RING-type domain-containing protein

Overview
NameRING-type domain-containing protein
Smed IDSMED30015687
Length (bp)767
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of RING-type domain-containing protein (SMED30015687) t-SNE clustered cells

Violin plots show distribution of expression levels for RING-type domain-containing protein (SMED30015687) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of RING-type domain-containing protein (SMED30015687) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for RING-type domain-containing protein (SMED30015687) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30015687

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 11

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
pigment cellSMED30015687SMESG000007981.1 SmedASXL_009307SmedAsxl_ww_GCZZ01PMID:29158443
He et al., 2017
whole organism asexual adult RNA-sequencing evidence
X1 cellSMED30015687SMESG000007981.1 SmedASXL_009307SmedAsxl_ww_GCZZ01PMID:26114597
Zhu et al., 2015
FACS sorted cell population asexual adult RNA-sequencing evidence
gutSMED30015687SMESG000007981.1 dd_Smed_v4_10019_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
cephalic gangliaSMED30015687SMESG000007981.1 dd_Smed_v4_10019_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
neoblastSMED30015687SMESG000007981.1 dd_Smed_v4_10019_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
parapharyngeal regionSMED30015687SMESG000007981.1 dd_Smed_v6_10019_0_1dd_Smed_v6PMID:28171748
Stückemann et al., 2017
whole organism asexual adult RNA-sequencing evidence
gutSMED30015687SMESG000007981.1 SMED30015687smed_20140614PMID:26457503
Tu et al., 2015
whole organism asexual adult colorimetric in situ hybridization evidence
parenchymaSMED30015687SMESG000007981.1 SMED30015687smed_20140614PMID:26457503
Tu et al., 2015
whole organism asexual adult colorimetric in situ hybridization evidence
zeta neoblastSMED30015687SMESG000007981.1 dd_Smed_v4_10019_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
neoblastSMED30015687SMESG000007981.1 SMED_28346_V2_1GPL14150_gene_modelsPMID:22385657
Wagner et al., 2012
whole organism asexual adult cDNA to DNA expression microarray evidence
neoblastSMED30015687SMESG000007981.1 SMED_28346_V2_1GPL14150PMID:22385657
Wagner et al., 2012
whole organism asexual adult cDNA to DNA expression microarray evidence
Note: Hover over icons to view figure legend
Homology
BLAST of RING-type domain-containing protein vs. Ensembl Human
Match: RNF8 (ring finger protein 8 [Source:HGNC Symbol;Acc:HGNC:10071])

HSP 1 Score: 61.6178 bits (148), Expect = 2.565e-10
Identity = 25/75 (33.33%), Postives = 46/75 (61.33%), Query Frame = 3
Query:  432 NLLIEDYLRCQICREYFIKPVITNCGHTFCQSCLDQWALRTRYGGGNCPLCQHQIEYTSRNILIETCVEALLKQL 656
            N ++E+ L+C IC EYFI+ V  NC H+FC  C+++W  R       CP+C+  I+  + +++++ C+  ++  L
Sbjct:  394 NDVLENELQCIICSEYFIEAVTLNCAHSFCSYCINEWMKRKI----ECPICRKDIKSKTYSLVLDNCINKMVNNL 464          
BLAST of RING-type domain-containing protein vs. Ensembl Human
Match: LONRF1 (LON peptidase N-terminal domain and ring finger 1 [Source:HGNC Symbol;Acc:HGNC:26302])

HSP 1 Score: 54.299 bits (129), Expect = 9.577e-8
Identity = 30/98 (30.61%), Postives = 49/98 (50.00%), Query Frame = 3
Query:  423 PENNLLIEDYLRCQICREYFIKPVITNCGHTFCQSCLDQWALRTRYGGGNCPLCQHQIE-------YTSRNILIETCVEALLKQLPETSRIEWNKTVQ 695
            PE  + + D+  C +C   F +PV T CGH+FC++CL++      Y    CPLC+  ++       Y    +L E  V+ L  +L E  +I   +T +
Sbjct:  468 PEELIDVSDF-ECSLCMRLFFEPVTTPCGHSFCKNCLERCLDHAPY----CPLCKESLKEYLADRRYCVTQLLEELIVKYLPDELSERKKIYDEETAE 560          
BLAST of RING-type domain-containing protein vs. Ensembl Human
Match: LONRF1 (LON peptidase N-terminal domain and ring finger 1 [Source:HGNC Symbol;Acc:HGNC:26302])

HSP 1 Score: 54.299 bits (129), Expect = 9.577e-8
Identity = 30/98 (30.61%), Postives = 49/98 (50.00%), Query Frame = 3
Query:  423 PENNLLIEDYLRCQICREYFIKPVITNCGHTFCQSCLDQWALRTRYGGGNCPLCQHQIE-------YTSRNILIETCVEALLKQLPETSRIEWNKTVQ 695
            PE  + + D+  C +C   F +PV T CGH+FC++CL++      Y    CPLC+  ++       Y    +L E  V+ L  +L E  +I   +T +
Sbjct:  468 PEELIDVSDF-ECSLCMRLFFEPVTTPCGHSFCKNCLERCLDHAPY----CPLCKESLKEYLADRRYCVTQLLEELIVKYLPDELSERKKIYDEETAE 560          
BLAST of RING-type domain-containing protein vs. Ensembl Human
Match: TRIM4 (tripartite motif containing 4 [Source:HGNC Symbol;Acc:HGNC:16275])

HSP 1 Score: 50.447 bits (119), Expect = 1.002e-6
Identity = 25/53 (47.17%), Postives = 31/53 (58.49%), Query Frame = 3
Query:  441 IEDYLRCQICREYFIKPVITNCGHTFCQSCLDQ-WALRTRYGGG--NCPLCQH 590
            I++ L C IC +YF  PV   CGH FC+ CL + WA     GGG   CP C+H
Sbjct:    6 IQEELTCPICLDYFQDPVSIECGHNFCRGCLHRNWA----PGGGPFPCPECRH 54          
BLAST of RING-type domain-containing protein vs. Ensembl Human
Match: LONRF1 (LON peptidase N-terminal domain and ring finger 1 [Source:HGNC Symbol;Acc:HGNC:26302])

HSP 1 Score: 50.0618 bits (118), Expect = 1.592e-6
Identity = 30/98 (30.61%), Postives = 49/98 (50.00%), Query Frame = 3
Query:  423 PENNLLIEDYLRCQICREYFIKPVITNCGHTFCQSCLDQWALRTRYGGGNCPLCQHQIE-------YTSRNILIETCVEALLKQLPETSRIEWNKTVQ 695
            PE  + + D+  C +C   F +PV T CGH+FC++CL++      Y    CPLC+  ++       Y    +L E  V+ L  +L E  +I   +T +
Sbjct:  111 PEELIDVSDF-ECSLCMRLFFEPVTTPCGHSFCKNCLERCLDHAPY----CPLCKESLKEYLADRRYCVTQLLEELIVKYLPDELSERKKIYDEETAE 203          
BLAST of RING-type domain-containing protein vs. Ensembl Celegans
Match: T02C1.2 (pep chromosome:WBcel235:III:9251029:9253126:1 gene:WBGene00011366.1 transcript:T02C1.2.1 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:T02C1.2)

HSP 1 Score: 46.2098 bits (108), Expect = 9.589e-6
Identity = 26/81 (32.10%), Postives = 43/81 (53.09%), Query Frame = 3
Query:  429 NNLLIEDYLRCQICREYFIKPVITNCGHTFCQSCLDQWALRTRYGGGNCPLCQHQIEYTSRNILIETCVEALLKQLPETSR 671
            +N L ED + C IC +  ++P    C H+FC+ C+DQ    TR     CP CQ  + ++ +N + +   E +L+ + E  R
Sbjct:   90 SNDLDEDDVLCTICYDIIVEPHTLRCQHSFCKKCIDQCLPLTR----KCPSCQQWVYWSRKNKIFK---EKVLRWVKEKQR 163          
BLAST of RING-type domain-containing protein vs. Ensembl Zebrafish
Match: rnf8 (ring finger protein 8, E3 ubiquitin protein ligase [Source:NCBI gene;Acc:404050])

HSP 1 Score: 65.0846 bits (157), Expect = 1.241e-11
Identity = 26/78 (33.33%), Postives = 45/78 (57.69%), Query Frame = 3
Query:  438 LIEDYLRCQICREYFIKPVITNCGHTFCQSCLDQWALRTRYGGGNCPLCQHQIEYTSRNILIETCVEALLKQLPETSR 671
            ++E  L+C IC E FI+ V  NC H+FCQ C+ +W    R     CP+C   I   +R+++++ C++ +++ L    R
Sbjct:  385 VLESELQCSICSELFIEAVTLNCAHSFCQHCISEW----RNRKDKCPMCWQNITSQTRSLVLDNCIDRMVENLSADMR 458          
BLAST of RING-type domain-containing protein vs. Ensembl Zebrafish
Match: rnf8 (ring finger protein 8, E3 ubiquitin protein ligase [Source:NCBI gene;Acc:404050])

