Histone H2A

Overview
NameHistone H2A
Smed IDSMED30015694
Length (bp)1536
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Histone H2A (SMED30015694) t-SNE clustered cells

Violin plots show distribution of expression levels for Histone H2A (SMED30015694) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Histone H2A (SMED30015694) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Histone H2A (SMED30015694) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30015694

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 2

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
Smed sexual biotypeSMED30015694h1SMcG0016297 Contig54924uc_Smed_v2PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30015694h1SMcG0016297 Contig54924newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Histone H2A vs. Ensembl Human
Match: H2AC21 (H2A clustered histone 21 [Source:HGNC Symbol;Acc:HGNC:20508])

HSP 1 Score: 165.622 bits (418), Expect = 9.490e-49
Identity = 99/118 (83.90%), Postives = 111/118 (94.07%), Query Frame = 2
Query:   80 SRNQSKTRSSRAGLQFPVGRIHRKLRKGNFAERVGAGAPXXXXXXXXXXXXXXXXXXGNAARDNKKSRIIPRHLQLAIRNDEELNKLLGGVTISQGGVIPNIQSALLPKKTE-EKPAK 430
            +R ++K+RSSRAGLQFPVGR+HR LRKGN+AERVGAGAPVYLAAVLEYL AE+LELAGNAARDNKK+RIIPRHLQLA+RNDEELNKLLGGVTI+QGGV+PNIQ+ LLPKKTE  KP K
Sbjct:   11 ARAKAKSRSSRAGLQFPVGRVHRLLRKGNYAERVGAGAPVYLAAVLEYLTAEILELAGNAARDNKKTRIIPRHLQLAVRNDEELNKLLGGVTIAQGGVLPNIQAVLLPKKTESHKPGK 128          
BLAST of Histone H2A vs. Ensembl Human
Match: H2AC20 (H2A clustered histone 20 [Source:HGNC Symbol;Acc:HGNC:4738])

HSP 1 Score: 165.236 bits (417), Expect = 1.221e-48
Identity = 97/117 (82.91%), Postives = 109/117 (93.16%), Query Frame = 2
Query:   80 SRNQSKTRSSRAGLQFPVGRIHRKLRKGNFAERVGAGAPXXXXXXXXXXXXXXXXXXGNAARDNKKSRIIPRHLQLAIRNDEELNKLLGGVTISQGGVIPNIQSALLPKKTEEKPAK 430
            +R ++K+RSSRAGLQFPVGR+HR LRKGN+AERVGAGAPVY+AAVLEYL AE+LELAGNAARDNKK+RIIPRHLQLAIRNDEELNKLLG VTI+QGGV+PNIQ+ LLPKKTE   AK
Sbjct:   11 ARAKAKSRSSRAGLQFPVGRVHRLLRKGNYAERVGAGAPVYMAAVLEYLTAEILELAGNAARDNKKTRIIPRHLQLAIRNDEELNKLLGKVTIAQGGVLPNIQAVLLPKKTESHKAK 127          
BLAST of Histone H2A vs. Ensembl Human
Match: H2AC1 (H2A clustered histone 1 [Source:HGNC Symbol;Acc:HGNC:18729])

HSP 1 Score: 165.236 bits (417), Expect = 1.674e-48
Identity = 97/112 (86.61%), Postives = 108/112 (96.43%), Query Frame = 2
Query:   80 SRNQSKTRSSRAGLQFPVGRIHRKLRKGNFAERVGAGAPXXXXXXXXXXXXXXXXXXGNAARDNKKSRIIPRHLQLAIRNDEELNKLLGGVTISQGGVIPNIQSALLPKKTE 415
            +R +SK+RSSRAGLQFPVGRIHR LRKGN+AER+GAGAPVYLAAVLEYL AE+LELAGNA+RDNKK+RIIPRHLQLAIRNDEELNKLLGGVTI+QGGV+PNIQ+ LLPKKTE
Sbjct:   11 ARAKSKSRSSRAGLQFPVGRIHRLLRKGNYAERIGAGAPVYLAAVLEYLTAEILELAGNASRDNKKTRIIPRHLQLAIRNDEELNKLLGGVTIAQGGVLPNIQAVLLPKKTE 122          
BLAST of Histone H2A vs. Ensembl Human
Match: H2AC14 (H2A clustered histone 14 [Source:HGNC Symbol;Acc:HGNC:4727])

HSP 1 Score: 164.466 bits (415), Expect = 2.771e-48
Identity = 97/112 (86.61%), Postives = 107/112 (95.54%), Query Frame = 2
Query:   80 SRNQSKTRSSRAGLQFPVGRIHRKLRKGNFAERVGAGAPXXXXXXXXXXXXXXXXXXGNAARDNKKSRIIPRHLQLAIRNDEELNKLLGGVTISQGGVIPNIQSALLPKKTE 415
            +R ++KTRSSRAGLQFPVGR+HR LRKGN+AERVGAGAPVYLAAVLEYL AE+LELAGNAARDNKK+RIIPRHLQLAIRNDEELNKLLG VTI+QGGV+PNIQ+ LLPKKTE
Sbjct:   11 ARAKAKTRSSRAGLQFPVGRVHRLLRKGNYAERVGAGAPVYLAAVLEYLTAEILELAGNAARDNKKTRIIPRHLQLAIRNDEELNKLLGKVTIAQGGVLPNIQAVLLPKKTE 122          
BLAST of Histone H2A vs. Ensembl Human
Match: H2AC12 (H2A clustered histone 12 [Source:HGNC Symbol;Acc:HGNC:13671])

HSP 1 Score: 164.466 bits (415), Expect = 2.982e-48
Identity = 97/112 (86.61%), Postives = 107/112 (95.54%), Query Frame = 2
Query:   80 SRNQSKTRSSRAGLQFPVGRIHRKLRKGNFAERVGAGAPXXXXXXXXXXXXXXXXXXGNAARDNKKSRIIPRHLQLAIRNDEELNKLLGGVTISQGGVIPNIQSALLPKKTE 415
            +R ++KTRSSRAGLQFPVGR+HR LRKGN+AERVGAGAPVYLAAVLEYL AE+LELAGNAARDNKK+RIIPRHLQLAIRNDEELNKLLG VTI+QGGV+PNIQ+ LLPKKTE
Sbjct:   11 ARAKAKTRSSRAGLQFPVGRVHRLLRKGNYAERVGAGAPVYLAAVLEYLTAEILELAGNAARDNKKTRIIPRHLQLAIRNDEELNKLLGKVTIAQGGVLPNIQAVLLPKKTE 122          
BLAST of Histone H2A vs. Ensembl Celegans
Match: his-35 (Histone H2A [Source:UniProtKB/TrEMBL;Acc:Q27485])

HSP 1 Score: 152.91 bits (385), Expect = 2.204e-44
Identity = 92/105 (87.62%), Postives = 101/105 (96.19%), Query Frame = 2
Query:   98 TRSSRAGLQFPVGRIHRKLRKGNFAERVGAGAPXXXXXXXXXXXXXXXXXXGNAARDNKKSRIIPRHLQLAIRNDEELNKLLGGVTISQGGVIPNIQSALLPKKT 412
            +RSSRAGLQFPVGR+HR LRKGN+A+RVGAGAPVYLAAVLEYLAAEVLELAGNAARDNKK+RI PRHLQLA+RNDEELNKLL GVTI+QGGV+PNIQ+ LLPKKT
Sbjct:   18 SRSSRAGLQFPVGRLHRILRKGNYAQRVGAGAPVYLAAVLEYLAAEVLELAGNAARDNKKTRIAPRHLQLAVRNDEELNKLLAGVTIAQGGVLPNIQAVLLPKKT 122          
BLAST of Histone H2A vs. Ensembl Celegans
Match: his-35 (Histone H2A [Source:UniProtKB/TrEMBL;Acc:Q27485])

HSP 1 Score: 152.91 bits (385), Expect = 2.204e-44
Identity = 92/105 (87.62%), Postives = 101/105 (96.19%), Query Frame = 2
Query:   98 TRSSRAGLQFPVGRIHRKLRKGNFAERVGAGAPXXXXXXXXXXXXXXXXXXGNAARDNKKSRIIPRHLQLAIRNDEELNKLLGGVTISQGGVIPNIQSALLPKKT 412
            +RSSRAGLQFPVGR+HR LRKGN+A+RVGAGAPVYLAAVLEYLAAEVLELAGNAARDNKK+RI PRHLQLA+RNDEELNKLL GVTI+QGGV+PNIQ+ LLPKKT
Sbjct:   18 SRSSRAGLQFPVGRLHRILRKGNYAQRVGAGAPVYLAAVLEYLAAEVLELAGNAARDNKKTRIAPRHLQLAVRNDEELNKLLAGVTIAQGGVLPNIQAVLLPKKT 122          
BLAST of Histone H2A vs. Ensembl Celegans
Match: his-57 (Histone H2A [Source:UniProtKB/Swiss-Prot;Acc:P09588])

HSP 1 Score: 153.295 bits (386), Expect = 2.620e-44
Identity = 92/105 (87.62%), Postives = 101/105 (96.19%), Query Frame = 2
Query:   98 TRSSRAGLQFPVGRIHRKLRKGNFAERVGAGAPXXXXXXXXXXXXXXXXXXGNAARDNKKSRIIPRHLQLAIRNDEELNKLLGGVTISQGGVIPNIQSALLPKKT 412
            +RSSRAGLQFPVGR+HR LRKGN+A+RVGAGAPVYLAAVLEYLAAEVLELAGNAARDNKK+RI PRHLQLA+RNDEELNKLL GVTI+QGGV+PNIQ+ LLPKKT
Sbjct:   18 SRSSRAGLQFPVGRLHRILRKGNYAQRVGAGAPVYLAAVLEYLAAEVLELAGNAARDNKKTRIAPRHLQLAVRNDEELNKLLAGVTIAQGGVLPNIQAVLLPKKT 122          
BLAST of Histone H2A vs. Ensembl Celegans
Match: his-68 (Histone H2A [Source:UniProtKB/Swiss-Prot;Acc:P09588])

HSP 1 Score: 152.525 bits (384), Expect = 3.013e-44
Identity = 92/105 (87.62%), Postives = 101/105 (96.19%), Query Frame = 2
Query:   98 TRSSRAGLQFPVGRIHRKLRKGNFAERVGAGAPXXXXXXXXXXXXXXXXXXGNAARDNKKSRIIPRHLQLAIRNDEELNKLLGGVTISQGGVIPNIQSALLPKKT 412
            +RSSRAGLQFPVGR+HR LRKGN+A+RVGAGAPVYLAAVLEYLAAEVLELAGNAARDNKK+RI PRHLQLA+RNDEELNKLL GVTI+QGGV+PNIQ+ LLPKKT
Sbjct:   18 SRSSRAGLQFPVGRLHRILRKGNYAQRVGAGAPVYLAAVLEYLAAEVLELAGNAARDNKKTRIAPRHLQLAVRNDEELNKLLAGVTIAQGGVLPNIQAVLLPKKT 122          
BLAST of Histone H2A vs. Ensembl Celegans
Match: his-65 (Histone H2A [Source:UniProtKB/Swiss-Prot;Acc:P09588])

HSP 1 Score: 152.525 bits (384), Expect = 3.013e-44
Identity = 92/105 (87.62%), Postives = 101/105 (96.19%), Query Frame = 2
Query:   98 TRSSRAGLQFPVGRIHRKLRKGNFAERVGAGAPXXXXXXXXXXXXXXXXXXGNAARDNKKSRIIPRHLQLAIRNDEELNKLLGGVTISQGGVIPNIQSALLPKKT 412
            +RSSRAGLQFPVGR+HR LRKGN+A+RVGAGAPVYLAAVLEYLAAEVLELAGNAARDNKK+RI PRHLQLA+RNDEELNKLL GVTI+QGGV+PNIQ+ LLPKKT
Sbjct:   18 SRSSRAGLQFPVGRLHRILRKGNYAQRVGAGAPVYLAAVLEYLAAEVLELAGNAARDNKKTRIAPRHLQLAVRNDEELNKLLAGVTIAQGGVLPNIQAVLLPKKT 122          
BLAST of Histone H2A vs. Ensembl Fly
Match: His2A:CG33850 (gene:FBgn0053850 transcript:FBtr0091854)

