Nuclear pore membrane glycoprotein 210

Overview
NameNuclear pore membrane glycoprotein 210
Smed IDSMED30015686
Length (bp)6361
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Nuclear pore membrane glycoprotein 210 (SMED30015686) t-SNE clustered cells

Violin plots show distribution of expression levels for Nuclear pore membrane glycoprotein 210 (SMED30015686) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Nuclear pore membrane glycoprotein 210 (SMED30015686) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Nuclear pore membrane glycoprotein 210 (SMED30015686) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30015686

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 11

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
X1 cellSMED30015686SMESG000046650.1 SmedASXL_017765SmedAsxl_ww_GCZZ01PMID:26114597
Zhu et al., 2015
FACS sorted cell population asexual adult RNA-sequencing evidence
X2 cellSMED30015686SMESG000046650.1 SmedASXL_017765SmedAsxl_ww_GCZZ01PMID:26114597
Zhu et al., 2015
FACS sorted cell population asexual adult RNA-sequencing evidence
nervous systemSMED30015686SMESG000046650.1 dd_Smed_v4_4698_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
epidermisSMED30015686SMESG000046650.1 dd_Smed_v4_4698_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
cephalic gangliaSMED30015686SMESG000046650.1 dd_Smed_v4_4698_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
muscle cellSMED30015686SMESG000046650.1 dd_Smed_v4_4698_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
neoblastSMED30015686SMESG000046650.1 dd_Smed_v4_4698_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
parenchymal cellSMED30015686SMESG000046650.1 dd_Smed_v4_4698_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30015686SMESG000046650.1 Contig54793newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30015686SMESG000046650.1 Contig54793uc_Smed_v2PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
zeta neoblastSMED30015686SMESG000046650.1 dd_Smed_v4_4698_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Nuclear pore membrane glycoprotein 210 vs. Ensembl Human
Match: NUP210 (nucleoporin 210 [Source:HGNC Symbol;Acc:HGNC:30052])

HSP 1 Score: 317.005 bits (811), Expect = 2.293e-113
Identity = 224/747 (29.99%), Postives = 381/747 (51.00%), Query Frame = 1
Query:  109 KLSDSKVLLPRTSYLSINYTIKGSPNICHEWISETPEVVVITPIYSSDGSKCSEQATITSVWQSNTKATGTVYAKNIATGHSVKCDVIIDQIRKLEIETRTLELYLHETPEALIARAYDEYGNTFSTLDGIPFEWLI---NHIGSNGDAQNVLRFITWTESEYVTPSLIGNLEQQGLMGYMQLVSGLKTGAAEVSLTFRDEXXXXXXXXXXXXXXXMANAALSPPLAYLIPYTQLSYKIIVHSQGSTQEVIMPNNQYLLKINNT----------DLAQLDFKGSTITAKKYGQTEVILIDKNINED--FRHPSSLLYIVEPGFLTFHISPHENQWVLQTMKDNIYTITIRPYDFNSHPIFMSDNIRLETLIPKEYFEVLHSSLNGTYNVVKTIKEGKTSLKSKLNFILLPNKTEFKLENPVEGTQDLIIYPPITVLPKFVVLPWYPNIKSIPGYLFSATGGSGEYKWMAH-----DDNHKINNLSISVDNKGFIKP-MKLGLSNVVAADQRNLNNIGTAIVLVDIIKSLQFIIDIVEVEIHNELDLPIFATN------SKANKISHCYWLPFNAISEDPSIIEVVKIAAVEHSKHPDACAFLKVRGLKPGFSKLTITLRNQPNEIIREMLTSSITIGSFIPTKFLDPLSGSTTIGVRSSITMNIAYGPLPWLLDPSNYFYEMVEDSTSKQIVKKLSLTDNRHNLKLRTLQLKVQCISVGEVNISIFISNKKSLKHPKPVKSTGLAKL 2268
            KL+  KVLLP T    +N+T++ S   C+ W+S  PEV  I P+   D  +CS++A + +      + T  ++A++I TG  ++CD I+D I  ++I + T ELYL ++P  L  +A D  GNTFSTL G+ FEW I   +      D+ N LR +T+ ES Y+ PS I  +E+    G   LVSG+KTG++++    ++   K++  ++   L++           YL+  T + YK+    QG   E+ MP++QY L++ N+           +A L    S +TA + GQ+ ++L  ++I      R P+S +Y+VEPG+L F + P  ++WVL+T +  +Y ITI  +D  S+ +++SDNIR+ET++P E+FEVL SS NG+Y+ ++ +K G+T++ + L  ++  +     L+ PV   Q++ I+ PIT+ P  +  PW P              G+ +Y   AH           ++L  +V  KG +     +G S + A D +N  + G   V V    S++F    VE  +   L+LP+  +       S+   +S C         E+  + + +       S+H   C+ ++V+    G + L ++ R+         L++ ITI +++P K +DP S    + + SS  M    GP PW+L+PS +F  +  + T       L+L     +   +   + V C ++GE  I++ + NK SL +P P     + K 
Sbjct:   27 KLNIPKVLLPFTRATRVNFTLEASEG-CYRWLSTRPEVASIEPL-GLDEQQCSQKAVVQARLTQPARLTSIIFAEDITTGQVLRCDAIVDLIHDIQIVSTTRELYLEDSPLELKIQALDSEGNTFSTLAGLVFEWTIVKDSEADRFSDSHNALRILTFLESTYIPPSYISEMEKAAKQGDTILVSGMKTGSSKLKARIQEAVYKNVRPAEVRLLILENILLNPAYDVYLMVGTSIHYKVQKIRQGKITELSMPSDQYELQLQNSIPGPEGDPARPVAVLAQDTSMVTALQLGQSSLVLGHRSIRMQGASRLPNSTIYVVEPGYLGFTVHPG-DRWVLETGR--LYEITIEVFDKFSNKVYVSDNIRIETVLPAEFFEVLSSSQNGSYHRIRALKRGQTAIDAALTSVVDQDGGVHILQVPVWNQQEVEIHIPITLYPSILTFPWQPKT------------GAYQYTIRAHGGSGNFSWSSSSHLVATVTVKGVMTTGSDIGFSVIQAHDVQNPLHFGEMKVYVIEPHSMEFAPCQVEARVGQALELPLRISGLMPGGASEVVTLSDCSHFDLAVEVENQGVFQPLPGRLPPGSEH---CSGIRVKAEAQGSTTLLVSYRHG-----HVHLSAKITIAAYLPLKAVDP-SSVALVTLGSSKEMLFEGGPRPWILEPSKFFQNVTAEDTDS---IGLALFAPHSSRNYQQHWILVTCQALGEQVIALSVGNKPSLTNPFPAVEPAVVKF 744          

HSP 2 Score: 115.931 bits (289), Expect = 2.293e-113
Identity = 198/993 (19.94%), Postives = 394/993 (39.68%), Query Frame = 2
Query: 2306 RLICTVPVRMKLVPRLISSNISTGCPFQNTSENQHITVDNKNPSSVEIVFTDKNGVQLERSESFAVKVEIKSLNKKNIKEIVQVIYPTVIYXXXXXXXXXXXKFL--VTPYRFGESTGEI----------EVIVKSSSCISGKCPAFNLESHLQIQISRSMIVNPITILLYQHEKVSTKFYVNYGSGYFTVTTPNNDFLXXXXXXXXXXXXXXVSYEIIQTKVDYSQRNAI------------INVIDACFSSLETEFENSKTIEIELVKPFKLQIFSLNRVQLGSQINVLLKIYDDNGREFPKDALHLLSMALHFTDRSNIVSANSLYSKDWVLTPNEFSESSGFVFKVNGEKLGFSSIYVELIN---TDITSNILKIEVFPPLKLLPKYTVLLEGSEIQLSTIGGPQNCHELLHYSIIKNETRNVKEAKIEFIIGPKGLLKAVSFGETSVVIKVEVIDADPTRNNRLTVLSKDEGRVGVVQIKSISIWSPTKNLLVGNSMPLWVTFASSSNDLQHIPITGFSITGLANSAISFKWHLNPPQGVISRLENVLEPAGINIGNKYLHSGMRLITSNPGKQTIEISISNV-PKRWLSIDLQHNLPLNSKINIAIIPKLEIIYPISYVQSVLVPPATKITLKTSLDDIALITYTLI--PYQVDKISSKAQSKIHSGNILETNPNLSDNKVENFILHVTSSQSIKLNTANEITANQTVALFFTVKHPTYSM--MSPYISSNSIFKQFQTTKFINKHSSIFVLPLGGPFEFHITNHDELGNIFDISPDTNMFSYQLHRSDNIGITICSSESIRKSDSLKESTTLNIDPILTFIDSKSFSSQKVLQFQGLSTGENTIQLFYHDLLSDSPQLTDIISIPTGSVLEMKKFPQNLATEGSRVKYEAPFSGGYWYSSEGDIVSIDSSFGDAILKNRGSSNIFYSLANAYPNIEKVQNKNVLISHELIVHGASKISMKIIEGTS----LPLDD--SCLKSECIP 5170
            + +C  P R+ L P   S  +   CP    ++       ++NP  +++   D+ G + +   S +++ E       + + ++  I P +     S +  S  K L  +      E++G            E  + S+       P   L + +++ +   + V+P  + +Y H  +  +  +  GSGYF + T   D +                      KV Y +   +            I + D C       F       + +    +L I  +++V++G  +   +++ D + + F   A +   M L     S I++  +L         +E  ++    F + G  +G +S+   + N     I S   +IEVFPP +L+P+   LL G+ +Q+++ GGPQ    +L    I NE+  +  A         GL++ ++ G  +V   V+ +DA+     ++ ++S+D  +V V+ ++++ I +P   +  G  MP++VT  ++  +        FS  G A   ++F W +   +  +  L      A I + ++Y +  M ++    G+  + + +  V P       L     L+ +I + +  KL+++ P    + +L+ P + I L+T+ D  A ++Y ++  P +V  +    +  + SG+++ T+                   +I++       ANQT+ +   V   +Y    MSP + +             NK + + V PLG    F +  HD  G++F     +++ ++  +R D +         I K  +        +   LT +         +  F  L             L + SP+L+  + +  G VL +     +L  EG           G W SS   I+ ID   G A+ +  GS  ++Y +A    ++   +   V +   ++      I     E T+    + + D  S L+ EC P
Sbjct:  743 KFVCAPPSRLTLAPVYTSPQLDMSCPLLQQNKQVVPVSSHRNPR-LDLAAYDQEGRRFDNFSSLSIQWE-------STRPVLASIEPELPMQLVSQDDESGQKKLHGLQAILVHEASGTTAITATATGYQESHLSSARTKQPHDPLVPLSASIELILVEDVRVSPEEVTIYNHPGIQAELRIREGSGYFFLNTSTADVV----------------------KVAYQEARGVAMVHPLLPGSSTIMIHDLCLV-----FPAPAKAVVYVSDIQELYIRVVDKVEIGKTVKAYVRVLDLHKKPF--LAKYFPFMDLKLRAASPIITLVAL---------DEALDNYTITFLIRGVAIGQTSLTASVTNKAGQRINSAPQQIEVFPPFRLMPRKVTLLIGATMQVTSEGGPQPQSNILFS--ISNESVALVSA--------AGLVQGLAIGNGTVSGLVQAVDAE---TGKVVIISQDLVQVEVLLLRAVRIRAPIMRMRTGTQMPIYVTGITNHQN-------PFSF-GNAVPGLTFHWSVT--KRDVLDLRGRHHEASIRLPSQY-NFAMNVLGRVKGRTGLRVVVKAVDPTSGQLYGLARE--LSDEIQVQVFEKLQLLNPEIEAEQILMSPNSYIKLQTNRDGAASLSYRVLDGPEKVPVVHVDEKGFLASGSMIGTS-------------------TIEVIAQEPFGANQTIIVAVKVSPVSYLRVSMSPVLHTQ------------NKEALVAV-PLGMTVTFTVHFHDNSGDVFHA--HSSVLNFATNRDDFV--------QIGKGPTNNTCVVRTVSVGLTLLRVWDAEHPGLSDFMPLPV-----------LQAISPELSGAMVV--GDVLCLATVLTSL--EG---------LSGTWSSSANSILHIDPKTGVAVARAVGSVTVYYEVAG---HLRTYKEVVVSVPQRIMARHLHPIQTSFQEATASKVIVAVGDRSSNLRGECTP 1594          
BLAST of Nuclear pore membrane glycoprotein 210 vs. Ensembl Human
Match: NUP210L (nucleoporin 210 like [Source:HGNC Symbol;Acc:HGNC:29915])

HSP 1 Score: 278.87 bits (712), Expect = 9.583e-75
Identity = 201/705 (28.51%), Postives = 358/705 (50.78%), Query Frame = 1
Query:  190 CHEWISETPEVVVITPIYSSDGSKCSEQATITSVWQSNTKATGTVYAKNIATGHSVKCDVIIDQIRKLEIETRTLELYLHETPEALIARAYDEYGNTFSTLDGIPFEWLI--NHIGSNGDAQNVLRFITWTESEYVTPSLIGNLEQQGLMGYMQLVSGLKTGAAEVSLTFRDEXXXXXXXXXXXXXXXMANAALSPPL-AYLIPYTQLSYKIIVHSQGSTQEVIMPNNQYLLKINN----------TDLAQLDFKGSTITAKKYGQTEVILIDKNINEDFRH--PSSLLYIVEPGFLTFHISPHENQWVLQTMKDNIYTITIRPYDFNSHPIFMSDNIRLETLIPKEYFEVLHSSLNGTYNVVKTIKEGKTSLKSKLNFILLPNKTEFKLENPVEGTQDLIIYPPITVLPKFVVLPWYPNIKSIPGYLFSATGGSGEYKWMAHDDNHKINNLSISVDNKGFIKPMKL-GLSNVVAADQRNLNNIGTAIVLVDIIKSLQFIIDIVEVEIHNELDLPIFATN-----SKANKISHCYWLPFNAISEDPSIIEVVKIAAVEHSKHPDACAFLKVRGLKPGFSKLTITLRNQPNEIIREMLTSSITIGSFIPTKFLDPLSGSTTIGVRSSITMNIAYGPLPWLLDPSNYFYEMVEDSTSKQIVKKLSLTDNRHNLKLRTLQLKVQCISVGEVNISIFISNKKSLKHPKP 2241
            C+ W S   + V + P+Y  +G+ CS++A + +      + +  + A+ I T H ++CDV +D I  +EI +R  ELY+ ++P  L+ RA D  GNTFS+L G+ FEW I  ++  +  +  + +R + ++E+EY  P  I  +E++   G + LVSG++TGAA V +    E     + +  ++LLV+ N  L P    YL+  T + Y++    QG   EV  P   Y+L++ +            +A LD K + +TA + GQT ++ + KN++       P+  +Y+VEPGFL F + P  N+W L+     +Y IT+  +D +S  +++SDN+R+    PKEYFE   +++NG+Y++VK +K+G   + + L  I+  NK    ++  ++  Q++ IY PI + PKF+  P +P +  +  Y     GGSG + W +       N   + V  KG +   ++ G S V+A D +N    G   + V  +  ++ +    +VEI   +++PI   +      +A   + C  L  +   +   +  ++K         P  C+   +     G + +T+++    NE   + L SS T  ++ P K L+P+  +  +  +S   M    GP PW+L+PS +F E+  + T K  + ++ L   R   K      ++QC+ +GE  ++  I N   + +P P
Sbjct:   65 CYTWHSTHHDAVTVEPLYE-NGTLCSQKAVLIAESTQPIRLSSIILAREIVTDHELRCDVKVDVINSIEIVSRARELYVDDSPLELMVRALDAEGNTFSSLAGMMFEWSIAQDNESAREELSSKIRILKYSEAEYAPPIYIAEMEKEEKQGDVILVSGIRTGAAVVKVRIH-EPFYKKVAAALIRLLVLENIFLIPSHDIYLLVGTYIKYQVAKMVQGRVTEVKFPLEHYILELQDHRVALNGSHSEKVAILDDKTAMVTASQLGQTNLVFVHKNVHMRSVSGLPNCTIYVVEPGFLGFTVQP-GNRWSLEV--GQVYVITVDVFDKSSTKVYISDNLRITYDFPKEYFEEQLTTVNGSYHIVKALKDGVVVINASLTSIIYQNKDIQPIKFLIKHQQEVKIYFPIMLTPKFLAFPHHP-MGMLYRYKVQVEGGSGNFTWTSS------NETVVIVTTKGVVTAGQVRGNSTVLARDVQNPFRYGEIKIHVLKLNKMELLPFHADVEIGQIIEIPIAMYHINKETKEAMAFTDCSHLSLDLNMDKQGVFTLLKEGI--QRPGPMHCSSTHIAAKSLGHTLVTVSV----NE-CDKYLESSATFAAYEPLKALNPVEVA-LVTWQSVKEMVFEGGPRPWILEPSRFFLELNAEKTEKIGIAQVWLPSKR---KQNQYIYRIQCLDLGEQVLTFRIGNHPGVLNPSP 746          

HSP 2 Score: 86.6557 bits (213), Expect = 5.208e-16
Identity = 101/489 (20.65%), Postives = 220/489 (44.99%), Query Frame = 2
Query: 2750 MIVNPITIL-----LYQHEKVSTKFYVNYGSGYFTVTTPNNDFLXXXXXXXXXXXXXXVSYEIIQTKVDYSQRNA---IINVIDACFSSLETEFENSKTIEIELVKPFKLQIFSLNRVQLGSQINVLLKIYDDNGREFPKDALHLLSMALHFTDRSNIVSANSL-----YSKDWVLTPNEFSESSGFVFKVNGEKLGFSSIYVELINTDITSNILKIEVFPPLKLLPKYTVLLEGSEIQLSTIGGPQNCHELLHYSIIKNETRNVKEAKIEFIIGPKGLLKAVSFGETSVVIKVEVIDADPTRNNRLTVLSKDEGRVGVVQIKSISIWSPTKNLLVGNSMPLWVTFASSSNDLQHIPITGFSITGLANSAISFKWHLNPPQ--GVISRLENVLEPAGINIGNKYLHSGMRLITSNPGKQTIEISISNVPKRWLSIDLQHN-LPLNSKINIAIIPKLEIIYPISYVQSVLVPPATKITLKTSLDDIALIT 4168
            ++V+ +T++     +Y H  V   F +  GSGYF V +     +              ++Y   ++ V+    +     + V D C + L     + +  +I+     +L++  +++V++   + V +++   + R F     +  +M L     S IV+   +     YS++++L      +++  +  +  +K+G             TS    IEVFPP +LLP+   L+  + +Q+ + GGPQ    ++H+S I N+T  V        +  +G +     G   V   ++ ++ D     ++ V S+DE ++ VVQ++++ I +    L+    MP++V   +S+        T FS +  AN  ++F W ++      ++ R   V     + + + +    M + T   G+ +I++++  +     S   + N L L+ ++ I +  KL++ YP    + +L+P  +++ L T+ +  A ++
Sbjct:  895 LLVDDVTVVPENATIYNHPDVKETFSLVEGSGYFLVNSSEQGVVT-------------ITYMEAESSVELVPLHPGFFTLEVYDLCLAFLGPATAHLRVSDIQ-----ELELDLIDKVEIDKTVLVTVRVLGSSKRPFQNK--YFRNMELKLQLASAIVTLTPMEQQDEYSENYILRATTIGQTT--LVAIAKDKMG----------RKYTSTPRHIEVFPPFRLLPEKMTLIPMNMMQVMSEGGPQP-QSIVHFS-ISNQTVAV--------VNRRGQVTGKIVGTAVVHGTIQTVNED---TGKVIVFSQDEVQIEVVQLRAVRILAAATRLITATKMPVYVMGVTSTQ-------TPFSFSN-ANPGLTFHWSMSKRDVLDLVPRHSEVF--LQLPVEHNF---AMVVHTKAAGRTSIKVTVHCMNSS--SGQFEGNLLELSDEVQILVFEKLQLFYPECQPEQILMPINSQLKLHTNREGAAFVS 1323          
BLAST of Nuclear pore membrane glycoprotein 210 vs. Ensembl Human
Match: NUP210L (nucleoporin 210 like [Source:HGNC Symbol;Acc:HGNC:29915])