HSP 1 Score: 64.6994 bits (156), Expect = 1.739e-11
Identity = 26/78 (33.33%), Postives = 45/78 (57.69%), Query Frame = 3
Query:  438 LIEDYLRCQICREYFIKPVITNCGHTFCQSCLDQWALRTRYGGGNCPLCQHQIEYTSRNILIETCVEALLKQLPETSR 671
            ++E  L+C IC E FI+ V  NC H+FCQ C+ +W    R     CP+C   I   +R+++++ C++ +++ L    R
Sbjct:  385 VLESELQCSICSELFIEAVTLNCAHSFCQHCISEW----RNRKDKCPMCWQNITSQTRSLVLDNCIDRMVENLSADMR 458          
BLAST of RING-type domain-containing protein vs. Ensembl Zebrafish
Match: btr31 (bloodthirsty-related gene family, member 31 [Source:ZFIN;Acc:ZDB-GENE-090512-3])

HSP 1 Score: 52.373 bits (124), Expect = 3.582e-8
Identity = 26/87 (29.89%), Postives = 49/87 (56.32%), Query Frame = 3
Query:  441 IEDYLRCQICREYFIKPVITNCGHTFCQSCLDQWALRTRYGGGNCPLCQHQIEYTSRNILIETCVEALLKQLPETSRIEWNKTVQER 701
            + + L+C IC + F  PV T CGH FC++CLDQ+   T      CP+C+ +      ++ +   +  +++ L + SR   ++T+++R
Sbjct:    7 LNEELQCSICLDVFTDPVTTPCGHNFCRTCLDQYWTNTHTCC--CPICKEKFSKQP-DLKVNIALREVVEHLKQESRPAESETMEDR 90          
BLAST of RING-type domain-containing protein vs. Ensembl Zebrafish
Match: btr31 (bloodthirsty-related gene family, member 31 [Source:ZFIN;Acc:ZDB-GENE-090512-3])

HSP 1 Score: 52.373 bits (124), Expect = 3.582e-8
Identity = 26/87 (29.89%), Postives = 49/87 (56.32%), Query Frame = 3
Query:  441 IEDYLRCQICREYFIKPVITNCGHTFCQSCLDQWALRTRYGGGNCPLCQHQIEYTSRNILIETCVEALLKQLPETSRIEWNKTVQER 701
            + + L+C IC + F  PV T CGH FC++CLDQ+   T      CP+C+ +      ++ +   +  +++ L + SR   ++T+++R
Sbjct:    7 LNEELQCSICLDVFTDPVTTPCGHNFCRTCLDQYWTNTHTCC--CPICKEKFSKQP-DLKVNIALREVVEHLKQESRPAESETMEDR 90          
BLAST of RING-type domain-containing protein vs. Ensembl Zebrafish
Match: btr02 (bloodthirsty-related gene family, member 2 [Source:ZFIN;Acc:ZDB-GENE-060825-228])

HSP 1 Score: 53.1434 bits (126), Expect = 1.103e-7
Identity = 22/50 (44.00%), Postives = 30/50 (60.00%), Query Frame = 3
Query:  438 LIEDYLRCQICREYFIKPVITNCGHTFCQSCLDQWALRTRYGGGNCPLCQ 587
            L E +  C +C E F  PV T CGH+FC++CL  +   +R G   CPLC+
Sbjct:    8 LSEKHFLCSLCEEIFSNPVTTPCGHSFCKACLRVYW--SRSGSDECPLCR 55          
BLAST of RING-type domain-containing protein vs. Ensembl Xenopus
Match: bmpr1a (bone morphogenetic protein receptor type 1A [Source:Xenbase;Acc:XB-GENE-485616])

HSP 1 Score: 62.7734 bits (151), Expect = 9.897e-11
Identity = 24/75 (32.00%), Postives = 48/75 (64.00%), Query Frame = 3
Query:  432 NLLIEDYLRCQICREYFIKPVITNCGHTFCQSCLDQWALRTRYGGGNCPLCQHQIEYTSRNILIETCVEALLKQL 656
            N ++++ L+C IC E+FI+ V  NC H+FC  C+  W  R       CP+C+ +I   +R+++++ C+++++ +L
Sbjct:  371 NDVLDNELQCIICSEHFIEAVTLNCAHSFCSYCIKSWRKRKE----ECPICRQEILSETRSLVLDNCIDSMVAKL 441          
BLAST of RING-type domain-containing protein vs. Ensembl Xenopus
Match: bmpr1a (bone morphogenetic protein receptor type 1A [Source:Xenbase;Acc:XB-GENE-485616])

HSP 1 Score: 62.7734 bits (151), Expect = 1.129e-10
Identity = 24/75 (32.00%), Postives = 48/75 (64.00%), Query Frame = 3
Query:  432 NLLIEDYLRCQICREYFIKPVITNCGHTFCQSCLDQWALRTRYGGGNCPLCQHQIEYTSRNILIETCVEALLKQL 656
            N ++++ L+C IC E+FI+ V  NC H+FC  C+  W  R       CP+C+ +I   +R+++++ C+++++ +L
Sbjct:  341 NDVLDNELQCIICSEHFIEAVTLNCAHSFCSYCIKSWRKRKE----ECPICRQEILSETRSLVLDNCIDSMVAKL 411          
BLAST of RING-type domain-containing protein vs. Ensembl Xenopus
Match: ENSXETT00000015963.1 (pep primary_assembly:Xenopus_tropicalis_v9.1:KV460506.1:95348:98036:-1 gene:ENSXETG00000009804.1 transcript:ENSXETT00000015963.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 51.6026 bits (122), Expect = 3.873e-7
Identity = 25/61 (40.98%), Postives = 35/61 (57.38%), Query Frame = 3
Query:  441 IEDYLRCQICREYFIKPVITNCGHTFCQSCLDQWALRTRYGGGNCPLCQHQIEYTSRNILI 623
            I++ L C ICRE +  PV   CGH+FC+SC+ Q+  +       CP C+H+  Y  R  LI
Sbjct:   24 IKEELNCSICREIYTDPVTLPCGHSFCRSCIRQFWDKQEDKEWFCPECRHR--YRRRPELI 82          
BLAST of RING-type domain-containing protein vs. Ensembl Xenopus
Match: xnf7 (Nuclear factor 7 [Source:NCBI gene;Acc:100327256])

HSP 1 Score: 50.8322 bits (120), Expect = 1.009e-6
Identity = 25/68 (36.76%), Postives = 37/68 (54.41%), Query Frame = 3
Query:  453 LRCQICREYFIKPVITNCGHTFCQSCLDQ-WALRTRYGGGNCPLCQHQIEYTSRNILIETCVEALLKQ 653
            L C +C E F  PV+  CGH FC+SC+D+ W  ++ +    CP C+  I  T R   I   +  L+K+
Sbjct:  157 LTCPLCMELFKDPVMVACGHNFCRSCIDKAWEGQSSFA---CPECKESI--TDRKYTINRVLANLVKK 219          
BLAST of RING-type domain-containing protein vs. Ensembl Xenopus
Match: xnf7 (Nuclear factor 7 [Source:NCBI gene;Acc:100327256])

HSP 1 Score: 50.8322 bits (120), Expect = 1.069e-6
Identity = 25/68 (36.76%), Postives = 37/68 (54.41%), Query Frame = 3
Query:  453 LRCQICREYFIKPVITNCGHTFCQSCLDQ-WALRTRYGGGNCPLCQHQIEYTSRNILIETCVEALLKQ 653
            L C +C E F  PV+  CGH FC+SC+D+ W  ++ +    CP C+  I  T R   I   +  L+K+
Sbjct:  182 LTCPLCMELFKDPVMVACGHNFCRSCIDKAWEGQSSFA---CPECKESI--TDRKYTINRVLANLVKK 244          
BLAST of RING-type domain-containing protein vs. Ensembl Mouse
Match: Gm28043 (predicted gene, 28043 [Source:MGI Symbol;Acc:MGI:5547779])

HSP 1 Score: 65.4698 bits (158), Expect = 1.022e-11
Identity = 29/91 (31.87%), Postives = 53/91 (58.24%), Query Frame = 3
Query:  432 NLLIEDYLRCQICREYFIKPVITNCGHTFCQSCLDQWALRTRYGGGNCPLCQHQIEYTSRNILIETCVEALLKQLPETSRIEWNKTVQERQ 704
            N L+E+ L+C IC EYFI+ V  NC H+FC  C+++W  R       CP+C+  IE  + +++++ C+  ++  L    +   +  ++ER+
Sbjct:  397 NDLLENELQCIICSEYFIEAVTLNCAHSFCSFCINEWMKRKV----ECPICRKDIESRTNSLVLDNCISKMVDNLSSDVKERRSVLIRERR 483          
BLAST of RING-type domain-containing protein vs. Ensembl Mouse
Match: Rnf8 (ring finger protein 8 [Source:MGI Symbol;Acc:MGI:1929069])

