIKTYWCATNGATPEFSGYLFGGLFGPSLQNPLTKSRSCPPNFFTQTFLSSGFKICLSNDYEAATRFSVPFGGFFSCQSTNQLAGS------------QSRCPPQFSQHLVAISDGCQILFCVQSGIFTGGELLPIRLPPFTRPPVISMIATNTVAVMTEGD 555          
BLAST of Macrophage-expressed gene 1 protein vs. Ensembl Cavefish
Match: ENSAMXT00000015822.2 (pep primary_assembly:Astyanax_mexicanus-2.0:6:8259512:8262317:1 gene:ENSAMXG00000015374.2 transcript:ENSAMXT00000015822.2 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 298.13 bits (762), Expect = 3.197e-89
Identity = 186/552 (33.70%), Postives = 284/552 (51.45%), Query Frame = 1
Query:  346 LGQVLEISYKGCFGSNDGSFLIPDNVVITPIKKSIVELTSDIFDHFSNVTSTTAMSINADASYSTPSYKISGSFSFEKIRIKNDQIKEKSSISRSQLRHELYEVAFQPHSKLDAKFRNRILDIGALLKEGKDTIYPQYLADLIVRDFGTHVIRSVDAGATLIKTDVLKSNYVKGFKGDTTKIAAAASFSMTTMLSVNLKGTYVGDTTSLNEFNSNSASTKVETFGGIPFGSNFKLEDWEKTLETNLVAIDRKGEPLSYAITPKNLPEFDEQAVFKIATLIKEAVNRYYAANTRVGCMNMESENFNDDANVDGGNCEPPNTFYSFGGTFQTCS----GPDYQCMDVAAKNPVTNSYACPDNYDTIELQSGLNKCINYCTKYLFSTQCH-------YEC-------------SQYALYWCSSTNKTKISEGALFGGFYTNTFPNPLTNSYSCPQYYVATRFGVNA-KVCTALNKAEAMEHHLPFGGFYSCKVGNPLLDDPLYNITQDPKYWPQGCSTGYSSHVAIVDRACQISYCVKNNALSMREQPPLYRPPF 1926
            +G+V+ +SY  C  + DG +LIPD V + P K S VE+ S+I   +    S+T+ SINAD S+ +    ++  FS E  R+K  Q+   S  +R Q+R+ LY V   P   LD++F  ++ +I   + E   T + +YL++ +V D+GTHVI SVDAGATL + D LKS+YV   +   + ++A+A  +    +  ++       T+    +  N   +   + GG  F     L+ W+++   NLVAIDR G PL Y + P    +     V K+A L+ +A+ RYY  NTR GC+  +S NF+  ANVD  +CE P+T  SFGG +Q C+      D  C ++A+ NP T SY+C   Y    L+S   +      +Y+ +T CH       + C             +Q   YWC++   T    G LFGG +  +F NPLT S SCP  + A  F  N  K+C + +   A +  +PFGGF+SC+  N L     +            C   +S H+A +   CQI +CV++   +  E  P++ PPF
Sbjct:    1 MGRVMNMSYSQCQTTEDGVYLIPDEVFVIPQKVSKVEMNSEIISSWLEQRSSTSGSINADGSFFS---VLNCKFSAENQRMKTHQVNYNSVTARVQVRNHLYTVKAYPDFSLDSRFAQQVEEIADAI-ENNQTRHAEYLSEKLVLDYGTHVITSVDAGATLEEEDYLKSSYVSDTQSSQSSVSASAGANFFNKVQFDIGSKESQTTSETRNYLGNVTYSITLSHGGALFYPGITLQKWQESTLNNLVAIDRSGLPLHYFLNPSVFSDLPLPTVNKLALLVSQAIERYYKVNTRPGCVKPDSRNFDFQANVDDASCEGPSTNLSFGGVYQQCTPLTPDGDVICQELASTNPATGSYSCKQPYIATLLRSETQE--RPYDQYVCNTHCHDCGFLGLFTCCDQVCGNVYHVRRAQINTYWCATNGATPEFSGYLFGGIFGPSFQNPLTKSRSCPSNFFAQTFLSNGFKICLSSDYETATKFSVPFGGFFSCQSTNLLAGGQSH------------CPPQFSQHLATITDGCQILFCVQSGIFTGGELKPIHLPPF 534          
BLAST of Macrophage-expressed gene 1 protein vs. Ensembl Nematostella
Match: EDO37879 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SEK6])

HSP 1 Score: 421.009 bits (1081), Expect = 2.686e-137
Identity = 220/551 (39.93%), Postives = 319/551 (57.89%), Query Frame = 1
Query:  304 VLPGSGWDNLENKELGQVLEISYKGCFGSNDGSFLIPDNVVITPIKKSIVELTSDIFDHFSNVTSTTAMSINADASYSTPSYKISGSFSFEKIRIKNDQIKEKSSISRSQLRHELYEVAFQPHSKLDAKFRNRILDIGALLKEGKDTIYPQYLADLIVRDFGTHVIRSVDAGATLIKTDVLKSNYVKGFKGDTTKIAAAASFSMTTMLSVNLKGTYVGDTTSLNEFNSNSASTKVETFGGIPFGSNFKLEDWEKTLETNLVAIDRKGEPLSYAITPKNLPEFDEQAVFKIATLIKEAVNRYYAANTRVGCMNMESENFNDDANVDGGNCEPPNTFYSFGGTFQTC----SGPDYQCMDVAAKNPVTNSYACPDNYDTIELQSGL--NKCINYCTK-YLFSTQCHYEC--SQYALYWCSSTNKTKISEGALFGGFYTNTFPNPLTNSYSCPQYYVATRFGVNAKVCTALNKAEAMEHHLPFGGFYSCKVGNPLLDDPLYNITQDPKYWPQGCSTGYSSHVAIVDRACQISYCVKNNALSMREQPPLYRPPFI 1929
            VLPG GWDNL N  +G V  ++Y  C  S+DG FL+PDNV + P+KKS V   ++ +DH++N +STT  SINA+A  S     +SGSFS E   +K  Q+++K+  +R QLRH  Y    QP S L   F++R+L+I + L+   +T Y  +LA ++VRDFGTH + SVDAGA L K D L   +V     D +KI A+AS S       +   +   DT +L+E+   +  +   T+GG PF  NF + +WE  +   LVA+DR G+PL Y ITP +LPE  EQA F++A ++K A+ +YY  NT  GC  M+S NF+  AN+D G+C+ P   Y+FGG +QTC    S     C  +A KNP+T  Y C   Y+ + +  G     C   C + +LF  +C  +C    ++ YWC + +    + G LFGG Y++   NPLT  +SCP  + A +FG   KVC + +     +  LPFGGF+SC  GNPL         + P    +GC TG+S H+  ++  C+I YCVK+N  +++  P + RPP++
