Heat shock 70 kDa protein

Overview
NameHeat shock 70 kDa protein
Smed IDSMED30015695
Length (bp)482
Neoblast Clusters

Zeng et. al., 2018




 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30015695

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 2

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
intestinal phagocyteSMED30015695SMESG000080786.1 Contig3521newmark_estsPMID:23079596
Forsthoefel et al., 2012
FACS sorted cell population asexual adult cDNA to DNA expression microarray evidence
intestinal phagocyteSMED30015695SMESG000080786.1 Contig3521uc_Smed_v2PMID:23079596
Forsthoefel et al., 2012
FACS sorted cell population asexual adult cDNA to DNA expression microarray evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Heat shock 70 kDa protein vs. Ensembl Human
Match: HSPA2 (heat shock protein family A (Hsp70) member 2 [Source:HGNC Symbol;Acc:HGNC:5235])

HSP 1 Score: 68.1662 bits (165), Expect = 3.274e-18
Identity = 33/46 (71.74%), Postives = 36/46 (78.26%), Query Frame = 3
Query:  252 GNAIGIGLSTAYSCVGVIQLEKPEIIANDQENRSTPSYVAFTDQKK 389
            G AIGI L T YSCVGV Q  K EIIANDQ NR+TPSYVAFTD ++
Sbjct:    5 GPAIGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTER 50          

HSP 2 Score: 41.5874 bits (96), Expect = 3.274e-18
Identity = 20/32 (62.50%), Postives = 23/32 (71.88%), Query Frame = 2
Query:  374 YRSEKRLITDAAKNQVRMKCNDTIFYAKRLIG 469
            +   +RLI DAAKNQV M   +TIF AKRLIG
Sbjct:   45 FTDTERLIGDAAKNQVAMNPTNTIFDAKRLIG 76          
BLAST of Heat shock 70 kDa protein vs. Ensembl Human
Match: HSPA2 (heat shock protein family A (Hsp70) member 2 [Source:HGNC Symbol;Acc:HGNC:5235])

HSP 1 Score: 68.1662 bits (165), Expect = 3.274e-18
Identity = 33/46 (71.74%), Postives = 36/46 (78.26%), Query Frame = 3
Query:  252 GNAIGIGLSTAYSCVGVIQLEKPEIIANDQENRSTPSYVAFTDQKK 389
            G AIGI L T YSCVGV Q  K EIIANDQ NR+TPSYVAFTD ++
Sbjct:    5 GPAIGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTER 50          

HSP 2 Score: 41.5874 bits (96), Expect = 3.274e-18
Identity = 20/32 (62.50%), Postives = 23/32 (71.88%), Query Frame = 2
Query:  374 YRSEKRLITDAAKNQVRMKCNDTIFYAKRLIG 469
            +   +RLI DAAKNQV M   +TIF AKRLIG
Sbjct:   45 FTDTERLIGDAAKNQVAMNPTNTIFDAKRLIG 76          
BLAST of Heat shock 70 kDa protein vs. Ensembl Human
Match: HSPA8 (heat shock protein family A (Hsp70) member 8 [Source:HGNC Symbol;Acc:HGNC:5241])

HSP 1 Score: 67.781 bits (164), Expect = 4.607e-18
Identity = 32/46 (69.57%), Postives = 36/46 (78.26%), Query Frame = 3
Query:  252 GNAIGIGLSTAYSCVGVIQLEKPEIIANDQENRSTPSYVAFTDQKK 389
            G A+GI L T YSCVGV Q  K EIIANDQ NR+TPSYVAFTD ++
Sbjct:    4 GPAVGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTER 49          

HSP 2 Score: 41.2022 bits (95), Expect = 4.607e-18
Identity = 19/32 (59.38%), Postives = 23/32 (71.88%), Query Frame = 2
Query:  374 YRSEKRLITDAAKNQVRMKCNDTIFYAKRLIG 469
            +   +RLI DAAKNQV M   +T+F AKRLIG
Sbjct:   44 FTDTERLIGDAAKNQVAMNPTNTVFDAKRLIG 75          
BLAST of Heat shock 70 kDa protein vs. Ensembl Human
Match: HSPA8 (heat shock protein family A (Hsp70) member 8 [Source:HGNC Symbol;Acc:HGNC:5241])

HSP 1 Score: 67.781 bits (164), Expect = 4.895e-18
Identity = 32/46 (69.57%), Postives = 36/46 (78.26%), Query Frame = 3
Query:  252 GNAIGIGLSTAYSCVGVIQLEKPEIIANDQENRSTPSYVAFTDQKK 389
            G A+GI L T YSCVGV Q  K EIIANDQ NR+TPSYVAFTD ++
Sbjct:    4 GPAVGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTER 49          

HSP 2 Score: 41.2022 bits (95), Expect = 4.895e-18
Identity = 19/32 (59.38%), Postives = 23/32 (71.88%), Query Frame = 2
Query:  374 YRSEKRLITDAAKNQVRMKCNDTIFYAKRLIG 469
            +   +RLI DAAKNQV M   +T+F AKRLIG
Sbjct:   44 FTDTERLIGDAAKNQVAMNPTNTVFDAKRLIG 75          
BLAST of Heat shock 70 kDa protein vs. Ensembl Human
Match: HSPA8 (heat shock protein family A (Hsp70) member 8 [Source:HGNC Symbol;Acc:HGNC:5241])

HSP 1 Score: 67.781 bits (164), Expect = 5.053e-18
Identity = 32/46 (69.57%), Postives = 36/46 (78.26%), Query Frame = 3
Query:  252 GNAIGIGLSTAYSCVGVIQLEKPEIIANDQENRSTPSYVAFTDQKK 389
            G A+GI L T YSCVGV Q  K EIIANDQ NR+TPSYVAFTD ++
Sbjct:    4 GPAVGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTER 49          

HSP 2 Score: 41.2022 bits (95), Expect = 5.053e-18
Identity = 19/32 (59.38%), Postives = 23/32 (71.88%), Query Frame = 2
Query:  374 YRSEKRLITDAAKNQVRMKCNDTIFYAKRLIG 469
            +   +RLI DAAKNQV M   +T+F AKRLIG
Sbjct:   44 FTDTERLIGDAAKNQVAMNPTNTVFDAKRLIG 75          
BLAST of Heat shock 70 kDa protein vs. Ensembl Celegans
Match: hsp-1 (Heat shock 70 kDa protein A [Source:UniProtKB/Swiss-Prot;Acc:P09446])

HSP 1 Score: 66.6254 bits (161), Expect = 3.032e-18
Identity = 31/45 (68.89%), Postives = 35/45 (77.78%), Query Frame = 3
Query:  255 NAIGIGLSTAYSCVGVIQLEKPEIIANDQENRSTPSYVAFTDQKK 389
            NA+GI L T YSCVGV    K EIIANDQ NR+TPSYVAFTD ++
Sbjct:    5 NAVGIDLGTTYSCVGVFMHGKVEIIANDQGNRTTPSYVAFTDTER 49          

HSP 2 Score: 41.5874 bits (96), Expect = 3.032e-18
Identity = 19/32 (59.38%), Postives = 24/32 (75.00%), Query Frame = 2
Query:  374 YRSEKRLITDAAKNQVRMKCNDTIFYAKRLIG 469
            +   +RLI DAAKNQV M  ++T+F AKRLIG
Sbjct:   44 FTDTERLIGDAAKNQVAMNPHNTVFDAKRLIG 75          
BLAST of Heat shock 70 kDa protein vs. Ensembl Celegans
Match: hsp-1 (Heat shock 70 kDa protein A [Source:UniProtKB/Swiss-Prot;Acc:P09446])

HSP 1 Score: 66.6254 bits (161), Expect = 3.032e-18
Identity = 31/45 (68.89%), Postives = 35/45 (77.78%), Query Frame = 3
Query:  255 NAIGIGLSTAYSCVGVIQLEKPEIIANDQENRSTPSYVAFTDQKK 389
            NA+GI L T YSCVGV    K EIIANDQ NR+TPSYVAFTD ++
Sbjct:    5 NAVGIDLGTTYSCVGVFMHGKVEIIANDQGNRTTPSYVAFTDTER 49          

HSP 2 Score: 41.5874 bits (96), Expect = 3.032e-18
Identity = 19/32 (59.38%), Postives = 24/32 (75.00%), Query Frame = 2
Query:  374 YRSEKRLITDAAKNQVRMKCNDTIFYAKRLIG 469
            +   +RLI DAAKNQV M  ++T+F AKRLIG
Sbjct:   44 FTDTERLIGDAAKNQVAMNPHNTVFDAKRLIG 75          
BLAST of Heat shock 70 kDa protein vs. Ensembl Celegans
Match: hsp-3 (Heat shock 70 kDa protein C [Source:UniProtKB/Swiss-Prot;Acc:P27420])

HSP 1 Score: 57.7658 bits (138), Expect = 7.034e-14
Identity = 30/49 (61.22%), Postives = 34/49 (69.39%), Query Frame = 3
Query:  252 GNAIGIGLSTAYSCVGVIQLEKPEIIANDQENRSTPSYVAFTDQKKD*L 398
            G  IGI L T YSCVGV +  + EIIANDQ NR TPSYVAF+  + D L
Sbjct:   33 GTIIGIDLGTTYSCVGVYKNGRVEIIANDQGNRITPSYVAFSGDQGDRL 81          

HSP 2 Score: 35.8094 bits (81), Expect = 7.034e-14
Identity = 18/27 (66.67%), Postives = 21/27 (77.78%), Query Frame = 2
Query:  389 RLITDAAKNQVRMKCNDTIFYAKRLIG 469
            RLI DAAKNQ+ +   +TIF AKRLIG
Sbjct:   80 RLIGDAAKNQLTINPENTIFDAKRLIG 106          
BLAST of Heat shock 70 kDa protein vs. Ensembl Celegans
Match: hsp-3 (Heat shock 70 kDa protein C [Source:UniProtKB/Swiss-Prot;Acc:P27420])

HSP 1 Score: 57.7658 bits (138), Expect = 7.034e-14
Identity = 30/49 (61.22%), Postives = 34/49 (69.39%), Query Frame = 3
Query:  252 GNAIGIGLSTAYSCVGVIQLEKPEIIANDQENRSTPSYVAFTDQKKD*L 398
            G  IGI L T YSCVGV +  + EIIANDQ NR TPSYVAF+  + D L
Sbjct:   33 GTIIGIDLGTTYSCVGVYKNGRVEIIANDQGNRITPSYVAFSGDQGDRL 81          

HSP 2 Score: 35.8094 bits (81), Expect = 7.034e-14
Identity = 18/27 (66.67%), Postives = 21/27 (77.78%), Query Frame = 2
Query:  389 RLITDAAKNQVRMKCNDTIFYAKRLIG 469
            RLI DAAKNQ+ +   +TIF AKRLIG
Sbjct:   80 RLIGDAAKNQLTINPENTIFDAKRLIG 106          
BLAST of Heat shock 70 kDa protein vs. Ensembl Celegans
Match: hsp-3 (Heat shock 70 kDa protein C [Source:UniProtKB/Swiss-Prot;Acc:P27420])