HSP 1 Score: 64.3142 bits (155), Expect = 2.206e-11
Identity = 29/91 (31.87%), Postives = 53/91 (58.24%), Query Frame = 3
Query:  432 NLLIEDYLRCQICREYFIKPVITNCGHTFCQSCLDQWALRTRYGGGNCPLCQHQIEYTSRNILIETCVEALLKQLPETSRIEWNKTVQERQ 704
            N L+E+ L+C IC EYFI+ V  NC H+FC  C+++W  R       CP+C+  IE  + +++++ C+  ++  L    +   +  ++ER+
Sbjct:  397 NDLLENELQCIICSEYFIEAVTLNCAHSFCSFCINEWMKRK----VECPICRKDIESRTNSLVLDNCISKMVDNLSSDVKERRSVLIRERR 483          
BLAST of RING-type domain-containing protein vs. Ensembl Mouse
Match: Lonrf1 (LON peptidase N-terminal domain and ring finger 1 [Source:MGI Symbol;Acc:MGI:3609241])

HSP 1 Score: 55.4546 bits (132), Expect = 2.704e-8
Identity = 30/98 (30.61%), Postives = 49/98 (50.00%), Query Frame = 3
Query:  423 PENNLLIEDYLRCQICREYFIKPVITNCGHTFCQSCLDQWALRTRYGGGNCPLCQHQIE-------YTSRNILIETCVEALLKQLPETSRIEWNKTVQ 695
            PE  + + D+  C +C   F +PV T CGH+FC++CL++      Y    CPLC+  ++       Y    +L E  V+ L  +L E  +I   +T +
Sbjct:  532 PEELIDVSDF-ECSLCMRLFFEPVTTPCGHSFCKNCLERCLDHAPY----CPLCKESLKEYLADRRYCVTQLLEELIVKYLPDELSERKKIYDEETAE 624          
BLAST of RING-type domain-containing protein vs. Ensembl Mouse
Match: Lonrf1 (LON peptidase N-terminal domain and ring finger 1 [Source:MGI Symbol;Acc:MGI:3609241])

HSP 1 Score: 50.0618 bits (118), Expect = 1.249e-6
Identity = 30/98 (30.61%), Postives = 49/98 (50.00%), Query Frame = 3
Query:  423 PENNLLIEDYLRCQICREYFIKPVITNCGHTFCQSCLDQWALRTRYGGGNCPLCQHQIE-------YTSRNILIETCVEALLKQLPETSRIEWNKTVQ 695
            PE  + + D+  C +C   F +PV T CGH+FC++CL++      Y    CPLC+  ++       Y    +L E  V+ L  +L E  +I   +T +
Sbjct:  457 PEELIDVSDF-ECSLCMRLFFEPVTTPCGHSFCKNCLERCLDHAPY----CPLCKESLKEYLADRRYCVTQLLEELIVKYLPDELSERKKIYDEETAE 549          
BLAST of RING-type domain-containing protein vs. Ensembl Mouse
Match: Trim50 (tripartite motif-containing 50 [Source:MGI Symbol;Acc:MGI:2664992])

HSP 1 Score: 48.9062 bits (115), Expect = 2.921e-6
Identity = 29/91 (31.87%), Postives = 49/91 (53.85%), Query Frame = 3
Query:  441 IEDYLRCQICREYFIKPVITNCGHTFCQSCLDQWALRTRYGGGNCPLCQHQIEYTSR--NILIETCVEALLKQLPETSRIEWNKTVQERQP 707
            ++D L+C IC E F +P++  CGH++C+ CLD  +         CP+C+  ++ +S   N+ +   ++AL  +LP    IE    V  R P
Sbjct:   10 LQDQLQCPICLEVFKEPLMLQCGHSYCKDCLDNLSQHLD-SELCCPVCRQSVDCSSSPPNVSLARVIDAL--RLP--GDIEPTVCVHHRNP 95          
BLAST of RING-type domain-containing protein vs. UniProt/SwissProt
Match: sp|Q2HJ46|RNF8_BOVIN (E3 ubiquitin-protein ligase RNF8 OS=Bos taurus OX=9913 GN=RNF8 PE=2 SV=1)

HSP 1 Score: 65.0846 bits (157), Expect = 8.262e-11
Identity = 25/75 (33.33%), Postives = 47/75 (62.67%), Query Frame = 3
Query:  432 NLLIEDYLRCQICREYFIKPVITNCGHTFCQSCLDQWALRTRYGGGNCPLCQHQIEYTSRNILIETCVEALLKQL 656
            N ++E+ L+C IC EYF++ V  NC H+FC  C+++W  R       CP+C+  I+  +R+++++ C+  ++  L
Sbjct:  396 NDVLENELQCIICSEYFVEAVTLNCAHSFCSYCINEWMKRK----VECPICRKDIKSKTRSLVLDNCISKMVDNL 466          
BLAST of RING-type domain-containing protein vs. UniProt/SwissProt
Match: sp|Q803C1|RNF8_DANRE (E3 ubiquitin-protein ligase rnf8 OS=Danio rerio OX=7955 GN=rnf8 PE=2 SV=1)

HSP 1 Score: 64.6994 bits (156), Expect = 1.185e-10
Identity = 26/78 (33.33%), Postives = 45/78 (57.69%), Query Frame = 3
Query:  438 LIEDYLRCQICREYFIKPVITNCGHTFCQSCLDQWALRTRYGGGNCPLCQHQIEYTSRNILIETCVEALLKQLPETSR 671
            ++E  L+C IC E FI+ V  NC H+FCQ C+ +W    R     CP+C   I   +R+++++ C++ +++ L    R
Sbjct:  385 VLESELQCSICSELFIEAVTLNCAHSFCQHCISEW----RNRKDKCPMCWQNITSQTRSLVLDNCIDRMVENLSADMR 458          
BLAST of RING-type domain-containing protein vs. UniProt/SwissProt
Match: sp|Q6CHI1|RAD18_YARLI (Postreplication repair E3 ubiquitin-protein ligase RAD18 OS=Yarrowia lipolytica (strain CLIB 122 / E 150) OX=284591 GN=RAD18 PE=3 SV=1)

HSP 1 Score: 64.3142 bits (155), Expect = 1.205e-10
Identity = 30/80 (37.50%), Postives = 44/80 (55.00%), Query Frame = 3
Query:  441 IEDYLRCQICREYFIKPVITNCGHTFCQSCLDQWALRTRYGGGNCPLC--QHQIEYTSRNILIETCVEALLKQLPETSRI 674
            +++ LRC IC+E+F  P+IT CGHTFC  C+ ++   T      CP C  + QI    +N+ +ET VE    Q     R+
Sbjct:   22 VDETLRCHICKEFFTAPMITGCGHTFCSLCIQRYLTNT---SQRCPTCMQEQQISQLRKNVTVETLVEHFSAQRATILRV 98          
BLAST of RING-type domain-containing protein vs. UniProt/SwissProt
Match: sp|Q8VC56|RNF8_MOUSE (E3 ubiquitin-protein ligase RNF8 OS=Mus musculus OX=10090 GN=Rnf8 PE=1 SV=1)

HSP 1 Score: 64.3142 bits (155), Expect = 1.543e-10
Identity = 29/91 (31.87%), Postives = 53/91 (58.24%), Query Frame = 3
Query:  432 NLLIEDYLRCQICREYFIKPVITNCGHTFCQSCLDQWALRTRYGGGNCPLCQHQIEYTSRNILIETCVEALLKQLPETSRIEWNKTVQERQ 704
            N L+E+ L+C IC EYFI+ V  NC H+FC  C+++W  R       CP+C+  IE  + +++++ C+  ++  L    +   +  ++ER+
Sbjct:  397 NDLLENELQCIICSEYFIEAVTLNCAHSFCSFCINEWMKRK----VECPICRKDIESRTNSLVLDNCISKMVDNLSSDVKERRSVLIRERR 483          
BLAST of RING-type domain-containing protein vs. UniProt/SwissProt
Match: sp|Q4KLN8|RNF8_RAT (E3 ubiquitin-protein ligase RNF8 OS=Rattus norvegicus OX=10116 GN=Rnf8 PE=2 SV=1)