Sbjct:    2 VLPGGGWDNLRNLHMGAVSAMNYSLCRSSDDGKFLVPDNVFLYPVKKSKVNTFAEFYDHWNNYSSTTTKSINAEAKASFGFGSVSGSFSSEYESVKKHQVEDKTVTTRVQLRHVFYTAKLQPDSPLQPAFKDRLLEIASHLQH-NNTAYASFLAQVLVRDFGTHYVSSVDAGAVLAKVDHLTKKFVADSNEDKSKITASASASFFHFFGASGSYSKSTDTKTLDEYTKATVYSTTYTYGGPPFRVNFTINEWEDKMLDELVAVDRSGDPLHYTITPGSLPELCEQATFQLAAVVKNAIKQYYIHNTIKGCTKMDSPNFSFQANMDDGSCQSPTNNYTFGGVYQTCQTDGSPSSDPCAPLAQKNPLTADYTCTPGYEPVLVHQGRTPQSCHKDCHRVWLFFKRCSVQCGFGSFSTYWCVAKSAVPANSGYLFGGLYSDVLKNPLTQDHSCPLKFYALKFGATMKVCVSDDYELGYQQSLPFGGFFSCNAGNPL-------AFKKPPTGDKGCPTGFSQHLGAIEANCEIQYCVKSNVFNLQGLPIVRRPPYL 544          
BLAST of Macrophage-expressed gene 1 protein vs. Ensembl Nematostella
Match: EDO28266 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7T6Y8])

HSP 1 Score: 93.5893 bits (231), Expect = 7.824e-23
Identity = 51/108 (47.22%), Postives = 71/108 (65.74%), Query Frame = 1
Query:  304 VLPGSGWDNLENKELGQVLEISYKGCFGSNDGSFLIPDNVVITPIKKSIVELTSDIFDHFSNVTSTTAMSINADASYSTPSYKISGSFSFEKIRIKNDQIKEKSSISR 627
            VLPG GWDNL N  +G V  ++Y  C  S+DG FLIPDNV + P+KKS V   ++ +DH++N +STT  SINA+A  S     +SGSFS E   +K  Q+++K+  +R
Sbjct:    2 VLPGGGWDNLRNLHMGAVSAMNYSLCRSSDDGKFLIPDNVFLYPVKKSKVNTFAEFYDHWNNYSSTTTKSINAEAKASFGFGSVSGSFSSEYESVKKHQVEDKTVTTR 109          
BLAST of Macrophage-expressed gene 1 protein vs. Ensembl Medaka
Match: MPEG1 (macrophage-expressed gene 1 protein [Source:NCBI gene;Acc:101169041])

HSP 1 Score: 343.584 bits (880), Expect = 1.426e-105
Identity = 200/582 (34.36%), Postives = 316/582 (54.30%), Query Frame = 1
Query:  262 VHECKLTSNQ--YPVNVLPGSGWDNLENKELGQVLEISYKGCFGSNDGSFLIPDNVVITPIKKSIVELTSDIFDHFSNVTSTTAMSINADASYSTPSYKISGSFSFEKIRIKNDQIKEKSSISRSQLRHELYEVAFQPHSKLDAKFRNRILDIGALLKEGKDTIYPQYLADLIVRDFGTHVIRSVDAGATLIKTDVLKSNYVKGFKGDTTKIAAAASFSMTTMLSVNLKGTYVGDTTSLNEFNSNSASTKVETFGGIPFGSNFKLEDWEKTLETNLVAIDRKGEPLSYAITPKNLPEFDEQAVFKIATLIKEAVNRYYAANTRVGCMNMESENFNDDANVDGGNCEPPNTFYSFGGTFQTC------SGPDYQCMDVAAKNPVTNSYACPDNYDTIELQSGLNK-------C--INYCTKYL-----FSTQC----HYECSQYALYWCSSTNKTKISEGALFGGFYTNTFPNPLTNSYSCPQYYVATRFGVNA-KVCTALNKAEAMEHHLPFGGFYSCKVGNPLLDDPLYNITQDPKYWPQGCSTGYSSHVAIVDRACQISYCVKNNALSMREQPPLYRPPF 1926
            + +C+ ++N     + VLPG GWDNL N ++G+V+  SY  C  + DG +LIPD V + P K++ VE  S+I   + +   +TA SIN D S+      ++  FS E  R+K  Q+K+ S+ +R Q+R+ +Y V   P   LD++F +++ +I   + E   T    YL++ +V DFGTHVI SVDAGA+L + D L+S+YV     D++ I A+A  +    L  ++   Y   +++L  + SN   + +++ GG PF     L+ W+++ + NLVAIDR G PL Y I    + +  +  + K+A  + +A+ RYY  NTR GC+++ ++N+N  ANVD  +C+ P T  SFGG +Q C      +GP   C ++A KNP T  ++C   Y    L+S + +       C  I Y   +L        QC    H   ++   YWCS   K   S G LFGG Y+ + PNP+TN+ SCP  Y++ RF  +  ++C + +   A    +PFGG +SC+  NPL ++             + C  GYS H+  V   C+I YCV++   +  +  P++ PPF
Sbjct:   56 LRQCRASTNLSLTALEVLPGGGWDNLRNMDMGRVMNFSYFQCQTTEDGLYLIPDEVFVVPYKETGVETNSEIISSWLDQKGSTAASINDDVSFLP---VLNAKFSVEITRMKTHQVKDSSTTARVQVRNFIYSVKSYPDFALDSRFAHQVKEIADAI-ENNQTRRADYLSEKMVVDFGTHVITSVDAGASLSQEDYLRSSYVSNSVSDSSSIKASAGLNFFDKLKFDISSDYTQKSSTLQNYQSNITYSIIQSHGGTPFYPGISLQKWQESTKNNLVAIDRSGVPLHYLINTNTIQDLPQPTLNKVALTVSQAIERYYRINTRPGCVDVTAKNYNFQANVDDKSCKGPATNLSFGGVYQACTELSSDAGP--LCEELAQKNPNTGDFSCRSPYTPTLLRSEVRQKGYTTYDCYDIRYSCGFLGLFTCHRKQCQDNYHVRSARILTYWCSVNGKAPESSGYLFGGIYSPSSPNPITNAKSCPANYISLRFLSDGQRICVSQDYELATRFSVPFGGLFSCESVNPLANN------------QRRCPPGYSQHLGTVSDGCEILYCVQSGLFTGGKLLPIHLPPF 619          
BLAST of Macrophage-expressed gene 1 protein vs. Ensembl Medaka