HSP 1 Score: 57.7658 bits (138), Expect = 7.034e-14
Identity = 30/49 (61.22%), Postives = 34/49 (69.39%), Query Frame = 3
Query:  252 GNAIGIGLSTAYSCVGVIQLEKPEIIANDQENRSTPSYVAFTDQKKD*L 398
            G  IGI L T YSCVGV +  + EIIANDQ NR TPSYVAF+  + D L
Sbjct:   33 GTIIGIDLGTTYSCVGVYKNGRVEIIANDQGNRITPSYVAFSGDQGDRL 81          

HSP 2 Score: 35.8094 bits (81), Expect = 7.034e-14
Identity = 18/27 (66.67%), Postives = 21/27 (77.78%), Query Frame = 2
Query:  389 RLITDAAKNQVRMKCNDTIFYAKRLIG 469
            RLI DAAKNQ+ +   +TIF AKRLIG
Sbjct:   80 RLIGDAAKNQLTINPENTIFDAKRLIG 106          
BLAST of Heat shock 70 kDa protein vs. Ensembl Fly
Match: Hsp68 (gene:FBgn0001230 transcript:FBtr0084589)

HSP 1 Score: 67.781 bits (164), Expect = 6.504e-18
Identity = 32/44 (72.73%), Postives = 35/44 (79.55%), Query Frame = 3
Query:  258 AIGIGLSTAYSCVGVIQLEKPEIIANDQENRSTPSYVAFTDQKK 389
            AIGI L T YSCVGV Q  K EIIANDQ NR+TPSYVAFTD ++
Sbjct:    3 AIGIDLGTTYSCVGVFQYGKVEIIANDQGNRTTPSYVAFTDSER 46          

HSP 2 Score: 40.0466 bits (92), Expect = 6.504e-18
Identity = 18/32 (56.25%), Postives = 23/32 (71.88%), Query Frame = 2
Query:  374 YRSEKRLITDAAKNQVRMKCNDTIFYAKRLIG 469
            +   +RLI DAAKNQV M   +++F AKRLIG
Sbjct:   41 FTDSERLIGDAAKNQVAMNPKNSVFDAKRLIG 72          
BLAST of Heat shock 70 kDa protein vs. Ensembl Fly
Match: Hsc70-4 (gene:FBgn0266599 transcript:FBtr0083059)

HSP 1 Score: 66.6254 bits (161), Expect = 6.662e-18
Identity = 31/44 (70.45%), Postives = 35/44 (79.55%), Query Frame = 3
Query:  258 AIGIGLSTAYSCVGVIQLEKPEIIANDQENRSTPSYVAFTDQKK 389
            A+GI L T YSCVGV Q  K EIIANDQ NR+TPSYVAFTD ++
Sbjct:    6 AVGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTER 49          

HSP 2 Score: 40.817 bits (94), Expect = 6.662e-18
Identity = 20/32 (62.50%), Postives = 22/32 (68.75%), Query Frame = 2
Query:  374 YRSEKRLITDAAKNQVRMKCNDTIFYAKRLIG 469
            +   +RLI DAAKNQV M    TIF AKRLIG
Sbjct:   44 FTDTERLIGDAAKNQVAMNPTQTIFDAKRLIG 75          
BLAST of Heat shock 70 kDa protein vs. Ensembl Fly
Match: Hsc70-4 (gene:FBgn0266599 transcript:FBtr0337053)

HSP 1 Score: 66.6254 bits (161), Expect = 6.662e-18
Identity = 31/44 (70.45%), Postives = 35/44 (79.55%), Query Frame = 3
Query:  258 AIGIGLSTAYSCVGVIQLEKPEIIANDQENRSTPSYVAFTDQKK 389
            A+GI L T YSCVGV Q  K EIIANDQ NR+TPSYVAFTD ++
Sbjct:    6 AVGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTER 49          

HSP 2 Score: 40.817 bits (94), Expect = 6.662e-18
Identity = 20/32 (62.50%), Postives = 22/32 (68.75%), Query Frame = 2
Query:  374 YRSEKRLITDAAKNQVRMKCNDTIFYAKRLIG 469
            +   +RLI DAAKNQV M    TIF AKRLIG
Sbjct:   44 FTDTERLIGDAAKNQVAMNPTQTIFDAKRLIG 75          
BLAST of Heat shock 70 kDa protein vs. Ensembl Fly
Match: Hsc70-4 (gene:FBgn0266599 transcript:FBtr0083058)

HSP 1 Score: 66.6254 bits (161), Expect = 6.662e-18
Identity = 31/44 (70.45%), Postives = 35/44 (79.55%), Query Frame = 3
Query:  258 AIGIGLSTAYSCVGVIQLEKPEIIANDQENRSTPSYVAFTDQKK 389
            A+GI L T YSCVGV Q  K EIIANDQ NR+TPSYVAFTD ++
Sbjct:    6 AVGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTER 49          

HSP 2 Score: 40.817 bits (94), Expect = 6.662e-18
Identity = 20/32 (62.50%), Postives = 22/32 (68.75%), Query Frame = 2
Query:  374 YRSEKRLITDAAKNQVRMKCNDTIFYAKRLIG 469
            +   +RLI DAAKNQV M    TIF AKRLIG
Sbjct:   44 FTDTERLIGDAAKNQVAMNPTQTIFDAKRLIG 75          
BLAST of Heat shock 70 kDa protein vs. Ensembl Fly
Match: Hsc70-4 (gene:FBgn0266599 transcript:FBtr0083060)

HSP 1 Score: 66.6254 bits (161), Expect = 6.662e-18
Identity = 31/44 (70.45%), Postives = 35/44 (79.55%), Query Frame = 3
Query:  258 AIGIGLSTAYSCVGVIQLEKPEIIANDQENRSTPSYVAFTDQKK 389
            A+GI L T YSCVGV Q  K EIIANDQ NR+TPSYVAFTD ++
Sbjct:    6 AVGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTER 49          

HSP 2 Score: 40.817 bits (94), Expect = 6.662e-18
Identity = 20/32 (62.50%), Postives = 22/32 (68.75%), Query Frame = 2
Query:  374 YRSEKRLITDAAKNQVRMKCNDTIFYAKRLIG 469
            +   +RLI DAAKNQV M    TIF AKRLIG
Sbjct:   44 FTDTERLIGDAAKNQVAMNPTQTIFDAKRLIG 75          
BLAST of Heat shock 70 kDa protein vs. Ensembl Zebrafish
Match: hsp70.1 (heat shock cognate 70-kd protein, tandem duplicate 1 [Source:ZFIN;Acc:ZDB-GENE-990415-91])

HSP 1 Score: 67.781 bits (164), Expect = 5.868e-19
Identity = 33/46 (71.74%), Postives = 36/46 (78.26%), Query Frame = 3
Query:  252 GNAIGIGLSTAYSCVGVIQLEKPEIIANDQENRSTPSYVAFTDQKK 389
            G AIGI L T YSCVGV Q  K EIIANDQ NR+TPSYVAFTD ++
Sbjct:    6 GIAIGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTER 51          

HSP 2 Score: 43.8986 bits (102), Expect = 5.868e-19
Identity = 20/32 (62.50%), Postives = 24/32 (75.00%), Query Frame = 2
Query:  374 YRSEKRLITDAAKNQVRMKCNDTIFYAKRLIG 469
            +   +RLI DAAKNQV M  N+T+F AKRLIG
Sbjct:   46 FTDTERLIGDAAKNQVAMNPNNTVFDAKRLIG 77          
BLAST of Heat shock 70 kDa protein vs. Ensembl Zebrafish
Match: hsp70.2 (heat shock cognate 70-kd protein, tandem duplicate 2 [Source:ZFIN;Acc:ZDB-GENE-110405-1])

HSP 1 Score: 67.781 bits (164), Expect = 5.868e-19
Identity = 33/46 (71.74%), Postives = 36/46 (78.26%), Query Frame = 3
Query:  252 GNAIGIGLSTAYSCVGVIQLEKPEIIANDQENRSTPSYVAFTDQKK 389
            G AIGI L T YSCVGV Q  K EIIANDQ NR+TPSYVAFTD ++
Sbjct:    6 GIAIGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTER 51          

HSP 2 Score: 43.8986 bits (102), Expect = 5.868e-19
Identity = 20/32 (62.50%), Postives = 24/32 (75.00%), Query Frame = 2
Query:  374 YRSEKRLITDAAKNQVRMKCNDTIFYAKRLIG 469
            +   +RLI DAAKNQV M  N+T+F AKRLIG
Sbjct:   46 FTDTERLIGDAAKNQVAMNPNNTVFDAKRLIG 77          
BLAST of Heat shock 70 kDa protein vs. Ensembl Zebrafish
Match: hsp70.1 (heat shock cognate 70-kd protein, tandem duplicate 1 [Source:ZFIN;Acc:ZDB-GENE-990415-91])

HSP 1 Score: 67.781 bits (164), Expect = 7.687e-19
Identity = 33/46 (71.74%), Postives = 36/46 (78.26%), Query Frame = 3
Query:  252 GNAIGIGLSTAYSCVGVIQLEKPEIIANDQENRSTPSYVAFTDQKK 389
            G AIGI L T YSCVGV Q  K EIIANDQ NR+TPSYVAFTD ++
Sbjct:    6 GIAIGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTER 51          

HSP 2 Score: 43.5134 bits (101), Expect = 7.687e-19
Identity = 20/32 (62.50%), Postives = 24/32 (75.00%), Query Frame = 2
Query:  374 YRSEKRLITDAAKNQVRMKCNDTIFYAKRLIG 469
            +   +RLI DAAKNQV M  N+T+F AKRLIG
Sbjct:   46 FTDTERLIGDAAKNQVAMNPNNTVFDAKRLIG 77          
BLAST of Heat shock 70 kDa protein vs. Ensembl Zebrafish
Match: hsp70.2 (heat shock cognate 70-kd protein, tandem duplicate 2 [Source:ZFIN;Acc:ZDB-GENE-110405-1])

HSP 1 Score: 67.781 bits (164), Expect = 7.687e-19
Identity = 33/46 (71.74%), Postives = 36/46 (78.26%), Query Frame = 3
Query:  252 GNAIGIGLSTAYSCVGVIQLEKPEIIANDQENRSTPSYVAFTDQKK 389
            G AIGI L T YSCVGV Q  K EIIANDQ NR+TPSYVAFTD ++
Sbjct:    6 GIAIGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTER 51          