HSP 1 Score: 64.3142 bits (155), Expect = 1.805e-10
Identity = 28/91 (30.77%), Postives = 54/91 (59.34%), Query Frame = 3
Query:  432 NLLIEDYLRCQICREYFIKPVITNCGHTFCQSCLDQWALRTRYGGGNCPLCQHQIEYTSRNILIETCVEALLKQLPETSRIEWNKTVQERQ 704
            N ++E+ L+C IC EYFI+ V  NC H+FC  C+ +W  R       CP+C+  IE  + +++++ C+  ++++L    +   +  ++ER+
Sbjct:  396 NDVLENELQCIICSEYFIEAVTLNCAHSFCSFCISEWMKRK----VECPICRKDIESRTNSLVLDNCISKMVERLSSDVKERRSVLIRERR 482          
BLAST of RING-type domain-containing protein vs. TrEMBL
Match: A0A5E4NQ88 (RING-type domain-containing protein OS=Cinara cedri OX=506608 GN=CINCED_3A005786 PE=4 SV=1)

HSP 1 Score: 70.8626 bits (172), Expect = 3.504e-11
Identity = 31/87 (35.63%), Postives = 50/87 (57.47%), Query Frame = 3
Query:  444 EDYLRCQICREYFIKPVITNCGHTFCQSCLDQWALRTRYGGGNCPLCQHQIEYTSRNILIETCVEALLKQLPETSRIEWNKTVQERQ 704
            E  L+CQIC E FIKP++ NC HTFC +C+  W  R       CP+C+  I+  S  + +   ++ +++ +PE      N +++ERQ
Sbjct:   33 ESELQCQICYEIFIKPIVLNCAHTFCATCIHIWTKRV----NRCPVCRMNIKSKSHCLTLNVFIDKMMQFMPEDVITRRNLSIEERQ 115          
BLAST of RING-type domain-containing protein vs. TrEMBL
Match: A0A5E4NSJ3 (RING-type domain-containing protein OS=Cinara cedri OX=506608 GN=CINCED_3A005786 PE=4 SV=1)

HSP 1 Score: 70.8626 bits (172), Expect = 3.832e-11
Identity = 31/87 (35.63%), Postives = 50/87 (57.47%), Query Frame = 3
Query:  444 EDYLRCQICREYFIKPVITNCGHTFCQSCLDQWALRTRYGGGNCPLCQHQIEYTSRNILIETCVEALLKQLPETSRIEWNKTVQERQ 704
            E  L+CQIC E FIKP++ NC HTFC +C+  W  R       CP+C+  I+  S  + +   ++ +++ +PE      N +++ERQ
Sbjct:   33 ESELQCQICYEIFIKPIVLNCAHTFCATCIHIWTKRV----NRCPVCRMNIKSKSHCLTLNVFIDKMMQFMPEDVITRRNLSIEERQ 115          
BLAST of RING-type domain-containing protein vs. TrEMBL
Match: A0A091EB50 (E3 ubiquitin-protein ligase RNF8 OS=Corvus brachyrhynchos OX=85066 GN=N302_08539 PE=4 SV=1)

HSP 1 Score: 68.9366 bits (167), Expect = 5.644e-11
Identity = 26/75 (34.67%), Postives = 51/75 (68.00%), Query Frame = 3
Query:  432 NLLIEDYLRCQICREYFIKPVITNCGHTFCQSCLDQWALRTRYGGGNCPLCQHQIEYTSRNILIETCVEALLKQL 656
            N ++E+ L+C IC E+FI+ V  NC H+FC  C+++W  R     G CP+C+ +I+  +R+++++ C++ +++ L
Sbjct:    2 NDVLENELQCTICSEHFIEAVTLNCAHSFCSYCINEWTKR----KGECPICRQEIKSKTRSLVLDNCIDRMVENL 72          
BLAST of RING-type domain-containing protein vs. TrEMBL
Match: A0A443Q9H9 (E3 ubiquitin-protein ligase RNF8-like protein (Fragment) OS=Dinothrombium tinctorium OX=1965070 GN=B4U79_14790 PE=4 SV=1)

HSP 1 Score: 72.7886 bits (177), Expect = 6.947e-11
Identity = 29/89 (32.58%), Postives = 55/89 (61.80%), Query Frame = 3
Query:  438 LIEDYLRCQICREYFIKPVITNCGHTFCQSCLDQWALRTRYGGGNCPLCQHQIEYTSRNILIETCVEALLKQLPETSRIEWNKTVQERQ 704
            + E  L C IC E FI+PV  NC HTFC  C++ W  + +     CP+C+  +  T+R ++IE  ++ ++ ++ E ++++ ++ V+ER+
Sbjct:  287 IFESELTCSICHELFIQPVNLNCSHTFCVYCIELWK-KNKNSHRECPVCRKPMTSTTRQLVIENLIDKIINEMDEEAKLKRSQVVEERK 374          
BLAST of RING-type domain-containing protein vs. TrEMBL
Match: A0A093QJ56 (E3 ubiquitin-protein ligase RNF8 OS=Manacus vitellinus OX=328815 GN=N305_05974 PE=4 SV=1)

HSP 1 Score: 68.5514 bits (166), Expect = 9.050e-11
Identity = 26/75 (34.67%), Postives = 51/75 (68.00%), Query Frame = 3
Query:  432 NLLIEDYLRCQICREYFIKPVITNCGHTFCQSCLDQWALRTRYGGGNCPLCQHQIEYTSRNILIETCVEALLKQL 656
            N ++E+ L+C IC E+FI+ V  NC H+FC  C+D+W  R       CP+C+ +I+  +R+++++ C++ ++++L
Sbjct:    2 NDVLENELQCTICSEHFIEAVTLNCAHSFCSYCIDEWTKR----KVECPICRQEIKSKTRSLVLDNCIDRMVEKL 72          
BLAST of RING-type domain-containing protein vs. Ensembl Cavefish
Match: rnf8 (ring finger protein 8 [Source:NCBI gene;Acc:103022192])

HSP 1 Score: 61.6178 bits (148), Expect = 1.675e-10
Identity = 27/89 (30.34%), Postives = 50/89 (56.18%), Query Frame = 3
Query:  438 LIEDYLRCQICREYFIKPVITNCGHTFCQSCLDQWALRTRYGGGNCPLCQHQIEYTSRNILIETCVEALLKQLPETSRIEWNKTVQERQ 704
            ++E+ L+C IC E FI+ V  NC H+FC  C+  W    R     CP+C+  I   +R+++++ C++ +++ L    R      ++ER+
Sbjct:  373 VLENELQCIICSELFIEAVTLNCAHSFCLHCISDW----RRRKDECPICRQAILSQTRSLVLDNCIDRMVENLSAEMRERRVALIRERK 457          
BLAST of RING-type domain-containing protein vs. Ensembl Cavefish
Match: rnf8 (ring finger protein 8 [Source:NCBI gene;Acc:103022192])