HSP 1 Score: 278.485 bits (711), Expect = 1.901e-74
Identity = 201/705 (28.51%), Postives = 358/705 (50.78%), Query Frame = 1
Query:  190 CHEWISETPEVVVITPIYSSDGSKCSEQATITSVWQSNTKATGTVYAKNIATGHSVKCDVIIDQIRKLEIETRTLELYLHETPEALIARAYDEYGNTFSTLDGIPFEWLI--NHIGSNGDAQNVLRFITWTESEYVTPSLIGNLEQQGLMGYMQLVSGLKTGAAEVSLTFRDEXXXXXXXXXXXXXXXMANAALSPPL-AYLIPYTQLSYKIIVHSQGSTQEVIMPNNQYLLKINN----------TDLAQLDFKGSTITAKKYGQTEVILIDKNINEDFRH--PSSLLYIVEPGFLTFHISPHENQWVLQTMKDNIYTITIRPYDFNSHPIFMSDNIRLETLIPKEYFEVLHSSLNGTYNVVKTIKEGKTSLKSKLNFILLPNKTEFKLENPVEGTQDLIIYPPITVLPKFVVLPWYPNIKSIPGYLFSATGGSGEYKWMAHDDNHKINNLSISVDNKGFIKPMKL-GLSNVVAADQRNLNNIGTAIVLVDIIKSLQFIIDIVEVEIHNELDLPIFATN-----SKANKISHCYWLPFNAISEDPSIIEVVKIAAVEHSKHPDACAFLKVRGLKPGFSKLTITLRNQPNEIIREMLTSSITIGSFIPTKFLDPLSGSTTIGVRSSITMNIAYGPLPWLLDPSNYFYEMVEDSTSKQIVKKLSLTDNRHNLKLRTLQLKVQCISVGEVNISIFISNKKSLKHPKP 2241
            C+ W S   + V + P+Y  +G+ CS++A + +      + +  + A+ I T H ++CDV +D I  +EI +R  ELY+ ++P  L+ RA D  GNTFS+L G+ FEW I  ++  +  +  + +R + ++E+EY  P  I  +E++   G + LVSG++TGAA V +    E     + +  ++LLV+ N  L P    YL+  T + Y++    QG   EV  P   Y+L++ +            +A LD K + +TA + GQT ++ + KN++       P+  +Y+VEPGFL F + P  N+W L+     +Y IT+  +D +S  +++SDN+R+    PKEYFE   +++NG+Y++VK +K+G   + + L  I+  NK    ++  ++  Q++ IY PI + PKF+  P +P +  +  Y     GGSG + W +       N   + V  KG +   ++ G S V+A D +N    G   + V  +  ++ +    +VEI   +++PI   +      +A   + C  L  +   +   +  ++K         P  C+   +     G + +T+++    NE   + L SS T  ++ P K L+P+  +  +  +S   M    GP PW+L+PS +F E+  + T K  + ++ L   R   K      ++QC+ +GE  ++  I N   + +P P
Sbjct:   65 CYTWHSTHHDAVTVEPLYE-NGTLCSQKAVLIAESTQPIRLSSIILAREIVTDHELRCDVKVDVINSIEIVSRARELYVDDSPLELMVRALDAEGNTFSSLAGMMFEWSIAQDNESAREELSSKIRILKYSEAEYAPPIYIAEMEKEEKQGDVILVSGIRTGAAVVKVRIH-EPFYKKVAAALIRLLVLENIFLIPSHDIYLLVGTYIKYQVAKMVQGRVTEVKFPLEHYILELQDHRVALNGSHSEKVAILDDKTAMVTASQLGQTNLVFVHKNVHMRSVSGLPNCTIYVVEPGFLGFTVQP-GNRWSLEV--GQVYVITVDVFDKSSTKVYISDNLRITYDFPKEYFEEQLTTVNGSYHIVKALKDGVVVINASLTSIIYQNKDIQPIKFLIKHQQEVKIYFPIMLTPKFLAFPHHP-MGMLYRYKVQVEGGSGNFTWTSS------NETVVIVTTKGVVTAGQVRGNSTVLARDVQNPFRYGEIKIHVLKLNKMELLPFHADVEIGQIIEIPIAMYHINKETKEAMAFTDCSHLSLDLNMDKQGVFTLLKEGI--QRPGPMHCSSTHIAAKSLGHTLVTVSV----NE-CDKYLESSATFAAYEPLKALNPVEVA-LVTWQSVKEMVFEGGPRPWILEPSRFFLELNAEKTEKIGIAQVWLPSKR---KQNQYIYRIQCLDLGEQVLTFRIGNHPGVLNPSP 746          

HSP 2 Score: 86.2705 bits (212), Expect = 6.569e-16
Identity = 101/489 (20.65%), Postives = 220/489 (44.99%), Query Frame = 2
Query: 2750 MIVNPITIL-----LYQHEKVSTKFYVNYGSGYFTVTTPNNDFLXXXXXXXXXXXXXXVSYEIIQTKVDYSQRNA---IINVIDACFSSLETEFENSKTIEIELVKPFKLQIFSLNRVQLGSQINVLLKIYDDNGREFPKDALHLLSMALHFTDRSNIVSANSL-----YSKDWVLTPNEFSESSGFVFKVNGEKLGFSSIYVELINTDITSNILKIEVFPPLKLLPKYTVLLEGSEIQLSTIGGPQNCHELLHYSIIKNETRNVKEAKIEFIIGPKGLLKAVSFGETSVVIKVEVIDADPTRNNRLTVLSKDEGRVGVVQIKSISIWSPTKNLLVGNSMPLWVTFASSSNDLQHIPITGFSITGLANSAISFKWHLNPPQ--GVISRLENVLEPAGINIGNKYLHSGMRLITSNPGKQTIEISISNVPKRWLSIDLQHN-LPLNSKINIAIIPKLEIIYPISYVQSVLVPPATKITLKTSLDDIALIT 4168
            ++V+ +T++     +Y H  V   F +  GSGYF V +     +              ++Y   ++ V+    +     + V D C + L     + +  +I+     +L++  +++V++   + V +++   + R F     +  +M L     S IV+   +     YS++++L      +++  +  +  +K+G             TS    IEVFPP +LLP+   L+  + +Q+ + GGPQ    ++H+S I N+T  V        +  +G +     G   V   ++ ++ D     ++ V S+DE ++ VVQ++++ I +    L+    MP++V   +S+        T FS +  AN  ++F W ++      ++ R   V     + + + +    M + T   G+ +I++++  +     S   + N L L+ ++ I +  KL++ YP    + +L+P  +++ L T+ +  A ++
Sbjct:  895 LLVDDVTVVPENATIYNHPDVKETFSLVEGSGYFLVNSSEQGVVT-------------ITYMEAESSVELVPLHPGFFTLEVYDLCLAFLGPATAHLRVSDIQ-----ELELDLIDKVEIDKTVLVTVRVLGSSKRPFQNK--YFRNMELKLQLASAIVTLTPMEQQDEYSENYILRATTIGQTT--LVAIAKDKMG----------RKYTSTPRHIEVFPPFRLLPEKMTLIPMNMMQVMSEGGPQP-QSIVHFS-ISNQTVAV--------VNRRGQVTGKIVGTAVVHGTIQTVNED---TGKVIVFSQDEVQIEVVQLRAVRILAAATRLITATKMPVYVMGVTSTQ-------TPFSFSN-ANPGLTFHWSMSKRDVLDLVPRHSEVF--LQLPVEHNF---AMVVHTKAAGRTSIKVTVHCMNSS--SGQFEGNLLELSDEVQILVFEKLQLFYPECQPEQILMPINSQLKLHTNREGAAFVS 1323          
BLAST of Nuclear pore membrane glycoprotein 210 vs. Ensembl Human
Match: NUP210L (nucleoporin 210 like [Source:HGNC Symbol;Acc:HGNC:29915])

HSP 1 Score: 75.0998 bits (183), Expect = 1.254e-12
Identity = 67/279 (24.01%), Postives = 136/279 (48.75%), Query Frame = 2
Query: 3341 TSNILKIEVFPPLKLLPKYTVLLEGSEIQLSTIGGPQNCHELLHYSIIKNETRNVKEAKIEFIIGPKGLLKAVSFGETSVVIKVEVIDADPTRNNRLTVLSKDEGRVGVVQIKSISIWSPTKNLLVGNSMPLWVTFASSSNDLQHIPITGFSITGLANSAISFKWHLNPPQ--GVISRLENVLEPAGINIGNKYLHSGMRLITSNPGKQTIEISISNVPKRWLSIDLQHN-LPLNSKINIAIIPKLEIIYPISYVQSVLVPPATKITLKTSLDDIALIT 4168
            TS    IEVFPP +LLP+   L+  + +Q+ + GGPQ    ++H+S I N+T  V        +  +G +     G   V   ++ ++ D     ++ V S+DE ++ VVQ++++ I +    L+    MP++V   +S+        T FS +  AN  ++F W ++      ++ R   V     + + + +    M + T   G+ +I++++  +     S   + N L L+ ++ I +  KL++ YP    + +L+P  +++ L T+ +  A ++
Sbjct:    6 TSTPRHIEVFPPFRLLPEKMTLIPMNMMQVMSEGGPQP-QSIVHFS-ISNQTVAV--------VNRRGQVTGKIVGTAVVHGTIQTVNED---TGKVIVFSQDEVQIEVVQLRAVRILAAATRLITATKMPVYVMGVTSTQ-------TPFSFSN-ANPGLTFHWSMSKRDVLDLVPRHSEVF--LQLPVEHNF---AMVVHTKAAGRTSIKVTVHCMNSS--SGQFEGNLLELSDEVQILVFEKLQLFYPECQPEQILMPINSQLKLHTNREGAAFVS 256          
BLAST of Nuclear pore membrane glycoprotein 210 vs. Ensembl Celegans
Match: npp-12 (Nuclear Pore complex Protein [Source:UniProtKB/TrEMBL;Acc:P91495])

HSP 1 Score: 225.713 bits (574), Expect = 9.532e-59
Identity = 195/754 (25.86%), Postives = 366/754 (48.54%), Query Frame = 1
Query:  106 FKLSDSKVLLPRTSYLSINYTIKGS--PNICHEWISETPEVVVITPIYSSDGSKCSEQATITSVWQSNT----KATGTVYAKNIATGHSVKCDVIIDQIRKLEIETRTLELYLHETPEALIARAYDEYGNTFSTLDGIPFEWLINHIGSNGDAQNVLRFITWTESEYVTPSLIGNLEQQGLMGYMQLVSGLKTGAAEVSLTFRDEXXXXXXXXXXXXXXXMANAALSPPLAYLIP-YTQLSYKIIVHSQGSTQEVIMPNNQYLLKINNTDLAQLDFKGSTITAKKYGQTEVILIDKNIN----EDFRHPSSLLYIVEPGFLTFHISPHENQWVLQTMKDNIYTITIRPYDFNSHPIFMSDNIRLETLIPKEYFEVLHSSLNGTYNVVKTIKEGKTSLKSKLNFILLPNKTEFKLENPVEGTQDLIIYPPITVLPKFVVLPWYPNIKSIPGYLFSATGGSGEYKWMAHDDNHKINNLSISVDNKGFIKPMKLGLSNVVAADQRN--LNNIGTAIVLVDIIKSLQFIIDIVEVEIHNELDLPIFATNSKAN----KISHCYWLPFNAISEDPSIIEVVKIAAVEHSKHPDA--------CAFLKVRGLKPGFSKLTITLRNQPNEIIREMLTSSITIGSFIPTKFLDPLSGSTTIGVRSSITMNIAYGPLPWLLDPSNYFYEMVEDSTSK--------QIVKKLSLTDNRHNLKLRTLQLKVQCISV---GEVNISIFISNKKSL----KHPKPVK 2247
            ++L+  +VLLP    + +++ ++ +     C  W S  P++V +  I +++   CS++A I SV +  T    + +  ++A++  +G ++ C V +D+I  + IET T  L++   P  +   A++  G+ FSTL  I  EW +    SN      LR + + +S Y  PS I  LE+    GY+ L+ G+ TG A ++  F D      + + +V+L V+AN  L P     +P ++ L +++++  Q  T+ V MPN  Y L+I+  D+A LD K S++ A   G T V L+  +++       R PS+++++V+   + +H+S   + W+L+T K   YTI +   D + + +F++DN R +T I +++  V   S NGT+ +V  +K  KT+L++K   I+            + G Q + I  P+ ++P  + LP+    +S      +ATGGSG ++W + D +    +L       G +    LG + V A D+RN  L +I +  +L   +  + F   + E  + + L L I AT   ++    ++S C  +  +        +++   A + H    D+        C  +  +GL  G ++++I+              +SI +  +   + L     S++I + S+  + ++ GP PW+LDP+N FY+  E   S+        +++ K   ++    ++LR   LK   + +    E+ +SI  +    L    K  +P K
Sbjct:   19 YRLNVPRVLLPYHPTVPVSFVLEVTHPTGGCFTWRSTRPDIVSVKRIETNEAG-CSDKAEIRSVAKPGTVGSSELSAVIFAEDKGSGTTLSCGVTVDEIATISIETTTKVLFVDAAPARMTVDAFNADGDRFSTLSEIALEWELASTSSN--KAKPLRIVPFEQSTYEAPSEIVKLEKNRKKGYLILIEGVGTGTATLTTKFSD-AYLQKVAAHNVELAVVANLLLVPSQDVYLPVHSVLPFQVLIVKQRGTEIVNMPNPSYELQIDGGDVASLDKKSSSVRALTIGNTAVHLLSSHVDVRAKAGLRPPSTVIHVVDAESVQWHVS--GDNWMLETGKQ--YTINVELLDEHGNVMFVADNSRFDTHIDEQFLHVDFKSENGTWFLVTPLKPSKTTLRTKFVAIIDAKGNRIAQSGKIGGEQRVTIVDPVRIVPPVIYLPFVSEKRS--QIDLTATGGSGLFEWTSEDGHVATVDLL-----TGRMTANSLGSTKVKATDKRNDQLRDIASVHILE--VSGIGFGETVRETFVGDTLTLNIKATGLTSDGLLVEMSDCRNIRAH--------VQITDNALLRHESSADSSLPMMGTGCGTITFKGLSSGDARVSISYLGH---------KASIDVAVY---EKLSISEESSSIALGSTHPLTVSGGPRPWILDPAN-FYKTQETKQSQLQVTFENEKVLFKCGSSEVTEAVRLRIGNLKSSTLPLPIHSEITVSICCAKPTRLEIFDKKQRPSK 734          
BLAST of Nuclear pore membrane glycoprotein 210 vs. Ensembl Fly
Match: Gp210 (gene:FBgn0266580 transcript:FBtr0086044)

HSP 1 Score: 191.815 bits (486), Expect = 2.593e-48
Identity = 169/685 (24.67%), Postives = 306/685 (44.67%), Query Frame = 1
Query:  109 KLSDSKVLLPRTSYLSINYTIKGSPNICHEWISETPEVVVITPIYSSDGSKCSEQATITSVWQSNTKATGTVYAKNIATGHSVKCDVIIDQIRKLEIETRTLELYLHETPEALIARAYDEYGNTFSTLDGIPFEWLINHIGSNGDAQNVLRFITWTESEYVT-PSLIGNLEQQGLMGYMQLVSGLKTGAAEVSLTFRDEXXXXXXXXXXXXXXXMANAALSPPLAYLIPYTQLSYKIIVHSQGSTQEVIMPNNQYLLKINNTDLAQLDFKGSTITAKKYGQTEVILIDKNI---NEDFRHPSSLLYIVEPGFLTFHISPHENQWVLQTMKDNIYTITIRPYDFNSHPIFMSDNIRLETLIPKEYFEVLHSSLNGTYNVVKTIKEGKTSLKSKLNFILLPNKTEFKLENPVEGTQDLIIYPPITVLPKFVVLPWYPNIKSIPGYLFSATGGSGEYKWMAHDDNHKINNLSISVDNKGFIKPMKLGLSNVVAADQRNLNNIGTAIVLVDIIKSLQFIIDIVEVEIHNELDLPIFATNSKANKISHCYWLP----------FNAISEDPSIIEVVKIAAVEHSKHP------------------------------DACAFLKVRGLKPGFSKLTITLRNQPNEIIREMLTSSITIGSFIPTKFLDPLSGSTTIGVRSSITMNIAYGP 2031
            +L+  +VLLP     +IN+T++     C++W S   +++ + PIY    S+C+ QA +T       + T  V+A+ + TG +++ DVI+D I  L + T T +LYL E P      A+DE GN F TL+GI F+W I   GS       +R++T+T+S Y T P  I   E  G  G+M L+ G+ TG A+V++    +     ++   V + V+AN  + P    ++    +S++I+          ++ NNQY L++ ++ +A L  +G++ T    G+T+V L D+N+   +E  + PS+LL +  P  L+  + PH N WV  T++   + I +  +  +   I M     + + + + +F ++  + NG+    +  KEG T +      + +                +L I+  + + P  VVLP+ PN        F A+GG   Y W +       N   I +D +G                   + ++ +A V  +++K      D  ++  H  + + + + N K ++++H Y+LP          F    +D   + V   A + +S+ P                              +AC  L++R    G + L ++        + ++L   I +  F P   L+P+     + V SS  +  A GP
Sbjct:   22 RLNHPRVLLPIFEDKAINFTLEVDEPNCYKWSSSRQDLISVMPIYKG-FSECAYQAVVTVRTHDRRRNTAIVFAEEVQTGETLRSDVIVDVIASLNVRTATRQLYLEEAPAMFELHAFDEQGNEFFTLEGIEFDWEILEPGSK--RPTAMRYLTFTDSPYHTVPPTIEKFEADGKKGHMILLEGINTGTAKVTIAM-PQAEYKHVRPVEVYISVLANIIIEPSEVTIMAGDSVSFRILQLKMDRLH--VIDNNQYYLEVEDSSIAYL--RGNSATGAALGRTQVFLRDRNMADSDEVQKGPSALLTVAYPNRLSISLLPHLN-WV--TVQGEHHAIALDLFAADGQKITMGTKYSINSEVDESFFAIVDRTRNGSRLFGQAKKEGITQVYGSYKDLSV--------------QAELQIFEELQLAPTKVVLPYDPNSLKPLKLQFHASGGDNNYAWFSG------NPQVIQIDTQG--------------QATTEIRDVKSAYVNQEVLK------DGGKLTAHTTVKVAL-SKNQKISRVAHIYFLPPERLQITRSNFETALKDFVHVHVGVYARINNSEVPYTSCDNLHFQLDFSQPILQLEGNEGAEAAHEACHVLRLRATAVGTTSLRVSYM-----YMDKVLYDIIDLYVFEPLVVLNPIENEVVLPVGSSRNIIYANGP 649          