HSP 2 Score: 43.5134 bits (101), Expect = 7.687e-19
Identity = 20/32 (62.50%), Postives = 24/32 (75.00%), Query Frame = 2
Query:  374 YRSEKRLITDAAKNQVRMKCNDTIFYAKRLIG 469
            +   +RLI DAAKNQV M  N+T+F AKRLIG
Sbjct:   46 FTDTERLIGDAAKNQVAMNPNNTVFDAKRLIG 77          
BLAST of Heat shock 70 kDa protein vs. Ensembl Zebrafish
Match: hsp70.3 (heat shock cognate 70-kd protein, tandem duplicate 3 [Source:ZFIN;Acc:ZDB-GENE-110713-1])

HSP 1 Score: 67.781 bits (164), Expect = 7.687e-19
Identity = 33/46 (71.74%), Postives = 36/46 (78.26%), Query Frame = 3
Query:  252 GNAIGIGLSTAYSCVGVIQLEKPEIIANDQENRSTPSYVAFTDQKK 389
            G AIGI L T YSCVGV Q  K EIIANDQ NR+TPSYVAFTD ++
Sbjct:    6 GIAIGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTER 51          

HSP 2 Score: 43.5134 bits (101), Expect = 7.687e-19
Identity = 20/32 (62.50%), Postives = 24/32 (75.00%), Query Frame = 2
Query:  374 YRSEKRLITDAAKNQVRMKCNDTIFYAKRLIG 469
            +   +RLI DAAKNQV M  N+T+F AKRLIG
Sbjct:   46 FTDTERLIGDAAKNQVAMNPNNTVFDAKRLIG 77          
BLAST of Heat shock 70 kDa protein vs. Ensembl Xenopus
Match: wdr26 (WD repeat domain 26 [Source:Xenbase;Acc:XB-GENE-993726])

HSP 1 Score: 70.4774 bits (171), Expect = 8.337e-19
Identity = 34/50 (68.00%), Postives = 38/50 (76.00%), Query Frame = 3
Query:  240 FQMSGNAIGIGLSTAYSCVGVIQLEKPEIIANDQENRSTPSYVAFTDQKK 389
             Q SG A+GI L T YSCVGV Q  K EIIANDQ NR+TPSYVAFTD ++
Sbjct:    1 MQPSGPAVGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTER 50          

HSP 2 Score: 41.2022 bits (95), Expect = 8.337e-19
Identity = 19/32 (59.38%), Postives = 23/32 (71.88%), Query Frame = 2
Query:  374 YRSEKRLITDAAKNQVRMKCNDTIFYAKRLIG 469
            +   +RLI DAAKNQV M   +T+F AKRLIG
Sbjct:   45 FTDTERLIGDAAKNQVAMNPTNTVFDAKRLIG 76          
BLAST of Heat shock 70 kDa protein vs. Ensembl Xenopus
Match: wdr26 (WD repeat domain 26 [Source:Xenbase;Acc:XB-GENE-993726])

HSP 1 Score: 67.3958 bits (163), Expect = 6.319e-18
Identity = 32/46 (69.57%), Postives = 36/46 (78.26%), Query Frame = 3
Query:  252 GNAIGIGLSTAYSCVGVIQLEKPEIIANDQENRSTPSYVAFTDQKK 389
            G A+GI L T YSCVGV Q  K EIIANDQ NR+TPSYVAFTD ++
Sbjct:    4 GPAVGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTER 49          

HSP 2 Score: 41.2022 bits (95), Expect = 6.319e-18
Identity = 19/32 (59.38%), Postives = 23/32 (71.88%), Query Frame = 2
Query:  374 YRSEKRLITDAAKNQVRMKCNDTIFYAKRLIG 469
            +   +RLI DAAKNQV M   +T+F AKRLIG
Sbjct:   44 FTDTERLIGDAAKNQVAMNPTNTVFDAKRLIG 75          
BLAST of Heat shock 70 kDa protein vs. Ensembl Xenopus
Match: ENSXETT00000032295.1 (heat shock protein family A (Hsp70) member 1A [Source:NCBI gene;Acc:100488052])

HSP 1 Score: 67.3958 bits (163), Expect = 6.473e-18
Identity = 32/46 (69.57%), Postives = 36/46 (78.26%), Query Frame = 3
Query:  252 GNAIGIGLSTAYSCVGVIQLEKPEIIANDQENRSTPSYVAFTDQKK 389
            G A+GI L T YSCVGV Q  K EIIANDQ NR+TPSYVAFTD ++
Sbjct:    4 GPAVGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTER 49          

HSP 2 Score: 40.817 bits (94), Expect = 6.473e-18
Identity = 19/32 (59.38%), Postives = 23/32 (71.88%), Query Frame = 2
Query:  374 YRSEKRLITDAAKNQVRMKCNDTIFYAKRLIG 469
            +   +RLI DAAKNQV M   +T+F AKRLIG
Sbjct:   44 FTDTERLIGDAAKNQVAMNPTNTVFDAKRLIG 75          
BLAST of Heat shock 70 kDa protein vs. Ensembl Xenopus
Match: wdr26 (WD repeat domain 26 [Source:Xenbase;Acc:XB-GENE-993726])

HSP 1 Score: 67.3958 bits (163), Expect = 6.527e-18
Identity = 32/46 (69.57%), Postives = 36/46 (78.26%), Query Frame = 3
Query:  252 GNAIGIGLSTAYSCVGVIQLEKPEIIANDQENRSTPSYVAFTDQKK 389
            G A+GI L T YSCVGV Q  K EIIANDQ NR+TPSYVAFTD ++
Sbjct:    4 GPAVGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTER 49          

HSP 2 Score: 41.2022 bits (95), Expect = 6.527e-18
Identity = 19/32 (59.38%), Postives = 23/32 (71.88%), Query Frame = 2
Query:  374 YRSEKRLITDAAKNQVRMKCNDTIFYAKRLIG 469
            +   +RLI DAAKNQV M   +T+F AKRLIG
Sbjct:   44 FTDTERLIGDAAKNQVAMNPTNTVFDAKRLIG 75          
BLAST of Heat shock 70 kDa protein vs. Ensembl Xenopus
Match: wdr26 (WD repeat domain 26 [Source:Xenbase;Acc:XB-GENE-993726])

HSP 1 Score: 67.3958 bits (163), Expect = 6.634e-18
Identity = 32/46 (69.57%), Postives = 36/46 (78.26%), Query Frame = 3
Query:  252 GNAIGIGLSTAYSCVGVIQLEKPEIIANDQENRSTPSYVAFTDQKK 389
            G A+GI L T YSCVGV Q  K EIIANDQ NR+TPSYVAFTD ++
Sbjct:    9 GPAVGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTER 54          

HSP 2 Score: 40.817 bits (94), Expect = 6.634e-18
Identity = 19/32 (59.38%), Postives = 23/32 (71.88%), Query Frame = 2
Query:  374 YRSEKRLITDAAKNQVRMKCNDTIFYAKRLIG 469
            +   +RLI DAAKNQV M   +T+F AKRLIG
Sbjct:   49 FTDTERLIGDAAKNQVAMNPTNTVFDAKRLIG 80          
BLAST of Heat shock 70 kDa protein vs. Ensembl Mouse
Match: Hspa2 (heat shock protein 2 [Source:MGI Symbol;Acc:MGI:96243])

HSP 1 Score: 68.1662 bits (165), Expect = 2.420e-18
Identity = 33/46 (71.74%), Postives = 36/46 (78.26%), Query Frame = 3
Query:  252 GNAIGIGLSTAYSCVGVIQLEKPEIIANDQENRSTPSYVAFTDQKK 389
            G AIGI L T YSCVGV Q  K EIIANDQ NR+TPSYVAFTD ++
Sbjct:    5 GPAIGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTER 50          

HSP 2 Score: 41.5874 bits (96), Expect = 2.420e-18
Identity = 20/32 (62.50%), Postives = 23/32 (71.88%), Query Frame = 2
Query:  374 YRSEKRLITDAAKNQVRMKCNDTIFYAKRLIG 469
            +   +RLI DAAKNQV M   +TIF AKRLIG
Sbjct:   45 FTDTERLIGDAAKNQVAMNPTNTIFDAKRLIG 76          
BLAST of Heat shock 70 kDa protein vs. Ensembl Mouse
Match: Hspa2 (heat shock protein 2 [Source:MGI Symbol;Acc:MGI:96243])

HSP 1 Score: 68.1662 bits (165), Expect = 2.420e-18
Identity = 33/46 (71.74%), Postives = 36/46 (78.26%), Query Frame = 3
Query:  252 GNAIGIGLSTAYSCVGVIQLEKPEIIANDQENRSTPSYVAFTDQKK 389
            G AIGI L T YSCVGV Q  K EIIANDQ NR+TPSYVAFTD ++
Sbjct:    5 GPAIGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTER 50          

HSP 2 Score: 41.5874 bits (96), Expect = 2.420e-18
Identity = 20/32 (62.50%), Postives = 23/32 (71.88%), Query Frame = 2
Query:  374 YRSEKRLITDAAKNQVRMKCNDTIFYAKRLIG 469
            +   +RLI DAAKNQV M   +TIF AKRLIG
Sbjct:   45 FTDTERLIGDAAKNQVAMNPTNTIFDAKRLIG 76          
BLAST of Heat shock 70 kDa protein vs. Ensembl Mouse
Match: Hspa1l (heat shock protein 1-like [Source:MGI Symbol;Acc:MGI:96231])

HSP 1 Score: 68.1662 bits (165), Expect = 3.019e-18
Identity = 33/46 (71.74%), Postives = 36/46 (78.26%), Query Frame = 3
Query:  252 GNAIGIGLSTAYSCVGVIQLEKPEIIANDQENRSTPSYVAFTDQKK 389
            G AIGI L T YSCVGV Q  K EIIANDQ NR+TPSYVAFTD ++
Sbjct:    6 GMAIGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTER 51          

HSP 2 Score: 40.817 bits (94), Expect = 3.019e-18
Identity = 19/32 (59.38%), Postives = 23/32 (71.88%), Query Frame = 2
Query:  374 YRSEKRLITDAAKNQVRMKCNDTIFYAKRLIG 469
            +   +RLI DAAKNQV M   +T+F AKRLIG
Sbjct:   46 FTDTERLIGDAAKNQVAMNPQNTVFDAKRLIG 77          
BLAST of Heat shock 70 kDa protein vs. Ensembl Mouse
Match: Hspa8 (heat shock protein 8 [Source:MGI Symbol;Acc:MGI:105384])

HSP 1 Score: 67.781 bits (164), Expect = 4.585e-18
Identity = 32/46 (69.57%), Postives = 36/46 (78.26%), Query Frame = 3
Query:  252 GNAIGIGLSTAYSCVGVIQLEKPEIIANDQENRSTPSYVAFTDQKK 389
            G A+GI L T YSCVGV Q  K EIIANDQ NR+TPSYVAFTD ++
Sbjct:    4 GPAVGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTER 49          