HSP 1 Score: 61.2326 bits (147), Expect = 1.704e-10
Identity = 27/89 (30.34%), Postives = 50/89 (56.18%), Query Frame = 3
Query:  438 LIEDYLRCQICREYFIKPVITNCGHTFCQSCLDQWALRTRYGGGNCPLCQHQIEYTSRNILIETCVEALLKQLPETSRIEWNKTVQERQ 704
            ++E+ L+C IC E FI+ V  NC H+FC  C+  W    R     CP+C+  I   +R+++++ C++ +++ L    R      ++ER+
Sbjct:  343 VLENELQCIICSELFIEAVTLNCAHSFCLHCISDW----RRRKDECPICRQAILSQTRSLVLDNCIDRMVENLSAEMRERRVALIRERK 427          
BLAST of RING-type domain-containing protein vs. Ensembl Cavefish
Match: ENSAMXT00000048012.1 (pep primary_assembly:Astyanax_mexicanus-2.0:12:1756149:1763403:-1 gene:ENSAMXG00000033729.1 transcript:ENSAMXT00000048012.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 55.4546 bits (132), Expect = 1.331e-8
Identity = 24/73 (32.88%), Postives = 46/73 (63.01%), Query Frame = 3
Query:  441 IEDYLRCQICREYFIKPVITNCGHTFCQSCLDQ-WALRTRYGGGNCPLCQHQIEYTS-RNILIETCVEALLKQ 653
            +E+ L+C IC ++F  PV+ +C H+FC++CLD+ W    +    NCPLC+ +I+    +N+ +    E+ +++
Sbjct:    8 LEENLKCSICLDFFKDPVVLSCSHSFCKTCLDRSW---NQNDEKNCPLCRKKIKRAPFKNLSLREACESFMEE 77          
BLAST of RING-type domain-containing protein vs. Ensembl Cavefish
Match: ENSAMXT00000003855.2 (pep primary_assembly:Astyanax_mexicanus-2.0:16:37830411:37833917:-1 gene:ENSAMXG00000003753.2 transcript:ENSAMXT00000003855.2 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 53.9138 bits (128), Expect = 4.776e-8
Identity = 25/55 (45.45%), Postives = 34/55 (61.82%), Query Frame = 3
Query:  432 NLLIEDYLRCQICREYFIKPVITNCGHTFCQSCLDQWALRTRYGGGNCPLCQHQI 596
            N L ED  +C IC + F  PV T CGH FC+SCL Q+   T++   +CPLC+ + 
Sbjct:   24 NPLSEDQFQCSICLDVFTDPVSTPCGHNFCKSCLTQYWNSTQH--CHCPLCKEKF 76          
BLAST of RING-type domain-containing protein vs. Ensembl Cavefish
Match: ENSAMXT00000044185.1 (pep primary_assembly:Astyanax_mexicanus-2.0:12:1783221:1790459:-1 gene:ENSAMXG00000034119.1 transcript:ENSAMXT00000044185.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 53.5286 bits (127), Expect = 7.075e-8
Identity = 29/74 (39.19%), Postives = 47/74 (63.51%), Query Frame = 3
Query:  441 IEDYLRCQICREYFIKPVITNCGHTFCQSCLD-QWALRTRYGGGNCPLCQHQIEYTSRNILI--ETCVEALLKQ 653
            +E+ L+C IC E F  PV+ +C H+FC++CL+  W+L+       CPLC+   E +  NIL+  E C ++LL++
Sbjct:    8 LEENLKCPICLELFRDPVLLHCSHSFCRTCLESSWSLKDVR---ECPLCRKTSEGSLLNILVLKEAC-DSLLEE 77          
BLAST of RING-type domain-containing protein vs. Ensembl Sea Lamprey
Match: ENSPMAT00000008283.1 (pep scaffold:Pmarinus_7.0:GL492550:1249:4726:-1 gene:ENSPMAG00000007497.1 transcript:ENSPMAT00000008283.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 54.299 bits (129), Expect = 7.797e-9
Identity = 21/83 (25.30%), Postives = 50/83 (60.24%), Query Frame = 3
Query:  438 LIEDYLRCQICREYFIKPVITNCGHTFCQSCLDQWALRTRYGGGNCPLCQHQIEYTSRNILIETCVEALLKQLPETSRIEWNK 686
            ++E+ L+C IC E FI+    +C HTFC++C+++W  +       CP+C+     ++ +++++ C+  +++ L +  + E ++
Sbjct:  340 VMENELQCIICSELFIQATTLSCAHTFCRNCIEEWLKQKEL----CPICRASPTSSTPSLVLDNCIARMVESLGQEKKAERDE 418          
BLAST of RING-type domain-containing protein vs. Ensembl Sea Lamprey
Match: ENSPMAT00000008284.1 (pep scaffold:Pmarinus_7.0:GL492550:1249:4726:-1 gene:ENSPMAG00000007497.1 transcript:ENSPMAT00000008284.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 53.9138 bits (128), Expect = 8.696e-9
Identity = 21/83 (25.30%), Postives = 50/83 (60.24%), Query Frame = 3
Query:  438 LIEDYLRCQICREYFIKPVITNCGHTFCQSCLDQWALRTRYGGGNCPLCQHQIEYTSRNILIETCVEALLKQLPETSRIEWNK 686
            ++E+ L+C IC E FI+    +C HTFC++C+++W  +       CP+C+     ++ +++++ C+  +++ L +  + E ++
Sbjct:  339 VMENELQCIICSELFIQATTLSCAHTFCRNCIEEWLKQKEL----CPICRASPTSSTPSLVLDNCIARMVESLGQEKKAERDE 417          
BLAST of RING-type domain-containing protein vs. Ensembl Sea Lamprey
Match: ENSPMAT00000005270.1 (pep scaffold:Pmarinus_7.0:GL480405:17764:25842:-1 gene:ENSPMAG00000004750.1 transcript:ENSPMAT00000005270.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 51.6026 bits (122), Expect = 7.403e-8
Identity = 19/45 (42.22%), Postives = 28/45 (62.22%), Query Frame = 3
Query:  459 CQICREYFIKPVITNCGHTFCQSCLD-QWALRTRYGGGNCPLCQH 590
            C +C + FI P    CGH+FC+SC++  W +    GG +CP C+H
Sbjct:   14 CSVCLDMFITPCTLPCGHSFCRSCIETHWRVNCARGGCDCPQCRH 58          
BLAST of RING-type domain-containing protein vs. Ensembl Sea Lamprey
Match: ENSPMAT00000000299.1 (pep scaffold:Pmarinus_7.0:GL484837:4300:10751:-1 gene:ENSPMAG00000000266.1 transcript:ENSPMAT00000000299.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 48.521 bits (114), Expect = 6.337e-7
Identity = 23/58 (39.66%), Postives = 32/58 (55.17%), Query Frame = 3
Query:  441 IEDYLRCQICREYFIKPVITNCGHTFCQSC-LDQWALRTRYGGGNCPLCQHQIEYTSR 611
            +E+ L C IC +Y+  PVI NC H+FC+ C L  W     +G  NCP C+    +  R
Sbjct:    4 LENELTCPICFQYYRDPVILNCKHSFCRECILKTW----EHGPSNCPHCRMLFFFMDR 57          
BLAST of RING-type domain-containing protein vs. Ensembl Sea Lamprey
Match: ENSPMAT00000001651.1 (pep scaffold:Pmarinus_7.0:GL478037:21275:40632:1 gene:ENSPMAG00000001486.1 transcript:ENSPMAT00000001651.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 46.595 bits (109), Expect = 2.881e-6
Identity = 26/71 (36.62%), Postives = 40/71 (56.34%), Query Frame = 3
Query:  453 LRCQICREYFIKPVITNCGHTFCQSCLDQ-WALRTRYGG-GNCPLCQHQIEYTSRNILIETCVEA-LLKQL 656
            L C +C E F +PV   CGH FCQ C+++ W      G   +CP C+ +  + +R +L +  V A ++KQL
Sbjct:   12 LTCVVCMEEFAEPVTLGCGHNFCQGCIERCWEAEEGAGAPPSCPQCRRR--FAARPLLQKNTVLANVVKQL 80          
BLAST of RING-type domain-containing protein vs. Ensembl Yeast
Match: RAD18 (E3 ubiquitin ligase; forms heterodimer with Rad6p to monoubiquitinate PCNA-K164; heterodimer binds single-stranded DNA and has single-stranded DNA dependent ATPase activity; required for postreplication repair; SUMO-targeted ubiquitin ligase (STUbl) that contains a SUMO-interacting motif (SIM) which stimulates its ubiquitin ligase activity towards the sumoylated form of PCNA [Source:SGD;Acc:S000000662])

HSP 1 Score: 50.447 bits (119), Expect = 8.615e-8
Identity = 22/49 (44.90%), Postives = 29/49 (59.18%), Query Frame = 3
Query:  441 IEDYLRCQICREYFIKPVITNCGHTFCQSCLDQWALRTRYGG-GNCPLC 584
            ++  LRC IC+++   PV+T CGHTFC  C     +RT      NCPLC
Sbjct:   22 LDTLLRCHICKDFLKVPVLTPCGHTFCSLC-----IRTHLNNQPNCPLC 65          
BLAST of RING-type domain-containing protein vs. Ensembl Yeast
Match: PSH1 (E3 ubiquitin ligase targeting centromere-binding protein Cse4p; mediates polyubiquitination and degradation of histone H3 variant Cse4p, preventing its mislocalization to euchromatin independent of Slx5p; ubiquitination of Cse4p may be antagonized by Scm3p [Source:SGD;Acc:S000005415])

HSP 1 Score: 46.9802 bits (110), Expect = 1.298e-6
Identity = 18/48 (37.50%), Postives = 24/48 (50.00%), Query Frame = 3
Query:  453 LRCQICREYFIKPVITNCGHTFCQSCLDQWALRTRYGGGNCPLCQHQI 596
            L C IC +Y   P++T CGH +C  CL+ W          CP C+  I
Sbjct:   28 LVCSICHDYMFVPMMTPCGHNYCYGCLNTWFASNTQKELACPQCRSDI 75          
BLAST of RING-type domain-containing protein vs. Ensembl Yeast
Match: CWC24 (General splicing factor; required for stable U2 snRNP binding to primary transcripts; essential for the first step of splicing; component of the pre-catalytic spliceosome complex containing Cef1p; similar to S. pombe Cwf24p [Source:SGD;Acc:S000004315])

HSP 1 Score: 44.669 bits (104), Expect = 4.840e-6
Identity = 17/53 (32.08%), Postives = 28/53 (52.83%), Query Frame = 3
Query:  453 LRCQICREYFIKPVITNCGHTFCQSCLDQWALRTRYGGGNCPLCQHQIEYTSR 611
             +C +C+E +  PV+TNCGH FC SC      +    G  C +C  +   +++
Sbjct:  197 FKCTLCKEDYKSPVVTNCGHYFCGSCF----AKDMKKGTKCFICHKETHGSAK 245          
BLAST of RING-type domain-containing protein vs. Ensembl Nematostella
Match: EDO48594 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RIZ5])