HSP 2 Score: 82.4185 bits (202), Expect = 5.403e-15
Identity = 127/540 (23.52%), Postives = 235/540 (43.52%), Query Frame = 2
Query: 3023 IEIELVKPFKLQIFSLNRVQLGSQINVLLKIYDDNGREFPKDALHLLSMA-LHFTDRSNIVSANSLYSKDWVLTPNEFSESSGFVFKVNGEKLGFSSIYVELINT--DITSNILKIEVFPPLKLLPKYTVLLEGSEIQLSTIGGPQNCHELLHYSIIKNETRNVKEAKIEFIIGPKGLLKAVSFGETSVVIKVEVIDADPTRNNRLTVLSKDEGRVGVVQIKSISIWSPTKNLLVGNSMP--LWVTFASSSNDLQHIPITGFSITGLANSAISFKWHLNPPQGVISRLENVLEPAGINIGNKYLHSGMRLITSNPGKQTIEISISNVPKRWL---SIDLQHNLPLNSKINIAIIPKLEIIYPISY-VQSVLVPPATKITLKTSLDDIALITYTLIPYQVDKISSKAQSKIHSGNILETNPNLSDNKVENFILHVTSSQSIKLNTANEITANQTVALFFTVKHPTYSMMSPYISSNSIFKQFQTTKFINKHSSIFVLPLGGPFEFHITNHDELGNIFDIS-PDTNMFSYQLHRSDNIGITI 4612
            + I +V    +++ S++R++  ++I  +++++D N      D L L+  + L   D S +V+  S+ S    L   E        + + G ++G + I  +       + S+ L I+VF P++L P+ + L+ GS IQ+   GGP     ++  S+ K +   +             ++ A   G T +V K  + +    ++    V+S+D   V VV +K + I +P   +  G  MP  LW       +DL   P+    +  L N+ IS  W ++ PQ  +  + NV   AGI   +  L S +R+   NPGK TI  S++      L   ++DLQ            +   LE++ P +  + S+L  P + + LK+++D++         Y++D           S  I+   P        + ++H   S    L  A   TA+Q++ +   VK+  Y ++       ++    +  +  +K      +P G  F F ++ HD LGN    +  D N   Y+L   D++ + I
Sbjct:  959 LSISVVGIGAIEVVSMDRLERTTRIEAIVRLFDTN------DNLLLVDQSKLSAYDLSEVVADQSILSVR--LGEQENVGPGEIRYTITGNQVGETKILFQSGKGIYKVASDPLNIQVFAPIRLFPRDSTLVVGSSIQVYFHGGPHPNTNMI-ISVEKEQVATISST----------VVTAHKLGTTKIVGKCLLKNPVTGKDE---VVSQDSVEVHVVALKGVQIRTPLVRIHSGAVMPATLW-----GLSDLS--PMI---LGTLQNTKIS--WKVSQPQ--VVEIFNVFTTAGIEYQSGDLIS-VRVRALNPGKATITASVTLADGTILPPATVDLQ------------VFKTLELVTPNAIKMDSILAAPRSILQLKSNMDNVV--------YKLDD---------RSNGIVSVTP--------DGLVHTKDSLGRDLIIAT--TADQSLPIGIEVKNVQYILV-------TLMPILKLRELEHK------IPRGMNFVFKVSLHDNLGNELSHNIEDFNGLRYELGNKDDVDVQI 1409          
BLAST of Nuclear pore membrane glycoprotein 210 vs. Ensembl Fly
Match: Gp210 (gene:FBgn0266580 transcript:FBtr0335270)

HSP 1 Score: 191.815 bits (486), Expect = 2.593e-48
Identity = 169/685 (24.67%), Postives = 306/685 (44.67%), Query Frame = 1
Query:  109 KLSDSKVLLPRTSYLSINYTIKGSPNICHEWISETPEVVVITPIYSSDGSKCSEQATITSVWQSNTKATGTVYAKNIATGHSVKCDVIIDQIRKLEIETRTLELYLHETPEALIARAYDEYGNTFSTLDGIPFEWLINHIGSNGDAQNVLRFITWTESEYVT-PSLIGNLEQQGLMGYMQLVSGLKTGAAEVSLTFRDEXXXXXXXXXXXXXXXMANAALSPPLAYLIPYTQLSYKIIVHSQGSTQEVIMPNNQYLLKINNTDLAQLDFKGSTITAKKYGQTEVILIDKNI---NEDFRHPSSLLYIVEPGFLTFHISPHENQWVLQTMKDNIYTITIRPYDFNSHPIFMSDNIRLETLIPKEYFEVLHSSLNGTYNVVKTIKEGKTSLKSKLNFILLPNKTEFKLENPVEGTQDLIIYPPITVLPKFVVLPWYPNIKSIPGYLFSATGGSGEYKWMAHDDNHKINNLSISVDNKGFIKPMKLGLSNVVAADQRNLNNIGTAIVLVDIIKSLQFIIDIVEVEIHNELDLPIFATNSKANKISHCYWLP----------FNAISEDPSIIEVVKIAAVEHSKHP------------------------------DACAFLKVRGLKPGFSKLTITLRNQPNEIIREMLTSSITIGSFIPTKFLDPLSGSTTIGVRSSITMNIAYGP 2031
            +L+  +VLLP     +IN+T++     C++W S   +++ + PIY    S+C+ QA +T       + T  V+A+ + TG +++ DVI+D I  L + T T +LYL E P      A+DE GN F TL+GI F+W I   GS       +R++T+T+S Y T P  I   E  G  G+M L+ G+ TG A+V++    +     ++   V + V+AN  + P    ++    +S++I+          ++ NNQY L++ ++ +A L  +G++ T    G+T+V L D+N+   +E  + PS+LL +  P  L+  + PH N WV  T++   + I +  +  +   I M     + + + + +F ++  + NG+    +  KEG T +      + +                +L I+  + + P  VVLP+ PN        F A+GG   Y W +       N   I +D +G                   + ++ +A V  +++K      D  ++  H  + + + + N K ++++H Y+LP          F    +D   + V   A + +S+ P                              +AC  L++R    G + L ++        + ++L   I +  F P   L+P+     + V SS  +  A GP
Sbjct:   22 RLNHPRVLLPIFEDKAINFTLEVDEPNCYKWSSSRQDLISVMPIYKG-FSECAYQAVVTVRTHDRRRNTAIVFAEEVQTGETLRSDVIVDVIASLNVRTATRQLYLEEAPAMFELHAFDEQGNEFFTLEGIEFDWEILEPGSK--RPTAMRYLTFTDSPYHTVPPTIEKFEADGKKGHMILLEGINTGTAKVTIAM-PQAEYKHVRPVEVYISVLANIIIEPSEVTIMAGDSVSFRILQLKMDRLH--VIDNNQYYLEVEDSSIAYL--RGNSATGAALGRTQVFLRDRNMADSDEVQKGPSALLTVAYPNRLSISLLPHLN-WV--TVQGEHHAIALDLFAADGQKITMGTKYSINSEVDESFFAIVDRTRNGSRLFGQAKKEGITQVYGSYKDLSV--------------QAELQIFEELQLAPTKVVLPYDPNSLKPLKLQFHASGGDNNYAWFSG------NPQVIQIDTQG--------------QATTEIRDVKSAYVNQEVLK------DGGKLTAHTTVKVAL-SKNQKISRVAHIYFLPPERLQITRSNFETALKDFVHVHVGVYARINNSEVPYTSCDNLHFQLDFSQPILQLEGNEGAEAAHEACHVLRLRATAVGTTSLRVSYM-----YMDKVLYDIIDLYVFEPLVVLNPIENEVVLPVGSSRNIIYANGP 649          

HSP 2 Score: 82.4185 bits (202), Expect = 5.403e-15
Identity = 127/540 (23.52%), Postives = 235/540 (43.52%), Query Frame = 2
Query: 3023 IEIELVKPFKLQIFSLNRVQLGSQINVLLKIYDDNGREFPKDALHLLSMA-LHFTDRSNIVSANSLYSKDWVLTPNEFSESSGFVFKVNGEKLGFSSIYVELINT--DITSNILKIEVFPPLKLLPKYTVLLEGSEIQLSTIGGPQNCHELLHYSIIKNETRNVKEAKIEFIIGPKGLLKAVSFGETSVVIKVEVIDADPTRNNRLTVLSKDEGRVGVVQIKSISIWSPTKNLLVGNSMP--LWVTFASSSNDLQHIPITGFSITGLANSAISFKWHLNPPQGVISRLENVLEPAGINIGNKYLHSGMRLITSNPGKQTIEISISNVPKRWL---SIDLQHNLPLNSKINIAIIPKLEIIYPISY-VQSVLVPPATKITLKTSLDDIALITYTLIPYQVDKISSKAQSKIHSGNILETNPNLSDNKVENFILHVTSSQSIKLNTANEITANQTVALFFTVKHPTYSMMSPYISSNSIFKQFQTTKFINKHSSIFVLPLGGPFEFHITNHDELGNIFDIS-PDTNMFSYQLHRSDNIGITI 4612
            + I +V    +++ S++R++  ++I  +++++D N      D L L+  + L   D S +V+  S+ S    L   E        + + G ++G + I  +       + S+ L I+VF P++L P+ + L+ GS IQ+   GGP     ++  S+ K +   +             ++ A   G T +V K  + +    ++    V+S+D   V VV +K + I +P   +  G  MP  LW       +DL   P+    +  L N+ IS  W ++ PQ  +  + NV   AGI   +  L S +R+   NPGK TI  S++      L   ++DLQ            +   LE++ P +  + S+L  P + + LK+++D++         Y++D           S  I+   P        + ++H   S    L  A   TA+Q++ +   VK+  Y ++       ++    +  +  +K      +P G  F F ++ HD LGN    +  D N   Y+L   D++ + I
Sbjct:  959 LSISVVGIGAIEVVSMDRLERTTRIEAIVRLFDTN------DNLLLVDQSKLSAYDLSEVVADQSILSVR--LGEQENVGPGEIRYTITGNQVGETKILFQSGKGIYKVASDPLNIQVFAPIRLFPRDSTLVVGSSIQVYFHGGPHPNTNMI-ISVEKEQVATISST----------VVTAHKLGTTKIVGKCLLKNPVTGKDE---VVSQDSVEVHVVALKGVQIRTPLVRIHSGAVMPATLW-----GLSDLS--PMI---LGTLQNTKIS--WKVSQPQ--VVEIFNVFTTAGIEYQSGDLIS-VRVRALNPGKATITASVTLADGTILPPATVDLQ------------VFKTLELVTPNAIKMDSILAAPRSILQLKSNMDNVV--------YKLDD---------RSNGIVSVTP--------DGLVHTKDSLGRDLIIAT--TADQSLPIGIEVKNVQYILV-------TLMPILKLRELEHK------IPRGMNFVFKVSLHDNLGNELSHNIEDFNGLRYELGNKDDVDVQI 1409          
BLAST of Nuclear pore membrane glycoprotein 210 vs. Ensembl Zebrafish
Match: nup210 (nucleoporin 210 [Source:ZFIN;Acc:ZDB-GENE-050208-132])

HSP 1 Score: 346.28 bits (887), Expect = 1.399e-126
Identity = 238/744 (31.99%), Postives = 383/744 (51.48%), Query Frame = 1
Query:  100 NEFKLSDSKVLLPRTSYLSINYTIKGSPNICHEWISETPEVVVITPIYSSDGSKCSEQATITSVWQSNTKATGTVYAKNIATGHSVKCDVIIDQIRKLEIETRTLELYLHETPEALIARAYDEYGNTFSTLDGIPFEWLI---NHIGSNGDAQNVLRFITWTESEYVTPSLIGNLEQQGLMGYMQLVSGLKTGAAEVSLTFRDEXXXXXXXXXXXXXXXMANAALSPPL-AYLIPYTQLSYKIIVHSQGSTQEVIMPNNQYLLKINN----------TDLAQLDFKGSTITAKKYGQTEVILIDKNINED--FRHPSSLLYIVEPGFLTFHISPHENQWVLQTMKDNIYTITIRPYDFNSHPIFMSDNIRLETLIPKEYFEVLHSSLNGTYNVVKTIKEGKTSLKSKLNFILLPNKTEFKLENPVEGTQDLIIYPPITVLPKFVVLPWYPNIKSIPGYLFSATGGSGEYKWMAHDDNHKINNLSISVDNKGFIKPMK-LGLSNVVAADQRNLNNIGTAIVLVDIIKSLQFIIDIVEVEIHNELDLP--IFAT-NSKANKISHCYWLPFNAISEDPSIIEVVKIAAVEHSKHPDACAFLKVRGLKPGFSKLTITLRNQPNEIIREMLTSSITIGSFIPTKFLDPLS-GSTTIGVRSSITMNIAYGPLPWLLDPSNYFYEMVEDSTSKQIVKKLSLTDNRHNLKLRTLQLKVQCISVGEVNISIFISNKKSLKHPKPVKSTGLAKL 2268
            N  KL+  KVLLP      IN+T++ +   C+ W S  PEV  I  +   D  +CS +A + +     ++ T  + A++I TG  ++CD I+D I +++IE+ T EL+L ++P  L   A D  GNTFSTL  + FEW I     +    D+ N LR + + ES Y  P  I  +E+ G  G + LVSG+KTG A++    + E +   + +  V+LL++ N  LSP    YL+  T + YK+    QG   E+ MP +QY L++ N          T +A LD   ST+ A ++G T ++L  K++      R P+S +Y+VEPG+L F I P E++WVL+T +   Y I I  +D + H I++SDNIR+ET  P EYFEVL SS+NG+Y+ VK +K+G+T +   L  ++    +   L  PV   QD+ IY PI + P  +  PW P  +    Y+  ATGGSG + W +       N+   +V  KG +  ++ +G+S + A D RN  + G   V V     ++F    VE  +   LDLP  IF     +   +S C         E   + ++++        H   C+ ++V+ L PG++ L ++  +         L++ ITI ++ P K +DP+S    T+G  SS  M    GP PW+L+PS +F  +  +  S   +         ++  L    ++  C ++GE  +++ + N+ ++ +P P     + K 
Sbjct:   19 NAAKLNIPKVLLPLARSTKINFTLEATEG-CYRWSSNRPEVASIEAV-DVDERQCSHRAVLQARSTQPSRLTSIILAEDILTGQVLRCDAIVDVISEIQIESTTRELHLEDSPLELKIHALDSEGNTFSTLASLLFEWTIVKDAEMAGFPDSYNTLRILRFAESAYTPPGYISEMERVGHQGDIVLVSGIKTGHAKLKAKIQ-ESIYKDVGAAEVRLLILENILLSPAYDVYLLAGTSIKYKVQKIRQGKITELSMPCDQYELQLQNSAVAPNGNLNTPVANLDQSSSTVFALQHGHTNILLDHKSLGMQGASRLPNSTIYVVEPGYLAFKIHP-EDRWVLETGRK--YEIFIEVFDKSGHKIYLSDNIRIETTFPAEYFEVLESSVNGSYHHVKAVKQGQTVIDGTLKAVVDQAGSVHALSVPVRNEQDVEIYDPIVLTPAILTFPWQPK-EGAYQYIIKATGGSGNFSWSS------TNSAVATVTVKGMMTTVRDVGVSVIYAHDMRNPLHYGDMKVYVIEPVGMEFSPCAVEARVGLHLDLPLRIFGQLGDERVTLSDCSHFDMQVDMESTGVFQMLEGRLPPGQSH---CSGIRVKALIPGYTTLLVSYTHS-----NVHLSAKITIAAYPPLKPIDPVSVAVVTLG--SSKDMTFEGGPRPWVLEPSKFFRNLTAEDHSSVSLALFGPAARTYSTHL----VRATCRALGEQVLAVTVGNQPTVTNPFPAVEPAVVKF 735          

HSP 2 Score: 130.183 bits (326), Expect = 1.399e-126
Identity = 196/968 (20.25%), Postives = 391/968 (40.39%), Query Frame = 2
Query: 2306 RLICTVPVRMKLVPRLISSNISTGCPFQNTSENQHITVDNKNPSSVEIVFTDKNGVQLERSESFAVKVEIKSLNKKNIKEIVQVIYPTVIYXXXXXXXXXXXKFL---------------VTPYRFGESTGEIEVIVKSSSCISGKCPAFNLESHLQIQISRSMIVNPITILLYQHEKVSTKFYVNYGSGYFTVTTPNNDFLXXXXXXXXXXXXXXVSYEIIQTKVDYSQRNAIINVIDACFSSLETEFENSKTIEIELVKPFKLQIFSLNRVQLGSQINVLLKIYDDNGREFPKDALHLLSMALHFTDRSNIVSANSLYSKDWVLTPNEFSESSGFVFKVNGEKLGFSSIYVELINTD---ITSNILKIEVFPPLKLLPKYTVLLEGSEIQLSTIGGPQNCHELLHYSIIKNETRNVKEAKIEFIIGPKGLLKAVSFGETSVVIKVEVIDADPTRNNRLTVLSKDEGRVGVVQIKSISIWSPTKNLLVGNSMPLWVTFASSSNDLQHIPITGFSITGLANSAISFKWHLNPPQGVISRLENVLEPAGINIGNKYLHSGMRLITSNPGKQTIEISISN-VPKRWLSIDLQHN-LPLNSKINIAIIPKLEIIYPISYVQSVLVPPATKITLKTSLDDIALITYTLI--PYQVDKISSKAQSKIHSGNILETNPNLSDNKVENFILHVTSSQSIKLNTANEITANQTVALFFTVKHPTYSMM--SPYISSNSIFKQFQTTKFINKHSSIFVLPLGGPFEFHITNHDELGNIFDISPDTNMFSYQLHRSDNIGITICSSESIRKSDSLKESTTLNIDPILTFIDSKSFSSQKVLQFQGLSTGENTIQLFYHDL----LSDSPQ--LTDIISIPTGSVLEMKKFPQNLATEGSRVKYEAPF-----SGGYWYSSEGDIVSIDSSFGDAILKNRGSSNIFYSLANAYPNIEKVQNKNVLISHELIVHGASKIS 5104
            + +C  P R+ L P  ++  +   CP    ++ Q + V N +   +++   D+ G + +   S ++  E   ++  +I+       PT+       E     K                 +T    G  T  +E    ++  +SG  P   + + L + +   + V P T+ +Y H  V+    +  GSGYF V         +   + Q I       +++  +    Q    + V D C +     F +     + +    ++ +  +++V++G  +   +++ D N + F      ++++ L     S+I+S  +L        P+  SE     F V G  +G +S+   +I+ +   ITS   +IEVFPP +LLP+   ++ G+ +Q+++ GGPQ    +L +S+      +V            G ++ ++ G  +V   V+ +D   T   +L V+SKD+  V VVQ+K+I I +P   +  G  MP++V   +SS        T F+  G A   ++F W +      I  +      A + +  ++ +  M +   + G+  + + +   VP   LS  L+ + L L+ +I I +  KL+++ P    + +L+ P + + L+T+ D +  + Y ++  P +   +    +  + SG++                   T + S++++       NQTV +   V   +Y  +  SP I             + +   ++  +PLG    F +  HD  G    +    +M S+  +R D + ++                                         +GLS G  T++     L    + DS Q  L D +++P    +   +  Q L   G  V + A F     + G W SS   ++ ++   G A+ +++G+  ++Y +A                  E+++ GAS+ S
Sbjct:  734 KFVCAPPSRLTLTPIYVNPQLDVSCPLLQQNK-QVVPVSNYHNPELDVAAFDEQGRKFDNFSSLSMIWESSKVSLASIE-------PTMPMQLHVHEDNKQKKLHGHQTVLVHHESGVAGITVTAVGYQTSHLE----AAMVLSGFDPLSAVSATLDLLLVEDVRVTPDTVTIYNHPDVAAALTLQQGSGYFFVNASVGGVADVTFQESQGIA------QVVPLQAGVLQ----VMVHDLCLT-----FPSPAKATVHISDILEVYVRVVDKVEIGKSVKAYVRVLDGNKKPFLSKYFSVMNLKLRAA--SSIISLQTL--------PDS-SEEDTATFLVKGLVIGQTSVSAFIIDKNGRKITSAPQQIEVFPPFRLLPRKVTVIVGAMMQITSEGGPQPQSNIL-FSLSHQHIASVNSL---------GHVQGLAVGNMTVTGVVQAVD---TETGKLVVVSKDQVDVEVVQLKAIRIRAPITRMKTGTLMPVYVMGLTSSQ-------TPFAF-GNALPGLTFHWSVTKRD--ILDVHTRHAEASVQLSAEH-NFAMSVFGRSKGRTGLRVVMKAIVP---LSGHLEDDALELHDEIQIQVYEKLQLLNPELEAEQILMSPNSLLKLQTNRDGVGSLLYRVLDCPDRAALVQVDDKGHLTSGSM-------------------TGTASLQISAQETFGVNQTVIIAVKVVPVSYLRLSTSPVI-------------YTSNRETVSAIPLGAILTFTVHFHDSTGET--LHSHNSMLSFSTNRDDLVQVS-----------------------------------------KGLSNGTLTMRTVNVGLTLLGVWDSEQAGLADFLALPVQHAIHPAQ-AQRLVV-GDVVCFSAQFINQDGALGVWSSSSSALLEVEPRTGAAVARDKGTVTVYYEIAGLLRTYR-----------EVLIEGASRTS 1548          
BLAST of Nuclear pore membrane glycoprotein 210 vs. Ensembl Xenopus
Match: NUP210 (nucleoporin 210kDa [Source:NCBI gene;Acc:100493693])