HSP 1 Score: 161.384 bits (407), Expect = 1.908e-47
Identity = 96/108 (88.89%), Postives = 105/108 (97.22%), Query Frame = 2
Query:   98 TRSSRAGLQFPVGRIHRKLRKGNFAERVGAGAPXXXXXXXXXXXXXXXXXXGNAARDNKKSRIIPRHLQLAIRNDEELNKLLGGVTISQGGVIPNIQSALLPKKTEEK 421
            +RS+RAGLQFPVGRIHR LRKGN+AERVGAGAPVYLAAV+EYLAAEVLELAGNAARDNKK+RIIPRHLQLAIRNDEELNKLL GVTI+QGGV+PNIQ+ LLPKKTE+K
Sbjct:   16 SRSNRAGLQFPVGRIHRLLRKGNYAERVGAGAPVYLAAVMEYLAAEVLELAGNAARDNKKTRIIPRHLQLAIRNDEELNKLLSGVTIAQGGVLPNIQAVLLPKKTEKK 123          
BLAST of Histone H2A vs. Ensembl Fly
Match: His2A:CG33847 (gene:FBgn0053847 transcript:FBtr0091851)

HSP 1 Score: 161.384 bits (407), Expect = 1.908e-47
Identity = 96/108 (88.89%), Postives = 105/108 (97.22%), Query Frame = 2
Query:   98 TRSSRAGLQFPVGRIHRKLRKGNFAERVGAGAPXXXXXXXXXXXXXXXXXXGNAARDNKKSRIIPRHLQLAIRNDEELNKLLGGVTISQGGVIPNIQSALLPKKTEEK 421
            +RS+RAGLQFPVGRIHR LRKGN+AERVGAGAPVYLAAV+EYLAAEVLELAGNAARDNKK+RIIPRHLQLAIRNDEELNKLL GVTI+QGGV+PNIQ+ LLPKKTE+K
Sbjct:   16 SRSNRAGLQFPVGRIHRLLRKGNYAERVGAGAPVYLAAVMEYLAAEVLELAGNAARDNKKTRIIPRHLQLAIRNDEELNKLLSGVTIAQGGVLPNIQAVLLPKKTEKK 123          
BLAST of Histone H2A vs. Ensembl Fly
Match: His2A:CG33844 (gene:FBgn0053844 transcript:FBtr0091848)

HSP 1 Score: 161.384 bits (407), Expect = 1.908e-47
Identity = 96/108 (88.89%), Postives = 105/108 (97.22%), Query Frame = 2
Query:   98 TRSSRAGLQFPVGRIHRKLRKGNFAERVGAGAPXXXXXXXXXXXXXXXXXXGNAARDNKKSRIIPRHLQLAIRNDEELNKLLGGVTISQGGVIPNIQSALLPKKTEEK 421
            +RS+RAGLQFPVGRIHR LRKGN+AERVGAGAPVYLAAV+EYLAAEVLELAGNAARDNKK+RIIPRHLQLAIRNDEELNKLL GVTI+QGGV+PNIQ+ LLPKKTE+K
Sbjct:   16 SRSNRAGLQFPVGRIHRLLRKGNYAERVGAGAPVYLAAVMEYLAAEVLELAGNAARDNKKTRIIPRHLQLAIRNDEELNKLLSGVTIAQGGVLPNIQAVLLPKKTEKK 123          
BLAST of Histone H2A vs. Ensembl Fly
Match: His2A:CG33832 (gene:FBgn0053832 transcript:FBtr0091836)

HSP 1 Score: 161.384 bits (407), Expect = 1.908e-47
Identity = 96/108 (88.89%), Postives = 105/108 (97.22%), Query Frame = 2
Query:   98 TRSSRAGLQFPVGRIHRKLRKGNFAERVGAGAPXXXXXXXXXXXXXXXXXXGNAARDNKKSRIIPRHLQLAIRNDEELNKLLGGVTISQGGVIPNIQSALLPKKTEEK 421
            +RS+RAGLQFPVGRIHR LRKGN+AERVGAGAPVYLAAV+EYLAAEVLELAGNAARDNKK+RIIPRHLQLAIRNDEELNKLL GVTI+QGGV+PNIQ+ LLPKKTE+K
Sbjct:   16 SRSNRAGLQFPVGRIHRLLRKGNYAERVGAGAPVYLAAVMEYLAAEVLELAGNAARDNKKTRIIPRHLQLAIRNDEELNKLLSGVTIAQGGVLPNIQAVLLPKKTEKK 123          
BLAST of Histone H2A vs. Ensembl Fly
Match: His2A:CG33826 (gene:FBgn0053826 transcript:FBtr0091830)

HSP 1 Score: 161.384 bits (407), Expect = 1.908e-47
Identity = 96/108 (88.89%), Postives = 105/108 (97.22%), Query Frame = 2
Query:   98 TRSSRAGLQFPVGRIHRKLRKGNFAERVGAGAPXXXXXXXXXXXXXXXXXXGNAARDNKKSRIIPRHLQLAIRNDEELNKLLGGVTISQGGVIPNIQSALLPKKTEEK 421
            +RS+RAGLQFPVGRIHR LRKGN+AERVGAGAPVYLAAV+EYLAAEVLELAGNAARDNKK+RIIPRHLQLAIRNDEELNKLL GVTI+QGGV+PNIQ+ LLPKKTE+K
Sbjct:   16 SRSNRAGLQFPVGRIHRLLRKGNYAERVGAGAPVYLAAVMEYLAAEVLELAGNAARDNKKTRIIPRHLQLAIRNDEELNKLLSGVTIAQGGVLPNIQAVLLPKKTEKK 123          
BLAST of Histone H2A vs. Ensembl Zebrafish
Match: si:ch211-113a14.19 (si:ch211-113a14.19 [Source:ZFIN;Acc:ZDB-GENE-121214-198])

HSP 1 Score: 168.703 bits (426), Expect = 4.044e-50
Identity = 101/118 (85.59%), Postives = 112/118 (94.92%), Query Frame = 2
Query:   80 SRNQSKTRSSRAGLQFPVGRIHRKLRKGNFAERVGAGAPXXXXXXXXXXXXXXXXXXGNAARDNKKSRIIPRHLQLAIRNDEELNKLLGGVTISQGGVIPNIQSALLPKKTEEKPAKG 433
            +R ++KTRSSRAGLQFPVGR+HR LRKGN+AERVGAGAPVYLAAVLEYL AE+LELAGNAARDNKK+RIIPRHLQLA+RNDEELNKLLGGVTI+QGGV+PNIQ+ LLPKKT EK AKG
Sbjct:   11 ARAKAKTRSSRAGLQFPVGRVHRLLRKGNYAERVGAGAPVYLAAVLEYLTAEILELAGNAARDNKKTRIIPRHLQLAVRNDEELNKLLGGVTIAQGGVLPNIQAVLLPKKT-EKAAKG 127          
BLAST of Histone H2A vs. Ensembl Zebrafish
Match: si:ch211-113a14.19 (si:ch211-113a14.19 [Source:ZFIN;Acc:ZDB-GENE-121214-198])

HSP 1 Score: 168.703 bits (426), Expect = 4.044e-50
Identity = 101/118 (85.59%), Postives = 112/118 (94.92%), Query Frame = 2
Query:   80 SRNQSKTRSSRAGLQFPVGRIHRKLRKGNFAERVGAGAPXXXXXXXXXXXXXXXXXXGNAARDNKKSRIIPRHLQLAIRNDEELNKLLGGVTISQGGVIPNIQSALLPKKTEEKPAKG 433
            +R ++KTRSSRAGLQFPVGR+HR LRKGN+AERVGAGAPVYLAAVLEYL AE+LELAGNAARDNKK+RIIPRHLQLA+RNDEELNKLLGGVTI+QGGV+PNIQ+ LLPKKT EK AKG
Sbjct:   11 ARAKAKTRSSRAGLQFPVGRVHRLLRKGNYAERVGAGAPVYLAAVLEYLTAEILELAGNAARDNKKTRIIPRHLQLAVRNDEELNKLLGGVTIAQGGVLPNIQAVLLPKKT-EKAAKG 127          
BLAST of Histone H2A vs. Ensembl Zebrafish
Match: si:ch211-113a14.19 (si:ch211-113a14.19 [Source:ZFIN;Acc:ZDB-GENE-121214-198])

HSP 1 Score: 168.703 bits (426), Expect = 4.044e-50
Identity = 101/118 (85.59%), Postives = 112/118 (94.92%), Query Frame = 2
Query:   80 SRNQSKTRSSRAGLQFPVGRIHRKLRKGNFAERVGAGAPXXXXXXXXXXXXXXXXXXGNAARDNKKSRIIPRHLQLAIRNDEELNKLLGGVTISQGGVIPNIQSALLPKKTEEKPAKG 433
            +R ++KTRSSRAGLQFPVGR+HR LRKGN+AERVGAGAPVYLAAVLEYL AE+LELAGNAARDNKK+RIIPRHLQLA+RNDEELNKLLGGVTI+QGGV+PNIQ+ LLPKKT EK AKG
Sbjct:   11 ARAKAKTRSSRAGLQFPVGRVHRLLRKGNYAERVGAGAPVYLAAVLEYLTAEILELAGNAARDNKKTRIIPRHLQLAVRNDEELNKLLGGVTIAQGGVLPNIQAVLLPKKT-EKAAKG 127          
BLAST of Histone H2A vs. Ensembl Zebrafish
Match: si:ch211-113a14.19 (si:ch211-113a14.19 [Source:ZFIN;Acc:ZDB-GENE-121214-198])

HSP 1 Score: 168.703 bits (426), Expect = 4.044e-50
Identity = 101/118 (85.59%), Postives = 112/118 (94.92%), Query Frame = 2
Query:   80 SRNQSKTRSSRAGLQFPVGRIHRKLRKGNFAERVGAGAPXXXXXXXXXXXXXXXXXXGNAARDNKKSRIIPRHLQLAIRNDEELNKLLGGVTISQGGVIPNIQSALLPKKTEEKPAKG 433
            +R ++KTRSSRAGLQFPVGR+HR LRKGN+AERVGAGAPVYLAAVLEYL AE+LELAGNAARDNKK+RIIPRHLQLA+RNDEELNKLLGGVTI+QGGV+PNIQ+ LLPKKT EK AKG
Sbjct:   11 ARAKAKTRSSRAGLQFPVGRVHRLLRKGNYAERVGAGAPVYLAAVLEYLTAEILELAGNAARDNKKTRIIPRHLQLAVRNDEELNKLLGGVTIAQGGVLPNIQAVLLPKKT-EKAAKG 127          
BLAST of Histone H2A vs. Ensembl Zebrafish
Match: si:ch211-113a14.19 (si:ch211-113a14.19 [Source:ZFIN;Acc:ZDB-GENE-121214-198])

HSP 1 Score: 168.703 bits (426), Expect = 4.044e-50
Identity = 101/118 (85.59%), Postives = 112/118 (94.92%), Query Frame = 2
Query:   80 SRNQSKTRSSRAGLQFPVGRIHRKLRKGNFAERVGAGAPXXXXXXXXXXXXXXXXXXGNAARDNKKSRIIPRHLQLAIRNDEELNKLLGGVTISQGGVIPNIQSALLPKKTEEKPAKG 433
            +R ++KTRSSRAGLQFPVGR+HR LRKGN+AERVGAGAPVYLAAVLEYL AE+LELAGNAARDNKK+RIIPRHLQLA+RNDEELNKLLGGVTI+QGGV+PNIQ+ LLPKKT EK AKG
Sbjct:   11 ARAKAKTRSSRAGLQFPVGRVHRLLRKGNYAERVGAGAPVYLAAVLEYLTAEILELAGNAARDNKKTRIIPRHLQLAVRNDEELNKLLGGVTIAQGGVLPNIQAVLLPKKT-EKAAKG 127          
BLAST of Histone H2A vs. Ensembl Xenopus
Match: ENSXETT00000000447.1 (pep primary_assembly:Xenopus_tropicalis_v9.1:3:124390910:124391717:1 gene:ENSXETG00000000090.1 transcript:ENSXETT00000000447.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 171.014 bits (432), Expect = 1.294e-50
Identity = 104/128 (81.25%), Postives = 114/128 (89.06%), Query Frame = 2
Query:   80 SRNQSKTRSSRAGLQFPVGRIHRKLRKGNFAERVGAGAPXXXXXXXXXXXXXXXXXXGNAARDNKKSRIIPRHLQLAIRNDEELNKLLGGVTISQGGVIPNIQSALLPKKTEE-KPAKGNLLKITSIS 460
            +R ++KTRSSRAGLQFPVGR+HR LRKGN+AERVGAGAPVYLAAVLEYL AE+LELAGNAARDNKK+RIIPRHLQLA+RNDEELNKLLGGVTI+QGGV+PNIQS LLPKKTE  K AK N    T  S
Sbjct:   11 TRAKAKTRSSRAGLQFPVGRVHRLLRKGNYAERVGAGAPVYLAAVLEYLTAEILELAGNAARDNKKTRIIPRHLQLAVRNDEELNKLLGGVTIAQGGVLPNIQSVLLPKKTESTKAAKSNGSSATCCS 138          
BLAST of Histone H2A vs. Ensembl Xenopus
Match: ENSXETT00000016361.1 (histone H2A type 1-like [Source:NCBI gene;Acc:101734900])