Match: ENSORLT00000006104.2 (pep primary_assembly:ASM223467v1:9:9652430:9669002:1 gene:ENSORLG00000027013.1 transcript:ENSORLT00000006104.2 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 339.732 bits (870), Expect = 5.870e-105
Identity = 199/582 (34.19%), Postives = 314/582 (53.95%), Query Frame = 1
Query:  262 VHECKLTSNQ--YPVNVLPGSGWDNLENKELGQVLEISYKGCFGSNDGSFLIPDNVVITPIKKSIVELTSDIFDHFSNVTSTTAMSINADASYSTPSYKISGSFSFEKIRIKNDQIKEKSSISRSQLRHELYEVAFQPHSKLDAKFRNRILDIGALLKEGKDTIYPQYLADLIVRDFGTHVIRSVDAGATLIKTDVLKSNYVKGFKGDTTKIAAAASFSMTTMLSVNLKGTYVGDTTSLNEFNSNSASTKVETFGGIPFGSNFKLEDWEKTLETNLVAIDRKGEPLSYAITPKNLPEFDEQAVFKIATLIKEAVNRYYAANTRVGCMNMESENFNDDANVDGGNCEPPNTFYSFGGTFQTC------SGPDYQCMDVAAKNPVTNSYACPDNYDTIELQSGLNK-------C--INYCTKYLFSTQCHYECSQ--YAL-------YWCSSTNKTKISEGALFGGFYTNTFPNPLTNSYSCPQYYVATRFGVNA-KVCTALNKAEAMEHHLPFGGFYSCKVGNPLLDDPLYNITQDPKYWPQGCSTGYSSHVAIVDRACQISYCVKNNALSMREQPPLYRPPF 1926
            + +C+ ++N     + VLPG GWDNL N ++G+V+   Y  C  + DG +L PD V + P K++ VE  S+I   + +   +TA SIN D S   P   ++  FS E IR+K  Q+K+ S+ +R Q+R+ +Y V   P   LD++F +++ +I   + E   T    YL++ +V DFGTHVI SVDAGA+L + D L S+YV     D + I   A  +    L  ++   Y   +++L  + SN   + +++ GG PF     L+ W+++ + NLVAIDR G PL Y I    + +  +  + K+A  + +A+ RYY  NTR GC+++ ++N+N  ANVD  +CE P T  SFGG +Q C      +GP   C ++A KNP+T  ++C   Y  + L+S + +       C  I Y   +L+   C  E  Q  Y++       YWCS       + G LFGG Y+ + PNP+TN+ SCP  Y++ +F  +  ++C + +   A    +PFGG +SC+  NPL ++             + C  GYS H+  V   C+I YCV++   +  E  P++ PPF
Sbjct:   28 LRQCRASTNLSLKALEVLPGGGWDNLRNMDMGRVMNFGYFQCQTTKDGLYLNPDEVFVVPYKETGVETNSEIISSWLDQKGSTAASINDDVS-DLPV--LNAKFSSEIIRMKTHQVKDSSTTARVQVRNFIYSVKSYPDFALDSRFAHQVKEIVDAI-ENNQTRRADYLSEKMVLDFGTHVITSVDAGASLSQEDYLHSSYVS--VSDRSLIKLQAGLNFYDKLKFDISSNYTQKSSTLQNYQSNITYSIIQSHGGAPFYPGISLQKWQESTKNNLVAIDRSGVPLHYLINSNTIQDLPQPTLNKVALTVSQAIERYYRINTRPGCVDVTAKNYNFQANVDDKSCEGPATNLSFGGVYQACTELSSDAGP--LCEELAQKNPITGDFSCRYPYTPLLLRSEVRQEGYTTRDCYDIIYSCGFLYLYTCQREQCQDNYSVRSARILTYWCSVNGTAPENSGYLFGGIYSPSSPNPITNAKSCPANYISLKFLSDGQRICVSQDYELANNFSVPFGGLFSCESVNPLANN------------QRRCPPGYSQHLGTVSNGCEILYCVQSGLFTGGELLPIHLPPF 589          
BLAST of Macrophage-expressed gene 1 protein vs. Planmine SMEST
Match: SMESG000071519.1 (SMESG000071519.1)

HSP 1 Score: 1015.76 bits (2625), Expect = 0.000e+0
Identity = 497/698 (71.20%), Postives = 575/698 (82.38%), Query Frame = 1
Query:  169 LNSIILFIFVYGVLSVSCEIEPNRDQPSSRRVHECKLTSNQYPVNVLPGSGWDNLENKELGQVLEISYKGCFGSNDGSFLIPDNVVITPIKKSIVELTSDIFDHFSNVTSTTAMSINADASYSTPSYKISGSFSFEKIRIKNDQIKEKSSISRSQLRHELYEVAFQPHSKLDAKFRNRILDIGALLKEGKDTIYPQYLADLIVRDFGTHVIRSVDAGATLIKTDVLKSNYVKGFKGDTTKIAAAASFSMTTMLSVNLKGTYVGDTTSLNEFNSNSASTKVETFGGIPFGSNFKLEDWEKTLETNLVAIDRKGEPLSYAITPKNLPEFDEQAVFKIATLIKEAVNRYYAANTRVGCMNMESENFNDDANVDGGNCEPPNTFYSFGGTFQTCSGPDYQCMDVAAKNPVTNSYACPDNYDTIELQSGLNKCINYCTK-YLFSTQCHYECSQYALYWCSSTNKTKISEGALFGGFYTNTFPNPLTNSYSCPQYYVATRFGVNAKVCTALNKAEAMEHHLPFGGFYSCKVGNPLLDDPLYNITQDPKYWPQGCSTGYSSHVAIVDRACQISYCVKNNALSMREQPPLYRPPFIDLGFGPNMTVITSLDTPMGVRLSVDENGKWSHNHQYKLSNYNXXXXXXXXXXXXXXXXXXXXLGVQRFSRNRKGQVSPESHEFDSRYDSTKDVANLALPGEVPPFRVIID 2259
             N+II+ IFV GVLS  C+ E NRD PS R+VH+CKLT+ QY  ++LPGSGWDNLENKELGQVLEISYK C  SNDGSFLIPDN VI PIK+S VEL SDIFDHFSN TS T+ SINADASY+TPSY+ISGSFS+EK  +KNDQIKEKS +SR QLRHE Y V+FQP SK D +F+NRILDIGALLKEGKDTIYPQYLADLIVRDFGTHVIRSVDAGATLIKTDVLKS YV  FKGDTT IAAAASFSMT +L V +KG Y  DT SL+E+N+NSASTKVET GG PFGSNFKLEDWEK+L++NLVAIDR+G PL YAITP++LPEFD++ V KI TLIK AVNRYYAANTRVGCMNMESENFNDDAN+DGGNCE P ++Y+ GGTFQTC GPDYQC +VA KNP+TNSYACP NY T+EL+SGL+KC   C + + FS  CHYECS YALYWC++T  T  SEG+LFGGFY+NT+PNP+TN+Y+CPQYY  +RFG+   +C A N+AE MEHHLPFGGFYSCKVGNPL D  + N TQDPKYW +GC+TGYSSHVAIV+R CQISYC+KNNALS REQPPL+RPPF+DLGFGPN T+ TSL+TP G++LSVDENGKWS N + K SNYNIII SV   A  +I III+ILG++   + R+  V PE +  D R +ST  + N      V PF+++ID