HSP 1 Score: 54.6842 bits (130), Expect = 1.264e-8
Identity = 25/88 (28.41%), Postives = 46/88 (52.27%), Query Frame = 3
Query:  441 IEDYLRCQICREYFIKPVITNCGHTFCQSCLDQWALRTRYGGGNCPLCQHQIEYTS-RNILIETCVEALLKQLPETSRIEWNKTVQER 701
            +ED   C +C+E FI+     C H+FC+ CL  W LR R     CP+C+  ++    R+I+++  +  ++  +   S+      ++ER
Sbjct:  451 MEDEFSCIVCQELFIRATTLTCSHSFCEYCLQSW-LRKR---NTCPICRCAVQSQPVRSIVLDNAIAKMVDSMDVASKERRRAVMEER 534          
BLAST of RING-type domain-containing protein vs. Ensembl Nematostella
Match: EDO30002 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7T215])

HSP 1 Score: 48.521 bits (114), Expect = 5.927e-8
Identity = 23/61 (37.70%), Postives = 35/61 (57.38%), Query Frame = 3
Query:  441 IEDYLRCQICREYFIKPVITNCGHTFCQSCLDQWALRTRYGGGN--CPLCQHQIEYTSRNI 617
            +ED + C IC E+F  P +  C H+FC+ CL++ AL +  G G   CPLC+ + +     I
Sbjct:    9 LEDEVTCSICIEHFNDPRVLPCFHSFCRHCLEELALHSE-GRGKLVCPLCKAEFKVICHKI 68          
BLAST of RING-type domain-containing protein vs. Ensembl Nematostella
Match: EDO30997 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SZ68])

HSP 1 Score: 47.3654 bits (111), Expect = 9.147e-8
Identity = 19/50 (38.00%), Postives = 29/50 (58.00%), Query Frame = 3
Query:  447 DYLRCQICREYFIKPVITNCGHTFCQSCLDQWALRTRYGGGNCPLCQHQI 596
            D++ C IC+E   +P+ T C H FC  C+ +W  +T Y    CP+C+  I
Sbjct:   12 DFVFCAICKEVLTQPIATPCDHYFCVLCICEWLDQT-YNKSGCPVCKASI 60          
BLAST of RING-type domain-containing protein vs. Ensembl Nematostella
Match: EDO41113 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S5F1])

HSP 1 Score: 51.2174 bits (121), Expect = 1.278e-7
Identity = 23/59 (38.98%), Postives = 33/59 (55.93%), Query Frame = 3
Query:  441 IEDYLRCQICREYFIKPVITNCGHTFCQSCLDQWALRTRYGGGNCPLCQHQIEYTSRNI 617
            +ED + C IC E+F  P +  C HTFC+ CL+  A  +  G   CPLC+ + E    +I
Sbjct:    9 LEDEVTCAICIEHFTDPRLLPCLHTFCRHCLEDLAEHSGKGKLVCPLCKVEYEIAVADI 67          
BLAST of RING-type domain-containing protein vs. Ensembl Nematostella
Match: EDO48322 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RJT0])

HSP 1 Score: 46.9802 bits (110), Expect = 1.377e-7
Identity = 19/50 (38.00%), Postives = 28/50 (56.00%), Query Frame = 3
Query:  447 DYLRCQICREYFIKPVITNCGHTFCQSCLDQWALRTRYGGGNCPLCQHQI 596
            D++ C IC+E   +P+ T C H FC  C+ +W L   Y    CP+C+  I
Sbjct:   12 DFVFCAICKEVLTQPIATPCDHYFCVLCICEW-LDQTYNKSGCPVCKASI 60          
BLAST of RING-type domain-containing protein vs. Ensembl Medaka
Match: rnf8 (ring finger protein 8 [Source:NCBI gene;Acc:101166923])

HSP 1 Score: 60.077 bits (144), Expect = 5.126e-10
Identity = 26/73 (35.62%), Postives = 42/73 (57.53%), Query Frame = 3
Query:  438 LIEDYLRCQICREYFIKPVITNCGHTFCQSCLDQWALRTRYGGGNCPLCQHQIEYTSRNILIETCVEALLKQL 656
            ++E+ L+C IC E FI+ V  NC H+FC  C+ QW    R     CP+C+  I   SR + ++  +E +++ L
Sbjct:  370 VLENELQCIICSELFIEAVTLNCAHSFCSYCITQW----RKKKEECPICRQAITSQSRCLALDNFIERMMENL 438          
BLAST of RING-type domain-containing protein vs. Ensembl Medaka
Match: rnf8 (ring finger protein 8 [Source:NCBI gene;Acc:101166923])

HSP 1 Score: 60.077 bits (144), Expect = 5.426e-10
Identity = 26/73 (35.62%), Postives = 42/73 (57.53%), Query Frame = 3
Query:  438 LIEDYLRCQICREYFIKPVITNCGHTFCQSCLDQWALRTRYGGGNCPLCQHQIEYTSRNILIETCVEALLKQL 656
            ++E+ L+C IC E FI+ V  NC H+FC  C+ QW    R     CP+C+  I   SR + ++  +E +++ L
Sbjct:  350 VLENELQCIICSELFIEAVTLNCAHSFCSYCITQW----RKKKEECPICRQAITSQSRCLALDNFIERMMENL 418          
BLAST of RING-type domain-containing protein vs. Ensembl Medaka
Match: rnf8 (ring finger protein 8 [Source:NCBI gene;Acc:101166923])

HSP 1 Score: 59.3066 bits (142), Expect = 7.463e-10
Identity = 26/73 (35.62%), Postives = 42/73 (57.53%), Query Frame = 3
Query:  438 LIEDYLRCQICREYFIKPVITNCGHTFCQSCLDQWALRTRYGGGNCPLCQHQIEYTSRNILIETCVEALLKQL 656
            ++E+ L+C IC E FI+ V  NC H+FC  C+ QW    R     CP+C+  I   SR + ++  +E +++ L
Sbjct:  370 VLENELQCIICSELFIEAVTLNCAHSFCSYCITQW----RKKKEECPICRQAITSQSRCLALDNFIERMMENL 438          
BLAST of RING-type domain-containing protein vs. Ensembl Medaka
Match: lonrf1l (LON peptidase N-terminal domain and ring finger 1 [Source:NCBI gene;Acc:101155327])

HSP 1 Score: 58.151 bits (139), Expect = 2.338e-9
Identity = 35/91 (38.46%), Postives = 49/91 (53.85%), Query Frame = 3
Query:  423 PENNLLIEDYLRCQICREYFIKPVITNCGHTFCQSCLDQWALRTRYGGGNCPLCQHQI-EYTS-RNILIETCVEALLKQLPETSRIEWNKT 689
            PE  L   D L C +C   F +PV T CGHTFC++CL++    T +    CPLC+  + EY + R  ++ T +E L+KQ       E  KT
Sbjct:  486 PEGMLDSSD-LECSLCMRLFYEPVTTPCGHTFCKNCLERCLDHTPH----CPLCKESLKEYLACRKYMVTTVLEVLIKQHLSHDYAERTKT 571          
BLAST of RING-type domain-containing protein vs. Ensembl Medaka
Match: ENSORLT00000027996.1 (pep primary_assembly:ASM223467v1:18:22473420:22531351:1 gene:ENSORLG00000026635.1 transcript:ENSORLT00000027996.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 57.3806 bits (137), Expect = 4.355e-9
Identity = 29/69 (42.03%), Postives = 40/69 (57.97%), Query Frame = 3
Query:  441 IEDYLRCQICREYFIKPVITNCGHTFCQSCLDQWALRTRYGGGNCPLCQHQIEYTSR-NILIETCVEAL 644
            +E +L C IC E F KPV T+CGH+FC+ CL    L  +Y    CPLC+  +  T   NI++   VE +
Sbjct:   14 MEKHLCCTICMEPFKKPVTTSCGHSFCRGCLK---LHFKYLSTMCPLCKTHVNKTPEVNIVLRDIVEHM 79          
BLAST of RING-type domain-containing protein vs. Planmine SMEST
Match: SMESG000007981.1 (SMESG000007981.1)