HSP 1 Score: 169.474 bits (428), Expect = 3.032e-50
Identity = 102/118 (86.44%), Postives = 111/118 (94.07%), Query Frame = 2
Query:   83 RNQSKTRSSRAGLQFPVGRIHRKLRKGNFAERVGAGAPXXXXXXXXXXXXXXXXXXGNAARDNKKSRIIPRHLQLAIRNDEELNKLLGGVTISQGGVIPNIQSALLPKKTE-EKPAKG 433
            R ++KTRSSRAGLQFPVGR+HR LRKGN+AERVGAGAPVYLAAVLEYL AE+LELAGNAARDNKK+RIIPRHLQLA+RNDEELNKLLGGVTI+QGGV+PNIQS LLPKK E  KPAKG
Sbjct:   12 RAKAKTRSSRAGLQFPVGRVHRLLRKGNYAERVGAGAPVYLAAVLEYLTAEILELAGNAARDNKKTRIIPRHLQLAVRNDEELNKLLGGVTIAQGGVLPNIQSVLLPKKAESSKPAKG 129          
BLAST of Histone H2A vs. Ensembl Xenopus
Match: ENSXETT00000018917.1 (pep primary_assembly:Xenopus_tropicalis_v9.1:6:520260:520655:-1 gene:ENSXETG00000007766.1 transcript:ENSXETT00000018917.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 169.474 bits (428), Expect = 3.666e-50
Identity = 102/118 (86.44%), Postives = 111/118 (94.07%), Query Frame = 2
Query:   83 RNQSKTRSSRAGLQFPVGRIHRKLRKGNFAERVGAGAPXXXXXXXXXXXXXXXXXXGNAARDNKKSRIIPRHLQLAIRNDEELNKLLGGVTISQGGVIPNIQSALLPKKTE-EKPAKG 433
            R ++KTRSSRAGLQFPVGR+HR LRKGN+AERVGAGAPVYLAAVLEYL AE+LELAGNAARDNKK+RIIPRHLQLA+RNDEELNKLLGGVTI+QGGV+PNIQS LLPKK E  KPAKG
Sbjct:   13 RAKAKTRSSRAGLQFPVGRVHRLLRKGNYAERVGAGAPVYLAAVLEYLTAEILELAGNAARDNKKTRIIPRHLQLAVRNDEELNKLLGGVTIAQGGVLPNIQSVLLPKKAESSKPAKG 130          
BLAST of Histone H2A vs. Ensembl Xenopus
Match: h2ac14 (H2A clustered histone 14 [Source:NCBI gene;Acc:448075])

HSP 1 Score: 169.088 bits (427), Expect = 4.338e-50
Identity = 99/116 (85.34%), Postives = 109/116 (93.97%), Query Frame = 2
Query:   80 SRNQSKTRSSRAGLQFPVGRIHRKLRKGNFAERVGAGAPXXXXXXXXXXXXXXXXXXGNAARDNKKSRIIPRHLQLAIRNDEELNKLLGGVTISQGGVIPNIQSALLPKKTEEKPA 427
            +R ++KTRSSRAGLQFPVGR+HR LRKGN+AERVGAGAPVYLAAVLEYL AE+LELAGNAARDNKK+RIIPRHLQLA+RNDEELNKLLGGVTI+QGGV+PNIQS LLPKKTE   A
Sbjct:   11 TRAKAKTRSSRAGLQFPVGRVHRLLRKGNYAERVGAGAPVYLAAVLEYLTAEILELAGNAARDNKKTRIIPRHLQLAVRNDEELNKLLGGVTIAQGGVLPNIQSVLLPKKTESSKA 126          
BLAST of Histone H2A vs. Ensembl Xenopus
Match: ENSXETT00000037811.1 (histone H2A type 1-like [Source:NCBI gene;Acc:100487588])

HSP 1 Score: 169.088 bits (427), Expect = 4.338e-50
Identity = 99/116 (85.34%), Postives = 109/116 (93.97%), Query Frame = 2
Query:   80 SRNQSKTRSSRAGLQFPVGRIHRKLRKGNFAERVGAGAPXXXXXXXXXXXXXXXXXXGNAARDNKKSRIIPRHLQLAIRNDEELNKLLGGVTISQGGVIPNIQSALLPKKTEEKPA 427
            +R ++KTRSSRAGLQFPVGR+HR LRKGN+AERVGAGAPVYLAAVLEYL AE+LELAGNAARDNKK+RIIPRHLQLA+RNDEELNKLLGGVTI+QGGV+PNIQS LLPKKTE   A
Sbjct:   11 TRAKAKTRSSRAGLQFPVGRVHRLLRKGNYAERVGAGAPVYLAAVLEYLTAEILELAGNAARDNKKTRIIPRHLQLAVRNDEELNKLLGGVTIAQGGVLPNIQSVLLPKKTESSKA 126          
BLAST of Histone H2A vs. Ensembl Mouse
Match: H2ac21 (H2A clustered histone 21 [Source:MGI Symbol;Acc:MGI:2448314])

HSP 1 Score: 166.007 bits (419), Expect = 4.854e-49
Identity = 98/118 (83.05%), Postives = 111/118 (94.07%), Query Frame = 2
Query:   80 SRNQSKTRSSRAGLQFPVGRIHRKLRKGNFAERVGAGAPXXXXXXXXXXXXXXXXXXGNAARDNKKSRIIPRHLQLAIRNDEELNKLLGGVTISQGGVIPNIQSALLPKKTE-EKPAK 430
            +R ++K+RSSRAGLQFPVGR+HR LRKGN+AERVGAGAPVY+AAVLEYL AE+LELAGNAARDNKK+RIIPRHLQLA+RNDEELNKLLGGVTI+QGGV+PNIQ+ LLPKKTE  KP K
Sbjct:   11 ARAKAKSRSSRAGLQFPVGRVHRLLRKGNYAERVGAGAPVYMAAVLEYLTAEILELAGNAARDNKKTRIIPRHLQLAVRNDEELNKLLGGVTIAQGGVLPNIQAVLLPKKTESHKPGK 128          
BLAST of Histone H2A vs. Ensembl Mouse
Match: H2ac20 (H2A clustered histone 20 [Source:MGI Symbol;Acc:MGI:2448316])

HSP 1 Score: 165.236 bits (417), Expect = 8.384e-49
Identity = 97/117 (82.91%), Postives = 109/117 (93.16%), Query Frame = 2
Query:   80 SRNQSKTRSSRAGLQFPVGRIHRKLRKGNFAERVGAGAPXXXXXXXXXXXXXXXXXXGNAARDNKKSRIIPRHLQLAIRNDEELNKLLGGVTISQGGVIPNIQSALLPKKTEEKPAK 430
            +R ++K+RSSRAGLQFPVGR+HR LRKGN+AERVGAGAPVY+AAVLEYL AE+LELAGNAARDNKK+RIIPRHLQLAIRNDEELNKLLG VTI+QGGV+PNIQ+ LLPKKTE   AK
Sbjct:   11 ARAKAKSRSSRAGLQFPVGRVHRLLRKGNYAERVGAGAPVYMAAVLEYLTAEILELAGNAARDNKKTRIIPRHLQLAIRNDEELNKLLGKVTIAQGGVLPNIQAVLLPKKTESHKAK 127          
BLAST of Histone H2A vs. Ensembl Mouse
Match: H2aj (H2J.A histone [Source:MGI Symbol;Acc:MGI:3606192])

HSP 1 Score: 163.31 bits (412), Expect = 5.974e-48
Identity = 97/116 (83.62%), Postives = 108/116 (93.10%), Query Frame = 2
Query:   83 RNQSKTRSSRAGLQFPVGRIHRKLRKGNFAERVGAGAPXXXXXXXXXXXXXXXXXXGNAARDNKKSRIIPRHLQLAIRNDEELNKLLGGVTISQGGVIPNIQSALLPKKTEEKPAK 430
            R ++K+RSSRAGLQFPVGR+HR LRKGN+AERVGAGAPVYLAAVLEYL AE+LELAGNAARDNKK+RIIPRHLQLAIRNDEELNKLLG VTI+QGGV+PNIQ+ LLPKKTE +  K
Sbjct:   12 RAKAKSRSSRAGLQFPVGRVHRLLRKGNYAERVGAGAPVYLAAVLEYLTAEILELAGNAARDNKKTRIIPRHLQLAIRNDEELNKLLGRVTIAQGGVLPNIQAVLLPKKTESQKVK 127          
BLAST of Histone H2A vs. Ensembl Mouse
Match: H2ac18 (H2A clustered histone 18 [Source:MGI Symbol;Acc:MGI:96097])

HSP 1 Score: 162.925 bits (411), Expect = 7.685e-48
Identity = 95/112 (84.82%), Postives = 107/112 (95.54%), Query Frame = 2
Query:   80 SRNQSKTRSSRAGLQFPVGRIHRKLRKGNFAERVGAGAPXXXXXXXXXXXXXXXXXXGNAARDNKKSRIIPRHLQLAIRNDEELNKLLGGVTISQGGVIPNIQSALLPKKTE 415
            +R ++K+RSSRAGLQFPVGR+HR LRKGN+AERVGAGAPVY+AAVLEYL AE+LELAGNAARDNKK+RIIPRHLQLAIRNDEELNKLLG VTI+QGGV+PNIQ+ LLPKKTE
Sbjct:   11 ARAKAKSRSSRAGLQFPVGRVHRLLRKGNYAERVGAGAPVYMAAVLEYLTAEILELAGNAARDNKKTRIIPRHLQLAIRNDEELNKLLGKVTIAQGGVLPNIQAVLLPKKTE 122          
BLAST of Histone H2A vs. Ensembl Mouse
Match: H2ac19 (H2A clustered histone 19 [Source:MGI Symbol;Acc:MGI:2448283])

HSP 1 Score: 162.925 bits (411), Expect = 7.685e-48
Identity = 95/112 (84.82%), Postives = 107/112 (95.54%), Query Frame = 2
Query:   80 SRNQSKTRSSRAGLQFPVGRIHRKLRKGNFAERVGAGAPXXXXXXXXXXXXXXXXXXGNAARDNKKSRIIPRHLQLAIRNDEELNKLLGGVTISQGGVIPNIQSALLPKKTE 415
            +R ++K+RSSRAGLQFPVGR+HR LRKGN+AERVGAGAPVY+AAVLEYL AE+LELAGNAARDNKK+RIIPRHLQLAIRNDEELNKLLG VTI+QGGV+PNIQ+ LLPKKTE
Sbjct:   11 ARAKAKSRSSRAGLQFPVGRVHRLLRKGNYAERVGAGAPVYMAAVLEYLTAEILELAGNAARDNKKTRIIPRHLQLAIRNDEELNKLLGKVTIAQGGVLPNIQAVLLPKKTE 122          
BLAST of Histone H2A vs. UniProt/SwissProt
Match: sp|P06897|H2A1_XENLA (Histone H2A type 1 OS=Xenopus laevis OX=8355 PE=1 SV=2)

HSP 1 Score: 168.703 bits (426), Expect = 3.972e-49
Identity = 98/112 (87.50%), Postives = 108/112 (96.43%), Query Frame = 2
Query:   80 SRNQSKTRSSRAGLQFPVGRIHRKLRKGNFAERVGAGAPXXXXXXXXXXXXXXXXXXGNAARDNKKSRIIPRHLQLAIRNDEELNKLLGGVTISQGGVIPNIQSALLPKKTE 415
            +R ++KTRSSRAGLQFPVGR+HR LRKGN+AERVGAGAPVYLAAVLEYL AE+LELAGNAARDNKK+RIIPRHLQLA+RNDEELNKLLGGVTI+QGGV+PNIQS LLPKKTE
Sbjct:   11 TRAKAKTRSSRAGLQFPVGRVHRLLRKGNYAERVGAGAPVYLAAVLEYLTAEILELAGNAARDNKKTRIIPRHLQLAVRNDEELNKLLGGVTIAQGGVLPNIQSVLLPKKTE 122          
BLAST of Histone H2A vs. UniProt/SwissProt
Match: sp|P02264|H2A_ONCMY (Histone H2A OS=Oncorhynchus mykiss OX=8022 PE=1 SV=2)