Sbjct:    2 FNNIIIVIFVCGVLSFKCKSESNRDLPSERQVHKCKLTNKQYAFDILPGSGWDNLENKELGQVLEISYKECLTSNDGSFLIPDNSVIIPIKRSTVELASDIFDHFSNFTSATSKSINADASYATPSYQISGSFSWEKKDVKNDQIKEKSLVSRVQLRHEFYTVSFQPDSKFDRQFKNRILDIGALLKEGKDTIYPQYLADLIVRDFGTHVIRSVDAGATLIKTDVLKSKYVNKFKGDTTTIAAAASFSMTKVLGVTIKGNYFSDTASLDEYNNNSASTKVETVGGRPFGSNFKLEDWEKSLDSNLVAIDRRGNPLFYAITPRSLPEFDDKTVNKIVTLIKNAVNRYYAANTRVGCMNMESENFNDDANIDGGNCETPKSYYTLGGTFQTCKGPDYQCENVAGKNPITNSYACPANYKTVELESGLSKCEKVCVRTFWFSYNCHYECSYYALYWCAATKATTKSEGSLFGGFYSNTYPNPITNAYNCPQYYYPSRFGMVGTICLAFNRAETMEHHLPFGGFYSCKVGNPLSDKFVDNTTQDPKYWSEGCATGYSSHVAIVNRGCQISYCIKNNALSKREQPPLFRPPFVDLGFGPNATITTSLETPTGLKLSVDENGKWSENKKSKSSNYNIIIFSVTAVAIITIMIIILILGIKIHRKTRRITVLPEYNGSD-RSNSTSSLNNPTTSNRVQPFKILID 698          
BLAST of Macrophage-expressed gene 1 protein vs. Planmine SMEST
Match: SMESG000067839.1 (SMESG000067839.1)

HSP 1 Score: 796.964 bits (2057), Expect = 0.000e+0
Identity = 388/409 (94.87%), Postives = 396/409 (96.82%), Query Frame = 1
Query:  154 MIPCRLNSIILFIFVYGVLSVSCEIEPNRDQPSSRRVHECKLTSNQYPVNVLPGSGWDNLENKELGQVLEISYKGCFGSNDGSFLIPDNVVITPIKKSIVELTSDIFDHFSNVTSTTAMSINADASYSTPSYKISGSFSFEKIRIKNDQIKEKSSISRSQLRHELYEVAFQPHSKLDAKFRNRILDIGALLKEGKDTIYPQYLADLIVRDFGTHVIRSVDAGATLIKTDVLKSNYVKGFKGDTTKIAAAASFSMTTMLSVNLKGTYVGDTTSLNEFNSNSASTKVETFGGIPFGSNFKLEDWEKTLETNLVAIDRKGEPLSYAITPKNLPEFDEQAVFKIATLIKEAVNRYYAANTRVGCMNMESENFNDDANVDGGNCEPPNTFYSFGGTFQTCSGPDYQCMDVAAKN 1380
            MIPCRLNSIILFIFVYGVLSVSCEIEP RDQPSSRRVHECKLTSNQYPVNVLPGSGWDNLENKELGQVLEISYKGCFGSNDGSFLIPDNVVITPIKKSIVELTSDIFDHFSNVTSTTAMSINADASYSTPSYKISGSFSFEKIRIKNDQIKEKSSISRSQLRHELYEVAFQPHSKLDAKFRNRILDIGALLKEGKDTIYPQYLADLIVRDFGTHVIRSVDAGATLIKTDVLKSNYVKGFKGDTTKIAAAASFSMTTMLSVNLKGTYVGDTTS+NEFN+NSASTKVETFGG PFGSNF+LE+WEKTLETNLVAIDRKGEPLSYAITPKNLPEFDEQAVFKIATLIKEAVNRYYAANTRVGCMNMESENFNDDANVDGG CE P ++Y+FGGTFQ CSG   QC  +  KN
Sbjct:    1 MIPCRLNSIILFIFVYGVLSVSCEIEPYRDQPSSRRVHECKLTSNQYPVNVLPGSGWDNLENKELGQVLEISYKGCFGSNDGSFLIPDNVVITPIKKSIVELTSDIFDHFSNVTSTTAMSINADASYSTPSYKISGSFSFEKIRIKNDQIKEKSSISRSQLRHELYEVAFQPHSKLDAKFRNRILDIGALLKEGKDTIYPQYLADLIVRDFGTHVIRSVDAGATLIKTDVLKSNYVKGFKGDTTKIAAAASFSMTTMLSVNLKGTYVGDTTSINEFNNNSASTKVETFGGRPFGSNFRLEEWEKTLETNLVAIDRKGEPLSYAITPKNLPEFDEQAVFKIATLIKEAVNRYYAANTRVGCMNMESENFNDDANVDGGTCEHPKSYYNFGGTFQNCSGNVDQCESITEKN 409          
BLAST of Macrophage-expressed gene 1 protein vs. Planmine SMEST
Match: SMESG000020344.1 (SMESG000020344.1)

HSP 1 Score: 557.37 bits (1435), Expect = 0.000e+0
Identity = 276/586 (47.10%), Postives = 378/586 (64.51%), Query Frame = 1
Query:  262 VHECKLTSNQYPVNVLPGSGWDNLENKELGQVLEISYKGCFGSNDGSFLIPDNVVITPIKKSIVELTSDIFDHFSNVTSTTAMSINADASYSTPSYKISGSFSFEKIRIKNDQIKEKSSISRSQLRHELYEVAFQPHSKLDAKFRNRILDIGALLKEGKDTIYPQYLADLIVRDFGTHVIRSVDAGATLIKTDVLKSNYVKGFKGDTTKIAAAASFSMTTMLSVNLKGTYVGDTTSLNEFNSNSASTKVETFGGIPFGSNFKLEDWEKTLETNLVAIDRKGEPLSYAITPKNLPEFDEQAVFKIATLIKEAVNRYYAANTRVGCMNMESENFNDDANVDGGNCEPPNTFYSFGGTFQTCSGPDYQCMDVAAKNPVTNSYACPDNYDTIELQSGLNKCINYCTKYLFSTQCHYECSQYALYWCSSTNKTKISEGALFGGFYTNTFPNPLTNSYSCPQYYVATRFGVNAKVCTALNKAEAMEHHLPFGGFYSCKVGNPLLDDPLYNITQDPKYWPQGCSTGYSSHVAIVDRACQISYCVKNNALSMREQPPLYRPPFIDLGFGPNMTVITSLDTPMGVRLSVDENGKW 2019