HSP 2 Score: 40.817 bits (94), Expect = 4.585e-18
Identity = 19/32 (59.38%), Postives = 23/32 (71.88%), Query Frame = 2
Query:  374 YRSEKRLITDAAKNQVRMKCNDTIFYAKRLIG 469
            +   +RLI DAAKNQV M   +T+F AKRLIG
Sbjct:   44 FTDTERLIGDAAKNQVAMNPTNTVFDAKRLIG 75          
BLAST of Heat shock 70 kDa protein vs. Ensembl Mouse
Match: Hspa8 (heat shock protein 8 [Source:MGI Symbol;Acc:MGI:105384])

HSP 1 Score: 67.3958 bits (163), Expect = 4.588e-18
Identity = 32/46 (69.57%), Postives = 36/46 (78.26%), Query Frame = 3
Query:  252 GNAIGIGLSTAYSCVGVIQLEKPEIIANDQENRSTPSYVAFTDQKK 389
            G A+GI L T YSCVGV Q  K EIIANDQ NR+TPSYVAFTD ++
Sbjct:    4 GPAVGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTER 49          

HSP 2 Score: 40.817 bits (94), Expect = 4.588e-18
Identity = 19/32 (59.38%), Postives = 23/32 (71.88%), Query Frame = 2
Query:  374 YRSEKRLITDAAKNQVRMKCNDTIFYAKRLIG 469
            +   +RLI DAAKNQV M   +T+F AKRLIG
Sbjct:   44 FTDTERLIGDAAKNQVAMNPTNTVFDAKRLIG 75          
BLAST of Heat shock 70 kDa protein vs. UniProt/SwissProt
Match: sp|Q06248|HSP74_PARLI (Heat shock 70 kDa protein IV OS=Paracentrotus lividus OX=7656 GN=HSP70IV PE=3 SV=1)

HSP 1 Score: 69.3218 bits (168), Expect = 2.839e-18
Identity = 34/47 (72.34%), Postives = 37/47 (78.72%), Query Frame = 3
Query:  249 SGNAIGIGLSTAYSCVGVIQLEKPEIIANDQENRSTPSYVAFTDQKK 389
            SG AIGI L T YSCVGV Q  K EIIANDQ NR+TPSYVAFTD ++
Sbjct:    3 SGPAIGIDLGTTYSCVGVFQNGKVEIIANDQGNRTTPSYVAFTDSER 49          

HSP 2 Score: 42.3578 bits (98), Expect = 2.839e-18
Identity = 20/32 (62.50%), Postives = 23/32 (71.88%), Query Frame = 2
Query:  374 YRSEKRLITDAAKNQVRMKCNDTIFYAKRLIG 469
            +   +RLI DAAKNQV M   +TIF AKRLIG
Sbjct:   44 FTDSERLIGDAAKNQVAMNPTNTIFDAKRLIG 75          
BLAST of Heat shock 70 kDa protein vs. UniProt/SwissProt
Match: sp|P27541|HSP70_BRUMA (Heat shock 70 kDa protein OS=Brugia malayi OX=6279 GN=HSP70 PE=3 SV=1)

HSP 1 Score: 70.4774 bits (171), Expect = 6.661e-18
Identity = 34/48 (70.83%), Postives = 37/48 (77.08%), Query Frame = 3
Query:  246 MSGNAIGIGLSTAYSCVGVIQLEKPEIIANDQENRSTPSYVAFTDQKK 389
            MS NAIGI L T YSCVGV    K EIIANDQ NR+TPSYVAFTD ++
Sbjct:    1 MSKNAIGIDLGTTYSCVGVFMHGKVEIIANDQGNRTTPSYVAFTDTER 48          

HSP 2 Score: 39.6614 bits (91), Expect = 6.661e-18
Identity = 18/32 (56.25%), Postives = 23/32 (71.88%), Query Frame = 2
Query:  374 YRSEKRLITDAAKNQVRMKCNDTIFYAKRLIG 469
            +   +RLI DAAKNQV M  ++T+F A RLIG
Sbjct:   43 FTDTERLIGDAAKNQVAMNPHNTVFDANRLIG 74          
BLAST of Heat shock 70 kDa protein vs. UniProt/SwissProt
Match: sp|Q91233|HSP70_ONCTS (Heat shock 70 kDa protein OS=Oncorhynchus tshawytscha OX=74940 GN=hsp70 PE=2 SV=1)

HSP 1 Score: 67.0106 bits (162), Expect = 7.350e-18
Identity = 32/46 (69.57%), Postives = 36/46 (78.26%), Query Frame = 3
Query:  252 GNAIGIGLSTAYSCVGVIQLEKPEIIANDQENRSTPSYVAFTDQKK 389
            G +IGI L T YSCVGV Q  K EIIANDQ NR+TPSYVAFTD ++
Sbjct:    6 GPSIGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTER 51          

HSP 2 Score: 43.5134 bits (101), Expect = 7.350e-18
Identity = 20/32 (62.50%), Postives = 24/32 (75.00%), Query Frame = 2
Query:  374 YRSEKRLITDAAKNQVRMKCNDTIFYAKRLIG 469
            +   +RLI DAAKNQV M  N+T+F AKRLIG
Sbjct:   46 FTDTERLIGDAAKNQVAMNPNNTVFDAKRLIG 77          
BLAST of Heat shock 70 kDa protein vs. UniProt/SwissProt
Match: sp|A5A8V7|HS71L_PIG (Heat shock 70 kDa protein 1-like OS=Sus scrofa OX=9823 GN=HSPA1L PE=2 SV=1)

HSP 1 Score: 68.9366 bits (167), Expect = 9.874e-18
Identity = 33/46 (71.74%), Postives = 36/46 (78.26%), Query Frame = 3
Query:  252 GNAIGIGLSTAYSCVGVIQLEKPEIIANDQENRSTPSYVAFTDQKK 389
            G AIGI L T YSCVGV Q  K EIIANDQ NR+TPSYVAFTD ++
Sbjct:    6 GTAIGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTER 51          

HSP 2 Score: 40.817 bits (94), Expect = 9.874e-18
Identity = 19/32 (59.38%), Postives = 23/32 (71.88%), Query Frame = 2
Query:  374 YRSEKRLITDAAKNQVRMKCNDTIFYAKRLIG 469
            +   +RLI DAAKNQV M   +T+F AKRLIG
Sbjct:   46 FTDTERLIGDAAKNQVAMNPQNTVFDAKRLIG 77          
BLAST of Heat shock 70 kDa protein vs. UniProt/SwissProt
Match: sp|P0CB32|HS71L_BOVIN (Heat shock 70 kDa protein 1-like OS=Bos taurus OX=9913 GN=HSPA1L PE=3 SV=1)

HSP 1 Score: 68.9366 bits (167), Expect = 9.955e-18
Identity = 33/46 (71.74%), Postives = 36/46 (78.26%), Query Frame = 3
Query:  252 GNAIGIGLSTAYSCVGVIQLEKPEIIANDQENRSTPSYVAFTDQKK 389
            G AIGI L T YSCVGV Q  K EIIANDQ NR+TPSYVAFTD ++
Sbjct:    6 GTAIGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTER 51          

HSP 2 Score: 40.817 bits (94), Expect = 9.955e-18
Identity = 19/32 (59.38%), Postives = 23/32 (71.88%), Query Frame = 2
Query:  374 YRSEKRLITDAAKNQVRMKCNDTIFYAKRLIG 469
            +   +RLI DAAKNQV M   +T+F AKRLIG
Sbjct:   46 FTDTERLIGDAAKNQVAMNPQNTVFDAKRLIG 77          
BLAST of Heat shock 70 kDa protein vs. TrEMBL
Match: A0A023G093 (Putative heat shock protein (Fragment) OS=Amblyomma parvum OX=251391 PE=2 SV=1)

HSP 1 Score: 70.0922 bits (170), Expect = 1.827e-16
Identity = 40/77 (51.95%), Postives = 46/77 (59.74%), Query Frame = 3
Query:  159 FSSIFEANNVIFEICSCYFIF*LIVD*FQMSGNAIGIGLSTAYSCVGVIQLEKPEIIANDQENRSTPSYVAFTDQKK 389
            F+ +F   N +  IC C F     V        AIGI L T YSCVGV Q  K EIIANDQ NR+TPSYVAFTD ++
Sbjct:    5 FARVFGVGNAL-TICWCSFTGMAKVP-------AIGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTER 73          

HSP 2 Score: 43.5134 bits (101), Expect = 1.827e-16
Identity = 20/32 (62.50%), Postives = 24/32 (75.00%), Query Frame = 2
Query:  374 YRSEKRLITDAAKNQVRMKCNDTIFYAKRLIG 469
            +   +RLI DAAKNQV M  N+T+F AKRLIG
Sbjct:   68 FTDTERLIGDAAKNQVAMNPNNTVFDAKRLIG 99          
BLAST of Heat shock 70 kDa protein vs. TrEMBL
Match: A0A3Q0RA61 (Si:ch211-199o1.2 OS=Amphilophus citrinellus OX=61819 PE=3 SV=1)

HSP 1 Score: 69.3218 bits (168), Expect = 1.859e-16
Identity = 33/48 (68.75%), Postives = 38/48 (79.17%), Query Frame = 3
Query:  246 MSGNAIGIGLSTAYSCVGVIQLEKPEIIANDQENRSTPSYVAFTDQKK 389
            M+G +IGI L T YSCVGV Q  K EIIANDQ NR+TPSYVAFTD ++
Sbjct:    1 MAGISIGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTER 48          

HSP 2 Score: 44.2838 bits (103), Expect = 1.859e-16
Identity = 21/32 (65.62%), Postives = 24/32 (75.00%), Query Frame = 2
Query:  374 YRSEKRLITDAAKNQVRMKCNDTIFYAKRLIG 469
            +   +RLI DAAKNQV M  N+TIF AKRLIG
Sbjct:   43 FTDTERLIGDAAKNQVAMNPNNTIFDAKRLIG 74          
BLAST of Heat shock 70 kDa protein vs. TrEMBL
Match: A6YT30 (Heat shock protein 70 OS=Trichinella nativa OX=6335 GN=HSP70 PE=2 SV=1)

HSP 1 Score: 72.7886 bits (177), Expect = 2.208e-16
Identity = 35/48 (72.92%), Postives = 38/48 (79.17%), Query Frame = 3
Query:  246 MSGNAIGIGLSTAYSCVGVIQLEKPEIIANDQENRSTPSYVAFTDQKK 389
            MS NAIGI L T YSCVGV Q  K EIIANDQ NR+TPSYVAFTD ++
Sbjct:    1 MSKNAIGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTER 48          