HSP 1 Score: 167.548 bits (423), Expect = 8.562e-49
Identity = 97/113 (85.84%), Postives = 109/113 (96.46%), Query Frame = 2
Query:   80 SRNQSKTRSSRAGLQFPVGRIHRKLRKGNFAERVGAGAPXXXXXXXXXXXXXXXXXXGNAARDNKKSRIIPRHLQLAIRNDEELNKLLGGVTISQGGVIPNIQSALLPKKTEE 418
            +R ++KTRSSRAGLQFPVGR+HR LRKGN+AERVGAGAPVYLAAVLEYL AE+LELAGNAARDNKK+RIIPRHLQLA+RNDEELNKLLGGVTI+QGGV+PNIQ+ LLPKKTE+
Sbjct:   11 ARAKAKTRSSRAGLQFPVGRVHRLLRKGNYAERVGAGAPVYLAAVLEYLTAEILELAGNAARDNKKTRIIPRHLQLAVRNDEELNKLLGGVTIAQGGVLPNIQAVLLPKKTEK 123          
BLAST of Histone H2A vs. UniProt/SwissProt
Match: sp|P35061|H2A_ACRFO (Histone H2A OS=Acropora formosa OX=126732 PE=3 SV=2)

HSP 1 Score: 166.007 bits (419), Expect = 3.289e-48
Identity = 97/112 (86.61%), Postives = 108/112 (96.43%), Query Frame = 2
Query:   86 NQSKTRSSRAGLQFPVGRIHRKLRKGNFAERVGAGAPXXXXXXXXXXXXXXXXXXGNAARDNKKSRIIPRHLQLAIRNDEELNKLLGGVTISQGGVIPNIQSALLPKKTEEK 421
             +SK+RSSRAGLQFPVGRIHR LRKGN+AERVGAGAPVY+AAVLEYL+AE+LELAGNAARDNKKSRIIPRHLQLA+RNDEELNKLL GVTI+QGGV+PNIQ+ LLPKKTE+K
Sbjct:   12 TKSKSRSSRAGLQFPVGRIHRLLRKGNYAERVGAGAPVYMAAVLEYLSAEILELAGNAARDNKKSRIIPRHLQLAVRNDEELNKLLAGVTIAQGGVLPNIQAVLLPKKTEKK 123          
BLAST of Histone H2A vs. UniProt/SwissProt
Match: sp|Q64522|H2A2B_MOUSE (Histone H2A type 2-B OS=Mus musculus OX=10090 GN=H2ac21 PE=1 SV=3)

HSP 1 Score: 166.007 bits (419), Expect = 3.395e-48
Identity = 98/118 (83.05%), Postives = 111/118 (94.07%), Query Frame = 2
Query:   80 SRNQSKTRSSRAGLQFPVGRIHRKLRKGNFAERVGAGAPXXXXXXXXXXXXXXXXXXGNAARDNKKSRIIPRHLQLAIRNDEELNKLLGGVTISQGGVIPNIQSALLPKKTE-EKPAK 430
            +R ++K+RSSRAGLQFPVGR+HR LRKGN+AERVGAGAPVY+AAVLEYL AE+LELAGNAARDNKK+RIIPRHLQLA+RNDEELNKLLGGVTI+QGGV+PNIQ+ LLPKKTE  KP K
Sbjct:   11 ARAKAKSRSSRAGLQFPVGRVHRLLRKGNYAERVGAGAPVYMAAVLEYLTAEILELAGNAARDNKKTRIIPRHLQLAVRNDEELNKLLGGVTIAQGGVLPNIQAVLLPKKTESHKPGK 128          
BLAST of Histone H2A vs. UniProt/SwissProt
Match: sp|Q8IUE6|H2A2B_HUMAN (Histone H2A type 2-B OS=Homo sapiens OX=9606 GN=H2AC21 PE=1 SV=3)

HSP 1 Score: 165.622 bits (418), Expect = 4.557e-48
Identity = 99/118 (83.90%), Postives = 111/118 (94.07%), Query Frame = 2
Query:   80 SRNQSKTRSSRAGLQFPVGRIHRKLRKGNFAERVGAGAPXXXXXXXXXXXXXXXXXXGNAARDNKKSRIIPRHLQLAIRNDEELNKLLGGVTISQGGVIPNIQSALLPKKTE-EKPAK 430
            +R ++K+RSSRAGLQFPVGR+HR LRKGN+AERVGAGAPVYLAAVLEYL AE+LELAGNAARDNKK+RIIPRHLQLA+RNDEELNKLLGGVTI+QGGV+PNIQ+ LLPKKTE  KP K
Sbjct:   11 ARAKAKSRSSRAGLQFPVGRVHRLLRKGNYAERVGAGAPVYLAAVLEYLTAEILELAGNAARDNKKTRIIPRHLQLAVRNDEELNKLLGGVTIAQGGVLPNIQAVLLPKKTESHKPGK 128          
BLAST of Histone H2A vs. TrEMBL
Match: A0A3B5QU85 (Histone H2A OS=Xiphophorus maculatus OX=8083 PE=3 SV=1)

HSP 1 Score: 174.866 bits (442), Expect = 6.739e-49
Identity = 101/119 (84.87%), Postives = 114/119 (95.80%), Query Frame = 2
Query:   80 SRNQSKTRSSRAGLQFPVGRIHRKLRKGNFAERVGAGAPXXXXXXXXXXXXXXXXXXGNAARDNKKSRIIPRHLQLAIRNDEELNKLLGGVTISQGGVIPNIQSALLPKKTEEKPAKGN 436
            +R ++KTRSSRAGLQFPVGR+HR LRKGN+AERVGAGAPVYLAAVLEYL AE+LELAGNAARDNKK+RIIPRHLQLA+RNDEELNKLLGGVTI+QGGV+PNIQ+ LLPKKTE+ PAKG+
Sbjct:   11 TRAKAKTRSSRAGLQFPVGRVHRLLRKGNYAERVGAGAPVYLAAVLEYLTAEILELAGNAARDNKKTRIIPRHLQLAVRNDEELNKLLGGVTIAQGGVLPNIQAVLLPKKTEKAPAKGS 129          
BLAST of Histone H2A vs. TrEMBL
Match: A0A3B4C9W5 (Histone H2A OS=Pygocentrus nattereri OX=42514 PE=3 SV=1)

HSP 1 Score: 174.866 bits (442), Expect = 7.339e-49
Identity = 103/124 (83.06%), Postives = 117/124 (94.35%), Query Frame = 2
Query:   80 SRNQSKTRSSRAGLQFPVGRIHRKLRKGNFAERVGAGAPXXXXXXXXXXXXXXXXXXGNAARDNKKSRIIPRHLQLAIRNDEELNKLLGGVTISQGGVIPNIQSALLPKKTEEKPAKGNLLKIT 451
            +R ++KTRSSRAGLQFPVGR+HR LRKGN+AERVGAGAPVYLAAVLEYL AE+LELAGNAARDNKK+RIIPRHLQLA+RNDEELNKLLGGVTI+QGGV+PNIQ+ LLPKKT EKPAK N+ ++T
Sbjct:   11 ARAKAKTRSSRAGLQFPVGRVHRLLRKGNYAERVGAGAPVYLAAVLEYLTAEILELAGNAARDNKKTRIIPRHLQLAVRNDEELNKLLGGVTIAQGGVLPNIQAVLLPKKT-EKPAKTNMSEVT 133          
BLAST of Histone H2A vs. TrEMBL
Match: G3PT01 (Histone H2A OS=Gasterosteus aculeatus OX=69293 PE=3 SV=1)

HSP 1 Score: 173.326 bits (438), Expect = 3.285e-48
Identity = 104/133 (78.20%), Postives = 118/133 (88.72%), Query Frame = 2
Query:   80 SRNQSKTRSSRAGLQFPVGRIHRKLRKGNFAERVGAGAPXXXXXXXXXXXXXXXXXXGNAARDNKKSRIIPRHLQLAIRNDEELNKLLGGVTISQGGVIPNIQSALLPKKTEEKPAKGNLLKITSISSSVRDS 478
            +R ++KTRSSRAGLQFPVGR+HR LRKGN+A+RVGAGAPVYLAAVLEYL AE+LELAGNAARDNKK+RIIPRHLQLA+RNDEELNKLLGGVTI+QGGV+PNIQ+ LLPKKT EKPAK N  +    S +V  S
Sbjct:   14 ARAKAKTRSSRAGLQFPVGRVHRHLRKGNYAQRVGAGAPVYLAAVLEYLTAEILELAGNAARDNKKTRIIPRHLQLAVRNDEELNKLLGGVTIAQGGVLPNIQAVLLPKKT-EKPAKSNFRRPEKASRAVCSS 145          
BLAST of Histone H2A vs. TrEMBL
Match: A0A4W6D0D0 (Histone H2A OS=Lates calcarifer OX=8187 PE=3 SV=1)

HSP 1 Score: 172.17 bits (435), Expect = 6.240e-48
Identity = 102/121 (84.30%), Postives = 113/121 (93.39%), Query Frame = 2
Query:   80 SRNQSKTRSSRAGLQFPVGRIHRKLRKGNFAERVGAGAPXXXXXXXXXXXXXXXXXXGNAARDNKKSRIIPRHLQLAIRNDEELNKLLGGVTISQGGVIPNIQSALLPKKTEEKPAKGNLL 442
            +R ++KTRSSRAGLQFPVGR+HR LRKGN+AERVGAGAPVYLAAVLEYL AE+LELAGNAARDNKK+RIIPRHLQLA+RNDEELNKLLGGVTI+QGGV+PNIQ+ LLPKKT EKPAK   L
Sbjct:   11 ARAKAKTRSSRAGLQFPVGRVHRLLRKGNYAERVGAGAPVYLAAVLEYLTAEILELAGNAARDNKKTRIIPRHLQLAVRNDEELNKLLGGVTIAQGGVLPNIQAVLLPKKT-EKPAKAKCL 130          
BLAST of Histone H2A vs. TrEMBL
Match: A0A3P9JJ54 (Histone H2A OS=Oryzias latipes OX=8090 PE=3 SV=1)