             H C+LT+N+YP NVLPGSGWDNL N+E  QVL+ISY  C  SNDG FLIPD   + P  KSIV+L S++  HFS   STT+ SINA+AS  T  Y ISGSFS E+  +K +Q+  KSSIS+SQLR++LY+++    ++LD KF  RIL+IG L++  KD++Y  YLADLIVR+FGTHVI SVDAGA L K D+LK  YV   +   + ++ AASFS+  +        +  D T + E+N+N AST+++T GG PFGS+F LE+WEKTL+TNLVAIDR GEPL   IT  N+PEF ++ +++I  L+K A+ +YY+ NTR+GCM+  S +F+++ANV+ G C      Y FGG +QTC   D +C     KNP T  Y+CP  ++ I+L    N  I +                    WC+  + +    G LFGG YT  +PN +TN+++CPQYY   ++G++ K+C   +K    ++ LPFGGFYSCK GNPL    +YN TQ    +P  C +GYS+H+A +   C  SYCVKNNA+  +   PLYRPPF+DL    N+ V++ L T  G++L + E+G W
Sbjct:    2 AHGCQLTNNEYPFNVLPGSGWDNLSNREQAQVLKISYDKCKASNDGRFLIPDQTKLVPKMKSIVQLDSNLISHFSKYPSTTSKSINAEASGETKKYSISGSFSNEREDVKRNQLNSKSSISQSQLRYDLYKISHIVDAELDTKFHQRILNIGVLIETKKDSLYSAYLADLIVREFGTHVITSVDAGAVLSKIDILKQKYVLDSQVQNSDVSVAASFSLGQICGFKFGSNFKNDDTKIEEYNNNCASTRIKTIGGGPFGSDFSLEEWEKTLDTNLVAIDRIGEPLYNVITKHNIPEFSDKTIYEINLLVKTAIEKYYSTNTRLGCMDFNSHSFDENANVNSGLCNETGNTYPFGGVYQTCQNSD-KCDTYNQKNPATGDYSCPKAFNPIKLFELDNPSITFV-------------------WCAPRSSSSAINGYLFGGMYTEQYPNLVTNNHNCPQYYFPVQYGISGKICITQDKELGGKNSLPFGGFYSCKTGNPLA-LAIYNGTQTN--FPLTCGSGYSTHLASIFNNCHYSYCVKNNAIKTKAATPLYRPPFVDLQMDSNIEVVSELTTSAGMKLVLAEDGIW 564          
BLAST of Macrophage-expressed gene 1 protein vs. Planmine SMEST
Match: SMESG000020345.1 (SMESG000020345.1)

HSP 1 Score: 534.643 bits (1376), Expect = 0.000e+0
Identity = 261/494 (52.83%), Postives = 344/494 (69.64%), Query Frame = 1
Query:  247 PSSRRVHECKLTSNQYPVNVLPGSGWDNLENKELGQVLEISYKGCFGSNDGSFLIPDNVVITPIKKSIVELTSDIFDHFSNVTSTTAMSINADASYSTPSYKISGSFSFEKIRIKNDQIKEKSSISRSQLRHELYEVAFQPHSKLDAKFRNRILDIGALLKEGKDTIYPQYLADLIVRDFGTHVIRSVDAGATLIKTDVLKSNYVKGFKGDTTKIAAAASFSMTTMLSVNLKGTYVGDTTSLNEFNSNSASTKVETFGGIPFGSNFKLEDWEKTLETNLVAIDRKGEPLSYAITPKNLPEFDEQAVFKIATLIKEAVNRYYAANTRVGCMNMESENFNDDANVDGGNCEPPNTFYSFGGTFQTCSGPDYQCMDVAAKNPVTNSYACPDNYDTIELQSGLNKCINYCTKYLFSTQCHYECSQYALYWCSSTNKTKISEGALFGGFYTNTFPNPLTNSYSCPQYYVATRFGVNAKVCTALNKAEAMEHHLPFGGFY 1728
            PSSR VH+C LT  QYP NVLPGSGWDNL NKE GQV +ISY  C GSNDG FLIPD+++ITP  KS V++ SD+  HFS  TSTT+ SIN + S STP+Y+ISGSFS+EK  IK +Q+KEKSSIS+ QLR+ELY VAFQP SKLD  F+NRI+ +G L++  K+ +Y QYLADLIVRD+GTHVIRSVDAGA L K D+LK+ Y+   KG  T I+ AAS S+ + + + + G+   + + + E+N N AS+K+ T GG P+GSNF+L +WEKT++ NLV IDR G+PL + IT ++LPEFD+  V+KI  LIK+A+ RYY  NTR GCM+++S+NF+ +ANV+ G C+     Y FGG +QTC G    C ++   NP T S +CP  Y+   +  GL      CT Y+FST C+   +  + YWC+   K       LFGGFY+  FPNP+TNS++CPQ ++A RFG ++ VC   +     +  LPFGGFY
Sbjct:    4 PSSRIVHKCHLTKTQYPFNVLPGSGWDNLANKESGQVYKISYDNCSGSNDGRFLIPDSIIITPYMKSKVQMDSDMVSHFSKYTSTTSKSINLEVSASTPNYEISGSFSWEKKDIKENQMKEKSSISKVQLRYELYHVAFQPDSKLDPIFKNRIIQLGVLMETQKNYLYSQYLADLIVRDYGTHVIRSVDAGAILSKVDILKAEYLSKHKGSQTTISLAASGSLNSAIGLKIGGSNKNNESEVREYNKNCASSKINTIGGGPYGSNFQLAEWEKTIQKNLVPIDRIGDPLFHVITKRSLPEFDDITVYKIGNLIKDAITRYYKINTRSGCMDIKSDNFDVNANVNNGICQDSKISYVFGGVYQTCEGN--SCENLIQTNPATGSTSCPAGYNATLVYHGLYSEQTICTYYVFSTVCNNFQTYISSYWCAPDPKKNPESVYLFGGFYSKVFPNPITNSFTCPQSFIALRFGHSSWVCVTSDSVLGRKFSLPFGGFY 495          
BLAST of Macrophage-expressed gene 1 protein vs. Planmine SMEST
Match: SMESG000044682.1 (SMESG000044682.1)

HSP 1 Score: 506.908 bits (1304), Expect = 8.808e-169
Identity = 251/614 (40.88%), Postives = 367/614 (59.77%), Query Frame = 1
Query:  211 SVSCEIEPNRDQPSSRRVHECKLTSNQYPVNVLPGSGWDNLENKELGQVLEISYKGCFGSNDGSFLIPDNVVITPIKKSIVELTSDIFDHFSNVTSTTAMSINADASYSTPSYKISGSFSFEKIRIKNDQIKEKSSISRSQLRHELYEVAFQPHSKLDAKFRNRILDIGALLKEGKDTIYPQYLADLIVRDFGTHVIRSVDAGATLIKTDVLKSNYVKGFKGDTTKIAAAASFSMTTMLSVNLKGTYVGDTTSLNEFNSNSASTKVETFGGIPFGSNFKLEDWEKTLETNLVAIDRKGEPLSYAITPKNLPEFDEQAVFKIATLIKEAVNRYYAANTRVGCMNMESENFNDDANVDGGNCEPPNTFYSFGGTFQTCSGPDYQCMDVAAKNPVTNSYACPDNYDTIELQSGLNKCINYCTKYLFSTQCHYECSQYALYWCSSTNKTKISEGALFGGFYTNTFPNPLTNSYSCPQYYVATRFGVNAKVCTALNKAEAMEHHLPFGGFYSCKVGNPLLDDPLYNITQDPK-----------YWPQGCSTGYSSHVAIVDRACQISYCVKNNALSMREQPPLYRPPFIDLGFGPNMTVITSLDTPMGVRLSVDENGKW 2019