HSP 2 Score: 40.0466 bits (92), Expect = 2.208e-16
Identity = 18/32 (56.25%), Postives = 24/32 (75.00%), Query Frame = 2
Query:  374 YRSEKRLITDAAKNQVRMKCNDTIFYAKRLIG 469
            +   +RLI DAAKNQV +  ++T+F AKRLIG
Sbjct:   43 FTDTERLIGDAAKNQVALNPHNTVFDAKRLIG 74          
BLAST of Heat shock 70 kDa protein vs. TrEMBL
Match: A0A5B6Z0H9 (Putative heat shock protein (Fragment) OS=Davidia involucrata OX=16924 GN=Din_006769 PE=3 SV=1)

HSP 1 Score: 72.0182 bits (175), Expect = 2.298e-16
Identity = 39/83 (46.99%), Postives = 51/83 (61.45%), Query Frame = 3
Query:  141 FDLNFEFSSIFEANNVIFEICSCYFIF*LIVD*FQMSGNAIGIGLSTAYSCVGVIQLEKPEIIANDQENRSTPSYVAFTDQKK 389
            F LN+ F+ +     ++FE       F L+    +  G AIGI L T YSCVGV Q ++ EII NDQ NR+TPSYVAFTD ++
Sbjct:   14 FSLNYSFAELQLYFKLVFE-------FKLLPMAAKTEGKAIGIDLGTTYSCVGVWQNDRVEIIPNDQGNRTTPSYVAFTDTER 89          

HSP 2 Score: 41.2022 bits (95), Expect = 2.298e-16
Identity = 19/32 (59.38%), Postives = 24/32 (75.00%), Query Frame = 2
Query:  374 YRSEKRLITDAAKNQVRMKCNDTIFYAKRLIG 469
            +   +RLI DAAKNQV M  ++T+F AKRLIG
Sbjct:   84 FTDTERLIGDAAKNQVAMNPSNTVFDAKRLIG 115          
BLAST of Heat shock 70 kDa protein vs. TrEMBL
Match: A0A3M7SUB5 (Heat shock 70 kDa cognate 4 OS=Brachionus plicatilis OX=10195 GN=BpHYR1_005077 PE=3 SV=1)

HSP 1 Score: 68.9366 bits (167), Expect = 2.300e-16
Identity = 32/46 (69.57%), Postives = 37/46 (80.43%), Query Frame = 3
Query:  252 GNAIGIGLSTAYSCVGVIQLEKPEIIANDQENRSTPSYVAFTDQKK 389
            G+AIGI L T YSCVG+ Q  K EIIANDQ NR+TPSYVAFTD ++
Sbjct:    4 GSAIGIDLGTTYSCVGIFQHGKVEIIANDQGNRTTPSYVAFTDSER 49          

HSP 2 Score: 43.8986 bits (102), Expect = 2.300e-16
Identity = 20/32 (62.50%), Postives = 24/32 (75.00%), Query Frame = 2
Query:  374 YRSEKRLITDAAKNQVRMKCNDTIFYAKRLIG 469
            +   +RLI DAAKNQV M  N+T+F AKRLIG
Sbjct:   44 FTDSERLIGDAAKNQVAMNPNNTVFDAKRLIG 75          
BLAST of Heat shock 70 kDa protein vs. Ensembl Cavefish
Match: ENSAMXT00000032722.1 (pep primary_assembly:Astyanax_mexicanus-2.0:APWO02001455.1:155723:156505:1 gene:ENSAMXG00000042801.1 transcript:ENSAMXT00000032722.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 68.1662 bits (165), Expect = 3.189e-19
Identity = 33/46 (71.74%), Postives = 36/46 (78.26%), Query Frame = 3
Query:  252 GNAIGIGLSTAYSCVGVIQLEKPEIIANDQENRSTPSYVAFTDQKK 389
            G AIGI L T YSCVGV Q  K EIIANDQ NR+TPSYVAFTD ++
Sbjct:    6 GVAIGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTER 51          

HSP 2 Score: 43.8986 bits (102), Expect = 3.189e-19
Identity = 20/32 (62.50%), Postives = 24/32 (75.00%), Query Frame = 2
Query:  374 YRSEKRLITDAAKNQVRMKCNDTIFYAKRLIG 469
            +   +RLI DAAKNQV M  N+T+F AKRLIG
Sbjct:   46 FTDTERLIGDAAKNQVAMNPNNTVFDAKRLIG 77          
BLAST of Heat shock 70 kDa protein vs. Ensembl Cavefish
Match: ENSAMXT00000055474.1 (pep primary_assembly:Astyanax_mexicanus-2.0:APWO02001455.1:150188:156169:-1 gene:ENSAMXG00000043809.1 transcript:ENSAMXT00000055474.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 67.781 bits (164), Expect = 5.190e-19
Identity = 33/46 (71.74%), Postives = 36/46 (78.26%), Query Frame = 3
Query:  252 GNAIGIGLSTAYSCVGVIQLEKPEIIANDQENRSTPSYVAFTDQKK 389
            G AIGI L T YSCVGV Q  K EIIANDQ NR+TPSYVAFTD ++
Sbjct:    6 GVAIGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTER 51          

HSP 2 Score: 43.5134 bits (101), Expect = 5.190e-19
Identity = 20/32 (62.50%), Postives = 24/32 (75.00%), Query Frame = 2
Query:  374 YRSEKRLITDAAKNQVRMKCNDTIFYAKRLIG 469
            +   +RLI DAAKNQV M  N+T+F AKRLIG
Sbjct:   46 FTDTERLIGDAAKNQVAMNPNNTVFDAKRLIG 77          
BLAST of Heat shock 70 kDa protein vs. Ensembl Cavefish
Match: ENSAMXT00000031477.1 (pep primary_assembly:Astyanax_mexicanus-2.0:APWO02001455.1:148482:152871:-1 gene:ENSAMXG00000043809.1 transcript:ENSAMXT00000031477.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 67.781 bits (164), Expect = 5.190e-19
Identity = 33/46 (71.74%), Postives = 36/46 (78.26%), Query Frame = 3
Query:  252 GNAIGIGLSTAYSCVGVIQLEKPEIIANDQENRSTPSYVAFTDQKK 389
            G AIGI L T YSCVGV Q  K EIIANDQ NR+TPSYVAFTD ++
Sbjct:    6 GVAIGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTER 51          

HSP 2 Score: 43.5134 bits (101), Expect = 5.190e-19
Identity = 20/32 (62.50%), Postives = 24/32 (75.00%), Query Frame = 2
Query:  374 YRSEKRLITDAAKNQVRMKCNDTIFYAKRLIG 469
            +   +RLI DAAKNQV M  N+T+F AKRLIG
Sbjct:   46 FTDTERLIGDAAKNQVAMNPNNTVFDAKRLIG 77          
BLAST of Heat shock 70 kDa protein vs. Ensembl Cavefish
Match: hspa1b (heat shock protein family A (Hsp70) member 1B [Source:ZFIN;Acc:ZDB-GENE-060503-867])

HSP 1 Score: 67.0106 bits (162), Expect = 7.814e-19
Identity = 32/47 (68.09%), Postives = 37/47 (78.72%), Query Frame = 3
Query:  249 SGNAIGIGLSTAYSCVGVIQLEKPEIIANDQENRSTPSYVAFTDQKK 389
            +G +IGI L T YSCVGV Q  K EIIANDQ NR+TPSYVAFTD ++
Sbjct:    3 AGVSIGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTER 49          

HSP 2 Score: 43.8986 bits (102), Expect = 7.814e-19
Identity = 21/28 (75.00%), Postives = 23/28 (82.14%), Query Frame = 2
Query:  386 KRLITDAAKNQVRMKCNDTIFYAKRLIG 469
            +RLI DAAKNQV M  N+TIF AKRLIG
Sbjct:   48 ERLIGDAAKNQVAMNPNNTIFDAKRLIG 75          
BLAST of Heat shock 70 kDa protein vs. Ensembl Cavefish
Match: hsc70 (heat shock cognate 71 kDa protein-like [Source:NCBI gene;Acc:103045816])

HSP 1 Score: 67.0106 bits (162), Expect = 1.049e-18
Identity = 31/46 (67.39%), Postives = 36/46 (78.26%), Query Frame = 3
Query:  252 GNAIGIGLSTAYSCVGVIQLEKPEIIANDQENRSTPSYVAFTDQKK 389
            G A+GI L T YSCVG+ Q  K EIIANDQ NR+TPSYVAFTD ++
Sbjct:    4 GPAVGIDLGTTYSCVGIFQHGKVEIIANDQGNRTTPSYVAFTDTER 49          

HSP 2 Score: 43.5134 bits (101), Expect = 1.049e-18
Identity = 20/32 (62.50%), Postives = 24/32 (75.00%), Query Frame = 2
Query:  374 YRSEKRLITDAAKNQVRMKCNDTIFYAKRLIG 469
            +   +RLI DAAKNQV M  N+T+F AKRLIG
Sbjct:   44 FTDTERLIGDAAKNQVAMNPNNTVFDAKRLIG 75          
BLAST of Heat shock 70 kDa protein vs. Ensembl Sea Lamprey
Match: hspa5 (heat shock protein 5 [Source:NCBI gene;Acc:378848])

HSP 1 Score: 59.6918 bits (143), Expect = 1.747e-14
Identity = 29/44 (65.91%), Postives = 32/44 (72.73%), Query Frame = 3
Query:  252 GNAIGIGLSTAYSCVGVIQLEKPEIIANDQENRSTPSYVAFTDQ 383
            G  IGI L T YSCVGV +  + EIIANDQ NR TPSYVAFT +
Sbjct:   33 GTVIGIDLGTTYSCVGVFKNGRVEIIANDQGNRITPSYVAFTAE 76          

HSP 2 Score: 34.2686 bits (77), Expect = 1.747e-14
Identity = 17/28 (60.71%), Postives = 21/28 (75.00%), Query Frame = 2
Query:  386 KRLITDAAKNQVRMKCNDTIFYAKRLIG 469
            +RLI DAAKNQ+     +T+F AKRLIG
Sbjct:   78 ERLIGDAAKNQLTSNPENTVFDAKRLIG 105          
BLAST of Heat shock 70 kDa protein vs. Ensembl Sea Lamprey
Match: hspa9 (heat shock protein 9 [Source:ZFIN;Acc:ZDB-GENE-030828-12])

HSP 1 Score: 40.4318 bits (93), Expect = 6.812e-6
Identity = 19/44 (43.18%), Postives = 29/44 (65.91%), Query Frame = 3
Query:  246 MSGNAIGIGLSTAYSCVGVIQLEKPEIIANDQENRSTPSYVAFT 377
            + G  IGI L T  SCV V++ ++ +++ N +  R+TPS VAFT
Sbjct:   51 IRGAVIGIDLGTTNSCVAVMEGKQAKVLENAEGARTTPSVVAFT 94          