HSP 1 Score: 171.785 bits (434), Expect = 8.739e-48
Identity = 102/119 (85.71%), Postives = 113/119 (94.96%), Query Frame = 2
Query:   80 SRNQSKTRSSRAGLQFPVGRIHRKLRKGNFAERVGAGAPXXXXXXXXXXXXXXXXXXGNAARDNKKSRIIPRHLQLAIRNDEELNKLLGGVTISQGGVIPNIQSALLPKKTEEKPAKGN 436
            +R ++KTRSSRAGLQFPVGR+HR LRKGN+AERVGAGAPVYLAAVLEYL AE+LELAGNAARDNKK+RIIPRHLQLA+RNDEELNKLLGGVTI+QGGV+PNIQ+ LLPKKT EKPAK N
Sbjct:   11 ARAKAKTRSSRAGLQFPVGRVHRLLRKGNYAERVGAGAPVYLAAVLEYLTAEILELAGNAARDNKKTRIIPRHLQLAVRNDEELNKLLGGVTIAQGGVLPNIQAVLLPKKT-EKPAKTN 128          
BLAST of Histone H2A vs. Ensembl Cavefish
Match: ENSAMXT00000040985.1 (pep primary_assembly:Astyanax_mexicanus-2.0:20:27523804:27524807:1 gene:ENSAMXG00000035879.1 transcript:ENSAMXT00000040985.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 168.703 bits (426), Expect = 3.768e-50
Identity = 100/117 (85.47%), Postives = 112/117 (95.73%), Query Frame = 2
Query:   80 SRNQSKTRSSRAGLQFPVGRIHRKLRKGNFAERVGAGAPXXXXXXXXXXXXXXXXXXGNAARDNKKSRIIPRHLQLAIRNDEELNKLLGGVTISQGGVIPNIQSALLPKKTEEKPAK 430
            +R ++K+RSSRAGLQFPVGR+HR LRKGN+AERVGAGAPVYLAAVLEYL AE+LELAGNAARDNKK+RIIPRHLQLA+RNDEELNKLLGGVTI+QGGV+PNIQ+ LLPKKT EKPAK
Sbjct:   13 ARAKAKSRSSRAGLQFPVGRVHRLLRKGNYAERVGAGAPVYLAAVLEYLTAEILELAGNAARDNKKTRIIPRHLQLAVRNDEELNKLLGGVTIAQGGVLPNIQAVLLPKKT-EKPAK 128          
BLAST of Histone H2A vs. Ensembl Cavefish
Match: ENSAMXT00000025817.2 (pep primary_assembly:Astyanax_mexicanus-2.0:APWO02000522.1:47764:48404:-1 gene:ENSAMXG00000025091.2 transcript:ENSAMXT00000025817.2 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 167.162 bits (422), Expect = 1.304e-49
Identity = 97/113 (85.84%), Postives = 109/113 (96.46%), Query Frame = 2
Query:   80 SRNQSKTRSSRAGLQFPVGRIHRKLRKGNFAERVGAGAPXXXXXXXXXXXXXXXXXXGNAARDNKKSRIIPRHLQLAIRNDEELNKLLGGVTISQGGVIPNIQSALLPKKTEE 418
            +R ++KTRSSRAGLQFPVGR+HR LRKGN+AERVGAGAPVYLAAVLEYL AE+LELAGNAARDNKK+RIIPRHLQLA+RNDEELNKLLGGVTI+QGGV+PNIQ+ LLPKKTE+
Sbjct:   13 ARAKAKTRSSRAGLQFPVGRVHRLLRKGNYAERVGAGAPVYLAAVLEYLTAEILELAGNAARDNKKTRIIPRHLQLAVRNDEELNKLLGGVTIAQGGVLPNIQAVLLPKKTEK 125          
BLAST of Histone H2A vs. Ensembl Cavefish
Match: ENSAMXT00000050088.1 (pep primary_assembly:Astyanax_mexicanus-2.0:21:10166233:10171033:1 gene:ENSAMXG00000038836.1 transcript:ENSAMXT00000050088.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 167.162 bits (422), Expect = 1.593e-49
Identity = 97/113 (85.84%), Postives = 109/113 (96.46%), Query Frame = 2
Query:   80 SRNQSKTRSSRAGLQFPVGRIHRKLRKGNFAERVGAGAPXXXXXXXXXXXXXXXXXXGNAARDNKKSRIIPRHLQLAIRNDEELNKLLGGVTISQGGVIPNIQSALLPKKTEE 418
            +R ++KTRSSRAGLQFPVGR+HR LRKGN+AERVGAGAPVYLAAVLEYL AE+LELAGNAARDNKK+RIIPRHLQLA+RNDEELNKLLGGVTI+QGGV+PNIQ+ LLPKKTE+
Sbjct:   14 ARAKAKTRSSRAGLQFPVGRVHRLLRKGNYAERVGAGAPVYLAAVLEYLTAEILELAGNAARDNKKTRIIPRHLQLAVRNDEELNKLLGGVTIAQGGVLPNIQAVLLPKKTEK 126          
BLAST of Histone H2A vs. Ensembl Cavefish
Match: ENSAMXT00000026274.2 (pep primary_assembly:Astyanax_mexicanus-2.0:21:10145526:10150789:1 gene:ENSAMXG00000025549.2 transcript:ENSAMXT00000026274.2 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 167.162 bits (422), Expect = 1.827e-49
Identity = 97/113 (85.84%), Postives = 109/113 (96.46%), Query Frame = 2
Query:   80 SRNQSKTRSSRAGLQFPVGRIHRKLRKGNFAERVGAGAPXXXXXXXXXXXXXXXXXXGNAARDNKKSRIIPRHLQLAIRNDEELNKLLGGVTISQGGVIPNIQSALLPKKTEE 418
            +R ++KTRSSRAGLQFPVGR+HR LRKGN+AERVGAGAPVYLAAVLEYL AE+LELAGNAARDNKK+RIIPRHLQLA+RNDEELNKLLGGVTI+QGGV+PNIQ+ LLPKKTE+
Sbjct:   11 ARAKAKTRSSRAGLQFPVGRVHRLLRKGNYAERVGAGAPVYLAAVLEYLTAEILELAGNAARDNKKTRIIPRHLQLAVRNDEELNKLLGGVTIAQGGVLPNIQAVLLPKKTEK 123          
BLAST of Histone H2A vs. Ensembl Cavefish
Match: h2ax (H2A.X variant histone [Source:NCBI gene;Acc:394048])

HSP 1 Score: 162.155 bits (409), Expect = 1.169e-47
Identity = 96/111 (86.49%), Postives = 106/111 (95.50%), Query Frame = 2
Query:   80 SRNQSKTRSSRAGLQFPVGRIHRKLRKGNFAERVGAGAPXXXXXXXXXXXXXXXXXXGNAARDNKKSRIIPRHLQLAIRNDEELNKLLGGVTISQGGVIPNIQSALLPKKT 412
            +R +SKTRSSRAGLQFPVGR+HR LRKGN+AERVGAGAPVYLAAVLEYL AE+LELAGNAARDNKK+RIIPRHLQLA+RNDEELNKLLG VTI+QGGV+PNIQ+ LLPKKT
Sbjct:   11 ARAKSKTRSSRAGLQFPVGRVHRLLRKGNYAERVGAGAPVYLAAVLEYLTAEILELAGNAARDNKKTRIIPRHLQLAVRNDEELNKLLGRVTIAQGGVLPNIQAVLLPKKT 121          
BLAST of Histone H2A vs. Ensembl Sea Lamprey
Match: ENSPMAT00000011253.1 (pep scaffold:Pmarinus_7.0:GL479154:926813:927238:-1 gene:ENSPMAG00000010226.1 transcript:ENSPMAT00000011253.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 165.236 bits (417), Expect = 2.483e-49
Identity = 97/118 (82.20%), Postives = 111/118 (94.07%), Query Frame = 2
Query:   80 SRNQSKTRSSRAGLQFPVGRIHRKLRKGNFAERVGAGAPXXXXXXXXXXXXXXXXXXGNAARDNKKSRIIPRHLQLAIRNDEELNKLLGGVTISQGGVIPNIQSALLPKKTEEKPAKG 433
            +R ++K+RSSRAGLQFPVGR+HR LRKGN+AERVGAGAPVYLAAVLEYL+AE+LELAGNAARDNKK+RIIPRHLQLAIRNDEELNKLLGGVTI+QGGV+PNIQ+ LLPKKT +  + G
Sbjct:   11 ARAKAKSRSSRAGLQFPVGRVHRLLRKGNYAERVGAGAPVYLAAVLEYLSAEILELAGNAARDNKKTRIIPRHLQLAIRNDEELNKLLGGVTIAQGGVLPNIQAVLLPKKTGQAASSG 128          
BLAST of Histone H2A vs. Ensembl Sea Lamprey
Match: ENSPMAT00000005338.1 (pep scaffold:Pmarinus_7.0:GL476820:708214:709027:-1 gene:ENSPMAG00000004859.1 transcript:ENSPMAT00000005338.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 162.925 bits (411), Expect = 1.162e-48
Identity = 94/113 (83.19%), Postives = 109/113 (96.46%), Query Frame = 2
Query:   80 SRNQSKTRSSRAGLQFPVGRIHRKLRKGNFAERVGAGAPXXXXXXXXXXXXXXXXXXGNAARDNKKSRIIPRHLQLAIRNDEELNKLLGGVTISQGGVIPNIQSALLPKKTEE 418
            SR ++K+RSSRAGLQFPVGR+HR LRKGN+A+RVGAGAPVYLAAVLEYL+AE+LELAGNAARDNKK+RIIPRHLQLA+RNDEELNKL+GGVTI+QGGV+PNIQ+ LLPKKT +
Sbjct:   11 SRAKAKSRSSRAGLQFPVGRVHRLLRKGNYAQRVGAGAPVYLAAVLEYLSAEILELAGNAARDNKKTRIIPRHLQLAVRNDEELNKLMGGVTIAQGGVLPNIQAVLLPKKTSQ 123          
BLAST of Histone H2A vs. Ensembl Sea Lamprey
Match: ENSPMAT00000002388.1 (pep scaffold:Pmarinus_7.0:GL476925:193851:194294:1 gene:ENSPMAG00000002177.1 transcript:ENSPMAT00000002388.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 162.54 bits (410), Expect = 1.575e-48
Identity = 94/113 (83.19%), Postives = 109/113 (96.46%), Query Frame = 2
Query:   80 SRNQSKTRSSRAGLQFPVGRIHRKLRKGNFAERVGAGAPXXXXXXXXXXXXXXXXXXGNAARDNKKSRIIPRHLQLAIRNDEELNKLLGGVTISQGGVIPNIQSALLPKKTEE 418
            SR ++K+RSSRAGLQFPVGR+HR LRKGN+A+RVGAGAPVYLAAVLEYL+AE+LELAGNAARDNKK+RIIPRHLQLA+RNDEELNKL+GGVTI+QGGV+PNIQ+ LLPKKT +
Sbjct:   11 SRAKAKSRSSRAGLQFPVGRVHRLLRKGNYAQRVGAGAPVYLAAVLEYLSAEILELAGNAARDNKKTRIIPRHLQLAVRNDEELNKLMGGVTIAQGGVLPNIQAVLLPKKTSQ 123          
BLAST of Histone H2A vs. Ensembl Sea Lamprey
Match: ENSPMAT00000011166.1 (pep scaffold:Pmarinus_7.0:GL476820:1027708:1028088:1 gene:ENSPMAG00000010139.1 transcript:ENSPMAT00000011166.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 160.614 bits (405), Expect = 8.793e-48
Identity = 93/113 (82.30%), Postives = 108/113 (95.58%), Query Frame = 2
Query:   80 SRNQSKTRSSRAGLQFPVGRIHRKLRKGNFAERVGAGAPXXXXXXXXXXXXXXXXXXGNAARDNKKSRIIPRHLQLAIRNDEELNKLLGGVTISQGGVIPNIQSALLPKKTEE 418
            SR ++K+RSSRAGLQFPVGR+HR L KGN+A+RVGAGAPVYLAAVLEYL+AE+LELAGNAARDNKK+RIIPRHLQLA+RNDEELNKL+GGVTI+QGGV+PNIQ+ LLPKKT +
Sbjct:   11 SRAKAKSRSSRAGLQFPVGRVHRLLCKGNYAQRVGAGAPVYLAAVLEYLSAEILELAGNAARDNKKTRIIPRHLQLAVRNDEELNKLMGGVTIAQGGVLPNIQAVLLPKKTSQ 123          
BLAST of Histone H2A vs. Ensembl Sea Lamprey
Match: ENSPMAT00000008684.1 (pep scaffold:Pmarinus_7.0:GL488596:2418:2939:-1 gene:ENSPMAG00000007861.1 transcript:ENSPMAT00000008684.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 159.844 bits (403), Expect = 2.584e-47
Identity = 96/127 (75.59%), Postives = 114/127 (89.76%), Query Frame = 2
Query:   80 SRNQSKTRSSRAGLQFPVGRIHRKLRKGNFAERVGAGAPXXXXXXXXXXXXXXXXXXGNAARDNKKSRIIPRHLQLAIRNDEELNKLLGGVTISQGGVIPNIQSALLPKKTEEKPAKGNLLKITSIS 460
            SR ++K+ SSRAGLQFPVGRIHR LRKGN+A+RVGAGAPVYLAAVLEYL+AE+LELAGNAARDNKK+RIIPR+LQLA+RNDEELNKL+GGVTI+QGGV+PNIQ+ LLPKKT +     + L+ +S S
Sbjct:   11 SRAKAKSHSSRAGLQFPVGRIHRLLRKGNYAQRVGAGAPVYLAAVLEYLSAEILELAGNAARDNKKTRIIPRNLQLAVRNDEELNKLMGGVTIAQGGVLPNIQAVLLPKKTSQAKKATHFLEKSSDS 137          
BLAST of Histone H2A vs. Ensembl Yeast
Match: HTA1 (Histone H2A; core histone protein required for chromatin assembly and chromosome function; one of two nearly identical subtypes (see also HTA2); DNA damage-dependent phosphorylation by Mec1p facilitates DNA repair; acetylated by Nat4p; N-terminally propionylated in vivo [Source:SGD;Acc:S000002633])