HSP 1 Score: 314.694 bits (805), Expect = 1.966e-117
Identity = 213/707 (30.13%), Postives = 361/707 (51.06%), Query Frame = 1
Query:  205 SETPEVVVITPIYSSDGSKCSEQATITSVWQSNTKATGTVYAKNIATGHSVKCDVIIDQIRKLEIETRTLELYLHETPEALIARAYDEYGNTFSTLDGIPFEWLI---NHIGSNGDAQNVLRFITWTESEYVTPSLIGNLEQQGLMGYMQLVSGLKTGAAEVSLTFRDEXXXXXXXXXXXXXXXMANAALSPPLAYLIPYTQLSYKIIVHSQGSTQEVIMPNNQYLLKINN----------TDLAQLDFKGSTITAKKYGQTEVILIDKNI-----NEDFRHPSSLLYIVEPGFLTFHISPHENQWVLQTMKDNIYTITIRPYDFNSHPIFMSDNIRLETLIPKEYFEVLHSSLNGTYNVVKTIKEGKTSLKSKLNFILLPNKTEFKLENPVEGTQDLIIYPPITVLPKFVVLPWYPNIKSIPG---YLFSATGGSGEYKWMAHDDNHKINNLSISVDNKGFIKPM-KLGLSNVVAADQRNLNNIGTAIVLVDIIKSLQFIIDIVEVEIHNELDLP--IF----ATNSKANKISHCYWLPFNAISEDPSIIEVVKIAAVEHSKHPDACAFLKVRGLKPGFSKLTITLRNQPNEIIREMLTSSITIGSFIPTKFLDPLSGSTTIGVRSSITMNIAYGPLPWLLDPSNYFYEMVEDSTSKQIVKKLSLTDNRHNLKLRTLQLKVQCISVGEVNISIFISNKKSLKHPKP 2241
            S  PEV  I P+   D  +CS++A + +     T+ T  ++A+++ TG  ++CD I+D I  ++I + T ELYL ++P  L  +A D  GNTFSTL G+ FEW +     +    D+ N LR + + ES YV P+ I  +E+    G   LVSGLKTG++++     +   + +  ++   L++           YL+  + + Y++    QG   ++ MP++QY  ++ N            +A+L+ + ST+TA + G T ++L+ KNI         R P+  +Y+VEPG+L F + P + +WVL+T +  +Y +TI  YD +S+ +++SDNIR+E  IPKEYFEVL +SLNG+Y+ VK +K G+T + + L  ++  +     L NP+   Q++ IY PIT+ PK +  PW P     PG   Y     GGSG + W +       NN   +V  KG +     +G+S + A D +N  + G   V V     ++FI   VE  + N L+LP  IF    A +++   +S C         E    + + K+         D C+ + V+   PG++ + ++  +         L S I + +++P + +DP S    + + SS  M    GP PW+L+P+ +F  +  D      +  +  + +R + +     ++  C  +GE  IS+ + NK +  +P P
Sbjct:   31 STRPEVASIEPL-GVDERQCSQRAVVQARATHPTRLTSIIFAEDVFTGQVLRCDAIVDLIHDIQIVSTTRELYLEDSPLELKIQAMDSEGNTFSTLAGLAFEWTVVKDADVDGFSDSHNTLRMLKFLESTYVPPAYITEMEKVAKQGDTILVSGLKTGSSKLRAKMLEPVYEKVTPAQVRLLILENILLNPASDIYLLVGSSIQYRVQKIKQGKITDLTMPSDQYAFQLQNHVVAPGGLSHEPIARLEERTSTVTALQMGHTNIVLLHKNILYLRMQGASRLPNGTVYVVEPGYLGFTVHPGD-RWVLETGR--LYELTIDVYDKSSNKVYLSDNIRIEAKIPKEYFEVLETSLNGSYHRVKALKSGQTIIDAALTCMVDQDGGVHILPNPIRNQQEVEIYTPITLSPKILTFPWQPK----PGAYQYTIQVQGGSGNFTWSSS------NNPVATVTVKGLMTTGDDIGVSVIRARDVQNRLHFGEMKVYVIEPHGMEFIPSAVEARVGNRLELPLRIFGLMNADDNEVVTLSDCSNFDLAVEME---TLNIFKLLPGRLPPGKDYCSGITVQAESPGYTTVYVSYTHG-----HVHLKSKIIVAAYLPLRTVDP-SSLALVTLGSSKDMLFEGGPKPWVLEPAKFFRNVTSDKAESSSLALVEPSLSRGHFQ---HWVRATCRDLGEQVISLTVGNKPTETNPFP 711          

HSP 2 Score: 131.724 bits (330), Expect = 1.966e-117
Identity = 199/949 (20.97%), Postives = 372/949 (39.20%), Query Frame = 2
Query: 2306 RLICTVPVRMKLVPRLISSNISTGCPFQNTSENQHITVDNKNPSSVEIVFTDKNGVQLERSESFAV-----KVEIKSLNKKNIKEIVQVIYPTVIYXXXXXXXXXXXKFLVTPYRFGESTGEIEV---------IVKSSSCISGKCPAFNLESHLQIQISRSMI------------------VNPITILLYQHEKVSTKFYVNYGSGYFTVTTPNNDFLXXXXXXXXXXXXXXVSYEIIQTKVDYSQRNAIINVIDACFSSLETEFENSKTIEIELVKPFKLQIFSLNRVQLGSQINVLLKIYDDNGREFPKDALHLLSMALHFTDRSNIVSANSLYSKDWVLTPNEFSESSGFVFKVNGEKLGFSSIYV---ELINTDITSNILKIEVFPPLKLLPKYTVLLEGSEIQLSTIGGPQNCHELLHYSIIKNETRNVKEAKIEFIIGPKGLLKAVSFGETSVVIKVEVIDADPTRNNRLTVLSKDEGRVGVVQIKSISIWSPTKNLLVGNSMPLWVTFASSSNDLQHIPITGFSITGLANSAISFKWHLNPPQGVISR---LENVLE-PAGINIGNKYLHSGMRLITSNPGKQTIEISISNVPKRWLSIDLQHNLP-LNSKINIAIIPKLEIIYPISYVQSVLVPPATKITLKTSLDDIALITYTLIPYQVDKISSKAQSKIHSGNILETNPNLSDNKVENFILHVTSSQSIKLNTANEITANQTVALFFTVKHPTYS--MMSPYISSNSIFKQFQTTKFINKHSSIFVLPLGGPFEFHITNHDELGNIFDISPDTNMFSYQLHRSDNIGITICSSESIRKSDSLKESTTLNIDPILTFIDSKSFSSQKVLQFQGLSTGENTIQLFYHDLLSDSPQLTDIISIPTGSVLEMKKFP--QNLATEGSRVKYEAPFSG--GYWYSSEGDIVSIDSSFGDAILKNRGSSNIFYSL 5014
            RLIC  P R  L+P    S++   CP    ++ Q I V N     +E+   D  G + +   S AV     +  + S +     E+VQ                             + +G+ +V          V  ++ I+ K   +  E+HLQ    R+ +                  VNP  I +Y H  V+ +F ++ GSGYF +    N                 VS   +            + V D C +     F    T+ + +   +++ +  +++V++G  +   +++ D +   F   A +L  M L     S IVS  +L  K      ++++     VF V+G  +G +S+     +   + I S+   +EVFPP +LLP+   L+ G+ +Q+++ GGPQ    +L +SI   +  +V         G  G +K    G  +V   V+ +DA+   + ++ ++S+D   V VVQ++++ I +P   + VG  MP++V   +SS        T FS    A   ++F W +     + +R    E ++E PA  N         M +     GK  +++++        +  L + +P L+ +I I +  +L ++ P    + +L+ P + + L T+ D  A ++Y ++        S+    +H            D+K        T   ++++N+      NQT+ +   V   +Y   + SP + S +              + +  +PLG    F +  HD  G++F       + S+  +R D + +T  ++ +                   TFI                   EN     +     ++P + D + +P    ++    P     A  G  + +  P +G  G W SS   I+ ID  FG  + +  G   ++Y +
Sbjct:  719 RLICAPPSRFALIPVYKHSHMDLVCPLMQQNK-QVIPVSNYRNQLLELAAFDHQGRKFDNFSSLAVTWDSSRSALASFDLAQPMELVQK---------------------------EDGSGQRKVHGFNTVYVHQVSGTTVIAAKTERYQ-EAHLQAARVRAPVSFAPVSASLDLLLVEDVKVNPRAISVYNHPDVTAEFTISEGSGYFFI----NRSAAHIARTAFEESSGVVSVSPLHPGA------LTVMVYDLCLA-----FPAPATVSVRVSDIYQVDVRVVDKVEIGKLVKAYVRVLDSSKNPFL--AKYLEYMDLELGSSSQIVSIKALREK-----VDDYTA----VFAVHGIAIGQTSLVATATDRAGSRIDSSPRALEVFPPFRLLPRKITLIIGATMQITSEGGPQPQSNIL-FSITDEKIASV---------GSNGFVKGAMVGNGTVTGVVQAVDAE---SGKVVIVSEDTVEVEVVQLRAVRIHAPITRMKVGTQMPVYVMGITSSQ-------TPFSFAN-AVPGLTFHWTVTKRDFIDARSRHSEALVELPAQYNF-------AMSVWAKMKGKTGLKVTVKATDPA--AKQLYNMVPELSDEIQIQVYERLHLVTPSIATEQILMSPNSFLRLHTNRDRFASVSYRILS------GSQEAPVVH-----------VDDKGLLTAGSQTGVSTMEINSREHFGINQTIIVSVKVSPVSYLHIVTSPTLRSGT-------------GTLLPAIPLGMTLTFTVQLHDSTGDLFH--SHNALLSFATNRDDFVHVTKGANNN-------------------TFIVRT----------------ENVGLTIFSVWDPETPGIADYVPLP----VQYSIAPSLSEDAIVGDIICFTCPIAGLKGIWSSSSNSILQIDPKFGVTLARGVGLVTVYYEI 1511          
BLAST of Nuclear pore membrane glycoprotein 210 vs. Ensembl Xenopus
Match: NUP210 (nucleoporin 210kDa [Source:NCBI gene;Acc:100493693])

HSP 1 Score: 310.842 bits (795), Expect = 1.343e-115
Identity = 211/703 (30.01%), Postives = 359/703 (51.07%), Query Frame = 1
Query:  205 SETPEVVVITPIYSSDGSKCSEQATITSVWQSNTKATGTVYAKNIATGHSVKCDVIIDQIRKLEIETRTLELYLHETPEALIARAYDEYGNTFSTLDGIPFEWLI---NHIGSNGDAQNVLRFITWTESEYVTPSLIGNLEQQGLMGYMQLVSGLKTGAAEVSLTFRDEXXXXXXXXXXXXXXXMANAALSPPLAYLIPYTQLSYKIIVHSQGSTQEVIMPNNQYLLKINN----------TDLAQLDFKGSTITAKKYGQTEVIL-IDKNINEDFRHPSSLLYIVEPGFLTFHISPHENQWVLQTMKDNIYTITIRPYDFNSHPIFMSDNIRLETLIPKEYFEVLHSSLNGTYNVVKTIKEGKTSLKSKLNFILLPNKTEFKLENPVEGTQDLIIYPPITVLPKFVVLPWYPNIKSIPG---YLFSATGGSGEYKWMAHDDNHKINNLSISVDNKGFIKPM-KLGLSNVVAADQRNLNNIGTAIVLVDIIKSLQFIIDIVEVEIHNELDLP--IF----ATNSKANKISHCYWLPFNAISEDPSIIEVVKIAAVEHSKHPDACAFLKVRGLKPGFSKLTITLRNQPNEIIREMLTSSITIGSFIPTKFLDPLSGSTTIGVRSSITMNIAYGPLPWLLDPSNYFYEMVEDSTSKQIVKKLSLTDNRHNLKLRTLQLKVQCISVGEVNISIFISNKKSLKHPKP 2241
            S  PEV  I P+   D  +CS++A + +     T+ T  ++A+++ TG  ++CD I+D I  ++I + T ELYL ++P  L  +A D  GNTFSTL G+ FEW +     +    D+ N LR + + ES YV P+ I  +E+    G   LVSGLKTG++++     +   + +  ++   L++           YL+  + + Y++    QG   ++ MP++QY  ++ N            +A+L+ + ST+TA + G T ++L  D  +    R P+  +Y+VEPG+L F + P  ++WVL+T +  +Y +TI  YD +S+ +++SDNIR+E  IPKEYFEVL +SLNG+Y+ VK +K G+T + + L  ++  +     L NP+   Q++ IY PIT+ PK +  PW P     PG   Y     GGSG + W +       NN   +V  KG +     +G+S + A D +N  + G   V V     ++FI   VE  + N L+LP  IF    A +++   +S C         E    + + K+         D C+ + V+   PG++ + ++  +         L S I + +++P + +DP S    + + SS  M    GP PW+L+P+ +F  +  D      +  +  + +R + +     ++  C  +GE  IS+ + NK +  +P P
Sbjct:   72 STRPEVASIEPL-GVDERQCSQRAVVQARATHPTRLTSIIFAEDVFTGQVLRCDAIVDLIHDIQIVSTTRELYLEDSPLELKIQAMDSEGNTFSTLAGLAFEWTVVKDADVDGFSDSHNTLRMLKFLESTYVPPAYITEMEKVAKQGDTILVSGLKTGSSKLRAKMLEPVYEKVTPAQVRLLILENILLNPASDIYLLVGSSIQYRVQKIKQGKITDLTMPSDQYAFQLQNHVVAPGGLSHEPIARLEERTSTVTALQMGHTNIVLGSDLRMQGASRLPNGTVYVVEPGYLGFTVHPG-DRWVLETGR--LYELTIDVYDKSSNKVYLSDNIRIEAKIPKEYFEVLETSLNGSYHRVKALKSGQTIIDAALTCMVDQDGGVHILPNPIRNQQEVEIYTPITLSPKILTFPWQPK----PGAYQYTIQVQGGSGNFTWSSS------NNPVATVTVKGLMTTGDDIGVSVIRARDVQNRLHFGEMKVYVIEPHGMEFIPSAVEARVGNRLELPLRIFGLMNADDNEVVTLSDCSNFDLAVEME---TLNIFKLLPGRLPPGKDYCSGITVQAESPGYTTVYVSYTHG-----HVHLKSKIIVAAYLPLRTVDP-SSLALVTLGSSKDMLFEGGPKPWVLEPAKFFRNVTSDKAESSSLALVEPSLSRGHFQ---HWVRATCRDLGEQVISLTVGNKPTETNPFP 748          

HSP 2 Score: 129.413 bits (324), Expect = 1.343e-115
Identity = 198/951 (20.82%), Postives = 370/951 (38.91%), Query Frame = 2
Query: 2306 RLICTVPVRMKLVPRLISSNISTGCPFQNTSENQHITVDNKNPSSVEIVFTDKNGVQLERSESFAV-----KVEIKSLNKKNIKEIVQVIYPTVIYXXXXXXXXXXXKFLVTPYRFGESTGEIEV---------IVKSSSCISGKCPAFNLESHLQIQISRS-------------------MIVNPITILLYQHEKVSTKFYVNYGSGYFTVTTPNNDFLXXXXXXXXXXXXXXVSYEIIQTKVDYSQRNAIINVIDACFSSLETEFENSKTIEIELVKPFKLQIFSLNRVQLGSQINVLLKIYDDNGREFPKDALHLLSMALHFTDRSNIVSANSLYSKDWVLTPNEFSESSGFVFKVNGEKLGFSSIYV---ELINTDITSNILKIEVFPPLKLLPKYTVLLEGSEIQLSTIGGPQNCHELLHYSIIKNETRNVKEAKIEFIIGPKGLLKAVSFGETSVVIKVEVIDADPTRNNRLTVLSKDEGRVGVVQIKSISIWSPTKNLLVGNSMPLWVTFASSSNDLQHIPITGFSITGLANSAISFKWHLNPPQGVISR---LENVLE-PAGINIGNKYLHSGMRLITSNPGKQTIEISISNVPKRWLSIDLQHNLP-LNSKINIAIIPKLEIIYPISYVQSVLVPPATKITLKTSLDDIALITYTLIPYQVDKISSKAQSKIHSGNILETNPNLSDNKVENFILHVTSSQSIKLNTANEITANQTVALFFTVKHPTYS--MMSPYISSNSIFKQFQTTKFINKHSSIFVLPLGGPFEFHITNHDELGNIFDISPDTNMFSYQLHRSDNIGITICSSESIRKSDSLKESTTLNIDPILTFIDSKSFSSQKVLQFQGLSTGENTIQLFYHDLLSDSPQLTDIISIPTGSVLEMKKFPQNLATEGSRVKYEAPFSG-----GYWYSSEGDIVSIDSSFGDAILKNRGSSNIFYSL 5014
            RLIC  P R  L+P    S++   CP    ++ Q I V N     +E+   D  G + +   S AV     +  + S +     E+VQ                             + +G+ +V          V  ++ I+ K   +  E+HLQ    R+                   + VNP  I +Y H  V+ +F ++ GSGYF +    N                 VS   +            + V D C +     F    T+ + +   +++ +  +++V++G  +   +++ D +   F   A +L  M L     S IVS  +L  K      ++++     VF V+G  +G +S+     +   + I S+   +EVFPP +LLP+   L+ G+ +Q+++ GGPQ    +L +SI   +  +V         G  G +K    G  +V   V+ +DA+   + ++ ++S+D   V VVQ++++ I +P   + VG  MP++V   +SS        T FS    A   ++F W +     + +R    E ++E PA  N         M +     GK  +++++        +  L + +P L+ +I I +  +L ++ P    + +L+ P + + L T+ D  A ++Y ++        S+    +H            D+K        T   ++++N+      NQT+ +   V   +Y   + SP + S +              + +  +PLG    F +  HD  G++F       + S+  +R D + +T  ++ +                   TFI                   EN     +     ++P + D + +P      +       A  G  + +  P +G     G W SS   I+ ID  FG  + +  G   ++Y +
Sbjct:  756 RLICAPPSRFALIPVYKHSHMDLVCPLMQQNK-QVIPVSNYRNQLLELAAFDHQGRKFDNFSSLAVTWDSSRSALASFDLAQPMELVQK---------------------------EDGSGQRKVHGFNTVYVHQVSGTTVIAAKTERYQ-EAHLQAARVRAPYEAFAPVSASLDLLLVEDVKVNPRAISVYNHPDVTAEFTISEGSGYFFI----NRSAAHIARTAFEESSGVVSVSPLHPGA------LTVMVYDLCLA-----FPAPATVSVRVSDIYQVDVRVVDKVEIGKLVKAYVRVLDSSKNPFL--AKYLEYMDLELGSSSQIVSIKALREK-----VDDYTA----VFAVHGIAIGQTSLVATATDRAGSRIDSSPRALEVFPPFRLLPRKITLIIGATMQITSEGGPQPQSNIL-FSITDEKIASV---------GSNGFVKGAMVGNGTVTGVVQAVDAE---SGKVVIVSEDTVEVEVVQLRAVRIHAPITRMKVGTQMPVYVMGITSSQ-------TPFSFAN-AVPGLTFHWTVTKRDFIDARSRHSEALVELPAQYNF-------AMSVWAKMKGKTGLKVTVKATDPA--AKQLYNMVPELSDEIQIQVYERLHLVTPSIATEQILMSPNSFLRLHTNRDRFASVSYRILS------GSQEAPVVH-----------VDDKGLLTAGSQTGVSTMEINSREHFGINQTIIVSVKVSPVSYLHIVTSPTLRSGT-------------GTLLPAIPLGMTLTFTVQLHDSTGDLFH--SHNALLSFATNRDDFVHVTKGANNN-------------------TFIVRT----------------ENVGLTIFSVWDPETPGIADYVPLPVQ--YSIAPSLSEDAIVGDIICFTCPIAGPEGLKGIWSSSSNSILQIDPKFGVTLARGVGLVTVYYEI 1552          
BLAST of Nuclear pore membrane glycoprotein 210 vs. Ensembl Xenopus
Match: NUP210 (nucleoporin 210kDa [Source:NCBI gene;Acc:100493693])