HSP 2 Score: 24.2534 bits (51), Expect = 6.812e-6
Identity = 12/28 (42.86%), Postives = 16/28 (57.14%), Query Frame = 2
Query:  386 KRLITDAAKNQVRMKCNDTIFYAKRLIG 469
            +RL+   AK Q     N+T +  KRLIG
Sbjct:   98 ERLVGMPAKRQAVTNPNNTFYATKRLIG 125          
BLAST of Heat shock 70 kDa protein vs. Ensembl Yeast
Match: KAR2 (ATPase involved in protein import into the ER; also acts as a chaperone to mediate protein folding in the ER and may play a role in ER export of soluble proteins; regulates the unfolded protein response via interaction with Ire1p [Source:SGD;Acc:S000003571])

HSP 1 Score: 60.077 bits (144), Expect = 1.641e-15
Identity = 28/46 (60.87%), Postives = 34/46 (73.91%), Query Frame = 3
Query:  252 GNAIGIGLSTAYSCVGVIQLEKPEIIANDQENRSTPSYVAFTDQKK 389
            G  IGI L T YSCV V++  K EI+AN+Q NR TPSYVAFTD ++
Sbjct:   50 GTVIGIDLGTTYSCVAVMKNGKTEILANEQGNRITPSYVAFTDDER 95          

HSP 2 Score: 36.965 bits (84), Expect = 1.641e-15
Identity = 18/33 (54.55%), Postives = 23/33 (69.70%), Query Frame = 2
Query:  374 YRSEKRLITDAAKNQVRMKCNDTIFYAKRLIGM 472
            +  ++RLI DAAKNQV     +TIF  KRLIG+
Sbjct:   90 FTDDERLIGDAAKNQVAANPQNTIFDIKRLIGL 122          
BLAST of Heat shock 70 kDa protein vs. Ensembl Yeast
Match: SSA4 (Heat shock protein that is highly induced upon stress; plays a role in SRP-dependent cotranslational protein-membrane targeting and translocation; member of the HSP70 family; cytoplasmic protein that concentrates in nuclei upon starvation; SSA4 has a paralog, SSA3, that arose from the whole genome duplication [Source:SGD;Acc:S000000905])

HSP 1 Score: 59.6918 bits (143), Expect = 2.100e-15
Identity = 27/44 (61.36%), Postives = 33/44 (75.00%), Query Frame = 3
Query:  258 AIGIGLSTAYSCVGVIQLEKPEIIANDQENRSTPSYVAFTDQKK 389
            A+GI L T YSCV     ++ EIIANDQ NR+TPSYVAFTD ++
Sbjct:    4 AVGIDLGTTYSCVAHFANDRVEIIANDQGNRTTPSYVAFTDTER 47          

HSP 2 Score: 36.965 bits (84), Expect = 2.100e-15
Identity = 18/32 (56.25%), Postives = 23/32 (71.88%), Query Frame = 2
Query:  374 YRSEKRLITDAAKNQVRMKCNDTIFYAKRLIG 469
            +   +RLI DAAKNQ  M  ++T+F AKRLIG
Sbjct:   42 FTDTERLIGDAAKNQAAMNPHNTVFDAKRLIG 73          
BLAST of Heat shock 70 kDa protein vs. Ensembl Yeast
Match: SSA3 (ATPase involved in protein folding and the response to stress; plays a role in SRP-dependent cotranslational protein-membrane targeting and translocation; member of the heat shock protein 70 (HSP70) family; localized to the cytoplasm; SSA3 has a paralog, SSA4, that arose from the whole genome duplication [Source:SGD;Acc:S000000171])

HSP 1 Score: 60.077 bits (144), Expect = 5.640e-15
Identity = 27/44 (61.36%), Postives = 33/44 (75.00%), Query Frame = 3
Query:  258 AIGIGLSTAYSCVGVIQLEKPEIIANDQENRSTPSYVAFTDQKK 389
            A+GI L T YSCV     ++ EIIANDQ NR+TPSYVAFTD ++
Sbjct:    4 AVGIDLGTTYSCVAHFSNDRVEIIANDQGNRTTPSYVAFTDTER 47          

HSP 2 Score: 35.039 bits (79), Expect = 5.640e-15
Identity = 17/32 (53.12%), Postives = 23/32 (71.88%), Query Frame = 2
Query:  374 YRSEKRLITDAAKNQVRMKCNDTIFYAKRLIG 469
            +   +RLI DAAKNQ  +  ++T+F AKRLIG
Sbjct:   42 FTDTERLIGDAAKNQAAINPHNTVFDAKRLIG 73          
BLAST of Heat shock 70 kDa protein vs. Ensembl Yeast
Match: SSA1 (ATPase involved in protein folding and NLS-directed nuclear transport; member of HSP70 family; required for ubiquitin-dependent degradation of short-lived proteins; forms chaperone complex with Ydj1p; localized to nucleus, cytoplasm, cell wall; 98% identical to paralog Ssa2p with different functional specificity in propagation of yeast [URE3] prions, vacuolar-mediated degradations of gluconeogenesis enzymes; general targeting factor of Hsp104p to prion fibrils [Source:SGD;Acc:S000000004])

HSP 1 Score: 56.9954 bits (136), Expect = 1.431e-14
Identity = 25/44 (56.82%), Postives = 33/44 (75.00%), Query Frame = 3
Query:  258 AIGIGLSTAYSCVGVIQLEKPEIIANDQENRSTPSYVAFTDQKK 389
            A+GI L T YSCV     ++ +IIANDQ NR+TPS+VAFTD ++
Sbjct:    4 AVGIDLGTTYSCVAHFANDRVDIIANDQGNRTTPSFVAFTDTER 47          

HSP 2 Score: 36.965 bits (84), Expect = 1.431e-14
Identity = 18/32 (56.25%), Postives = 23/32 (71.88%), Query Frame = 2
Query:  374 YRSEKRLITDAAKNQVRMKCNDTIFYAKRLIG 469
            +   +RLI DAAKNQ  M  ++T+F AKRLIG
Sbjct:   42 FTDTERLIGDAAKNQAAMNPSNTVFDAKRLIG 73          
BLAST of Heat shock 70 kDa protein vs. Ensembl Yeast
Match: SSA2 (HSP70 family ATP-binding protein; involved in protein folding, vacuolar import of proteins; required for ubiquitin-dependent degradation of short-lived proteins; associated with chaperonin-containing T-complex; 98% identical to paralog Ssa1p with distinct functional specificity in propagation of yeast [URE3] prions and vacuolar-mediated degradation of gluconeogenesis enzymes; binds tRNA, has role in tRNA nuclear import during starvation [Source:SGD;Acc:S000003947])

HSP 1 Score: 55.4546 bits (132), Expect = 4.826e-14
Identity = 24/44 (54.55%), Postives = 32/44 (72.73%), Query Frame = 3
Query:  258 AIGIGLSTAYSCVGVIQLEKPEIIANDQENRSTPSYVAFTDQKK 389
            A+GI L T YSCV     ++ +IIANDQ NR+TPS+V FTD ++
Sbjct:    4 AVGIDLGTTYSCVAHFSNDRVDIIANDQGNRTTPSFVGFTDTER 47          

HSP 2 Score: 36.5798 bits (83), Expect = 4.826e-14
Identity = 18/32 (56.25%), Postives = 22/32 (68.75%), Query Frame = 2
Query:  374 YRSEKRLITDAAKNQVRMKCNDTIFYAKRLIG 469
            +   +RLI DAAKNQ  M   +T+F AKRLIG
Sbjct:   42 FTDTERLIGDAAKNQAAMNPANTVFDAKRLIG 73          
BLAST of Heat shock 70 kDa protein vs. Ensembl Nematostella
Match: EDO30323 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7T144])

HSP 1 Score: 68.5514 bits (166), Expect = 1.166e-19
Identity = 32/44 (72.73%), Postives = 36/44 (81.82%), Query Frame = 3
Query:  258 AIGIGLSTAYSCVGVIQLEKPEIIANDQENRSTPSYVAFTDQKK 389
            AIGI L T YSCVGV Q  K EIIANDQ NR+TPSYVAFTD+++
Sbjct:    6 AIGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDEER 49          

HSP 2 Score: 43.5134 bits (101), Expect = 1.166e-19
Identity = 20/32 (62.50%), Postives = 24/32 (75.00%), Query Frame = 2
Query:  374 YRSEKRLITDAAKNQVRMKCNDTIFYAKRLIG 469
            +  E+RL+ DAAKNQV M   +TIF AKRLIG
Sbjct:   44 FTDEERLVGDAAKNQVAMNPTNTIFDAKRLIG 75          
BLAST of Heat shock 70 kDa protein vs. Ensembl Nematostella
Match: EDO37280 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SG65])

HSP 1 Score: 65.0846 bits (157), Expect = 5.100e-18
Identity = 30/44 (68.18%), Postives = 35/44 (79.55%), Query Frame = 3
Query:  258 AIGIGLSTAYSCVGVIQLEKPEIIANDQENRSTPSYVAFTDQKK 389
            A+GI L T YSCVGV Q  K EIIANDQ NR+TPSYVAF+D ++
Sbjct:    6 AVGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFSDTER 49          

HSP 2 Score: 41.5874 bits (96), Expect = 5.100e-18
Identity = 19/32 (59.38%), Postives = 23/32 (71.88%), Query Frame = 2
Query:  374 YRSEKRLITDAAKNQVRMKCNDTIFYAKRLIG 469
            +   +RLI DAAKNQV M   +T+F AKRLIG
Sbjct:   44 FSDTERLIGDAAKNQVAMNPENTVFDAKRLIG 75          
BLAST of Heat shock 70 kDa protein vs. Ensembl Nematostella
Match: EDO44530 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RV88])

HSP 1 Score: 65.4698 bits (158), Expect = 8.324e-17
Identity = 31/44 (70.45%), Postives = 34/44 (77.27%), Query Frame = 3
Query:  258 AIGIGLSTAYSCVGVIQLEKPEIIANDQENRSTPSYVAFTDQKK 389
            AIGI L T YSCVGV Q  K EIIANDQ NR+TPSYV FTD ++
Sbjct:    6 AIGIDLGTTYSCVGVFQNGKVEIIANDQGNRTTPSYVGFTDTER 49          

HSP 2 Score: 36.965 bits (84), Expect = 8.324e-17
Identity = 18/32 (56.25%), Postives = 23/32 (71.88%), Query Frame = 2
Query:  374 YRSEKRLITDAAKNQVRMKCNDTIFYAKRLIG 469
            +   +RL+ DAAKNQV +   +TIF AKRLIG
Sbjct:   44 FTDTERLVGDAAKNQVALNPENTIFDAKRLIG 75          
BLAST of Heat shock 70 kDa protein vs. Ensembl Nematostella
Match: EDO33296 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SSL5])