HSP 1 Score: 143.665 bits (361), Expect = 1.685e-41
Identity = 83/106 (78.30%), Postives = 99/106 (93.40%), Query Frame = 2
Query:   95 KTRSSRAGLQFPVGRIHRKLRKGNFAERVGAGAPXXXXXXXXXXXXXXXXXXGNAARDNKKSRIIPRHLQLAIRNDEELNKLLGGVTISQGGVIPNIQSALLPKKT 412
            ++RS++AGL FPVGR+HR LR+GN+A+R+G+GAPVYL AVLEYLAAE+LELAGNAARDNKK+RIIPRHLQLAIRND+ELNKLLG VTI+QGGV+PNI   LLPKK+
Sbjct:   17 QSRSAKAGLTFPVGRVHRLLRRGNYAQRIGSGAPVYLTAVLEYLAAEILELAGNAARDNKKTRIIPRHLQLAIRNDDELNKLLGNVTIAQGGVLPNIHQNLLPKKS 122          
BLAST of Histone H2A vs. Ensembl Yeast
Match: HTA2 (Histone H2A; core histone protein required for chromatin assembly and chromosome function; one of two nearly identical (see also HTA1) subtypes; DNA damage-dependent phosphorylation by Mec1p facilitates DNA repair; acetylated by Nat4p [Source:SGD;Acc:S000000099])

HSP 1 Score: 143.28 bits (360), Expect = 1.927e-41
Identity = 83/106 (78.30%), Postives = 99/106 (93.40%), Query Frame = 2
Query:   95 KTRSSRAGLQFPVGRIHRKLRKGNFAERVGAGAPXXXXXXXXXXXXXXXXXXGNAARDNKKSRIIPRHLQLAIRNDEELNKLLGGVTISQGGVIPNIQSALLPKKT 412
            ++RS++AGL FPVGR+HR LR+GN+A+R+G+GAPVYL AVLEYLAAE+LELAGNAARDNKK+RIIPRHLQLAIRND+ELNKLLG VTI+QGGV+PNI   LLPKK+
Sbjct:   17 QSRSAKAGLTFPVGRVHRLLRRGNYAQRIGSGAPVYLTAVLEYLAAEILELAGNAARDNKKTRIIPRHLQLAIRNDDELNKLLGNVTIAQGGVLPNIHQNLLPKKS 122          
BLAST of Histone H2A vs. Ensembl Yeast
Match: HTZ1 (Histone variant H2AZ; exchanged for histone H2A in nucleosomes by the SWR1 complex; involved in transcriptional regulation through prevention of the spread of silent heterochromatin; Htz1p-containing nucleosomes facilitate RNA Pol II passage by affecting correct assembly and modification status of RNA Pol II elongation complexes and by favoring efficient nucleosome remodeling [Source:SGD;Acc:S000005372])

HSP 1 Score: 83.5741 bits (205), Expect = 8.974e-20
Identity = 68/109 (62.39%), Postives = 80/109 (73.39%), Query Frame = 2
Query:  107 SRAGLQFPVGRIHRKL-RKGNFAERVGAGAPXXXXXXXXXXXXXXXXXXGNAARDNKKSRIIPRHLQLAIRNDEELNKLLGGVTISQGGVIPNIQSALLPKKTEEKPAK 430
            +RAGLQFPVGRI R L R      RVG+ A +YL AVLEYL AEVLELAGNAA+D K  RI PRHLQLAIR D+EL+ L+   TI+ GGV+P+I  ALL  K E+K +K
Sbjct:   27 ARAGLQFPVGRIKRYLKRHATGRTRVGSKAAIYLTAVLEYLTAEVLELAGNAAKDLKVKRITPRHLQLAIRGDDELDSLI-RATIASGGVLPHINKALLL-KVEKKGSK 133          
BLAST of Histone H2A vs. Ensembl Yeast
Match: CMD1 (Calmodulin; Ca2+ binding protein that regulates Ca2+ independent processes (mitosis, bud growth, actin organization, endocytosis, etc.) and Ca2+ dependent processes (stress-activated pathways), targets include Nuf1p, Myo2p and calcineurin; binds to the Hog1p MAPK in response to hyperosmotic stress; potentiates membrane tubulation and constriction mediated by the Rvs161p-Rvs167p complex; human CALM1 or CALM2 functionally complement repression induced inviability [Source:SGD;Acc:S000000313])

HSP 1 Score: 53.1434 bits (126), Expect = 6.163e-9
Identity = 24/76 (31.58%), Postives = 47/76 (61.84%), Query Frame = -1
Query:  439 IIEDVDTDGNGTVDFDEFINIMRKYPPTDETEDDLTNALITFSENK-QTVSASKFRTFLTNYGESLTDEEIDVIFK 663
            ++ ++D DGN  ++F EF+ +M +   ++++E +L  A   F +N    +SA++ +  LT+ GE LTD E+D + +
Sbjct:   52 LMNEIDVDGNHQIEFSEFLALMSRQLKSNDSEQELLEAFKVFDKNGDGLISAAELKHVLTSIGEKLTDAEVDDMLR 127          
BLAST of Histone H2A vs. Ensembl Nematostella
Match: EDO27651 (Histone H2A [Source:UniProtKB/TrEMBL;Acc:A7T8N1])

HSP 1 Score: 167.162 bits (422), Expect = 4.241e-50
Identity = 97/113 (85.84%), Postives = 109/113 (96.46%), Query Frame = 2
Query:   86 NQSKTRSSRAGLQFPVGRIHRKLRKGNFAERVGAGAPXXXXXXXXXXXXXXXXXXGNAARDNKKSRIIPRHLQLAIRNDEELNKLLGGVTISQGGVIPNIQSALLPKKTEEKP 424
             +SKTRSSRAGLQFPVGRIHR LRKGN+AERVGAGAPVY+AAVLEYL+AE+LELAGNAARDNKK+RIIPRHLQLA+RNDEELN+LL GVTI+QGGV+PNIQ+ LLPKKTE+KP
Sbjct:   12 TKSKTRSSRAGLQFPVGRIHRHLRKGNYAERVGAGAPVYMAAVLEYLSAEILELAGNAARDNKKTRIIPRHLQLAVRNDEELNRLLHGVTIAQGGVLPNIQAVLLPKKTEKKP 124          
BLAST of Histone H2A vs. Ensembl Nematostella
Match: EDO48283 (Histone H2A [Source:UniProtKB/TrEMBL;Acc:A7RJL4])

HSP 1 Score: 166.777 bits (421), Expect = 7.483e-50
Identity = 97/112 (86.61%), Postives = 108/112 (96.43%), Query Frame = 2
Query:   86 NQSKTRSSRAGLQFPVGRIHRKLRKGNFAERVGAGAPXXXXXXXXXXXXXXXXXXGNAARDNKKSRIIPRHLQLAIRNDEELNKLLGGVTISQGGVIPNIQSALLPKKTEEK 421
             +SKTRSSRAGLQFPVGRIHR LRKGN+AERVGAGAPVY+AAVLEYL+AE+LELAGNAARDNKK+RIIPRHLQLA+RNDEELN+LL GVTI+QGGV+PNIQS LLPKKTE+K
Sbjct:   12 TKSKTRSSRAGLQFPVGRIHRLLRKGNYAERVGAGAPVYMAAVLEYLSAEILELAGNAARDNKKTRIIPRHLQLAVRNDEELNRLLSGVTIAQGGVLPNIQSVLLPKKTEKK 123          
BLAST of Histone H2A vs. Ensembl Nematostella
Match: EDO30157 (Histone H2A [Source:UniProtKB/TrEMBL;Acc:A7T1L1])

HSP 1 Score: 164.851 bits (416), Expect = 2.257e-49
Identity = 97/112 (86.61%), Postives = 108/112 (96.43%), Query Frame = 2
Query:   86 NQSKTRSSRAGLQFPVGRIHRKLRKGNFAERVGAGAPXXXXXXXXXXXXXXXXXXGNAARDNKKSRIIPRHLQLAIRNDEELNKLLGGVTISQGGVIPNIQSALLPKKTEEK 421
             +SKTRSSRAGLQFPVGRIHR LRKGN+AERVGAGAPVYLAAVLEYL+AE+LELAGNAARDNKK+RIIPRHLQLA+RNDEELN+LL GVTI+QGGV+PNIQ+ LLPKKTE+K
Sbjct:    5 TKSKTRSSRAGLQFPVGRIHRHLRKGNYAERVGAGAPVYLAAVLEYLSAEILELAGNAARDNKKTRIIPRHLQLAVRNDEELNRLLHGVTIAQGGVLPNIQAVLLPKKTEKK 116          
BLAST of Histone H2A vs. Ensembl Nematostella
Match: EDO26088 (Histone H2A [Source:UniProtKB/TrEMBL;Acc:A7TCX1])

HSP 1 Score: 165.236 bits (417), Expect = 2.587e-49
Identity = 97/112 (86.61%), Postives = 109/112 (97.32%), Query Frame = 2
Query:   86 NQSKTRSSRAGLQFPVGRIHRKLRKGNFAERVGAGAPXXXXXXXXXXXXXXXXXXGNAARDNKKSRIIPRHLQLAIRNDEELNKLLGGVTISQGGVIPNIQSALLPKKTEEK 421
             +SKTRSSRAGLQFPVGRIHR LRKGN+AERVGAGAPVYLAAVLEYL+AE+LELAGNAARDNKK+RIIPRHLQLA+RNDEELN+LL GVTI+QGGV+PNIQ++LLPKKTE+K
Sbjct:   12 TKSKTRSSRAGLQFPVGRIHRHLRKGNYAERVGAGAPVYLAAVLEYLSAEILELAGNAARDNKKTRIIPRHLQLAVRNDEELNRLLHGVTIAQGGVLPNIQASLLPKKTEKK 123          
BLAST of Histone H2A vs. Ensembl Nematostella
Match: EDO48304 (Histone H2A [Source:UniProtKB/TrEMBL;Acc:A7RJM1])