            SV C  + + ++        C L SNQ   +VLPGSGWDNL N  +G++L++++  C  SND  +LIP+ + I P K S VE++S+IF HFSN TS ++ SIN DA      +KI GSFS E  +IK+DQ++ KS ++R QLR+ +++  F+P + L   F+NRI+DI  L+ E KD++YP+YLAD+IVRD+GTHVIR++DAGA L KTD L S YVK +  D++ I+ +AS S   M  ++ +       T+++EFN N+  T ++T GG  FG+N  L DWE ++  NLV IDR+GEPL YAITP+ LPE D+  V K+  L+K+A+ RYY AN R+GC+++ S NFN DAN+D GNCE P+  ++FGGT+Q C GP   C   A  NP+T  ++CP  + +I+L SGL +C   C  + F   C   CS +  +WC   N      G  FGG              SCP  Y+  +  ++ ++C  ++      + + FGGF+SC  GNPL  +    + + PK           YWP+ C+ GY +H+  +++ CQISYC + N +S+   P + +PPFI   + PN T +       G  +  D+ G W
Sbjct:   15 SVKCLDQNDGNKLFKNAYELCHLRSNQLTFDVLPGSGWDNLANVGMGRILDLNFSKCSFSNDNKYLIPNQLAIYPQKTSQVEISSEIFRHFSNYTSMSSQSINLDAEGLFGHWKIGGSFSTENTKIKSDQMETKSILTRVQLRYLVFQSMFEPDTPLYPTFKNRIIDIAGLVIENKDSLYPEYLADMIVRDYGTHVIRAIDAGAILSKTDALNSRYVKKYASDSSTISVSASASFLGMFKISGRYQTKTSQTNIDEFNHNADKTHIDTVGGAIFGANMSLSDWENSVMNNLVPIDRRGEPLYYAITPRALPELDQTTVHKVTELLKKAILRYYMANGRIGCLDIYSPNFNPDANIDSGNCEHPSVNFTFGGTYQVCGGP--ACGPYAQVNPLTGGFSCPSGFISIKLHSGLVRCDESCHGWWFWRSCDTTCSYFTTFWCYPVNIGPNYNGYQFGGIRQG----------SCPIGYIPLKVALSTEICVTVDADPFNPYAIKFGGFFSCSAGNPLAKE---YVNKKPKLPSNSKMEGLLYWPKTCAKGYVAHIVSIEQGCQISYCTETNKVSLGPLPLIIKPPFISTNYNPNSTKVFLFKNKKGETIIKDDLGYW 613          
The following BLAST results are available for this feature:
BLAST of Macrophage-expressed gene 1 protein vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 1
Match NameE-valueIdentityDescription
MPEG16.016e-11933.82macrophage expressed 1 [Source:HGNC Symbol;Acc:HGN... [more]
back to top
BLAST of Macrophage-expressed gene 1 protein vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Macrophage-expressed gene 1 protein vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Macrophage-expressed gene 1 protein vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
mpeg1.16.888e-10936.00macrophage expressed 1, tandem duplicate 1 [Source... [more]
mpeg1.16.888e-10936.00macrophage expressed 1, tandem duplicate 1 [Source... [more]
mpeg1.31.045e-10834.57macrophage expressed 1, tandem duplicate 3 [Source... [more]
mpeg1.22.343e-10032.68macrophage expressed 1, tandem duplicate 2 [Source... [more]
mpeg1.16.124e-1345.76macrophage expressed 1, tandem duplicate 1 [Source... [more]
back to top
BLAST of Macrophage-expressed gene 1 protein vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Macrophage-expressed gene 1 protein vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 2
Match NameE-valueIdentityDescription
Pfpl2.132e-11933.72pore forming protein-like [Source:MGI Symbol;Acc:M... [more]
Mpeg17.024e-11732.06macrophage expressed gene 1 [Source:MGI Symbol;Acc... [more]
back to top
BLAST of Macrophage-expressed gene 1 protein vs. UniProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q2KJC3|MPEG1_BOVIN6.547e-12035.65Macrophage-expressed gene 1 protein OS=Bos taurus ... [more]
sp|Q2M385|MPEG1_HUMAN2.889e-11833.82Macrophage-expressed gene 1 protein OS=Homo sapien... [more]
sp|Q5RBP9|MPEG1_PONAB3.455e-11833.66Macrophage-expressed gene 1 protein OS=Pongo abeli... [more]
sp|Q9WV57|MPEG1_RAT4.553e-11733.92Macrophage-expressed gene 1 protein OS=Rattus norv... [more]
sp|A1L314|MPEG1_MOUSE4.932e-11532.00Macrophage-expressed gene 1 protein OS=Mus musculu... [more]
back to top
BLAST of Macrophage-expressed gene 1 protein vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
gnl|BL_ORD_ID|234419821.445e-13537.13tr|A0A2B4RFA8|A0A2B4RFA8_STYPI Macrophage-expresse... [more]
gnl|BL_ORD_ID|175330421.942e-13339.93tr|A7SEK6|A7SEK6_NEMVE Predicted protein (Fragment... [more]