HSP 1 Score: 411.764 bits (1057), Expect = 1.864e-147
Identity = 221/222 (99.55%), Postives = 221/222 (99.55%), Query Frame = 3
Query:   42 MYLLGVGKNEFSFLKMRYKLDKEEISVGRGKKNDINISSLVLSQKQFSLKRFIDHWEVTNFSRTNGTLKNKIPLPFEKSEVINTNDILSIGSDGTYQLIFTDYFNYEXXXXXXXXXXXXXXXXXXXTPENNLLIEDYLRCQICREYFIKPVITNCGHTFCQSCLDQWALRTRYGGGNCPLCQHQIEYTSRNILIETCVEALLKQLPETSRIEWNKTVQERQP 707
            MYLLGVGKNEFSFLKMRYKLDKEEISVGRGKKNDINISSLVLSQKQFSLKRFIDHWEVTNFSRTNGTLKNKIPLPFEKSEVI TNDILSIGSDGTYQLIFTDYFNYEKLKENYNMLNNNLILSINKTPENNLLIEDYLRCQICREYFIKPVITNCGHTFCQSCLDQWALRTRYGGGNCPLCQHQIEYTSRNILIETCVEALLKQLPETSRIEWNKTVQERQP
Sbjct:    1 MYLLGVGKNEFSFLKMRYKLDKEEISVGRGKKNDINISSLVLSQKQFSLKRFIDHWEVTNFSRTNGTLKNKIPLPFEKSEVIYTNDILSIGSDGTYQLIFTDYFNYEKLKENYNMLNNNLILSINKTPENNLLIEDYLRCQICREYFIKPVITNCGHTFCQSCLDQWALRTRYGGGNCPLCQHQIEYTSRNILIETCVEALLKQLPETSRIEWNKTVQERQP 222          
BLAST of RING-type domain-containing protein vs. Planmine SMEST
Match: SMESG000007981.1 (SMESG000007981.1)

HSP 1 Score: 380.948 bits (977), Expect = 1.408e-135
Identity = 206/207 (99.52%), Postives = 206/207 (99.52%), Query Frame = 3
Query:   87 MRYKLDKEEISVGRGKKNDINISSLVLSQKQFSLKRFIDHWEVTNFSRTNGTLKNKIPLPFEKSEVINTNDILSIGSDGTYQLIFTDYFNYEXXXXXXXXXXXXXXXXXXXTPENNLLIEDYLRCQICREYFIKPVITNCGHTFCQSCLDQWALRTRYGGGNCPLCQHQIEYTSRNILIETCVEALLKQLPETSRIEWNKTVQERQP 707
            MRYKLDKEEISVGRGKKNDINISSLVLSQKQFSLKRFIDHWEVTNFSRTNGTLKNKIPLPFEKSEVI TNDILSIGSDGTYQLIFTDYFNYEKLKENYNMLNNNLILSINKTPENNLLIEDYLRCQICREYFIKPVITNCGHTFCQSCLDQWALRTRYGGGNCPLCQHQIEYTSRNILIETCVEALLKQLPETSRIEWNKTVQERQP
Sbjct:    1 MRYKLDKEEISVGRGKKNDINISSLVLSQKQFSLKRFIDHWEVTNFSRTNGTLKNKIPLPFEKSEVIYTNDILSIGSDGTYQLIFTDYFNYEKLKENYNMLNNNLILSINKTPENNLLIEDYLRCQICREYFIKPVITNCGHTFCQSCLDQWALRTRYGGGNCPLCQHQIEYTSRNILIETCVEALLKQLPETSRIEWNKTVQERQP 207          
BLAST of RING-type domain-containing protein vs. Planmine SMEST
Match: SMESG000075024.1 (SMESG000075024.1)

HSP 1 Score: 48.521 bits (114), Expect = 1.130e-6
Identity = 21/68 (30.88%), Postives = 37/68 (54.41%), Query Frame = 3
Query:  441 IEDYLRCQICREYFIKPVITNCGHTFCQSCLDQWALRTRYGGGNCPLCQHQIEYTSRNILIETCVEAL 644
            I ++L CQIC++ F  P   +CGHTFC++C+ QW +       +CP  + ++    +N  +   +  L
Sbjct:   36 ISEHLICQICQDVFNDPWCLSCGHTFCRTCITQWIV----SNNSCPADRTKVTLCCKNFTLANIIGDL 99          
BLAST of RING-type domain-containing protein vs. Planmine SMEST
Match: SMESG000006795.1 (SMESG000006795.1)

HSP 1 Score: 49.6766 bits (117), Expect = 1.184e-6
Identity = 26/86 (30.23%), Postives = 41/86 (47.67%), Query Frame = 3
Query:  441 IEDYLRCQICREYFIKPVITNCGHTFCQSCLDQWALRTRYGGGNCPLCQHQIEYT---------SRNILIETCVEALLKQLPETSR 671
             +D+  C+ICRE      + +CGH  CQSC   + L  +Y   NCP C  +I+ T         S+++      E++   + E SR
Sbjct:  288 FDDFKECKICRESEKDLQLESCGHQICQSC---YKLLRKYDKRNCPFCNQKIQSTTKIVNVKDPSKDVDAMKSAESVYMDMSEPSR 370          
BLAST of RING-type domain-containing protein vs. Planmine SMEST
Match: SMESG000066342.1 (SMESG000066342.1)