HSP 1 Score: 164.851 bits (416), Expect = 3.192e-49
Identity = 96/112 (85.71%), Postives = 108/112 (96.43%), Query Frame = 2
Query:   86 NQSKTRSSRAGLQFPVGRIHRKLRKGNFAERVGAGAPXXXXXXXXXXXXXXXXXXGNAARDNKKSRIIPRHLQLAIRNDEELNKLLGGVTISQGGVIPNIQSALLPKKTEEK 421
             +SKTRSSRAGLQFPVGRIHR LRKGN+AERVGAGAPVY+AAVLEYL+AE+LELAGNAARDNKK+RIIPRHLQLA+RNDEELN+LL GVTI+QGGV+PNIQ+ LLPKKTE+K
Sbjct:   12 TKSKTRSSRAGLQFPVGRIHRHLRKGNYAERVGAGAPVYMAAVLEYLSAEILELAGNAARDNKKTRIIPRHLQLAVRNDEELNRLLHGVTIAQGGVLPNIQAVLLPKKTEKK 123          
BLAST of Histone H2A vs. Ensembl Medaka
Match: ENSORLT00000043619.1 (pep primary_assembly:ASM223467v1:1:2176285:2181192:1 gene:ENSORLG00000022228.1 transcript:ENSORLT00000043619.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 171.014 bits (432), Expect = 4.855e-51
Identity = 102/119 (85.71%), Postives = 113/119 (94.96%), Query Frame = 2
Query:   80 SRNQSKTRSSRAGLQFPVGRIHRKLRKGNFAERVGAGAPXXXXXXXXXXXXXXXXXXGNAARDNKKSRIIPRHLQLAIRNDEELNKLLGGVTISQGGVIPNIQSALLPKKTEEKPAKGN 436
            +R ++KTRSSRAGLQFPVGR+HR LRKGN+AERVGAGAPVYLAAVLEYL AE+LELAGNAARDNKK+RIIPRHLQLA+RNDEELNKLLGGVTI+QGGV+PNIQ+ LLPKKT EKPAK N
Sbjct:   11 ARAKAKTRSSRAGLQFPVGRVHRLLRKGNYAERVGAGAPVYLAAVLEYLTAEILELAGNAARDNKKTRIIPRHLQLAVRNDEELNKLLGGVTIAQGGVLPNIQAVLLPKKT-EKPAKTN 128          
BLAST of Histone H2A vs. Ensembl Medaka
Match: ENSORLT00000034627.1 (pep primary_assembly:ASM223467v1:1:1239146:1240518:-1 gene:ENSORLG00000022956.1 transcript:ENSORLT00000034627.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 169.859 bits (429), Expect = 1.911e-50
Identity = 101/117 (86.32%), Postives = 112/117 (95.73%), Query Frame = 2
Query:   80 SRNQSKTRSSRAGLQFPVGRIHRKLRKGNFAERVGAGAPXXXXXXXXXXXXXXXXXXGNAARDNKKSRIIPRHLQLAIRNDEELNKLLGGVTISQGGVIPNIQSALLPKKTEEKPAK 430
            +R ++KTRSSRAGLQFPVGR+HR LRKGN+AERVGAGAPVYLAAVLEYL AE+LELAGNAARDNKK+RIIPRHLQLA+RNDEELNKLLGGVTI+QGGV+PNIQ+ LLPKKT EKPAK
Sbjct:   11 ARAKAKTRSSRAGLQFPVGRVHRLLRKGNYAERVGAGAPVYLAAVLEYLTAEILELAGNAARDNKKTRIIPRHLQLAVRNDEELNKLLGGVTIAQGGVLPNIQAVLLPKKT-EKPAK 126          
BLAST of Histone H2A vs. Ensembl Medaka
Match: ENSORLT00000001657.2 (pep primary_assembly:ASM223467v1:1:2123146:2150212:1 gene:ENSORLG00000028923.1 transcript:ENSORLT00000001657.2 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 169.474 bits (428), Expect = 1.929e-50
Identity = 101/118 (85.59%), Postives = 113/118 (95.76%), Query Frame = 2
Query:   80 SRNQSKTRSSRAGLQFPVGRIHRKLRKGNFAERVGAGAPXXXXXXXXXXXXXXXXXXGNAARDNKKSRIIPRHLQLAIRNDEELNKLLGGVTISQGGVIPNIQSALLPKKTEE-KPAK 430
            +R ++KTRSSRAGLQFPVGR+HR LRKGN+AERVGAGAPVYLAAVLEYL AE+LELAGNAARDNKK+RIIPRHLQLA+RNDEELNKLLGGVTI+QGGV+PNIQ+ LLPKKTE+ KPAK
Sbjct:   11 ARAKAKTRSSRAGLQFPVGRVHRLLRKGNYAERVGAGAPVYLAAVLEYLTAEILELAGNAARDNKKTRIIPRHLQLAVRNDEELNKLLGGVTIAQGGVLPNIQAVLLPKKTEKPKPAK 128          
BLAST of Histone H2A vs. Ensembl Medaka
Match: ENSORLT00000027984.1 (pep primary_assembly:ASM223467v1:1:8921530:8926502:-1 gene:ENSORLG00000030081.1 transcript:ENSORLT00000027984.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 169.088 bits (427), Expect = 2.911e-50
Identity = 101/117 (86.32%), Postives = 112/117 (95.73%), Query Frame = 2
Query:   80 SRNQSKTRSSRAGLQFPVGRIHRKLRKGNFAERVGAGAPXXXXXXXXXXXXXXXXXXGNAARDNKKSRIIPRHLQLAIRNDEELNKLLGGVTISQGGVIPNIQSALLPKKTEEKPAK 430
            +R ++KTRSSRAGLQFPVGR+HR LRKGN+AERVGAGAPVYLAAVLEYL AE+LELAGNAARDNKK+RIIPRHLQLA+RNDEELNKLLGGVTI+QGGV+PNIQ+ LLPKKT EKPAK
Sbjct:   11 ARAKAKTRSSRAGLQFPVGRVHRLLRKGNYAERVGAGAPVYLAAVLEYLTAEILELAGNAARDNKKTRIIPRHLQLAVRNDEELNKLLGGVTIAQGGVLPNIQAVLLPKKT-EKPAK 126          
BLAST of Histone H2A vs. Ensembl Medaka
Match: ENSORLT00000042228.1 (pep primary_assembly:ASM223467v1:23:22958305:22963215:1 gene:ENSORLG00000027073.1 transcript:ENSORLT00000042228.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 169.088 bits (427), Expect = 4.078e-50
Identity = 100/117 (85.47%), Postives = 111/117 (94.87%), Query Frame = 2
Query:   80 SRNQSKTRSSRAGLQFPVGRIHRKLRKGNFAERVGAGAPXXXXXXXXXXXXXXXXXXGNAARDNKKSRIIPRHLQLAIRNDEELNKLLGGVTISQGGVIPNIQSALLPKKTEEKPAK 430
            +R ++KTRSSRAGLQFPVGR+HR LRKGN+AERVGAGAPVYLAAVLEYL AE+LELAGNAARDNKK+RIIPRHLQLA+RNDEELNKLLGGVTI+QGGV+PNIQ+ LLPKKT EKP K
Sbjct:   11 ARAKAKTRSSRAGLQFPVGRVHRLLRKGNYAERVGAGAPVYLAAVLEYLTAEILELAGNAARDNKKTRIIPRHLQLAVRNDEELNKLLGGVTIAQGGVLPNIQAVLLPKKT-EKPVK 126          
BLAST of Histone H2A vs. Planmine SMEST
Match: SMESG000067932.1 (SMESG000067932.1)

HSP 1 Score: 196.823 bits (499), Expect = 4.624e-61
Identity = 128/128 (100.00%), Postives = 128/128 (100.00%), Query Frame = 2
Query:   47 MSXXXXXXXXTSRNQSKTRSSRAGLQFPVGRIHRKLRKGNFAERVGAGAPXXXXXXXXXXXXXXXXXXGNAARDNKKSRIIPRHLQLAIRNDEELNKLLGGVTISQGGVIPNIQSALLPKKTEEKPAK 430
            MSGKAGKAGKTSRNQSKTRSSRAGLQFPVGRIHRKLRKGNFAERVGAGAPVYLAAVLEYLAAEVLELAGNAARDNKKSRIIPRHLQLAIRNDEELNKLLGGVTISQGGVIPNIQSALLPKKTEEKPAK
Sbjct:    1 MSGKAGKAGKTSRNQSKTRSSRAGLQFPVGRIHRKLRKGNFAERVGAGAPVYLAAVLEYLAAEVLELAGNAARDNKKSRIIPRHLQLAIRNDEELNKLLGGVTISQGGVIPNIQSALLPKKTEEKPAK 128          
BLAST of Histone H2A vs. Planmine SMEST
Match: SMESG000006040.1 (SMESG000006040.1)

HSP 1 Score: 175.637 bits (444), Expect = 4.996e-53
Identity = 106/115 (92.17%), Postives = 112/115 (97.39%), Query Frame = 2
Query:   77 TSRNQSKTRSSRAGLQFPVGRIHRKLRKGNFAERVGAGAPXXXXXXXXXXXXXXXXXXGNAARDNKKSRIIPRHLQLAIRNDEELNKLLGGVTISQGGVIPNIQSALLPKKTEEK 421
            T+++QSKTRSSRAGLQFPVGRIHRKLRKGNFAERVGAGAPVYLAAVLEYLAAEVLELAGNAARDNKKSRIIPRHLQLAIRNDEELNKLLG VTI+QGGV+PNIQ +LLPKK EEK
Sbjct:   10 TTKSQSKTRSSRAGLQFPVGRIHRKLRKGNFAERVGAGAPVYLAAVLEYLAAEVLELAGNAARDNKKSRIIPRHLQLAIRNDEELNKLLGKVTIAQGGVLPNIQISLLPKKAEEK 124          
BLAST of Histone H2A vs. Planmine SMEST
Match: SMESG000006040.1 (SMESG000006040.1)

HSP 1 Score: 175.637 bits (444), Expect = 8.218e-53
Identity = 106/115 (92.17%), Postives = 112/115 (97.39%), Query Frame = 2
Query:   77 TSRNQSKTRSSRAGLQFPVGRIHRKLRKGNFAERVGAGAPXXXXXXXXXXXXXXXXXXGNAARDNKKSRIIPRHLQLAIRNDEELNKLLGGVTISQGGVIPNIQSALLPKKTEEK 421
            T+++QSKTRSSRAGLQFPVGRIHRKLRKGNFAERVGAGAPVYLAAVLEYLAAEVLELAGNAARDNKKSRIIPRHLQLAIRNDEELNKLLG VTI+QGGV+PNIQ +LLPKK EEK
Sbjct:   10 TTKSQSKTRSSRAGLQFPVGRIHRKLRKGNFAERVGAGAPVYLAAVLEYLAAEVLELAGNAARDNKKSRIIPRHLQLAIRNDEELNKLLGKVTIAQGGVLPNIQISLLPKKAEEK 124          
BLAST of Histone H2A vs. Planmine SMEST
Match: SMESG000018807.1 (SMESG000018807.1)

HSP 1 Score: 165.622 bits (418), Expect = 3.959e-49
Identity = 100/111 (90.09%), Postives = 107/111 (96.40%), Query Frame = 2
Query:   80 SRNQSKTRSSRAGLQFPVGRIHRKLRKGNFAERVGAGAPXXXXXXXXXXXXXXXXXXGNAARDNKKSRIIPRHLQLAIRNDEELNKLLGGVTISQGGVIPNIQSALLPKKT 412
            SRN++K+RS RAGLQFPVGRIHR LRKGN+AERVGAGAPVYLAAVLEYLAAEVLELAGNAARDNKK+RIIPRHLQLAIRNDEELNKLLG VTI+QGGV+PNIQS LLPKKT
Sbjct:   10 SRNKAKSRSVRAGLQFPVGRIHRMLRKGNYAERVGAGAPVYLAAVLEYLAAEVLELAGNAARDNKKTRIIPRHLQLAIRNDEELNKLLGSVTIAQGGVLPNIQSVLLPKKT 120          
BLAST of Histone H2A vs. Planmine SMEST
Match: SMESG000067933.1 (SMESG000067933.1)