HSP 1 Score: 293.123 bits (749), Expect = 1.048e-109
Identity = 209/704 (29.69%), Postives = 355/704 (50.43%), Query Frame = 1
Query:  205 SETPEVVVITPIYSSDGSKCSEQATITSVWQSNTKATGTVYAKNIATGHSVKCDVIIDQIRKLEIETRTLELYLHETPEALIARAYDEYGNTFSTLDGIPFEWLI---NHIGSNGDAQNVLRFITWTESEYVTPSLIGNLEQQGLMGYMQLVSGLKTGAAEVSLTFRDEXXXXXXXXXXXXXXXMANAALSPPLAYLIPYTQLSYKIIVHSQGSTQEVIMPNNQYLLKINN----------TDLAQLDFKGSTITAKKYGQTEVILIDKNIN--EDFRHPSSLLYIVEPGFLTFHISPHENQWVLQTMKDNIYTITIRPYDFNSHPIFMSDNIRLETLIPKEYFEVLHSSLNGTYNVVKTIKEGKTSLKSKLNFILLPNKTEFKLENPVEGTQDLIIYPPITVLPKFVVLPWYPNIKSIPG---YLFSATGGSGEYKWMAHDDNHKINNLSISVDNKGFIKPM-KLGLSNVVAADQRNLNNIGTAIVLVDIIKSLQFIIDIVEVEIHNELDLP--IF----ATNSKANKISHCYWLPFNAISEDPSIIEVVKIAAVEHSKHPDACAFLKVRGLKPGFSKLTITLRNQPNEIIREMLTSSITIGSFIPTKFLDPLSGSTTIGVRSSITMNIAYGPLPWLLDPSNYFYEMVEDSTSKQIVKKLSLTDNRHNLKLRTLQLKVQCISVGEVNISIFISNKKSLKHPKP 2241
            S  PEV  I P+   D  +CS++A + +     T+ T  ++A+++ TG  ++CD I+D I  ++I + T ELYL ++P  L  +A D  GNTFSTL G+ FEW +     +    D+ N LR + + ES YV P+ I  +E+    G   LVSGLKTG++++     +   + +  ++   L++           YL+  + + Y++    QG   ++ MP++QY  ++ N            +A+L+ + ST+TA + G T ++L+ KNI       H S   ++  P  L F + P  ++WVL+T +  +Y +TI  YD +S+ +++SDNIR+E  IPKEYFEVL +SLNG+Y+ VK +K G+T + + L  ++  +     L NP+   Q++ IY PIT+ PK +  PW P     PG   Y     GGSG + W +       NN   +V  KG +     +G+S + A D +N  + G   V V     ++FI   VE  + N L+LP  IF    A +++   +S C         E    + + K+         D C+ + V+   PG++ + ++  +         L S I + +++P + +DP S    + + SS  M    GP PW+L+P+ +F  +  D      +  +  + +R + +     ++  C  +GE  IS+ + NK +  +P P
Sbjct:   52 STRPEVASIEPL-GVDERQCSQRAVVQARATHPTRLTSIIFAEDVFTGQVLRCDAIVDLIHDIQIVSTTRELYLEDSPLELKIQAMDSEGNTFSTLAGLAFEWTVVKDADVDGFSDSHNTLRMLKFLESTYVPPAYITEMEKVAKQGDTILVSGLKTGSSKLRAKMLEPVYEKVTPAQVRLLILENILLNPASDIYLLVGSSIQYRVQKIKQGKITDLTMPSDQYAFQLQNHVVAPGGLSHEPIARLEERTSTVTALQMGHTNIVLLHKNILCLSILTHFSC--WVSPP--LGFTVHPG-DRWVLETGR--LYELTIDVYDKSSNKVYLSDNIRIEAKIPKEYFEVLETSLNGSYHRVKALKSGQTIIDAALTCMVDQDGGVHILPNPIRNQQEVEIYTPITLSPKILTFPWQPK----PGAYQYTIQVQGGSGNFTWSSS------NNPVATVTVKGLMTTGDDIGVSVIRARDVQNRLHFGEMKVYVIEPHGMEFIPSAVEARVGNRLELPLRIFGLMNADDNEVVTLSDCSNFDLAVEME---TLNIFKLLPGRLPPGKDYCSGITVQAESPGYTTVYVSYTHG-----HVHLKSKIIVAAYLPLRTVDP-SSLALVTLGSSKDMLFEGGPKPWVLEPAKFFRNVTSDKAESSSLALVEPSLSRGHFQ---HWVRATCRDLGEQVISLTVGNKPTETNPFP 725          

HSP 2 Score: 127.487 bits (319), Expect = 1.048e-109
Identity = 190/920 (20.65%), Postives = 363/920 (39.46%), Query Frame = 2
Query: 2306 RLICTVPVRMKLVPRLISSNISTGCPFQNTSENQHITVDNKNPSSVEIVFTDKNGVQLERSESFAV-----KVEIKSLNKKNIKEIVQVIYPTVIYXXXXXXXXXXXKFLVTPYRFGESTGEIEVIVKSSSCISGKCPAFN-LESHLQIQISRSMIVNPITILLYQHEKVSTKFYVNYGSGYFTVTTPNNDFLXXXXXXXXXXXXXXVSYEIIQTKVDYSQRNAIINVIDACFSSLETEFENSKTIEIELVKPFKLQIFSLNRVQLGSQINVLLKIYDDNGREFPKDALHLLSMALHFTDRSNIVSANSLYSKDWVLTPNEFSESSGFVFKVNGEKLGFSSIYV---ELINTDITSNILKIEVFPPLKLLPKYTVLLEGSEIQLSTIGGPQNCHELLHYSIIKNETRNVKEAKIEFIIGPKGLLKAVSFGETSVVIKVEVIDADPTRNNRLTVLSKDEGRVGVVQIKSISIWSPTKNLLVGNSMPLWVTFASSSNDLQHIPITGFSITGLANSAISFKWHLNPPQGVISRLENVLEPAGINIGNKYLHSGMRLITSNPGKQTIEISISNVPKRWLSIDLQHNLP-LNSKINIAIIPKLEIIYPISYVQSVLVPPATKITLKTSLDDIALITYTLIPYQVDKISSKAQSKIHSGNILETNPNLSDNKVENFILHVTSSQSIKLNTANEITANQTVALFFTVKHPTYS--MMSPYISSNSIFKQFQTTKFINKHSSIFVLPLGGPFEFHITNHDELGNIFDISPDTNMFSYQLHRSDNIGITICSSESIRKSDSLKESTTLNIDPILTFIDSKSFSSQKVLQFQGLSTGENTIQLFYHDLLSDSPQLTDIISIPTGSVLEMKKFPQNLATEGSRVKYEAPFSG-----GYWYSSEGDIVSIDSSFGDAILKNRGSSNIFYSL 5014
            RLIC  P R  L+P    S++   CP    ++ Q I V N     +E+   D  G + +   S AV     +  + S +     E+VQ                    F+ +P            ++           AF  + + L + +   + VNP  I +Y H  V+ +F ++ GSGYF +    N                 VS   +            + V D C +     F    T+ + +   +++ +  +++V++G  +   +++ D +   F   A +L  M L     S IVS  +L  K      ++++     VF V+G  +G +S+     +   + I S+   +EVFPP +LLP+   L+ G+ +Q+++ GGPQ    +L +SI   +  +V         G  G +K    G  +V   V+ +DA+   + ++ ++S+D   V VVQ++++ I +P   + VG  MP++V   +SS        T FS    A   ++F W +     + +R  +    A + +  +Y +  M +     GK  +++++        +  L + +P L+ +I I +  +L ++ P    + +L+ P + + L T+ D  A ++Y ++        S+    +H            D+K        T   ++++N+      NQT+ +   V   +Y   + SP + S +              + +  +PLG    F +  HD  G++F       + S+  +R D + +T  ++ +                   TFI                   EN     +     ++P + D + +P      +       A  G  + +  P +G     G W SS   I+ ID  FG  + +  G   ++Y +
Sbjct:  733 RLICAPPSRFALIPVYKHSHMDLVCPLMQQNK-QVIPVSNYRNQLLELAAFDHQGRKFDNFSSLAVTWDSSRSALASFDLAQPMELVQ--------------KEDGILFVSSP------------VILVLLLAVVPYEAFAPVSASLDLLLVEDVKVNPRAISVYNHPDVTAEFTISEGSGYFFI----NRSAAHIARTAFEESSGVVSVSPLHPGA------LTVMVYDLCLA-----FPAPATVSVRVSDIYQVDVRVVDKVEIGKLVKAYVRVLDSSKNPFL--AKYLEYMDLELGSSSQIVSIKALREK-----VDDYTA----VFAVHGIAIGQTSLVATATDRAGSRIDSSPRALEVFPPFRLLPRKITLIIGATMQITSEGGPQPQSNIL-FSITDEKIASV---------GSNGFVKGAMVGNGTVTGVVQAVDAE---SGKVVIVSEDTVEVEVVQLRAVRIHAPITRMKVGTQMPVYVMGITSSQ-------TPFSFAN-AVPGLTFHWTVTKRDFIDARSRH--SEALVELPAQY-NFAMSVWAKMKGKTGLKVTVKATDPA--AKQLYNMVPELSDEIQIQVYERLHLVTPSIATEQILMSPNSFLRLHTNRDRFASVSYRILS------GSQEAPVVH-----------VDDKGLLTAGSQTGVSTMEINSREHFGINQTIIVSVKVSPVSYLHIVTSPTLRSGT-------------GTLLPAIPLGMTLTFTVQLHDSTGDLFH--SHNALLSFATNRDDFVHVTKGANNN-------------------TFIVRT----------------ENVGLTIFSVWDPETPGIADYVPLPVQ--YSIAPSLSEDAIVGDIICFTCPIAGPEGLKGIWSSSSNSILQIDPKFGVTLARGVGLVTVYYEI 1504          
BLAST of Nuclear pore membrane glycoprotein 210 vs. Ensembl Mouse
Match: Nup210l (nucleoporin 210-like [Source:MGI Symbol;Acc:MGI:1924845])

HSP 1 Score: 271.552 bits (693), Expect = 6.995e-93
Identity = 204/707 (28.85%), Postives = 350/707 (49.50%), Query Frame = 1
Query:  190 CHEWISETPEVVVITPIYSSDGSKCSEQATITSVWQSNTKATGTVYAKNIATGHSVKCDVIIDQIRKLEIETRTLELYLHETPEALIARAYDEYGNTFSTLDGIPFEWLI--NHIGSNGDAQNVLRFITWTESEYVTPSLIGNLEQQGLMGYMQLVSGLKTGAAEVSLTFRDEXXXXXXXXXXXXXXXMANAALSPPL-AYLIPYTQLSYKIIVHSQGSTQEVIMPNNQYLLKINNTDL----------AQLDFKGSTITAKKYGQTEVILIDKNINEDFRH--PSSLLYIVEPGFLTFHISPHENQWVLQTMKDNIYTITIRPYDFNSHPIFMSDNIRLETLIPKEYFEVLHSSLNGTYNVVKTIKEGKTSLKSKLNFILLPNKTEFKLENPVEGTQDLIIYPPITVLPKFVVLPWYPNIKSIPGYLFSATGGSGEYKWMAHDDNHKINNLSISVDNKGFIKPMKL-GLSNVVAADQRNLNNIGTAIVLVDIIKSLQFIIDIVEVEIHNELDLPI--FATNS---KANKISHCYWLPFNAISEDPSIIEVVKIAAVEHSKHPDA--CAFLKVRGLKPGFSKLTITLRNQPNEIIREMLTSSITIGSFIPTKFLDPLSGSTTIGVRSSITMNIAYGPLPWLLDPSNYFYEMVEDSTSKQIVKKLSLTDNRHNLKLRTLQLKVQCISVGEVNISIFISNKKSLKHPKP 2241
            C+ W S   + V I P+Y  +G+ CS++A + +      + +  + A+ + T H ++CDV +D I  +EI +RT ELY+ + P  L+ RA D  GNTFSTL G+ FEW I  ++  S  +  + +R + ++E+EY  P  I  +E+Q   G + LVSG++TGAA V +    E     + +  ++LLV+ N  L P    YL+    + Y++    QG   EV  P   Y L++ +  L          A LD K + +TA + GQT ++ + KN++       P+S +Y+VEPGFL F I P   +W L+     +Y IT+  +D +S  +++SDN+++     KEYFE   S+ NG+Y+VVK +K+G   + + L   L    +       +   Q++ IY PI + P F+  P +P +     +     GGSG + W + ++   +      V  KG +   ++ G S ++A D +N +  G   V V  +  ++ +    +VEI   +++PI  +  N+   +A   + C  LP +  S+   +  + K    E  + P A  C+ + +    PG + +T+++         E   SS T  ++ P K L+P+     +  +S   M    GP PW+L+PS +F E+  +      V ++ L   R   K      +V C+ +GE  ++  I N   + +P P
Sbjct:   61 CYIWHSTHHDAVTIQPLYE-NGTSCSQRAVLVAESTQPIRLSSIILAREVVTDHELRCDVKVDVIDNIEIVSRTRELYVDDAPLELMVRALDSKGNTFSTLAGMVFEWSIAQDNESSREELSSKIRILKYSEAEYSPPDYIIEMEKQERQGDVILVSGMRTGAAVVKVRIY-EPFYKKVAAALIRLLVLENIFLIPSHDTYLLVGAYIKYRVAKMVQGRMTEVNFPLEHYTLELQDHRLTNGGLPSKSVALLDEKTAMVTAVQLGQTNLVFVHKNVHMRSVSGLPNSTIYVVEPGFLGFSIHP-GGRWSLEV--GQVYVITVEVFDKSSTRVYISDNLKITFQFSKEYFEEQLSTSNGSYHVVKALKDGVVVINATLTSSLQERNSSQPKTYQISHQQEVKIYFPIQLKPSFLAFPHHP-LGISNRFTVQVEGGSGNFTWSSSNETVAM------VTTKGVVTAGQVRGNSTILARDVQNPSRSGDIKVYVMKLNKMELLPFQADVEIGQIIEVPIAMYHVNTETKEAIAFTDCSHLPLDLNSDKQGVFTLFK----EGIQKPGAMHCSSVHIAATSPGHTLVTVSVTGH-----EEHAWSSATFAAYEPLKALNPVD-VALVTWQSVKEMVFEGGPHPWILEPSRFFLELSMEKAEAIRVAEVRLPAKR---KQNQYVYRVLCLELGEQVLTFRIGNHPGVLNPSP 742          

HSP 2 Score: 92.4337 bits (228), Expect = 6.995e-93
Identity = 134/639 (20.97%), Postives = 273/639 (42.72%), Query Frame = 2
Query: 2306 RLICTVPVRMKLVPRLISSNISTGCPFQNTSENQHITVDNKNPSSVEIVFTDKNGVQLERSESFAVKVEIKSLNK-----KNIKEIVQVIY-----PTVIYXXXXXXXXXXXKFLVTPYRFGESTGEIEVIVKSSSCISGKCPAFNLESHLQIQISRSMIVNPITILLYQHEKVSTKFYVNYGSGYFTVTTPNNDFLXXXXXXXXXXXXXXVSYEIIQTKVDYSQRNA---IINVIDACFSSLETEFENSKTIEIELVKPFKLQIFSLNRVQLGSQINVLLKIYDDNGREFPKDALHLLSMALHFTDRSNIVSANSLYSKDWVLTPNEFSESSGFVFKVNGEKLGFSSIYVELINTDITSNILKIEVFPPLKLLPKYTVLLEGSEIQLSTIGGPQNCHELLHYSIIKNETRNVKEAKIEFIIGPKGLLKAVSFGETSVVIKVEVIDADPTRNNRLTVLSKDEGRVGVVQIKSISIWSPTKNLLVGNSMPLWVTFASSSNDLQHIPITGFSITGLANSAISFKWHLNPPQ--GVISRLENVL--EPAGINIGNKYLHSGMRLITSNPGKQTIEISISNVPKRWLSIDLQHN-LPLNSKINIAIIPKLEIIYPISYVQSVLVPPATKITLKTSLDDIALIT 4168
            R IC  P  M + P   + + +  CP    ++ Q I V +   S +E+   D++G + +   S  +  E KS N+     ++ K +  V        T ++     +       ++    F   +G+     KS   IS    +  +E    + +   + V P    +Y H  V   F +  GSGYF + +   D +              ++Y   ++ V     +     + V D C + L       +  +I+     +L++  +++V++G  + V++++   +   F     +  +M +     S IV+   +  +D      E+SE+   +  V   +    +I  + +    TS    IEVFPP +L+P+   L+  + +Q+ + GGPQ    ++H+S I N+T  V        +  +G +   S G   +   ++ ++ D     ++ V S+DE ++ VVQ++++ I +    L+    MP++V   +S+        T FS +  A+  ++F W ++      ++ R   V    PA  N         M + T   G+ TI++++ +  +   S  L+ N L L+ +I I +  KL++ Y     + +L+P  +++ L T+ +  A ++
Sbjct:  750 RFICAHPASMLVTPMYKAPSGTQPCPLPQYNK-QLIPVSSLRDSVLELAVFDQHGRKFDNFSSLML--EWKSSNETLAHFEDSKSVEMVARDDGSGQTRLHGHQILKVHQMKGTVLIGVNFAGYSGK-----KSPKGISNSPRSAGVE----LILVEDVTVQPENATIYNHPDVKEIFNLVEGSGYFLINSSEQDIVT-------------ITYREAESSVQLVPAHPGFLTLEVYDLCLAYLGPAVAQIRVSDIQ-----ELELDLIDKVEIGKTVLVVVRVLGSSKHPFRNK--YFRNMEVRLQLASAIVTLRLMEDQD------EYSENY-MLRAVTVGQTTLVAIATDRMGKKFTSAPRHIEVFPPFRLIPEKMTLIATNMMQIMSEGGPQP-QSIIHFS-ISNQTVAV--------VNRRGQVTGKSVGTAVLHGTIQTVNED---TGKVIVFSQDEVQIEVVQLQAVRILAAATRLVTATEMPVYVMGVTSTQ-------TPFSFSN-ASPLLTFHWSMSKRDVLDLVPRHSEVFLQLPAENNF-------AMVVHTKAAGRTTIKVTVRS--ENSSSGQLEGNLLELSDEIQILVFEKLQLFYANCQPEQILMPMNSQLKLHTNREGAAFVS 1319          
BLAST of Nuclear pore membrane glycoprotein 210 vs. Ensembl Mouse
Match: Nup210l (nucleoporin 210-like [Source:MGI Symbol;Acc:MGI:1924845])