gnl|BL_ORD_ID|235356081.244e-13236.36tr|A0A210Q242|A0A210Q242_MIZYE Macrophage-expresse... [more]
gnl|BL_ORD_ID|187130062.910e-12235.00tr|A0A0X3NYC1|A0A0X3NYC1_SCHSO MACPF domain-contai... [more]
gnl|BL_ORD_ID|234158896.192e-12137.22tr|A0A2B4REP2|A0A2B4REP2_STYPI Macrophage-expresse... [more]
back to top
BLAST of Macrophage-expressed gene 1 protein vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 2
Match NameE-valueIdentityDescription
MPEG11.460e-9033.45macrophage expressed 1 [Source:HGNC Symbol;Acc:HGN... [more]
ENSAMXT00000015822.23.197e-8933.70pep primary_assembly:Astyanax_mexicanus-2.0:6:8259... [more]
back to top
BLAST of Macrophage-expressed gene 1 protein vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Macrophage-expressed gene 1 protein vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Macrophage-expressed gene 1 protein vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 2
Match NameE-valueIdentityDescription
EDO378792.686e-13739.93Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO282667.824e-2347.22Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Macrophage-expressed gene 1 protein vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 2
Match NameE-valueIdentityDescription
MPEG11.426e-10534.36macrophage-expressed gene 1 protein [Source:NCBI g... [more]
ENSORLT00000006104.25.870e-10534.19pep primary_assembly:ASM223467v1:9:9652430:9669002... [more]
back to top
BLAST of Macrophage-expressed gene 1 protein vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000071519.10.000e+071.20SMESG000071519.1[more]
SMESG000067839.10.000e+094.87SMESG000067839.1[more]
SMESG000020344.10.000e+047.10SMESG000020344.1[more]
SMESG000020345.10.000e+052.83SMESG000020345.1[more]
SMESG000044682.18.808e-16940.88SMESG000044682.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30015696 ID=SMED30015696|Name=Macrophage-expressed gene 1 protein|organism=Schmidtea mediterranea sexual|type=transcript|length=2665bp
AGTCGCGATAGCACGCAACGTCGACATTGCGATGACGTAATCATTGTGAA
TCTCTACTACAATCGGATCATTCTAATCACGTGCATCCTAAAACAATATA
AATCTTACAAACGGGAATCCAATTGAACATTTATTTACTCAAGCGTGAAA
CCAATGATACCGTGTAGACTTAATAGTATAATATTGTTTATATTTGTTTA
TGGAGTTCTATCGGTTTCATGTGAAATTGAACCTAACCGAGATCAACCAT
CTTCAAGACGAGTTCATGAGTGTAAACTCACCAGCAACCAATATCCAGTG
AATGTTCTTCCCGGATCTGGGTGGGATAATCTTGAAAACAAAGAACTCGG
TCAAGTTTTAGAAATTTCATATAAAGGATGTTTTGGATCGAATGATGGAA
GCTTTCTCATTCCAGACAATGTGGTGATCACCCCAATAAAGAAATCTATT
GTCGAGTTAACTTCAGATATATTTGACCATTTCTCAAATGTCACCTCTAC
AACGGCGATGTCTATCAACGCCGATGCCAGTTACTCAACACCAAGCTACA
AAATCAGTGGATCATTTTCATTTGAAAAAATAAGAATAAAAAACGATCAA
ATCAAAGAAAAGTCGTCGATTTCGAGATCCCAGTTAAGACATGAATTATA
TGAAGTAGCGTTCCAACCACACTCAAAACTAGACGCAAAATTCAGAAACA
GAATTCTAGATATTGGAGCGTTATTGAAAGAAGGAAAAGACACAATTTAT
CCACAATATTTAGCGGATTTAATTGTCCGTGACTTCGGCACTCACGTCAT
TCGGTCGGTGGATGCGGGAGCGACACTAATAAAGACTGATGTTTTAAAAT
CGAATTATGTCAAAGGTTTTAAAGGGGATACAACTAAGATTGCAGCTGCG
GCATCATTCAGTATGACAACAATGCTTTCAGTCAACCTCAAAGGAACCTA
TGTTGGTGATACCACGAGTCTCAATGAATTCAATAGTAATAGTGCAAGTA
CAAAAGTCGAAACTTTTGGTGGTATACCGTTTGGTTCGAATTTTAAGTTG
GAAGATTGGGAGAAAACCCTTGAAACGAATTTGGTAGCAATTGATCGCAA
AGGTGAACCGTTGTCCTATGCTATCACACCAAAAAATCTTCCAGAATTCG
ATGAACAAGCAGTTTTCAAAATAGCTACGCTCATCAAAGAAGCAGTCAAT
AGATATTATGCAGCCAACACGAGAGTGGGATGTATGAATATGGAGTCAGA
AAATTTCAATGACGACGCAAATGTTGACGGTGGAAACTGCGAACCTCCTA
ATACATTTTACAGTTTTGGAGGAACTTTTCAAACCTGCTCAGGCCCTGAT
TATCAGTGTATGGATGTCGCGGCAAAAAACCCAGTGACCAATAGTTATGC
TTGTCCTGATAACTATGATACCATTGAATTACAAAGTGGATTGAATAAAT
GCATAAATTATTGCACCAAATACTTATTTTCCACTCAATGTCATTACGAG
TGTTCCCAATATGCATTGTATTGGTGTTCTTCTACAAACAAAACGAAAAT