HSP 1 Score: 161.384 bits (407), Expect = 2.883e-47
Identity = 80/80 (100.00%), Postives = 80/80 (100.00%), Query Frame = -1
Query:  427 KIIEDVDTDGNGTVDFDEFINIMRKYPPTDETEDDLTNALITFSENKQTVSASKFRTFLTNYGESLTDEEIDVIFKRFPL 666
            KIIEDVDTDGNGTVDFDEFINIMRKYPPTDETEDDLTNALITFSENKQTVSASKFRTFLTNYGESLTDEEIDVIFKRFPL
Sbjct:   54 KIIEDVDTDGNGTVDFDEFINIMRKYPPTDETEDDLTNALITFSENKQTVSASKFRTFLTNYGESLTDEEIDVIFKRFPL 133          
The following BLAST results are available for this feature:
BLAST of Histone H2A vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
H2AC219.490e-4983.90H2A clustered histone 21 [Source:HGNC Symbol;Acc:H... [more]
H2AC201.221e-4882.91H2A clustered histone 20 [Source:HGNC Symbol;Acc:H... [more]
H2AC11.674e-4886.61H2A clustered histone 1 [Source:HGNC Symbol;Acc:HG... [more]
H2AC142.771e-4886.61H2A clustered histone 14 [Source:HGNC Symbol;Acc:H... [more]
H2AC122.982e-4886.61H2A clustered histone 12 [Source:HGNC Symbol;Acc:H... [more]
back to top
BLAST of Histone H2A vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
his-352.204e-4487.62Histone H2A [Source:UniProtKB/TrEMBL;Acc:Q27485][more]
his-352.204e-4487.62Histone H2A [Source:UniProtKB/TrEMBL;Acc:Q27485][more]
his-572.620e-4487.62Histone H2A [Source:UniProtKB/Swiss-Prot;Acc:P095... [more]
his-683.013e-4487.62Histone H2A [Source:UniProtKB/Swiss-Prot;Acc:P095... [more]
his-653.013e-4487.62Histone H2A [Source:UniProtKB/Swiss-Prot;Acc:P095... [more]
back to top
BLAST of Histone H2A vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
His2A:CG338501.908e-4788.89gene:FBgn0053850 transcript:FBtr0091854[more]
His2A:CG338471.908e-4788.89gene:FBgn0053847 transcript:FBtr0091851[more]
His2A:CG338441.908e-4788.89gene:FBgn0053844 transcript:FBtr0091848[more]
His2A:CG338321.908e-4788.89gene:FBgn0053832 transcript:FBtr0091836[more]
His2A:CG338261.908e-4788.89gene:FBgn0053826 transcript:FBtr0091830[more]
back to top
BLAST of Histone H2A vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
si:ch211-113a14.194.044e-5085.59si:ch211-113a14.19 [Source:ZFIN;Acc:ZDB-GENE-12121... [more]
si:ch211-113a14.194.044e-5085.59si:ch211-113a14.19 [Source:ZFIN;Acc:ZDB-GENE-12121... [more]
si:ch211-113a14.194.044e-5085.59si:ch211-113a14.19 [Source:ZFIN;Acc:ZDB-GENE-12121... [more]
si:ch211-113a14.194.044e-5085.59si:ch211-113a14.19 [Source:ZFIN;Acc:ZDB-GENE-12121... [more]
si:ch211-113a14.194.044e-5085.59si:ch211-113a14.19 [Source:ZFIN;Acc:ZDB-GENE-12121... [more]
back to top
BLAST of Histone H2A vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ENSXETT00000000447.11.294e-5081.25pep primary_assembly:Xenopus_tropicalis_v9.1:3:124... [more]
ENSXETT00000016361.13.032e-5086.44histone H2A type 1-like [Source:NCBI gene;Acc:1017... [more]
ENSXETT00000018917.13.666e-5086.44pep primary_assembly:Xenopus_tropicalis_v9.1:6:520... [more]
h2ac144.338e-5085.34H2A clustered histone 14 [Source:NCBI gene;Acc:448... [more]
ENSXETT00000037811.14.338e-5085.34histone H2A type 1-like [Source:NCBI gene;Acc:1004... [more]
back to top
BLAST of Histone H2A vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
H2ac214.854e-4983.05H2A clustered histone 21 [Source:MGI Symbol;Acc:MG... [more]
H2ac208.384e-4982.91H2A clustered histone 20 [Source:MGI Symbol;Acc:MG... [more]
H2aj5.974e-4883.62H2J.A histone [Source:MGI Symbol;Acc:MGI:3606192][more]
H2ac187.685e-4884.82H2A clustered histone 18 [Source:MGI Symbol;Acc:MG... [more]
H2ac197.685e-4884.82H2A clustered histone 19 [Source:MGI Symbol;Acc:MG... [more]
back to top
BLAST of Histone H2A vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|P06897|H2A1_XENLA3.972e-4987.50Histone H2A type 1 OS=Xenopus laevis OX=8355 PE=1 ... [more]
sp|P02264|H2A_ONCMY8.562e-4985.84Histone H2A OS=Oncorhynchus mykiss OX=8022 PE=1 SV... [more]
sp|P35061|H2A_ACRFO3.289e-4886.61Histone H2A OS=Acropora formosa OX=126732 PE=3 SV=... [more]
sp|Q64522|H2A2B_MOUSE3.395e-4883.05Histone H2A type 2-B OS=Mus musculus OX=10090 GN=H... [more]
sp|Q8IUE6|H2A2B_HUMAN4.557e-4883.90Histone H2A type 2-B OS=Homo sapiens OX=9606 GN=H2... [more]
back to top
BLAST of Histone H2A vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A3B5QU856.739e-4984.87Histone H2A OS=Xiphophorus maculatus OX=8083 PE=3 ... [more]
A0A3B4C9W57.339e-4983.06Histone H2A OS=Pygocentrus nattereri OX=42514 PE=3... [more]
G3PT013.285e-4878.20Histone H2A OS=Gasterosteus aculeatus OX=69293 PE=... [more]
A0A4W6D0D06.240e-4884.30Histone H2A OS=Lates calcarifer OX=8187 PE=3 SV=1[more]
A0A3P9JJ548.739e-4885.71Histone H2A OS=Oryzias latipes OX=8090 PE=3 SV=1[more]
back to top
BLAST of Histone H2A vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ENSAMXT00000040985.13.768e-5085.47pep primary_assembly:Astyanax_mexicanus-2.0:20:275... [more]
ENSAMXT00000025817.21.304e-4985.84pep primary_assembly:Astyanax_mexicanus-2.0:APWO02... [more]
ENSAMXT00000050088.11.593e-4985.84pep primary_assembly:Astyanax_mexicanus-2.0:21:101... [more]
ENSAMXT00000026274.21.827e-4985.84pep primary_assembly:Astyanax_mexicanus-2.0:21:101... [more]
h2ax1.169e-4786.49H2A.X variant histone [Source:NCBI gene;Acc:394048... [more]
back to top
BLAST of Histone H2A vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ENSPMAT00000011253.12.483e-4982.20pep scaffold:Pmarinus_7.0:GL479154:926813:927238:-... [more]
ENSPMAT00000005338.11.162e-4883.19pep scaffold:Pmarinus_7.0:GL476820:708214:709027:-... [more]
ENSPMAT00000002388.11.575e-4883.19pep scaffold:Pmarinus_7.0:GL476925:193851:194294:1... [more]
ENSPMAT00000011166.18.793e-4882.30pep scaffold:Pmarinus_7.0:GL476820:1027708:1028088... [more]
ENSPMAT00000008684.12.584e-4775.59pep scaffold:Pmarinus_7.0:GL488596:2418:2939:-1 ge... [more]
back to top
BLAST of Histone H2A vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 4
Match NameE-valueIdentityDescription
HTA11.685e-4178.30Histone H2A; core histone protein required for chr... [more]
HTA21.927e-4178.30Histone H2A; core histone protein required for chr... [more]
HTZ18.974e-2062.39Histone variant H2AZ; exchanged for histone H2A in... [more]
CMD16.163e-931.58Calmodulin; Ca2+ binding protein that regulates Ca... [more]
back to top
BLAST of Histone H2A vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
EDO276514.241e-5085.84Histone H2A [Source:UniProtKB/TrEMBL;Acc:A7T8N1][more]
EDO482837.483e-5086.61Histone H2A [Source:UniProtKB/TrEMBL;Acc:A7RJL4][more]
EDO301572.257e-4986.61Histone H2A [Source:UniProtKB/TrEMBL;Acc:A7T1L1][more]
EDO260882.587e-4986.61Histone H2A [Source:UniProtKB/TrEMBL;Acc:A7TCX1][more]
EDO483043.192e-4985.71Histone H2A [Source:UniProtKB/TrEMBL;Acc:A7RJM1][more]
back to top
BLAST of Histone H2A vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ENSORLT00000043619.14.855e-5185.71pep primary_assembly:ASM223467v1:1:2176285:2181192... [more]
ENSORLT00000034627.11.911e-5086.32pep primary_assembly:ASM223467v1:1:1239146:1240518... [more]
ENSORLT00000001657.21.929e-5085.59pep primary_assembly:ASM223467v1:1:2123146:2150212... [more]
ENSORLT00000027984.12.911e-5086.32pep primary_assembly:ASM223467v1:1:8921530:8926502... [more]
ENSORLT00000042228.14.078e-5085.47pep primary_assembly:ASM223467v1:23:22958305:22963... [more]
back to top
BLAST of Histone H2A vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000067932.14.624e-61100.00SMESG000067932.1[more]
SMESG000006040.14.996e-5392.17SMESG000006040.1[more]
SMESG000006040.18.218e-5392.17SMESG000006040.1[more]
SMESG000018807.13.959e-4990.09SMESG000018807.1[more]
SMESG000067933.12.883e-47100.00SMESG000067933.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30015694 ID=SMED30015694|Name=Histone H2A|organism=Schmidtea mediterranea sexual|type=transcript|length=1536bp
ATTAACTATATATACCAATGAGATGTCATTTTAATATAATTAAAAAATGT
CAGGAAAAGCAGGTAAAGCTGGTAAAACAAGTCGAAACCAAAGCAAAACT
CGTAGTTCAAGGGCTGGTCTTCAGTTTCCTGTAGGAAGAATTCATCGAAA
ATTGCGGAAAGGAAATTTTGCTGAACGTGTCGGAGCTGGAGCACCAGTTT
ATTTAGCAGCAGTTTTGGAATACCTAGCTGCTGAGGTACTTGAATTGGCG
GGTAATGCTGCAAGAGATAACAAGAAAAGTCGTATTATTCCCCGACATCT
GCAATTAGCTATCCGCAATGATGAAGAACTGAACAAATTATTGGGAGGTG
TAACTATTTCTCAAGGTGGTGTCATTCCTAATATTCAATCAGCGTTGTTG
CCGAAAAAGACTGAAGAAAAACCGGCCAAGGGAAATCTTTTAAAAATCAC
ATCAATTTCTTCGTCAGTTAGAGATTCACCATAATTTGTAAGAAATGTTC
TAAATTTAGAAGCAGATACAGTTTGTTTATTTTCACTAAAAGTAATGAGA
GCATTTGTTAAATCATCTTCAGTTTCGTCTGTTGGTGGATATTTTCTCAT
GATGTTGATAAATTCATCAAAATCGACAGTTCCATTTCCATCAGTATCAA
CATCTTCTATGATTTTCTAAAATCAATATGGAAAATTAAATGGCGAAACA
ATTGTTAAGAAATCAAAATTTATCGGCGGCAGAATCAAATGATTAGAATA
TTTTGTTAAGTTATCACATGTCATTGTGATTGACAAATCAATCAAGATTC
TACGGTTGATTGCACTTATAAATCTTTGATACAAAATTATGAAGCCATCA
AAACCTCAATTCAGACTCAAATTTGTAAACCACATGTAAAATTTGGCAAA
GCAATCGGTAACAAGTTTACTATATAAAGTAGTTAGCCATTTTTATTGTT
ATTCCATGTTTAATTTGTTTAGATTTTTGATTATTGACTTAATTATCATT
AATTAGGATTTTCACAATTCAGTTCACAGGTGGCAGTGTTTTGGACTTGT
GATGGGTGGGAGGCATTTAGTGGGCAGGTATGACGTTTTTAACCGTCTCT
AATCCACTTAAGTATGCATTGTTAAACATGTTGGAAGATTTCAATTGTTT
TGTAATTTATAATTTACTTTTGTCATTCTCTTTTAATTGACAGCAATTTA
CTGTTGAATGCTTATCACAAATAAGAAGAGTAAACAAATATGCTGAAATC
CCCAATTTCCAAAGCCATCGAACGTATTAGAACCAGTGAAGAGTTCAAAG
TTAAAGAGGTTATCGTCTTAACGATGGTGATGATAATGTTTGGGTTCCTC
CAAGAAATGCTTGATTATGTATTGTAACGAGGTGATATATTAAAATGACG
GTGACTGAGCTTTCTTTTAGATATTACTAAAGAGAATATTGTAGAACACA
ATGGAGTCATTTTTGGAATAATTGGGGAAATTTTATTTTATTATTTATGA
TTTCTATTTCTAAATTTTTGAATATTTAATCAAAAG
back to top

protein sequence of SMED30015694-orf-1

>SMED30015694-orf-1 ID=SMED30015694-orf-1|Name=SMED30015694-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=146bp
MSGKAGKAGKTSRNQSKTRSSRAGLQFPVGRIHRKLRKGNFAERVGAGAP
VYLAAVLEYLAAEVLELAGNAARDNKKSRIIPRHLQLAIRNDEELNKLLG
GVTISQGGVIPNIQSALLPKKTEEKPAKGNLLKITSISSSVRDSP*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000034epidermis
PLANA:0000099neuron
PLANA:0000101muscle cell
Vocabulary: INTERPRO
TermDefinition
IPR002119Histone_H2A
IPR007125Histone_H2A/H2B/H3
IPR009072Histone-fold
IPR032454Histone_H2A_C
IPR032458Histone_H2A_CS
IPR002048EF_hand_dom
IPR011992EF-hand-dom_pair
IPR018247EF_Hand_1_Ca_BS
Vocabulary: molecular function
TermDefinition
GO:0003677DNA binding
GO:0046982protein heterodimerization activity
GO:0005509calcium ion binding
Vocabulary: cellular component
TermDefinition
GO:0000786nucleosome
GO:0005634nucleus
GO:0005615extracellular space
GO:0005694chromosome
Vocabulary: biological process
TermDefinition
GO:0031640killing of cells of other organism
GO:0042742defense response to bacterium
GO:0045087innate immune response
GO:0050830defense response to Gram-positive bacterium
GO:0050832defense response to fungus
GO:0051673membrane disruption in other organism
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR002119Histone H2APRINTSPR00620HISTONEH2Acoord: 15..37
score: 70.19
coord: 101..119
score: 67.87
coord: 59..72
score: 89.46
coord: 44..59
score: 90.36
coord: 73..87
score: 81.65
IPR002119Histone H2ASMARTSM00414h2a4coord: 4..124
e-value: 6.1E-79
score: 278.2
IPR002119Histone H2ACDDcd00074H2Acoord: 7..121
e-value: 8.77395E-68
score: 198.713
IPR032454Histone H2A, C-terminal domainPFAMPF16211Histone_H2A_Ccoord: 93..125
e-value: 2.3E-19
score: 68.8
IPR009072Histone-foldGENE3DG3DSA:1.10.20.10coord: 3..130
e-value: 2.6E-63
score: 213.6
IPR009072Histone-foldSUPERFAMILYSSF47113Histone-foldcoord: 6..123
IPR007125Histone H2A/H2B/H3PFAMPF00125Histonecoord: 7..90
e-value: 4.9E-16
score: 59.3
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 7..23
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 1..25
NoneNo IPR availablePANTHERPTHR23430HISTONE H2Acoord: 1..128
NoneNo IPR availablePANTHERPTHR23430:SF214HISTONE H2Acoord: 1..128
IPR032458Histone H2A conserved sitePROSITEPS00046HISTONE_H2Acoord: 23..29