HSP 1 Score: 271.552 bits (693), Expect = 9.672e-93
Identity = 204/707 (28.85%), Postives = 350/707 (49.50%), Query Frame = 1
Query:  190 CHEWISETPEVVVITPIYSSDGSKCSEQATITSVWQSNTKATGTVYAKNIATGHSVKCDVIIDQIRKLEIETRTLELYLHETPEALIARAYDEYGNTFSTLDGIPFEWLI--NHIGSNGDAQNVLRFITWTESEYVTPSLIGNLEQQGLMGYMQLVSGLKTGAAEVSLTFRDEXXXXXXXXXXXXXXXMANAALSPPL-AYLIPYTQLSYKIIVHSQGSTQEVIMPNNQYLLKINNTDL----------AQLDFKGSTITAKKYGQTEVILIDKNINEDFRH--PSSLLYIVEPGFLTFHISPHENQWVLQTMKDNIYTITIRPYDFNSHPIFMSDNIRLETLIPKEYFEVLHSSLNGTYNVVKTIKEGKTSLKSKLNFILLPNKTEFKLENPVEGTQDLIIYPPITVLPKFVVLPWYPNIKSIPGYLFSATGGSGEYKWMAHDDNHKINNLSISVDNKGFIKPMKL-GLSNVVAADQRNLNNIGTAIVLVDIIKSLQFIIDIVEVEIHNELDLPI--FATNS---KANKISHCYWLPFNAISEDPSIIEVVKIAAVEHSKHPDA--CAFLKVRGLKPGFSKLTITLRNQPNEIIREMLTSSITIGSFIPTKFLDPLSGSTTIGVRSSITMNIAYGPLPWLLDPSNYFYEMVEDSTSKQIVKKLSLTDNRHNLKLRTLQLKVQCISVGEVNISIFISNKKSLKHPKP 2241
            C+ W S   + V I P+Y  +G+ CS++A + +      + +  + A+ + T H ++CDV +D I  +EI +RT ELY+ + P  L+ RA D  GNTFSTL G+ FEW I  ++  S  +  + +R + ++E+EY  P  I  +E+Q   G + LVSG++TGAA V +    E     + +  ++LLV+ N  L P    YL+    + Y++    QG   EV  P   Y L++ +  L          A LD K + +TA + GQT ++ + KN++       P+S +Y+VEPGFL F I P   +W L+     +Y IT+  +D +S  +++SDN+++     KEYFE   S+ NG+Y+VVK +K+G   + + L   L    +       +   Q++ IY PI + P F+  P +P +     +     GGSG + W + ++   +      V  KG +   ++ G S ++A D +N +  G   V V  +  ++ +    +VEI   +++PI  +  N+   +A   + C  LP +  S+   +  + K    E  + P A  C+ + +    PG + +T+++         E   SS T  ++ P K L+P+     +  +S   M    GP PW+L+PS +F E+  +      V ++ L   R   K      +V C+ +GE  ++  I N   + +P P
Sbjct:   61 CYIWHSTHHDAVTIQPLYE-NGTSCSQRAVLVAESTQPIRLSSIILAREVVTDHELRCDVKVDVIDNIEIVSRTRELYVDDAPLELMVRALDSKGNTFSTLAGMVFEWSIAQDNESSREELSSKIRILKYSEAEYSPPDYIIEMEKQERQGDVILVSGMRTGAAVVKVRIY-EPFYKKVAAALIRLLVLENIFLIPSHDTYLLVGAYIKYRVAKMVQGRMTEVNFPLEHYTLELQDHRLTNGGLPSKSVALLDEKTAMVTAVQLGQTNLVFVHKNVHMRSVSGLPNSTIYVVEPGFLGFSIHP-GGRWSLEV--GQVYVITVEVFDKSSTRVYISDNLKITFQFSKEYFEEQLSTSNGSYHVVKALKDGVVVINATLTSSLQERNSSQPKTYQISHQQEVKIYFPIQLKPSFLAFPHHP-LGISNRFTVQVEGGSGNFTWSSSNETVAM------VTTKGVVTAGQVRGNSTILARDVQNPSRSGDIKVYVMKLNKMELLPFQADVEIGQIIEVPIAMYHVNTETKEAIAFTDCSHLPLDLNSDKQGVFTLFK----EGIQKPGAMHCSSVHIAATSPGHTLVTVSVTGH-----EEHAWSSATFAAYEPLKALNPVD-VALVTWQSVKEMVFEGGPHPWILEPSRFFLELSMEKAEAIRVAEVRLPAKR---KQNQYVYRVLCLELGEQVLTFRIGNHPGVLNPSP 742          

HSP 2 Score: 92.0485 bits (227), Expect = 9.672e-93
Identity = 135/636 (21.23%), Postives = 273/636 (42.92%), Query Frame = 2
Query: 2306 RLICTVPVRMKLVPRLISSNISTGCPFQNTSENQHITVDNKNPSSVEIVFTDKNGVQLERSESFAVKVEIKSLNK-----KNIKEIVQVIY-----PTVIYXXXXXXXXXXXKFLVTPYRFGESTGEIEVIVKSSSCISGKCPAFNLESHLQIQISRSMIVNPITILLYQHEKVSTKFYVNYGSGYFTVTTPNNDFLXXXXXXXXXXXXXXVSYEIIQTKVDYSQRNAIINVIDACFSSLETEFENSKTIEIELVKPFKLQIFSLNRVQLGSQINVLLKIYDDNGREFPKDALHLLSMALHFTDRSNIVSANSLYSKDWVLTPNEFSESSGFVFKVNGEKLGFSSIYVELINTDITSNILKIEVFPPLKLLPKYTVLLEGSEIQLSTIGGPQNCHELLHYSIIKNETRNVKEAKIEFIIGPKGLLKAVSFGETSVVIKVEVIDADPTRNNRLTVLSKDEGRVGVVQIKSISIWSPTKNLLVGNSMPLWVTFASSSNDLQHIPITGFSITGLANSAISFKWHLNPPQ--GVISRLENVL--EPAGINIGNKYLHSGMRLITSNPGKQTIEISISNVPKRWLSIDLQHN-LPLNSKINIAIIPKLEIIYPISYVQSVLVPPATKITLKTSLDDIALIT 4168
            R IC  P  M + P   + + +  CP    ++ Q I V +   S +E+   D++G + +   S  +  E KS N+     ++ K +  V        T ++     +       ++    F   +G+     KS   IS    +  +E    + +   + V P    +Y H  V   F +  GSGYF + +   D + I   + +       S ++I     +      + V D C + L       +  +I+     +L++  +++V++G  + V++++   +   F       + + L     S IV+   +  +D      E+SE+   +  V   +    +I  + +    TS    IEVFPP +L+P+   L+  + +Q+ + GGPQ    ++H+S I N+T  V        +  +G +   S G   +   ++ ++ D     ++ V S+DE ++ VVQ++++ I +    L+    MP++V   +S+        T FS +  A+  ++F W ++      ++ R   V    PA  N         M + T   G+ TI++++ +  +   S  L+ N L L+ +I I +  KL++ Y     + +L+P  +++ L T+ +  A ++
Sbjct:  750 RFICAHPASMLVTPMYKAPSGTQPCPLPQYNK-QLIPVSSLRDSVLELAVFDQHGRKFDNFSSLML--EWKSSNETLAHFEDSKSVEMVARDDGSGQTRLHGHQILKVHQMKGTVLIGVNFAGYSGK-----KSPKGISNSPRSAGVE----LILVEDVTVQPENATIYNHPDVKEIFNLVEGSGYFLINSSEQDIVTITYREAES------SVQVIPAHPGF----LTLEVYDLCLAYLGPAVAQIRVSDIQ-----ELELDLIDKVEIGKTVLVVVRVLGSSKHPFRNKYFRNMEVRLQLA--SAIVTLRLMEDQD------EYSENY-MLRAVTVGQTTLVAIATDRMGKKFTSAPRHIEVFPPFRLIPEKMTLIATNMMQIMSEGGPQP-QSIIHFS-ISNQTVAV--------VNRRGQVTGKSVGTAVLHGTIQTVNED---TGKVIVFSQDEVQIEVVQLQAVRILAAATRLVTATEMPVYVMGVTSTQ-------TPFSFSN-ASPLLTFHWSMSKRDVLDLVPRHSEVFLQLPAENNF-------AMVVHTKAAGRTTIKVTVRS--ENSSSGQLEGNLLELSDEIQILVFEKLQLFYANCQPEQILMPMNSQLKLHTNREGAAFVS 1319          
BLAST of Nuclear pore membrane glycoprotein 210 vs. Ensembl Mouse
Match: Nup210 (nucleoporin 210 [Source:MGI Symbol;Acc:MGI:1859555])

HSP 1 Score: 315.079 bits (806), Expect = 6.443e-86
Identity = 231/773 (29.88%), Postives = 394/773 (50.97%), Query Frame = 1
Query:  109 KLSDSKVLLPRTSYLSINYTIKGSPNICHEWISETPEVVVITPIYSSDGSKCSEQATITSVWQSNTKATGTVYAKNIATGHSVKCDVIIDQIRKLEIETRTLELYLHETPEALIARAYDEYGNTFSTLDGIPFEW-LINHIGSNG--DAQNVLRFITWTESEYVTPSLIGNLEQQGLMGYMQLVSGLKTGAAEVSLTFRDEXXXXXXXXXXXXXXXMANAALSPPLAYLIPYTQLSYKIIVHSQGSTQEVIMPNNQYLLKINNT----------DLAQLDFKGSTITAKKYGQTEVILIDKNINED--FRHPSSLLYIVEPGFLTFHISPHENQWVLQTMKDNIYTITIRPYDFNSHPIFMSDNIRLETLIPKEYFEVLHSSLNGTYNVVKTIKEGKTSLKSKLNFILLPNKTEFKLENPVEGTQDLIIYPPITVLPKFVVLPWYPNIKSIPGYLFSATGGSGEYKWMAH-----DDNHKINNLSISVDNKGFIKPM-KLGLSNVVAADQRNLNNIGTAIVLVDIIKSLQFIIDIVEVEIHNELDLPIF------ATNSKANKISHCYWLPFNAISEDPSIIEVVKIAAVEHSKHPDACAFLKVRGLKPGFSKLTITLRNQPNEIIREMLTSSITIGSFIPTKFLDPLSGSTTIGVRSSITMNIAYGPLPWLLDPSNYFYEMVEDSTSKQIVKKLSLTDNRHNLKLRTLQLKVQCISVGEVNISIFISNKKSLKHPKP------VKSTGL--AKLNLMIILKFKQLL*IDLHC 2322
            KL+  KVLLP T    +N+T++ S   C+ W S  PEV  I P+ SS+  +CS++A + +      + T  ++A++I TG  ++CD I+D I  ++I + T ELYL ++P  L  +A D  GNTFSTL G+ F+W ++    +NG  D+ N LR +T+ ES Y+ PS I  +E+    G   LVSG+KTG++++    ++   K++  ++   L++           YL+  T + YK+    QG   E+ MP++QY L++ N+           +A L    S +TA + GQ+ ++L  ++I      R P+S +Y+VE G+L F + P  ++WVL+T   ++Y ITI  +D +S+ ++ SDNIR+E ++P E+FEVL SS NG+Y+ ++ I+ G+T++ + L  ++  +     L+ PV   Q++ I+ PIT+ P  +  PW P              G+ +Y   AH           +++  +V  KG +      GLS + A D +N  + G   V V    S++F    VE  + + L+LP+          S+   +S C         E+  + + +        +H   C+ +KV+    G + L ++  +         L + IT+ +++P K +DP S    + + SS  M    GP PW+L+PS +F  +  + T    +  L    +R+  + R L   + C ++GE  I++ + N+ SL +P P      VKS     ++L LM +    QL   DL C
Sbjct:   27 KLNIPKVLLPFTRATRVNFTLEASEG-CYRWSSTRPEVASIEPLGSSE-QQCSQKAVVQARLTQPARLTSIIFAEDITTGQVLRCDAIVDLIHGIQIVSTTRELYLEDSPLELKIQALDSEGNTFSTLAGLVFDWTIVKDTEANGFSDSHNALRILTFLESTYIPPSYISEMEKAAKQGDTILVSGMKTGSSKLKARIQEAVYKNVRPAEVRLLILENILLNPAYDVYLLVGTSIHYKVQKIRQGKITELSMPSDQYELQLQNSIPDPQGDPARPVAILTQDTSRVTAMQMGQSNLVLGHRSIRMQGASRLPNSTIYVVEAGYLGFTVYPG-DRWVLET--GHLYAITIEVFDRSSNKVYPSDNIRIEAVLPAEFFEVLSSSQNGSYHHIRAIQSGQTAISATLTSVVDQDGGVHVLQVPVWNQQEVDIHIPITLYPSILTFPWQPKT------------GAYQYTIKAHGGSGNFSWSSSSSMVATVTVKGVMTTSGDTGLSVIRAHDVQNPLHFGEMKVYVIEPSSMEFAPCQVEARVGHTLELPLTISGFMPGGGSEVVTLSDCSHFDLVVEVENQGVFQPLPGRLPPGPEH---CSGVKVKADAQGSTTLLVSYTHG-----HVHLDAKITLAAYLPLKAVDP-SSVAVVTLGSSKEMLFEGGPRPWVLEPSKFFRNVTSEDTGSISLSLLGPPASRNYQQHRVL---MTCQALGEQVIALSVGNRPSLSNPFPAVEPTVVKSICAPPSRLTLMPVYALPQL---DLSC 767          

HSP 2 Score: 95.9005 bits (237), Expect = 5.787e-19
Identity = 130/647 (20.09%), Postives = 276/647 (42.66%), Query Frame = 2
Query: 2702 PAFNLESHLQIQISRSMIVNPITILLYQHEKVSTKFYVNYGSGYFTVTTPNNDFLXXXXXXXXXXXXXXVSYEIIQTKV---DYSQRNAIINVIDACFSSLETEFENSKTIEIELVKPFKLQIFSLNRVQLGSQINVLLKIYDDNGREFPKDALHLLSMALHFTDRSNIVSANSLYSKDWVLTPNEFSESSGFVFKVNGEKLGFSSIYVELINTD---ITSNILKIEVFPPLKLLPKYTVLLEGSEIQLSTIGGPQNCHELLHYSIIKNETRNVKEAKIEFIIGPKGLLKAVSFGETSVVIKVEVIDADPTRNNRLTVLSKDEGRVGVVQIKSISIWSPTKNLLVGNSMPLWVTFASSSNDLQHIPITGFSITGLANSAISFKWHLNPPQGVISRLENVLEPAGINIGNKYLHSGMRLITSNPGKQTIEISISNVPKRWLSIDLQHNL--PLNSKINIAIIPKLEIIYPISYVQSVLVPPATKITLKTSLDDIALITYTLI--PYQVDKISSKAQSKIHSGNILETNPNLSDNKVENFILHVTSSQSIKLNTANEITANQTVALFFTVKHPTYSM--MSPYISSNSIFKQFQTTKFINKHSSIFVLPLGGPFEFHITNHDELGNIFDISPDTNMFSYQLHRSDNIGI 4606
            P   + + +++ +   + V+P  + +Y H  V  + Y+  GSGYF + T   D ++             V+Y+  +           ++ + V D C +     F       I +    +L +  +++V++G  +   +++ D   + F   A +   M L     S I++         ++T +E  ++    F V+G  +G +S+   + +     ++S   +IEVFPP +L+P+   L+ G+ +Q+++ GGPQ    +L    I NE+           +   GL++ +  G  SV+  V+ +DA+     ++ ++S+D   V V+Q++++ I +P   +  G  MP++VT  +S+        + FS  G A   ++F W +   +  +  L        I +  +Y +  M +     G+  + + +  +      +   H L   L+ +I I +  KL ++ P    + +L+ P + I L+T+ D  A+++Y ++  P +   + +  +  + SG+ +  +                   ++++        NQT+ +   V   +Y    MSP + +                 ++  LPLG    F +  HD  G+IF      ++ ++  +R D + I
Sbjct:  879 PLVPVSASIELILVEDVRVSPEEMTIYNHPGVQVELYITEGSGYFFLNTSTQDIIK-------------VAYQDTRGVALVHPLLPGSSTVMVHDLCLA-----FPAPAKAIIHVSDIQELYVRVVDKVEIGKAVKAYVRVLDFYKKPF--LAKYFTFMDLKLQAASQIIT---------LVTLDEALDNYTATFLVHGVAIGQTSLSASVTDKSGQRVSSTPQQIEVFPPFRLIPRKVTLIIGAMMQITSEGGPQPQSNILFS--INNESVAA--------VSSSGLVRGLMVGNGSVLGVVQAVDAE---TGKVIIVSQDLVEVEVLQLQAVRIRAPITRMRTGTQMPVFVTGITSNQ-------SPFSF-GNAVPGLTFHWSVT--KRDVLDLRGRHHEVSIRLPPQY-NFAMNVYGRVKGRTGLRVVVKALDPTAGQL---HGLGKELSDEIQIQVFEKLRLLNPEIEAEQILMSPNSFIKLQTNRDGAAILSYRVLDGPEKAPIVHTDEKGFLVSGSGIGVS-------------------TLEVIAQEPFGTNQTILVAVKVSPVSYLRISMSPVLHT-------------QHKEALTALPLGMTVTFIVHFHDSSGDIFHA--HNSVLNFATNRDDFVQI 1435          
BLAST of Nuclear pore membrane glycoprotein 210 vs. Ensembl Mouse
Match: Nup210 (nucleoporin 210 [Source:MGI Symbol;Acc:MGI:1859555])