ATCAGAAGGCGCACTTTTCGGGGGATTCTACACTAATACATTTCCGAATC
CACTTACAAATTCCTATAGTTGTCCACAATACTATGTAGCGACAAGATTC
GGCGTAAACGCCAAGGTTTGCACTGCACTCAATAAGGCAGAGGCTATGGA
ACACCATTTGCCGTTTGGAGGATTTTATAGTTGCAAAGTTGGAAATCCTC
TACTAGATGATCCTCTCTACAACATTACACAGGATCCCAAATATTGGCCT
CAAGGTTGTTCAACCGGATATTCATCACATGTAGCTATTGTCGACAGAGC
TTGTCAAATTTCCTATTGCGTTAAAAATAACGCCCTTAGCATGAGAGAGC
AACCGCCTCTCTACCGACCACCTTTTATTGATTTGGGATTTGGACCCAAT
ATGACAGTAATTACCTCTCTGGACACTCCAATGGGGGTCCGATTATCTGT
TGATGAAAACGGGAAATGGAGTCATAATCACCAATACAAATTATCCAATT
ACAATATTATAATAATATCAGTCATTATGGCGGCAGGAGCCAGCATTGCA
ATTATTATTATAATTCTTGGAGTTCAAAGATTCAGCAGAAACCGAAAAGG
TCAAGTCTCACCGGAATCTCATGAATTTGATAGCAGATATGATTCTACTA
AAGATGTTGCCAATCTTGCGTTACCCGGCGAGGTTCCACCGTTTCGTGTT
ATAATTGACGGAGCGAAATGATGCTTGGAACCTTTTATTATTTCTGTTGA
ATCTGATCTGTAAATGTTTTCAGAATATTTTTCTAATAAAATCGTTCTGA
AATTTTAAAGTGATCCTTGATGCTATTAAATGATGGACTTTATTGTACCC
CGAATTGGGTCACCCTTGTTCACGCAAATTCGTGCTTAGGATATTTGTAC
GGGCTTATGCAACTTTTTAAATTTTTATTTTTCCTTATTTTTATTAGCAA
TCCGTTTTATTTATAACGACAAATGCTTGATGTTTGAATCAAATTTTTAT
TATGTTTCTTAATGAAACATAGTGAACAATGTGCCACTAATTTCATAACC
AAGGTCTAATCAAATAGTTTGGGTAGTGAAAGCAATATTACAGAGTTTAG
GTTTGTCATTCATAT
back to top

protein sequence of SMED30015696-orf-1

>SMED30015696-orf-1 ID=SMED30015696-orf-1|Name=SMED30015696-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=706bp
MIPCRLNSIILFIFVYGVLSVSCEIEPNRDQPSSRRVHECKLTSNQYPVN
VLPGSGWDNLENKELGQVLEISYKGCFGSNDGSFLIPDNVVITPIKKSIV
ELTSDIFDHFSNVTSTTAMSINADASYSTPSYKISGSFSFEKIRIKNDQI
KEKSSISRSQLRHELYEVAFQPHSKLDAKFRNRILDIGALLKEGKDTIYP
QYLADLIVRDFGTHVIRSVDAGATLIKTDVLKSNYVKGFKGDTTKIAAAA
SFSMTTMLSVNLKGTYVGDTTSLNEFNSNSASTKVETFGGIPFGSNFKLE
DWEKTLETNLVAIDRKGEPLSYAITPKNLPEFDEQAVFKIATLIKEAVNR
YYAANTRVGCMNMESENFNDDANVDGGNCEPPNTFYSFGGTFQTCSGPDY
QCMDVAAKNPVTNSYACPDNYDTIELQSGLNKCINYCTKYLFSTQCHYEC
SQYALYWCSSTNKTKISEGALFGGFYTNTFPNPLTNSYSCPQYYVATRFG
VNAKVCTALNKAEAMEHHLPFGGFYSCKVGNPLLDDPLYNITQDPKYWPQ
GCSTGYSSHVAIVDRACQISYCVKNNALSMREQPPLYRPPFIDLGFGPNM
TVITSLDTPMGVRLSVDENGKWSHNHQYKLSNYNIIIISVIMAAGASIAI
IIIILGVQRFSRNRKGQVSPESHEFDSRYDSTKDVANLALPGEVPPFRVI
IDGAK*
back to top
Aliases
The feature 'Macrophage-expressed gene 1 protein' has the following synonyms
Synonym
MPEG1-like-3
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000085primitive gut cell
PLANA:0000023embryonic pharynx
PLANA:0002031embryonic gut
PLANA:0002087primitive gut
PLANA:0000059embryonic gut cell
PLANA:0000058embryonic digestive system
Vocabulary: INTERPRO
TermDefinition
IPR039707MPEG1
IPR020864MACPF
Vocabulary: cellular component
TermDefinition
GO:0016020membrane
GO:0016021integral component of membrane
Vocabulary: Schmidtea mediterranea Developmental Stages
TermDefinition
PLANA:0000003Stage 3
PLANA:0000005Stage 5
PLANA:0000004Stage 4
PLANA:0000002Stage 2
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR020864Membrane attack complex component/perforin (MACPF) domainSMARTSM00457MACPF_8coord: 153..353
e-value: 0.0012
score: 25.5
IPR020864Membrane attack complex component/perforin (MACPF) domainPFAMPF01823MACPFcoord: 135..341
e-value: 3.3E-23
score: 82.9
IPR020864Membrane attack complex component/perforin (MACPF) domainPROSITEPS51412MACPF_2coord: 26..355
score: 15.974
IPR039707Macrophage-expressed gene 1 proteinPANTHERPTHR31463FAMILY NOT NAMEDcoord: 12..431
coord: 441..581
NoneNo IPR availablePANTHERPTHR31463:SF4MACROPHAGE-EXPRESSED GENE 1 PROTEINcoord: 12..431
coord: 441..581
NoneNo IPR availablePROSITEPS51257PROKAR_LIPOPROTEINcoord: 1..23
score: 5.0
NoneNo IPR availableSIGNALP_EUKSignalP-noTMSignalP-noTMcoord: 1..20
score: 0.839
NoneNo IPR availableTMHMMTMhelixcoord: 622..644