HSP 1 Score: 46.9802 bits (110), Expect = 3.988e-6
Identity = 23/57 (40.35%), Postives = 34/57 (59.65%), Query Frame = 3
Query:  438 LIEDYLRCQICREYFIKP-VITNCGHTFCQSCLDQWALRTRYGGGNCPLCQHQIEYT 605
            ++  +L C +C  Y I P ++T C HTFC+SC+ ++    RY    CPLCQ  I+ T
Sbjct:   12 VLNAHLICALCGGYLIDPTMLTQCLHTFCKSCIFKYLEHNRY----CPLCQCLIQET 64          
The following BLAST results are available for this feature:
BLAST of RING-type domain-containing protein vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
RNF82.565e-1033.33ring finger protein 8 [Source:HGNC Symbol;Acc:HGNC... [more]
LONRF19.577e-830.61LON peptidase N-terminal domain and ring finger 1 ... [more]
LONRF19.577e-830.61LON peptidase N-terminal domain and ring finger 1 ... [more]
TRIM41.002e-647.17tripartite motif containing 4 [Source:HGNC Symbol;... [more]
LONRF11.592e-630.61LON peptidase N-terminal domain and ring finger 1 ... [more]
back to top
BLAST of RING-type domain-containing protein vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 1
Match NameE-valueIdentityDescription
T02C1.29.589e-632.10pep chromosome:WBcel235:III:9251029:9253126:1 gene... [more]
back to top
BLAST of RING-type domain-containing protein vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of RING-type domain-containing protein vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
rnf81.241e-1133.33ring finger protein 8, E3 ubiquitin protein ligase... [more]
rnf81.739e-1133.33ring finger protein 8, E3 ubiquitin protein ligase... [more]
btr313.582e-829.89bloodthirsty-related gene family, member 31 [Sourc... [more]
btr313.582e-829.89bloodthirsty-related gene family, member 31 [Sourc... [more]
btr021.103e-744.00bloodthirsty-related gene family, member 2 [Source... [more]
back to top
BLAST of RING-type domain-containing protein vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
bmpr1a9.897e-1132.00bone morphogenetic protein receptor type 1A [Sourc... [more]
bmpr1a1.129e-1032.00bone morphogenetic protein receptor type 1A [Sourc... [more]
ENSXETT00000015963.13.873e-740.98pep primary_assembly:Xenopus_tropicalis_v9.1:KV460... [more]
xnf71.009e-636.76Nuclear factor 7 [Source:NCBI gene;Acc:100327256][more]
xnf71.069e-636.76Nuclear factor 7 [Source:NCBI gene;Acc:100327256][more]
back to top
BLAST of RING-type domain-containing protein vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Gm280431.022e-1131.87predicted gene, 28043 [Source:MGI Symbol;Acc:MGI:5... [more]
Rnf82.206e-1131.87ring finger protein 8 [Source:MGI Symbol;Acc:MGI:1... [more]
Lonrf12.704e-830.61LON peptidase N-terminal domain and ring finger 1 ... [more]
Lonrf11.249e-630.61LON peptidase N-terminal domain and ring finger 1 ... [more]
Trim502.921e-631.87tripartite motif-containing 50 [Source:MGI Symbol;... [more]
back to top
BLAST of RING-type domain-containing protein vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q2HJ46|RNF8_BOVIN8.262e-1133.33E3 ubiquitin-protein ligase RNF8 OS=Bos taurus OX=... [more]
sp|Q803C1|RNF8_DANRE1.185e-1033.33E3 ubiquitin-protein ligase rnf8 OS=Danio rerio OX... [more]
sp|Q6CHI1|RAD18_YARLI1.205e-1037.50Postreplication repair E3 ubiquitin-protein ligase... [more]
sp|Q8VC56|RNF8_MOUSE1.543e-1031.87E3 ubiquitin-protein ligase RNF8 OS=Mus musculus O... [more]
sp|Q4KLN8|RNF8_RAT1.805e-1030.77E3 ubiquitin-protein ligase RNF8 OS=Rattus norvegi... [more]
back to top
BLAST of RING-type domain-containing protein vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A5E4NQ883.504e-1135.63RING-type domain-containing protein OS=Cinara cedr... [more]
A0A5E4NSJ33.832e-1135.63RING-type domain-containing protein OS=Cinara cedr... [more]
A0A091EB505.644e-1134.67E3 ubiquitin-protein ligase RNF8 OS=Corvus brachyr... [more]
A0A443Q9H96.947e-1132.58E3 ubiquitin-protein ligase RNF8-like protein (Fra... [more]
A0A093QJ569.050e-1134.67E3 ubiquitin-protein ligase RNF8 OS=Manacus vitell... [more]
back to top
BLAST of RING-type domain-containing protein vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
rnf81.675e-1030.34ring finger protein 8 [Source:NCBI gene;Acc:103022... [more]
rnf81.704e-1030.34ring finger protein 8 [Source:NCBI gene;Acc:103022... [more]
ENSAMXT00000048012.11.331e-832.88pep primary_assembly:Astyanax_mexicanus-2.0:12:175... [more]
ENSAMXT00000003855.24.776e-845.45pep primary_assembly:Astyanax_mexicanus-2.0:16:378... [more]
ENSAMXT00000044185.17.075e-839.19pep primary_assembly:Astyanax_mexicanus-2.0:12:178... [more]
back to top
BLAST of RING-type domain-containing protein vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ENSPMAT00000008283.17.797e-925.30pep scaffold:Pmarinus_7.0:GL492550:1249:4726:-1 ge... [more]
ENSPMAT00000008284.18.696e-925.30pep scaffold:Pmarinus_7.0:GL492550:1249:4726:-1 ge... [more]
ENSPMAT00000005270.17.403e-842.22pep scaffold:Pmarinus_7.0:GL480405:17764:25842:-1 ... [more]
ENSPMAT00000000299.16.337e-739.66pep scaffold:Pmarinus_7.0:GL484837:4300:10751:-1 g... [more]
ENSPMAT00000001651.12.881e-636.62pep scaffold:Pmarinus_7.0:GL478037:21275:40632:1 g... [more]
back to top
BLAST of RING-type domain-containing protein vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 3
Match NameE-valueIdentityDescription
RAD188.615e-844.90E3 ubiquitin ligase; forms heterodimer with Rad6p ... [more]
PSH11.298e-637.50E3 ubiquitin ligase targeting centromere-binding p... [more]
CWC244.840e-632.08General splicing factor; required for stable U2 sn... [more]
back to top
BLAST of RING-type domain-containing protein vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
EDO485941.264e-828.41Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO300025.927e-837.70Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO309979.147e-838.00Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO411131.278e-738.98Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO483221.377e-738.00Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of RING-type domain-containing protein vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
rnf85.126e-1035.62ring finger protein 8 [Source:NCBI gene;Acc:101166... [more]
rnf85.426e-1035.62ring finger protein 8 [Source:NCBI gene;Acc:101166... [more]
rnf87.463e-1035.62ring finger protein 8 [Source:NCBI gene;Acc:101166... [more]
lonrf1l2.338e-938.46LON peptidase N-terminal domain and ring finger 1 ... [more]
ENSORLT00000027996.14.355e-942.03pep primary_assembly:ASM223467v1:18:22473420:22531... [more]
back to top
BLAST of RING-type domain-containing protein vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000007981.11.864e-14799.55SMESG000007981.1[more]
SMESG000007981.11.408e-13599.52SMESG000007981.1[more]
SMESG000075024.11.130e-630.88SMESG000075024.1[more]
SMESG000006795.11.184e-630.23SMESG000006795.1[more]
SMESG000066342.13.988e-640.35SMESG000066342.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30015687 ID=SMED30015687|Name=RING-type domain-containing protein|organism=Schmidtea mediterranea sexual|type=transcript|length=767bp
ATTCAATTTATATAATAAAGGTTTAGCATAAATTTATTGAAATGTATCTT
TTAGGTGTTGGGAAAAATGAATTTTCATTTTTAAAAATGCGATATAAATT
GGATAAAGAAGAGATTTCTGTTGGTCGTGGTAAGAAGAATGACATTAATA
TTTCGTCACTAGTTCTATCTCAAAAACAATTTTCATTGAAAAGATTTATT
GATCATTGGGAAGTTACAAATTTCAGTCGTACTAATGGTACTTTAAAAAA
TAAAATTCCACTGCCCTTTGAAAAAAGTGAAGTGATAAATACAAATGATA
TTTTATCAATCGGCAGTGATGGGACTTATCAACTCATATTTACCGATTAT
TTCAATTATGAAAAATTGAAGGAAAATTATAATATGCTAAACAATAATTT
AATATTAAGTATCAACAAGACACCAGAAAATAATTTATTGATTGAGGATT
ATTTACGATGTCAAATATGCCGAGAATATTTTATAAAACCAGTTATTACC
AATTGCGGTCATACATTTTGCCAATCCTGTCTCGATCAATGGGCATTAAG
AACAAGATATGGCGGTGGAAATTGCCCACTTTGTCAACATCAAATCGAGT
ACACTTCTCGTAATATTTTAATCGAGACTTGTGTAGAAGCACTGTTAAAA
CAACTTCCGGAAACTTCCCGGATAGAATGGAATAAAACTGTTCAAGAACG
TCAACCGAAAAAACGGAAAGGATGTAAAAAGAAAGATTAAAAATGTTTCT
ATTTGCAGTGAAATAGA
back to top

protein sequence of SMED30015687-orf-1

>SMED30015687-orf-1 ID=SMED30015687-orf-1|Name=SMED30015687-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=233bp
MYLLGVGKNEFSFLKMRYKLDKEEISVGRGKKNDINISSLVLSQKQFSLK
RFIDHWEVTNFSRTNGTLKNKIPLPFEKSEVINTNDILSIGSDGTYQLIF
TDYFNYEKLKENYNMLNNNLILSINKTPENNLLIEDYLRCQICREYFIKP
VITNCGHTFCQSCLDQWALRTRYGGGNCPLCQHQIEYTSRNILIETCVEA
LLKQLPETSRIEWNKTVQERQPKKRKGCKKKD*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: biological process
TermDefinition
GO:0016567protein ubiquitination
Vocabulary: molecular function
TermDefinition
GO:0061630ubiquitin protein ligase activity
GO:0008270zinc ion binding
GO:0005515protein binding
GO:0016874ligase activity
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000014zeta neoblast
PLANA:0000026gut
PLANA:0000420parapharyngeal region
PLANA:0000429neoblast
PLANA:0002075pigment cell
PLANA:0002109X1 cell
PLANA:0002142parenchyma
Vocabulary: INTERPRO
TermDefinition
IPR001841Znf_RING
IPR013083Znf_RING/FYVE/PHD
IPR000253FHA_dom
IPR017907Znf_RING_CS
IPR008984SMAD_FHA_dom_sf
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
NoneNo IPR availableCOILSCoilCoilcoord: 106..126
NoneNo IPR availableGENE3DG3DSA:2.60.200.20coord: 8..97
e-value: 2.0E-10
score: 42.5
NoneNo IPR availablePFAMPF15227zf-C3HC4_4coord: 140..181
e-value: 5.3E-11
score: 42.5
NoneNo IPR availablePANTHERPTHR16079UBIQUITIN LIGASE PROTEIN CHFRcoord: 18..212
NoneNo IPR availablePANTHERPTHR16079:SF4E3 UBIQUITIN-PROTEIN LIGASE CHFRcoord: 18..212
NoneNo IPR availableCDDcd16449RING-HCcoord: 140..181
e-value: 1.22803E-12
score: 58.2477
NoneNo IPR availableSUPERFAMILYSSF57850RING/U-boxcoord: 129..188
IPR001841Zinc finger, RING-typeSMARTSM00184ring_2coord: 140..181
e-value: 1.8E-9
score: 47.4
IPR001841Zinc finger, RING-typePROSITEPS50089ZF_RING_2coord: 140..182
score: 13.64
IPR000253Forkhead-associated (FHA) domainPFAMPF00498FHAcoord: 26..91
e-value: 7.2E-6
score: 26.3
IPR000253Forkhead-associated (FHA) domainPROSITEPS50006FHA_DOMAINcoord: 25..74
score: 7.336
IPR000253Forkhead-associated (FHA) domainCDDcd00060FHAcoord: 21..96
e-value: 5.13365E-4
score: 36.2102
IPR013083Zinc finger, RING/FYVE/PHD-typeGENE3DG3DSA:3.30.40.10coord: 111..232
e-value: 8.3E-21
score: 76.0
IPR017907Zinc finger, RING-type, conserved sitePROSITEPS00518ZF_RING_1coord: 155..164
IPR008984SMAD/FHA domain superfamilySUPERFAMILYSSF49879SMAD/FHA domaincoord: 3..129