HSP 1 Score: 300.056 bits (767), Expect = 2.453e-81
Identity = 214/720 (29.72%), Postives = 369/720 (51.25%), Query Frame = 1
Query:  109 KLSDSKVLLPRTSYLSINYTIKGSPNICHEWISETPEVVVITPIYSSDGSKCSEQATITSVWQSNTKATGTVYAKNIATGHSVKCDVIIDQIRKLEIETRTLELYLHETPEALIARAYDEYGNTFSTLDGIPFEW-LINHIGSNG--DAQNVLRFITWTESEYVTPSLIGNLEQQGLMGYMQLVSGLKTGAAEVSLTFRDEXXXXXXXXXXXXXXXMANAALSPPLAYLIPYTQLSYKIIVHSQGSTQEVIMPNNQYLLKINNT----------DLAQLDFKGSTITAKKYGQTEVILIDKNINED--FRHPSSLLYIVEPGFLTFHISPHENQWVLQTMKDNIYTITIRPYDFNSHPIFMSDNIRLETLIPKEYFEVLHSSLNGTYNVVKTIKEGKTSLKSKLNFILLPNKTEFKLENPVEGTQDLIIYPPITVLPKFVVLPWYPNIKSIPGYLFSATGGSGEYKWMAH-----DDNHKINNLSISVDNKGFIKPM-KLGLSNVVAADQRNLNNIGTAIVLVDIIKSLQFIIDIVEVEIHNELDLPIF------ATNSKANKISHCYWLPFNAISEDPSIIEVVKIAAVEHSKHPDACAFLKVRGLKPGFSKLTITLRNQPNEIIREMLTSSITIGSFIPTKFLDPLSGSTTIGVRSSITMNIAYGPLPWLLDPSNYFYEMVEDSTSKQIVKKLSLTDNRHNLKLRTLQLKVQCISVGE 2187
            KL+  KVLLP T    +N+T++ S   C+ W S  PEV  I P+ SS+  +CS++A + +      + T  ++A++I TG  ++CD I+D I  ++I + T ELYL ++P  L  +A D  GNTFSTL G+ F+W ++    +NG  D+ N LR +T+ ES Y+ PS I  +E+    G   LVSG+KTG++++    ++   K++  ++   L++           YL+  T + YK+    QG   E+ MP++QY L++ N+           +A L    S +TA + GQ+ ++L  ++I      R P+S +Y+VE G+L F + P  ++WVL+T   ++Y ITI  +D +S+ ++ SDNIR+E ++P E+FEVL SS NG+Y+ ++ I+ G+T++ + L  ++  +     L+ PV   Q++ I+ PIT+ P  +  PW P              G+ +Y   AH           +++  +V  KG +      GLS + A D +N  + G   V V    S++F    VE  + + L+LP+          S+   +S C         E+  + + +        +H   C+ +KV+    G + L ++  +         L + IT+ +++P K +DP S    + + SS  M    GP PW+L+PS +F  +  + T    +  L    +R+  + R L   + C ++GE
Sbjct:   27 KLNIPKVLLPFTRATRVNFTLEASEG-CYRWSSTRPEVASIEPLGSSE-QQCSQKAVVQARLTQPARLTSIIFAEDITTGQVLRCDAIVDLIHGIQIVSTTRELYLEDSPLELKIQALDSEGNTFSTLAGLVFDWTIVKDTEANGFSDSHNALRILTFLESTYIPPSYISEMEKAAKQGDTILVSGMKTGSSKLKARIQEAVYKNVRPAEVRLLILENILLNPAYDVYLLVGTSIHYKVQKIRQGKITELSMPSDQYELQLQNSIPDPQGDPARPVAILTQDTSRVTAMQMGQSNLVLGHRSIRMQGASRLPNSTIYVVEAGYLGFTVYPG-DRWVLET--GHLYAITIEVFDRSSNKVYPSDNIRIEAVLPAEFFEVLSSSQNGSYHHIRAIQSGQTAISATLTSVVDQDGGVHVLQVPVWNQQEVDIHIPITLYPSILTFPWQPKT------------GAYQYTIKAHGGSGNFSWSSSSSMVATVTVKGVMTTSGDTGLSVIRAHDVQNPLHFGEMKVYVIEPSSMEFAPCQVEARVGHTLELPLTISGFMPGGGSEVVTLSDCSHFDLVVEVENQGVFQPLPGRLPPGPEH---CSGVKVKADAQGSTTLLVSYTHG-----HVHLDAKITLAAYLPLKAVDP-SSVAVVTLGSSKEMLFEGGPRPWVLEPSKFFRNVTSEDTGSISLSLLGPPASRNYQQHRVL---MTCQALGE 717          

HSP 2 Score: 95.9005 bits (237), Expect = 5.845e-19
Identity = 127/626 (20.29%), Postives = 267/626 (42.65%), Query Frame = 2
Query: 2702 PAFNLESHLQIQISRSMIVNPITILLYQHEKVSTKFYVNYGSGYFTVTTPNNDFLXXXXXXXXXXXXXXVSYEIIQTKV---DYSQRNAIINVIDACFSSLETEFENSKTIEIELVKPFKLQIFSLNRVQLGSQINVLLKIYDDNGREFPKDALHLLSMALHFTDRSNIVSANSLYSKDWVLTPNEFSESSGFVFKVNGEKLGFSSIYVELINTD---ITSNILKIEVFPPLKLLPKYTVLLEGSEIQLSTIGGPQNCHELLHYSIIKNETRNVKEAKIEFIIGPKGLLKAVSFGETSVVIKVEVIDADPTRNNRLTVLSKDEGRVGVVQIKSISIWSPTKNLLVGNSMPLWVTFASSSNDLQHIPITGFSITGLANSAISFKWHLNPPQGVISRLENVLEPAGINIGNKYLHSGMRLITSNPGKQTIEISISNVPKRWLSIDLQHNL--PLNSKINIAIIPKLEIIYPISYVQSVLVPPATKITLKTSLDDIALITYTLI--PYQVDKISSKAQSKIHSGNILETNPNLSDNKVENFILHVTSSQSIKLNTANEITANQTVALFFTVKHPTYSM--MSPYISSNSIFKQFQTTKFINKHSSIFVLPLGGPFEFHITNHDELGNIF 4543
            P   + + +++ +   + V+P  + +Y H  V  + Y+  GSGYF + T   D ++             V+Y+  +           ++ + V D C +     F       I +    +L +  +++V++G  +   +++ D   + F   A +   M L     S I++         ++T +E  ++    F V+G  +G +S+   + +     ++S   +IEVFPP +L+P+   L+ G+ +Q+++ GGPQ    +L    I NE+           +   GL++ +  G  SV+  V+ +DA+     ++ ++S+D   V V+Q++++ I +P   +  G  MP++VT  +S+        + FS  G A   ++F W +   +  +  L        I +  +Y +  M +     G+  + + +  +      +   H L   L+ +I I +  KL ++ P    + +L+ P + I L+T+ D  A+++Y ++  P +   + +  +  + SG+ +  +                   ++++        NQT+ +   V   +Y    MSP + +                 ++  LPLG    F +  HD  G+IF
Sbjct:  835 PLVPVSASIELILVEDVRVSPEEMTIYNHPGVQVELYITEGSGYFFLNTSTQDIIK-------------VAYQDTRGVALVHPLLPGSSTVMVHDLCLA-----FPAPAKAIIHVSDIQELYVRVVDKVEIGKAVKAYVRVLDFYKKPF--LAKYFTFMDLKLQAASQIIT---------LVTLDEALDNYTATFLVHGVAIGQTSLSASVTDKSGQRVSSTPQQIEVFPPFRLIPRKVTLIIGAMMQITSEGGPQPQSNILFS--INNESVAA--------VSSSGLVRGLMVGNGSVLGVVQAVDAE---TGKVIIVSQDLVEVEVLQLQAVRIRAPITRMRTGTQMPVFVTGITSNQ-------SPFSF-GNAVPGLTFHWSVT--KRDVLDLRGRHHEVSIRLPPQY-NFAMNVYGRVKGRTGLRVVVKALDPTAGQL---HGLGKELSDEIQIQVFEKLRLLNPEIEAEQILMSPNSFIKLQTNRDGAAILSYRVLDGPEKAPIVHTDEKGFLVSGSGIGVS-------------------TLEVIAQEPFGTNQTILVAVKVSPVSYLRISMSPVLHT-------------QHKEALTALPLGMTVTFIVHFHDSSGDIF 1372          
BLAST of Nuclear pore membrane glycoprotein 210 vs. Ensembl Mouse
Match: Nup210 (nucleoporin 210 [Source:MGI Symbol;Acc:MGI:1859555])

HSP 1 Score: 95.9005 bits (237), Expect = 4.212e-19
Identity = 127/626 (20.29%), Postives = 266/626 (42.49%), Query Frame = 2
Query: 2702 PAFNLESHLQIQISRSMIVNPITILLYQHEKVSTKFYVNYGSGYFTVTTPNNDFLXXXXXXXXXXXXXXVSYEIIQTKV---DYSQRNAIINVIDACFSSLETEFENSKTIEIELVKPFKLQIFSLNRVQLGSQINVLLKIYDDNGREFPKDALHLLSMALHFTDRSNIVSANSLYSKDWVLTPNEFSESSGFVFKVNGEKLGFSSIYVELINTD---ITSNILKIEVFPPLKLLPKYTVLLEGSEIQLSTIGGPQNCHELLHYSIIKNETRNVKEAKIEFIIGPKGLLKAVSFGETSVVIKVEVIDADPTRNNRLTVLSKDEGRVGVVQIKSISIWSPTKNLLVGNSMPLWVTFASSSNDLQHIPITGFSITGLANSAISFKWHLNPPQGVISRLENVLEPAGINIGNKYLHSGMRLITSNPGKQTIEISISNVPKRWLSIDLQHNL--PLNSKINIAIIPKLEIIYPISYVQSVLVPPATKITLKTSLDDIALITYTLI--PYQVDKISSKAQSKIHSGNILETNPNLSDNKVENFILHVTSSQSIKLNTANEITANQTVALFFTVKHPTYSM--MSPYISSNSIFKQFQTTKFINKHSSIFVLPLGGPFEFHITNHDELGNIF 4543
            P   + + +++ +   + V+P  + +Y H  V  + Y+  GSGYF + T   D ++             V+Y+  +           ++ + V D C +     F       I +    +L +  +++V++G  +   +++ D   + F   A +   M L     S I++         ++T +E  ++    F V+G  +G +S+   + +     ++S   +IEVFPP +L+P+   L+ G+ +Q+++ GGPQ    +L    I NE+           +   GL++ +  G  SV+  V+ +DA+     ++ ++S+D   V V+Q++++ I +P   +  G  MP++VT  +S+        + FS  G A   ++F W +      +  L        I +  +Y +  M +     G+  + + +  +      +   H L   L+ +I I +  KL ++ P    + +L+ P + I L+T+ D  A+++Y ++  P +   + +  +  + SG+ +  +                   ++++        NQT+ +   V   +Y    MSP + +                 ++  LPLG    F +  HD  G+IF
Sbjct:   92 PLVPVSASIELILVEDVRVSPEEMTIYNHPGVQVELYITEGSGYFFLNTSTQDIIK-------------VAYQDTRGVALVHPLLPGSSTVMVHDLCLA-----FPAPAKAIIHVSDIQELYVRVVDKVEIGKAVKAYVRVLDFYKKPF--LAKYFTFMDLKLQAASQIIT---------LVTLDEALDNYTATFLVHGVAIGQTSLSASVTDKSGQRVSSTPQQIEVFPPFRLIPRKVTLIIGAMMQITSEGGPQPQSNILFS--INNESVAA--------VSSSGLVRGLMVGNGSVLGVVQAVDAE---TGKVIIVSQDLVEVEVLQLQAVRIRAPITRMRTGTQMPVFVTGITSNQ-------SPFSF-GNAVPGLTFHWSVTKRD--VLDLRGRHHEVSIRLPPQY-NFAMNVYGRVKGRTGLRVVVKALDPTAGQL---HGLGKELSDEIQIQVFEKLRLLNPEIEAEQILMSPNSFIKLQTNRDGAAILSYRVLDGPEKAPIVHTDEKGFLVSGSGIGVS-------------------TLEVIAQEPFGTNQTILVAVKVSPVSYLRISMSPVLHT-------------QHKEALTALPLGMTVTFIVHFHDSSGDIF 629          
BLAST of Nuclear pore membrane glycoprotein 210 vs. UniProt/SwissProt
Match: sp|Q8TEM1|PO210_HUMAN (Nuclear pore membrane glycoprotein 210 OS=Homo sapiens OX=9606 GN=NUP210 PE=1 SV=3)

HSP 1 Score: 317.005 bits (811), Expect = 1.017e-112
Identity = 224/747 (29.99%), Postives = 381/747 (51.00%), Query Frame = 1
Query:  109 KLSDSKVLLPRTSYLSINYTIKGSPNICHEWISETPEVVVITPIYSSDGSKCSEQATITSVWQSNTKATGTVYAKNIATGHSVKCDVIIDQIRKLEIETRTLELYLHETPEALIARAYDEYGNTFSTLDGIPFEWLI---NHIGSNGDAQNVLRFITWTESEYVTPSLIGNLEQQGLMGYMQLVSGLKTGAAEVSLTFRDEXXXXXXXXXXXXXXXMANAALSPPLAYLIPYTQLSYKIIVHSQGSTQEVIMPNNQYLLKINNT----------DLAQLDFKGSTITAKKYGQTEVILIDKNINED--FRHPSSLLYIVEPGFLTFHISPHENQWVLQTMKDNIYTITIRPYDFNSHPIFMSDNIRLETLIPKEYFEVLHSSLNGTYNVVKTIKEGKTSLKSKLNFILLPNKTEFKLENPVEGTQDLIIYPPITVLPKFVVLPWYPNIKSIPGYLFSATGGSGEYKWMAH-----DDNHKINNLSISVDNKGFIKP-MKLGLSNVVAADQRNLNNIGTAIVLVDIIKSLQFIIDIVEVEIHNELDLPIFATN------SKANKISHCYWLPFNAISEDPSIIEVVKIAAVEHSKHPDACAFLKVRGLKPGFSKLTITLRNQPNEIIREMLTSSITIGSFIPTKFLDPLSGSTTIGVRSSITMNIAYGPLPWLLDPSNYFYEMVEDSTSKQIVKKLSLTDNRHNLKLRTLQLKVQCISVGEVNISIFISNKKSLKHPKPVKSTGLAKL 2268
            KL+  KVLLP T    +N+T++ S   C+ W+S  PEV  I P+   D  +CS++A + +      + T  ++A++I TG  ++CD I+D I  ++I + T ELYL ++P  L  +A D  GNTFSTL G+ FEW I   +      D+ N LR +T+ ES Y+ PS I  +E+    G   LVSG+KTG++++    ++   K++  ++   L++           YL+  T + YK+    QG   E+ MP++QY L++ N+           +A L    S +TA + GQ+ ++L  ++I      R P+S +Y+VEPG+L F + P  ++WVL+T +  +Y ITI  +D  S+ +++SDNIR+ET++P E+FEVL SS NG+Y+ ++ +K G+T++ + L  ++  +     L+ PV   Q++ I+ PIT+ P  +  PW P              G+ +Y   AH           ++L  +V  KG +     +G S + A D +N  + G   V V    S++F    VE  +   L+LP+  +       S+   +S C         E+  + + +       S+H   C+ ++V+    G + L ++ R+         L++ ITI +++P K +DP S    + + SS  M    GP PW+L+PS +F  +  + T       L+L     +   +   + V C ++GE  I++ + NK SL +P P     + K 
Sbjct:   27 KLNIPKVLLPFTRATRVNFTLEASEG-CYRWLSTRPEVASIEPL-GLDEQQCSQKAVVQARLTQPARLTSIIFAEDITTGQVLRCDAIVDLIHDIQIVSTTRELYLEDSPLELKIQALDSEGNTFSTLAGLVFEWTIVKDSEADRFSDSHNALRILTFLESTYIPPSYISEMEKAAKQGDTILVSGMKTGSSKLKARIQEAVYKNVRPAEVRLLILENILLNPAYDVYLMVGTSIHYKVQKIRQGKITELSMPSDQYELQLQNSIPGPEGDPARPVAVLAQDTSMVTALQLGQSSLVLGHRSIRMQGASRLPNSTIYVVEPGYLGFTVHPG-DRWVLETGR--LYEITIEVFDKFSNKVYVSDNIRIETVLPAEFFEVLSSSQNGSYHRIRALKRGQTAIDAALTSVVDQDGGVHILQVPVWNQQEVEIHIPITLYPSILTFPWQPKT------------GAYQYTIRAHGGSGNFSWSSSSHLVATVTVKGVMTTGSDIGFSVIQAHDVQNPLHFGEMKVYVIEPHSMEFAPCQVEARVGQALELPLRISGLMPGGASEVVTLSDCSHFDLAVEVENQGVFQPLPGRLPPGSEH---CSGIRVKAEAQGSTTLLVSYRHG-----HVHLSAKITIAAYLPLKAVDP-SSVALVTLGSSKEMLFEGGPRPWILEPSKFFQNVTAEDTDS---IGLALFAPHSSRNYQQHWILVTCQALGEQVIALSVGNKPSLTNPFPAVEPAVVKF 744          

HSP 2 Score: 115.931 bits (289), Expect = 1.017e-112
Identity = 198/993 (19.94%), Postives = 394/993 (39.68%), Query Frame = 2
Query: 2306 RLICTVPVRMKLVPRLISSNISTGCPFQNTSENQHITVDNKNPSSVEIVFTDKNGVQLERSESFAVKVEIKSLNKKNIKEIVQVIYPTVIYXXXXXXXXXXXKFL--VTPYRFGESTGEI----------EVIVKSSSCISGKCPAFNLESHLQIQISRSMIVNPITILLYQHEKVSTKFYVNYGSGYFTVTTPNNDFLXXXXXXXXXXXXXXVSYEIIQTKVDYSQRNAI------------INVIDACFSSLETEFENSKTIEIELVKPFKLQIFSLNRVQLGSQINVLLKIYDDNGREFPKDALHLLSMALHFTDRSNIVSANSLYSKDWVLTPNEFSESSGFVFKVNGEKLGFSSIYVELIN---TDITSNILKIEVFPPLKLLPKYTVLLEGSEIQLSTIGGPQNCHELLHYSIIKNETRNVKEAKIEFIIGPKGLLKAVSFGETSVVIKVEVIDADPTRNNRLTVLSKDEGRVGVVQIKSISIWSPTKNLLVGNSMPLWVTFASSSNDLQHIPITGFSITGLANSAISFKWHLNPPQGVISRLENVLEPAGINIGNKYLHSGMRLITSNPGKQTIEISISNV-PKRWLSIDLQHNLPLNSKINIAIIPKLEIIYPISYVQSVLVPPATKITLKTSLDDIALITYTLI--PYQVDKISSKAQSKIHSGNILETNPNLSDNKVENFILHVTSSQSIKLNTANEITANQTVALFFTVKHPTYSM--MSPYISSNSIFKQFQTTKFINKHSSIFVLPLGGPFEFHITNHDELGNIFDISPDTNMFSYQLHRSDNIGITICSSESIRKSDSLKESTTLNIDPILTFIDSKSFSSQKVLQFQGLSTGENTIQLFYHDLLSDSPQLTDIISIPTGSVLEMKKFPQNLATEGSRVKYEAPFSGGYWYSSEGDIVSIDSSFGDAILKNRGSSNIFYSLANAYPNIEKVQNKNVLISHELIVHGASKISMKIIEGTS----LPLDD--SCLKSECIP 5170
            + +C  P R+ L P   S  +   CP    ++       ++NP  +++   D+ G + +   S +++ E       + + ++  I P +     S +  S  K L  +      E++G            E  + S+       P   L + +++ +   + V+P  + +Y H  +  +  +  GSGYF + T   D +                      KV Y +   +            I + D C       F       + +    +L I  +++V++G  +   +++ D + + F   A +   M L     S I++  +L         +E  ++    F + G  +G +S+   + N     I S   +IEVFPP +L+P+   LL G+ +Q+++ GGPQ    +L    I NE+  +  A         GL++ ++ G  +V   V+ +DA+     ++ ++S+D  +V V+ ++++ I +P   +  G  MP++VT  ++  +        FS  G A   ++F W +   +  +  L      A I + ++Y +  M ++    G+  + + +  V P       L     L+ +I + +  KL+++ P    + +L+ P + I L+T+ D  A ++Y ++  P +V  +    +  + SG+++ T+                   +I++       ANQT+ +   V   +Y    MSP + +             NK + + V PLG    F +  HD  G++F     +++ ++  +R D +         I K  +        +   LT +         +  F  L             L + SP+L+  + +  G VL +     +L  EG           G W SS   I+ ID   G A+ +  GS  ++Y +A    ++   +   V +   ++      I     E T+    + + D  S L+ EC P
Sbjct:  743 KFVCAPPSRLTLAPVYTSPQLDMSCPLLQQNKQVVPVSSHRNPR-LDLAAYDQEGRRFDNFSSLSIQWE-------STRPVLASIEPELPMQLVSQDDESGQKKLHGLQAILVHEASGTTAITATATGYQESHLSSARTKQPHDPLVPLSASIELILVEDVRVSPEEVTIYNHPGIQAELRIREGSGYFFLNTSTADVV----------------------KVAYQEARGVAMVHPLLPGSSTIMIHDLCLV-----FPAPAKAVVYVSDIQELYIRVVDKVEIGKTVKAYVRVLDLHKKPF--LAKYFPFMDLKLRAASPIITLVAL---------DEALDNYTITFLIRGVAIGQTSLTASVTNKAGQRINSAPQQIEVFPPFRLMPRKVTLLIGATMQVTSEGGPQPQSNILFS--ISNESVALVSA--------AGLVQGLAIGNGTVSGLVQAVDAE---TGKVVIISQDLVQVEVLLLRAVRIRAPIMRMRTGTQMPIYVTGITNHQN-------PFSF-GNAVPGLTFHWSVT--KRDVLDLRGRHHEASIRLPSQY-NFAMNVLGRVKGRTGLRVVVKAVDPTSGQLYGLARE--LSDEIQVQVFEKLQLLNPEIEAEQILMSPNSYIKLQTNRDGAASLSYRVLDGPEKVPVVHVDEKGFLASGSMIGTS-------------------TIEVIAQEPFGANQTIIVAVKVSPVSYLRVSMSPVLHTQ------------NKEALVAV-PLGMTVTFTVHFHDNSGDVFHA--HSSVLNFATNRDDFV--------QIGKGPTNNTCVVRTVSVGLTLLRVWDAEHPGLSDFMPLPV-----------LQAISPELSGAMVV--GDVLCLATVLTSL--EG---------LSGTWSSSANSILHIDPKTGVAVARAVGSVTVYYEVAG---HLRTYKEVVVSVPQRIMARHLHPIQTSFQEATASKVIVAVGDRSSNLRGECTP 1594          
BLAST of Nuclear pore membrane glycoprotein 210 vs. UniProt/SwissProt
Match: sp|Q9D2F7|P210L_MOUSE (Nuclear pore membrane glycoprotein 210-like OS=Mus musculus OX=10090 GN=Nup210l PE=1 SV=2)