HSP 1 Score: 59.6918 bits (143), Expect = 7.702e-14
Identity = 29/44 (65.91%), Postives = 33/44 (75.00%), Query Frame = 3
Query:  252 GNAIGIGLSTAYSCVGVIQLEKPEIIANDQENRSTPSYVAFTDQ 383
            G  IGI L T YSCVGV +  + EIIANDQ NR TPSYVAFT++
Sbjct:   33 GTVIGIDLGTTYSCVGVFKNGRVEIIANDQGNRITPSYVAFTEE 76          

HSP 2 Score: 32.7278 bits (73), Expect = 7.702e-14
Identity = 16/30 (53.33%), Postives = 21/30 (70.00%), Query Frame = 2
Query:  386 KRLITDAAKNQVRMKCNDTIFYAKRLIGMT 475
            +RLI D AKNQ+     +T+F AKRLIG +
Sbjct:   78 ERLIGDGAKNQLTTNPENTVFDAKRLIGRS 107          
BLAST of Heat shock 70 kDa protein vs. Ensembl Medaka
Match: hspa8b (heat shock cognate 70 kDa protein [Source:NCBI gene;Acc:100125490])

HSP 1 Score: 67.3958 bits (163), Expect = 2.007e-18
Identity = 32/46 (69.57%), Postives = 36/46 (78.26%), Query Frame = 3
Query:  252 GNAIGIGLSTAYSCVGVIQLEKPEIIANDQENRSTPSYVAFTDQKK 389
            G A+GI L T YSCVGV Q  K EIIANDQ NR+TPSYVAFTD ++
Sbjct:    4 GPAVGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTER 49          

HSP 2 Score: 41.9726 bits (97), Expect = 2.007e-18
Identity = 19/32 (59.38%), Postives = 24/32 (75.00%), Query Frame = 2
Query:  374 YRSEKRLITDAAKNQVRMKCNDTIFYAKRLIG 469
            +   +RLI DAAKNQV +  N+T+F AKRLIG
Sbjct:   44 FTDTERLIGDAAKNQVALNPNNTVFDAKRLIG 75          
BLAST of Heat shock 70 kDa protein vs. Ensembl Medaka
Match: hspa8b (heat shock cognate 70 kDa protein [Source:NCBI gene;Acc:100125490])

HSP 1 Score: 67.3958 bits (163), Expect = 2.289e-18
Identity = 32/46 (69.57%), Postives = 36/46 (78.26%), Query Frame = 3
Query:  252 GNAIGIGLSTAYSCVGVIQLEKPEIIANDQENRSTPSYVAFTDQKK 389
            G A+GI L T YSCVGV Q  K EIIANDQ NR+TPSYVAFTD ++
Sbjct:    4 GPAVGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTER 49          

HSP 2 Score: 41.9726 bits (97), Expect = 2.289e-18
Identity = 19/32 (59.38%), Postives = 24/32 (75.00%), Query Frame = 2
Query:  374 YRSEKRLITDAAKNQVRMKCNDTIFYAKRLIG 469
            +   +RLI DAAKNQV +  N+T+F AKRLIG
Sbjct:   44 FTDTERLIGDAAKNQVALNPNNTVFDAKRLIG 75          
BLAST of Heat shock 70 kDa protein vs. Ensembl Medaka
Match: hsc70 (heat shock protein 70 cognate [Source:NCBI gene;Acc:100049425])

HSP 1 Score: 67.3958 bits (163), Expect = 4.699e-18
Identity = 32/46 (69.57%), Postives = 36/46 (78.26%), Query Frame = 3
Query:  252 GNAIGIGLSTAYSCVGVIQLEKPEIIANDQENRSTPSYVAFTDQKK 389
            G A+GI L T YSCVGV Q  K EIIANDQ NR+TPSYVAFTD ++
Sbjct:   54 GPAVGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTER 99          

HSP 2 Score: 40.817 bits (94), Expect = 4.699e-18
Identity = 19/32 (59.38%), Postives = 23/32 (71.88%), Query Frame = 2
Query:  374 YRSEKRLITDAAKNQVRMKCNDTIFYAKRLIG 469
            +   +RLI DAAKNQV M   +T+F AKRLIG
Sbjct:   94 FTDTERLIGDAAKNQVAMNPTNTVFDAKRLIG 125          
BLAST of Heat shock 70 kDa protein vs. Ensembl Medaka
Match: hsc70 (heat shock protein 70 cognate [Source:NCBI gene;Acc:100049425])

HSP 1 Score: 67.3958 bits (163), Expect = 4.785e-18
Identity = 32/46 (69.57%), Postives = 36/46 (78.26%), Query Frame = 3
Query:  252 GNAIGIGLSTAYSCVGVIQLEKPEIIANDQENRSTPSYVAFTDQKK 389
            G A+GI L T YSCVGV Q  K EIIANDQ NR+TPSYVAFTD ++
Sbjct:   54 GPAVGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTER 99          

HSP 2 Score: 40.817 bits (94), Expect = 4.785e-18
Identity = 19/32 (59.38%), Postives = 23/32 (71.88%), Query Frame = 2
Query:  374 YRSEKRLITDAAKNQVRMKCNDTIFYAKRLIG 469
            +   +RLI DAAKNQV M   +T+F AKRLIG
Sbjct:   94 FTDTERLIGDAAKNQVAMNPTNTVFDAKRLIG 125          
BLAST of Heat shock 70 kDa protein vs. Ensembl Medaka
Match: hsp70-3 (heat shock protein 70 [Source:NCBI gene;Acc:100125493])

HSP 1 Score: 67.0106 bits (162), Expect = 7.690e-18
Identity = 31/46 (67.39%), Postives = 36/46 (78.26%), Query Frame = 3
Query:  252 GNAIGIGLSTAYSCVGVIQLEKPEIIANDQENRSTPSYVAFTDQKK 389
            G A+GI L T YSCVG+ Q  K EIIANDQ NR+TPSYVAFTD ++
Sbjct:    4 GPAVGIDLGTTYSCVGIFQHGKVEIIANDQGNRTTPSYVAFTDTER 49          

HSP 2 Score: 40.4318 bits (93), Expect = 7.690e-18
Identity = 19/32 (59.38%), Postives = 23/32 (71.88%), Query Frame = 2
Query:  374 YRSEKRLITDAAKNQVRMKCNDTIFYAKRLIG 469
            +   +RLI DAAKNQV M   +T+F AKRLIG
Sbjct:   44 FTDTERLIGDAAKNQVAMNPANTVFDAKRLIG 75          
BLAST of Heat shock 70 kDa protein vs. Planmine SMEST
Match: SMESG000051570.1 (SMESG000051570.1)

HSP 1 Score: 75.8702 bits (185), Expect = 2.149e-21
Identity = 36/48 (75.00%), Postives = 39/48 (81.25%), Query Frame = 3
Query:  246 MSGNAIGIGLSTAYSCVGVIQLEKPEIIANDQENRSTPSYVAFTDQKK 389
            MSGNAIGI L T YSCVGV Q  K EIIANDQ NR+TPSYVAFTD ++
Sbjct:    1 MSGNAIGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTER 48          

HSP 2 Score: 43.5134 bits (101), Expect = 2.149e-21
Identity = 20/32 (62.50%), Postives = 24/32 (75.00%), Query Frame = 2
Query:  374 YRSEKRLITDAAKNQVRMKCNDTIFYAKRLIG 469
            +   +RLI DAAKNQV M  N+T+F AKRLIG
Sbjct:   43 FTDTERLIGDAAKNQVAMNPNNTVFDAKRLIG 74          
BLAST of Heat shock 70 kDa protein vs. Planmine SMEST
Match: SMESG000051567.1 (SMESG000051567.1)

HSP 1 Score: 75.8702 bits (185), Expect = 2.149e-21
Identity = 36/48 (75.00%), Postives = 39/48 (81.25%), Query Frame = 3
Query:  246 MSGNAIGIGLSTAYSCVGVIQLEKPEIIANDQENRSTPSYVAFTDQKK 389
            MSGNAIGI L T YSCVGV Q  K EIIANDQ NR+TPSYVAFTD ++
Sbjct:    1 MSGNAIGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTER 48          

HSP 2 Score: 43.5134 bits (101), Expect = 2.149e-21
Identity = 20/32 (62.50%), Postives = 24/32 (75.00%), Query Frame = 2
Query:  374 YRSEKRLITDAAKNQVRMKCNDTIFYAKRLIG 469
            +   +RLI DAAKNQV M  N+T+F AKRLIG
Sbjct:   43 FTDTERLIGDAAKNQVAMNPNNTVFDAKRLIG 74          
BLAST of Heat shock 70 kDa protein vs. Planmine SMEST
Match: SMESG000051541.1 (SMESG000051541.1)

HSP 1 Score: 75.8702 bits (185), Expect = 2.149e-21
Identity = 36/48 (75.00%), Postives = 39/48 (81.25%), Query Frame = 3
Query:  246 MSGNAIGIGLSTAYSCVGVIQLEKPEIIANDQENRSTPSYVAFTDQKK 389
            MSGNAIGI L T YSCVGV Q  K EIIANDQ NR+TPSYVAFTD ++
Sbjct:    1 MSGNAIGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTER 48          

HSP 2 Score: 43.5134 bits (101), Expect = 2.149e-21
Identity = 20/32 (62.50%), Postives = 24/32 (75.00%), Query Frame = 2
Query:  374 YRSEKRLITDAAKNQVRMKCNDTIFYAKRLIG 469
            +   +RLI DAAKNQV M  N+T+F AKRLIG
Sbjct:   43 FTDTERLIGDAAKNQVAMNPNNTVFDAKRLIG 74          
BLAST of Heat shock 70 kDa protein vs. Planmine SMEST
Match: SMESG000051540.1 (SMESG000051540.1)

HSP 1 Score: 75.8702 bits (185), Expect = 2.149e-21
Identity = 36/48 (75.00%), Postives = 39/48 (81.25%), Query Frame = 3
Query:  246 MSGNAIGIGLSTAYSCVGVIQLEKPEIIANDQENRSTPSYVAFTDQKK 389
            MSGNAIGI L T YSCVGV Q  K EIIANDQ NR+TPSYVAFTD ++
Sbjct:    1 MSGNAIGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTER 48          

HSP 2 Score: 43.5134 bits (101), Expect = 2.149e-21
Identity = 20/32 (62.50%), Postives = 24/32 (75.00%), Query Frame = 2
Query:  374 YRSEKRLITDAAKNQVRMKCNDTIFYAKRLIG 469
            +   +RLI DAAKNQV M  N+T+F AKRLIG
Sbjct:   43 FTDTERLIGDAAKNQVAMNPNNTVFDAKRLIG 74          
BLAST of Heat shock 70 kDa protein vs. Planmine SMEST
Match: SMESG000051815.1 (SMESG000051815.1)

HSP 1 Score: 72.0182 bits (175), Expect = 2.672e-20
Identity = 35/48 (72.92%), Postives = 38/48 (79.17%), Query Frame = 3
Query:  246 MSGNAIGIGLSTAYSCVGVIQLEKPEIIANDQENRSTPSYVAFTDQKK 389
            MS NAIGI L T YSCVGV Q  K EIIANDQ NR+TPSYVAFTD ++
Sbjct:    1 MSVNAIGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTER 48          

HSP 2 Score: 43.5134 bits (101), Expect = 2.672e-20
Identity = 20/28 (71.43%), Postives = 23/28 (82.14%), Query Frame = 2
Query:  386 KRLITDAAKNQVRMKCNDTIFYAKRLIG 469
            +RLI DAAKNQV M  N+T+F AKRLIG
Sbjct:   47 ERLIGDAAKNQVAMNPNNTVFDAKRLIG 74          
The following BLAST results are available for this feature:
BLAST of Heat shock 70 kDa protein vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
HSPA23.274e-1871.74heat shock protein family A (Hsp70) member 2 [Sour... [more]
HSPA23.274e-1871.74heat shock protein family A (Hsp70) member 2 [Sour... [more]
HSPA84.607e-1869.57heat shock protein family A (Hsp70) member 8 [Sour... [more]
HSPA84.895e-1869.57heat shock protein family A (Hsp70) member 8 [Sour... [more]
HSPA85.053e-1869.57heat shock protein family A (Hsp70) member 8 [Sour... [more]
back to top
BLAST of Heat shock 70 kDa protein vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
hsp-13.032e-1868.89Heat shock 70 kDa protein A [Source:UniProtKB/Swi... [more]
hsp-13.032e-1868.89Heat shock 70 kDa protein A [Source:UniProtKB/Swi... [more]
hsp-37.034e-1461.22Heat shock 70 kDa protein C [Source:UniProtKB/Swi... [more]
hsp-37.034e-1461.22Heat shock 70 kDa protein C [Source:UniProtKB/Swi... [more]
hsp-37.034e-1461.22Heat shock 70 kDa protein C [Source:UniProtKB/Swi... [more]
back to top
BLAST of Heat shock 70 kDa protein vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Hsp686.504e-1872.73gene:FBgn0001230 transcript:FBtr0084589[more]
Hsc70-46.662e-1870.45gene:FBgn0266599 transcript:FBtr0083059[more]
Hsc70-46.662e-1870.45gene:FBgn0266599 transcript:FBtr0337053[more]
Hsc70-46.662e-1870.45gene:FBgn0266599 transcript:FBtr0083058[more]
Hsc70-46.662e-1870.45gene:FBgn0266599 transcript:FBtr0083060[more]
back to top
BLAST of Heat shock 70 kDa protein vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
hsp70.15.868e-1971.74heat shock cognate 70-kd protein, tandem duplicate... [more]
hsp70.25.868e-1971.74heat shock cognate 70-kd protein, tandem duplicate... [more]
hsp70.17.687e-1971.74heat shock cognate 70-kd protein, tandem duplicate... [more]
hsp70.27.687e-1971.74heat shock cognate 70-kd protein, tandem duplicate... [more]
hsp70.37.687e-1971.74heat shock cognate 70-kd protein, tandem duplicate... [more]
back to top
BLAST of Heat shock 70 kDa protein vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
wdr268.337e-1968.00WD repeat domain 26 [Source:Xenbase;Acc:XB-GENE-99... [more]
wdr266.319e-1869.57WD repeat domain 26 [Source:Xenbase;Acc:XB-GENE-99... [more]
ENSXETT00000032295.16.473e-1869.57heat shock protein family A (Hsp70) member 1A [Sou... [more]
wdr266.527e-1869.57WD repeat domain 26 [Source:Xenbase;Acc:XB-GENE-99... [more]
wdr266.634e-1869.57WD repeat domain 26 [Source:Xenbase;Acc:XB-GENE-99... [more]
back to top
BLAST of Heat shock 70 kDa protein vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Hspa22.420e-1871.74heat shock protein 2 [Source:MGI Symbol;Acc:MGI:96... [more]
Hspa22.420e-1871.74heat shock protein 2 [Source:MGI Symbol;Acc:MGI:96... [more]
Hspa1l3.019e-1871.74heat shock protein 1-like [Source:MGI Symbol;Acc:M... [more]
Hspa84.585e-1869.57heat shock protein 8 [Source:MGI Symbol;Acc:MGI:10... [more]
Hspa84.588e-1869.57heat shock protein 8 [Source:MGI Symbol;Acc:MGI:10... [more]
back to top
BLAST of Heat shock 70 kDa protein vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q06248|HSP74_PARLI2.839e-1872.34Heat shock 70 kDa protein IV OS=Paracentrotus livi... [more]
sp|P27541|HSP70_BRUMA6.661e-1870.83Heat shock 70 kDa protein OS=Brugia malayi OX=6279... [more]
sp|Q91233|HSP70_ONCTS7.350e-1869.57Heat shock 70 kDa protein OS=Oncorhynchus tshawyts... [more]
sp|A5A8V7|HS71L_PIG9.874e-1871.74Heat shock 70 kDa protein 1-like OS=Sus scrofa OX=... [more]
sp|P0CB32|HS71L_BOVIN9.955e-1871.74Heat shock 70 kDa protein 1-like OS=Bos taurus OX=... [more]
back to top
BLAST of Heat shock 70 kDa protein vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A023G0931.827e-1651.95Putative heat shock protein (Fragment) OS=Amblyomm... [more]
A0A3Q0RA611.859e-1668.75Si:ch211-199o1.2 OS=Amphilophus citrinellus OX=618... [more]
A6YT302.208e-1672.92Heat shock protein 70 OS=Trichinella nativa OX=633... [more]
A0A5B6Z0H92.298e-1646.99Putative heat shock protein (Fragment) OS=Davidia ... [more]
A0A3M7SUB52.300e-1669.57Heat shock 70 kDa cognate 4 OS=Brachionus plicatil... [more]
back to top
BLAST of Heat shock 70 kDa protein vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ENSAMXT00000032722.13.189e-1971.74pep primary_assembly:Astyanax_mexicanus-2.0:APWO02... [more]
ENSAMXT00000055474.15.190e-1971.74pep primary_assembly:Astyanax_mexicanus-2.0:APWO02... [more]
ENSAMXT00000031477.15.190e-1971.74pep primary_assembly:Astyanax_mexicanus-2.0:APWO02... [more]
hspa1b7.814e-1968.09heat shock protein family A (Hsp70) member 1B [Sou... [more]
hsc701.049e-1867.39heat shock cognate 71 kDa protein-like [Source:NCB... [more]
back to top
BLAST of Heat shock 70 kDa protein vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 2
Match NameE-valueIdentityDescription
hspa51.747e-1465.91heat shock protein 5 [Source:NCBI gene;Acc:378848][more]
hspa96.812e-643.18heat shock protein 9 [Source:ZFIN;Acc:ZDB-GENE-030... [more]
back to top
BLAST of Heat shock 70 kDa protein vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 5
Match NameE-valueIdentityDescription
KAR21.641e-1560.87ATPase involved in protein import into the ER; als... [more]
SSA42.100e-1561.36Heat shock protein that is highly induced upon str... [more]
SSA35.640e-1561.36ATPase involved in protein folding and the respons... [more]
SSA11.431e-1456.82ATPase involved in protein folding and NLS-directe... [more]
SSA24.826e-1454.55HSP70 family ATP-binding protein; involved in prot... [more]
back to top
BLAST of Heat shock 70 kDa protein vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 4
Match NameE-valueIdentityDescription
EDO303231.166e-1972.73Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO372805.100e-1868.18Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO445308.324e-1770.45Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO332967.702e-1465.91Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Heat shock 70 kDa protein vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
hspa8b2.007e-1869.57heat shock cognate 70 kDa protein [Source:NCBI gen... [more]
hspa8b2.289e-1869.57heat shock cognate 70 kDa protein [Source:NCBI gen... [more]
hsc704.699e-1869.57heat shock protein 70 cognate [Source:NCBI gene;Ac... [more]
hsc704.785e-1869.57heat shock protein 70 cognate [Source:NCBI gene;Ac... [more]
hsp70-37.690e-1867.39heat shock protein 70 [Source:NCBI gene;Acc:100125... [more]
back to top
BLAST of Heat shock 70 kDa protein vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000051570.12.149e-2175.00SMESG000051570.1[more]
SMESG000051567.12.149e-2175.00SMESG000051567.1[more]
SMESG000051541.12.149e-2175.00SMESG000051541.1[more]
SMESG000051540.12.149e-2175.00SMESG000051540.1[more]
SMESG000051815.12.672e-2072.92SMESG000051815.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30015695 ID=SMED30015695|Name=Heat shock 70 kDa protein|organism=Schmidtea mediterranea sexual|type=transcript|length=482bp
GATGTATTGCTGGCTGTGATACCACCATAGGGATTGCAGGATAATAATAA
GGTTATTCAATCTCAGAATCCAAATCAAGCTCTATTGATTTCTGTTTGGT
CTTGATGTGCTGTACTGGGTGCATAATTATGCCGGATATTTTTGATCTGA
ATTTTGAATTTTCAAGCATTTTCGAAGCAAATAACGTAATTTTTGAAATT
TGCTCTTGCTATTTTATTTTTTAACTTATTGTCGATTGATTCCAAATGTC
TGGTAACGCTATCGGTATTGGGTTGAGTACTGCCTATTCATGCGTTGGTG
TAATTCAACTTGAAAAACCTGAAATTATTGCTAATGATCAAGAAAACCGC
TCAACGCCCAGTTATGTTGCATTTACAGATCAGAAAAAAGATTGATTACG
GATGCTGCAAAAAATCAAGTTAGAATGAAGTGTAACGATACGATTTTCTA
TGCCAAACGACTAATCGGAATGACTGATAAAA
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000070intestinal phagocyte
Vocabulary: INTERPRO
TermDefinition
IPR043129ATPase_NBD
IPR013126Hsp_70_fam
Vocabulary: molecular function
TermDefinition
GO:0000166nucleotide binding
GO:0005524ATP binding
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
NoneNo IPR availablePRINTSPR00301HEATSHOCK70coord: 32..44
score: 71.39
coord: 4..17
score: 61.65
NoneNo IPR availableGENE3DG3DSA:3.30.420.40coord: 1..48
e-value: 1.7E-13
score: 52.3
NoneNo IPR availablePANTHERPTHR19375:SF376coord: 2..47
IPR013126Heat shock protein 70 familyPFAMPF00012HSP70coord: 5..47
e-value: 1.1E-12
score: 46.9
IPR013126Heat shock protein 70 familyPANTHERPTHR19375HEAT SHOCK PROTEIN 70KDAcoord: 2..47
IPR043129ATPase, nucleotide binding domainSUPERFAMILYSSF53067Actin-like ATPase domaincoord: 4..46