HSP 1 Score: 271.552 bits (693), Expect = 4.273e-92
Identity = 204/707 (28.85%), Postives = 350/707 (49.50%), Query Frame = 1
Query:  190 CHEWISETPEVVVITPIYSSDGSKCSEQATITSVWQSNTKATGTVYAKNIATGHSVKCDVIIDQIRKLEIETRTLELYLHETPEALIARAYDEYGNTFSTLDGIPFEWLI--NHIGSNGDAQNVLRFITWTESEYVTPSLIGNLEQQGLMGYMQLVSGLKTGAAEVSLTFRDEXXXXXXXXXXXXXXXMANAALSPPL-AYLIPYTQLSYKIIVHSQGSTQEVIMPNNQYLLKINNTDL----------AQLDFKGSTITAKKYGQTEVILIDKNINEDFRH--PSSLLYIVEPGFLTFHISPHENQWVLQTMKDNIYTITIRPYDFNSHPIFMSDNIRLETLIPKEYFEVLHSSLNGTYNVVKTIKEGKTSLKSKLNFILLPNKTEFKLENPVEGTQDLIIYPPITVLPKFVVLPWYPNIKSIPGYLFSATGGSGEYKWMAHDDNHKINNLSISVDNKGFIKPMKL-GLSNVVAADQRNLNNIGTAIVLVDIIKSLQFIIDIVEVEIHNELDLPI--FATNS---KANKISHCYWLPFNAISEDPSIIEVVKIAAVEHSKHPDA--CAFLKVRGLKPGFSKLTITLRNQPNEIIREMLTSSITIGSFIPTKFLDPLSGSTTIGVRSSITMNIAYGPLPWLLDPSNYFYEMVEDSTSKQIVKKLSLTDNRHNLKLRTLQLKVQCISVGEVNISIFISNKKSLKHPKP 2241
            C+ W S   + V I P+Y  +G+ CS++A + +      + +  + A+ + T H ++CDV +D I  +EI +RT ELY+ + P  L+ RA D  GNTFSTL G+ FEW I  ++  S  +  + +R + ++E+EY  P  I  +E+Q   G + LVSG++TGAA V +    E     + +  ++LLV+ N  L P    YL+    + Y++    QG   EV  P   Y L++ +  L          A LD K + +TA + GQT ++ + KN++       P+S +Y+VEPGFL F I P   +W L+     +Y IT+  +D +S  +++SDN+++     KEYFE   S+ NG+Y+VVK +K+G   + + L   L    +       +   Q++ IY PI + P F+  P +P +     +     GGSG + W + ++   +      V  KG +   ++ G S ++A D +N +  G   V V  +  ++ +    +VEI   +++PI  +  N+   +A   + C  LP +  S+   +  + K    E  + P A  C+ + +    PG + +T+++         E   SS T  ++ P K L+P+     +  +S   M    GP PW+L+PS +F E+  +      V ++ L   R   K      +V C+ +GE  ++  I N   + +P P
Sbjct:   61 CYIWHSTHHDAVTIQPLYE-NGTSCSQRAVLVAESTQPIRLSSIILAREVVTDHELRCDVKVDVIDNIEIVSRTRELYVDDAPLELMVRALDSKGNTFSTLAGMVFEWSIAQDNESSREELSSKIRILKYSEAEYSPPDYIIEMEKQERQGDVILVSGMRTGAAVVKVRIY-EPFYKKVAAALIRLLVLENIFLIPSHDTYLLVGAYIKYRVAKMVQGRMTEVNFPLEHYTLELQDHRLTNGGLPSKSVALLDEKTAMVTAVQLGQTNLVFVHKNVHMRSVSGLPNSTIYVVEPGFLGFSIHP-GGRWSLEV--GQVYVITVEVFDKSSTRVYISDNLKITFQFSKEYFEEQLSTSNGSYHVVKALKDGVVVINATLTSSLQERNSSQPKTYQISHQQEVKIYFPIQLKPSFLAFPHHP-LGISNRFTVQVEGGSGNFTWSSSNETVAM------VTTKGVVTAGQVRGNSTILARDVQNPSRSGDIKVYVMKLNKMELLPFQADVEIGQIIEVPIAMYHVNTETKEAIAFTDCSHLPLDLNSDKQGVFTLFK----EGIQKPGAMHCSSVHIAATSPGHTLVTVSVTGH-----EEHAWSSATFAAYEPLKALNPVD-VALVTWQSVKEMVFEGGPHPWILEPSRFFLELSMEKAEAIRVAEVRLPAKR---KQNQYVYRVLCLELGEQVLTFRIGNHPGVLNPSP 742          

HSP 2 Score: 92.4337 bits (228), Expect = 4.273e-92
Identity = 134/639 (20.97%), Postives = 273/639 (42.72%), Query Frame = 2
Query: 2306 RLICTVPVRMKLVPRLISSNISTGCPFQNTSENQHITVDNKNPSSVEIVFTDKNGVQLERSESFAVKVEIKSLNK-----KNIKEIVQVIY-----PTVIYXXXXXXXXXXXKFLVTPYRFGESTGEIEVIVKSSSCISGKCPAFNLESHLQIQISRSMIVNPITILLYQHEKVSTKFYVNYGSGYFTVTTPNNDFLXXXXXXXXXXXXXXVSYEIIQTKVDYSQRNA---IINVIDACFSSLETEFENSKTIEIELVKPFKLQIFSLNRVQLGSQINVLLKIYDDNGREFPKDALHLLSMALHFTDRSNIVSANSLYSKDWVLTPNEFSESSGFVFKVNGEKLGFSSIYVELINTDITSNILKIEVFPPLKLLPKYTVLLEGSEIQLSTIGGPQNCHELLHYSIIKNETRNVKEAKIEFIIGPKGLLKAVSFGETSVVIKVEVIDADPTRNNRLTVLSKDEGRVGVVQIKSISIWSPTKNLLVGNSMPLWVTFASSSNDLQHIPITGFSITGLANSAISFKWHLNPPQ--GVISRLENVL--EPAGINIGNKYLHSGMRLITSNPGKQTIEISISNVPKRWLSIDLQHN-LPLNSKINIAIIPKLEIIYPISYVQSVLVPPATKITLKTSLDDIALIT 4168
            R IC  P  M + P   + + +  CP    ++ Q I V +   S +E+   D++G + +   S  +  E KS N+     ++ K +  V        T ++     +       ++    F   +G+     KS   IS    +  +E    + +   + V P    +Y H  V   F +  GSGYF + +   D +              ++Y   ++ V     +     + V D C + L       +  +I+     +L++  +++V++G  + V++++   +   F     +  +M +     S IV+   +  +D      E+SE+   +  V   +    +I  + +    TS    IEVFPP +L+P+   L+  + +Q+ + GGPQ    ++H+S I N+T  V        +  +G +   S G   +   ++ ++ D     ++ V S+DE ++ VVQ++++ I +    L+    MP++V   +S+        T FS +  A+  ++F W ++      ++ R   V    PA  N         M + T   G+ TI++++ +  +   S  L+ N L L+ +I I +  KL++ Y     + +L+P  +++ L T+ +  A ++
Sbjct:  750 RFICAHPASMLVTPMYKAPSGTQPCPLPQYNK-QLIPVSSLRDSVLELAVFDQHGRKFDNFSSLML--EWKSSNETLAHFEDSKSVEMVARDDGSGQTRLHGHQILKVHQMKGTVLIGVNFAGYSGK-----KSPKGISNSPRSAGVE----LILVEDVTVQPENATIYNHPDVKEIFNLVEGSGYFLINSSEQDIVT-------------ITYREAESSVQLVPAHPGFLTLEVYDLCLAYLGPAVAQIRVSDIQ-----ELELDLIDKVEIGKTVLVVVRVLGSSKHPFRNK--YFRNMEVRLQLASAIVTLRLMEDQD------EYSENY-MLRAVTVGQTTLVAIATDRMGKKFTSAPRHIEVFPPFRLIPEKMTLIATNMMQIMSEGGPQP-QSIIHFS-ISNQTVAV--------VNRRGQVTGKSVGTAVLHGTIQTVNED---TGKVIVFSQDEVQIEVVQLQAVRILAAATRLVTATEMPVYVMGVTSTQ-------TPFSFSN-ASPLLTFHWSMSKRDVLDLVPRHSEVFLQLPAENNF-------AMVVHTKAAGRTTIKVTVRS--ENSSSGQLEGNLLELSDEIQILVFEKLQLFYANCQPEQILMPMNSQLKLHTNREGAAFVS 1319          
BLAST of Nuclear pore membrane glycoprotein 210 vs. UniProt/SwissProt
Match: sp|P11654|PO210_RAT (Nuclear pore membrane glycoprotein 210 OS=Rattus norvegicus OX=10116 GN=Nup210 PE=1 SV=1)

HSP 1 Score: 332.028 bits (850), Expect = 2.327e-90
Identity = 236/768 (30.73%), Postives = 397/768 (51.69%), Query Frame = 1
Query:  109 KLSDSKVLLPRTSYLSINYTIKGSPNICHEWISETPEVVVITPIYSSDGSKCSEQATITSVWQSNTKATGTVYAKNIATGHSVKCDVIIDQIRKLEIETRTLELYLHETPEALIARAYDEYGNTFSTLDGIPFEW-LINHIGSNG--DAQNVLRFITWTESEYVTPSLIGNLEQQGLMGYMQLVSGLKTGAAEVSLTFRDEXXXXXXXXXXXXXXXMANAALSPPLAYLIPYTQLSYKIIVHSQGSTQEVIMPNNQYLLKINNT----------DLAQLDFKGSTITAKKYGQTEVILIDKNINED--FRHPSSLLYIVEPGFLTFHISPHENQWVLQTMKDNIYTITIRPYDFNSHPIFMSDNIRLETLIPKEYFEVLHSSLNGTYNVVKTIKEGKTSLKSKLNFILLPNKTEFKLENPVEGTQDLIIYPPITVLPKFVVLPWYPNIKSIPGYLFSATGGSGEYKWMAHDDNHKINNLSISVDNKGFIKP-MKLGLSNVVAADQRNLNNIGTAIVLVDIIKSLQFIIDIVEVEIHNELDLPIF------ATNSKANKISHCYWLPFNAISEDPSIIEVVKIAAVEHSKHPDACAFLKVRGLKPGFSKLTITLRNQPNEIIREMLTSSITIGSFIPTKFLDPLSGSTTIGVRSSITMNIAYGPLPWLLDPSNYFYEMVEDSTSKQIVKKLSLTDNRHNLKLRTLQLKVQCISVGEVNISIFISNKKSLKHPKP------VKSTGL--AKLNLMIILKFKQLL*IDLHC 2322
            KL+  KVLLP T    +N+T++ S   C+ W S  PEV  I P+ SS+  +CS++A + +      + T  ++A++I TG  ++CD I+D I  ++I + T ELYL ++P  L  +A D  GNTFSTL G+ F+W ++    +NG  D+ N LR +T+ ES Y+ PS I  +E+    G   LVSG+KTG++++    ++   K++  ++   L++           YL+  T + YK+    QG   E+ MP++QY L++ N+           +A L    S +TA + GQ+ ++L  ++I      R P+S +Y+VE G+L F + P  ++WVL+T   ++Y +TI  +D +S+ ++ SDNIR+E + P E+FEVL SS NG+Y+ V+ I+ G+T++ + L  ++  +     L+ PV   Q++ I+ PIT+ P  +  PW P   +   Y   A GGSG + W +       + +  +V  KG +      GLS + A D +N  + G   V V    S++F    VE  + + L+LP+         +S+   +S C         E+  + + +        +H   C+ +KVR    G + L ++  +         L + IT+ +++P K +DP S    + + SS  M    GP PW+L+PS +F  +  + T    +  L    +R+  + R L   V C ++GE  I++ + N+ SL +P P      VKS     ++L LM +    QL   DL C
Sbjct:   27 KLNIPKVLLPFTRATRVNFTLEASEG-CYRWSSTRPEVASIEPLGSSE-QQCSQKAVVQARLTQPARLTSIIFAEDITTGQVLRCDAIVDLIHGIQIVSTTRELYLEDSPLELKIQALDSEGNTFSTLAGLVFDWTIVKDTEANGFSDSHNALRILTFLESTYIPPSYISEMEKAAKQGDTILVSGMKTGSSKLKARIQEAVYKNVRPAEVRLLILENILLNPAYDVYLLVGTSIHYKVQKIRQGKITELSMPSDQYELQLQNSIPDPQGDPARPVAVLTQDTSRVTAMQMGQSNLVLGHRSIRMQGASRLPNSTIYVVEAGYLGFTVHP-GDRWVLET--GHLYAVTIEVFDRSSNKVYPSDNIRIEAVFPAEFFEVLSSSQNGSYHHVRAIQSGQTTISASLTSVVDQDGGVHVLQVPVWNQQEVDIHIPITLYPSILTFPWQPKTGAYQ-YTIKAHGGSGNFTWSSS------SYMVATVTVKGVMTTGGDTGLSVIRAHDVQNPLHFGEMKVYVIEPSSMEFAPCQVEARVGHTLELPLTISGLMPGGSSEVVTLSDCSHFDLVVEVENQGVFQPLPGRLPPGPEH---CSGVKVRADAQGSTTLLVSYTHG-----HVHLGAKITLAAYLPLKAVDP-SSVAVVTLGSSKEMLFEGGPRPWVLEPSKFFRNVTSEDTGSISLSLLGPPASRNYQQHRVL---VTCQALGEQVIALSVGNRPSLSNPFPAVEPTVVKSVCAPPSRLTLMPVYALPQL---DLSC 767          

HSP 2 Score: 99.3673 bits (246), Expect = 3.158e-19
Identity = 106/500 (21.20%), Postives = 225/500 (45.00%), Query Frame = 2
Query: 2696 KCPAFNLESHLQIQISRSMIVNPITILLYQHEKVSTKFYVNYGSGYFTVTTPNNDFLXXXXXXXXXXXXXXVSYEIIQTKVDYSQRNAIINVIDACFSSLETEFENSKTIEIELVKPFKLQIFSLNRVQLGSQINVLLKIYDDNGREFPKDALHLLSMALHFTDRSNIVSANSLYSKDWVLTPNEFSESSGFVFKVNGEKLGFSSIYVELINTD---ITSNILKIEVFPPLKLLPKYTVLLEGSEIQLSTIGGPQNCHELLHYSIIKNETRNVKEAKIEFIIGPKGLLKAVSFGETSVVIKVEVIDADPTRNNRLTVLSKDEGRVGVVQIKSISIWSPTKNLLVGNSMPLWVTFASSSNDLQHIPITGFSITGLANSAISFKWHLNPPQGVISRLENVLEPAGINIGNKYLHSGMRLITSNPGKQTIEISISNVPKRWLSIDLQHNL--PLNSKINIAIIPKLEIIYPISYVQSVLVPPATKITLKTSLDDIALITYTLI 4180
            + P   + + +++ +   + V+P  + +Y H  V  + ++  GSGYF + T   D + +   D + +      +            ++ + V D C +     F       I +    +L +  +++V++G  +   +++ D   + F   A +   M L     S I++         ++T +E  ++    F V+G  +G +S+   + +     ++S   +IEVFPP +L+P+   L+ G+ IQ+++ GGPQ    +L +SI       V  A         GL++ +  G  SV+  V+ +DA+     ++ ++S+D   V V+Q++++ I +P   +  G  MP++VT  +S+        + FS  G A   ++F W +   +  +  L        I +  +Y +  M +     G+  + + +  +      +   H L   L+ +I I +  KL ++ P    + +L+ P + I L+T+ D  A+++Y ++
Sbjct:  877 RDPLVPVSASIELILVEDVRVSPEEVTIYNHPGVQVELHITEGSGYFFLNTSTQDIINVAYQDTRGVAMVHPLFP----------GSSTVMVHDLCLT-----FPAPAKATIHVSDIQELYVRVVDKVEIGKAVKAYVRVLDFYKKPF--LAKYFTFMDLKLRAASQIIT---------LVTLDEALDNYTATFLVHGVAIGQTSLSASVTDKSGQRVSSTAQQIEVFPPFRLIPRKVTLIIGAMIQITSEGGPQPQSNIL-FSINNESVAAVSSA---------GLVRGLMVGNGSVLGVVQAVDAE---TGKVIIVSQDHVEVEVLQLQAVRIRAPITRMRTGTQMPVYVTGITSNQ-------SPFSF-GNAVPGLTFHWSVT--KRDVLDLRGRHHEVSIRLSPQY-NFAMNVHGRVKGRTGLRVVVKALDPTAGQL---HGLGKELSDEIQIQVFEKLRLLNPEVEAEQILMSPNSFIKLQTNRDGAAILSYRVL 1323          
BLAST of Nuclear pore membrane glycoprotein 210 vs. UniProt/SwissProt
Match: sp|Q9QY81|PO210_MOUSE (Nuclear pore membrane glycoprotein 210 OS=Mus musculus OX=10090 GN=Nup210 PE=1 SV=2)

HSP 1 Score: 315.079 bits (806), Expect = 4.507e-85
Identity = 231/773 (29.88%), Postives = 394/773 (50.97%), Query Frame = 1
Query:  109 KLSDSKVLLPRTSYLSINYTIKGSPNICHEWISETPEVVVITPIYSSDGSKCSEQATITSVWQSNTKATGTVYAKNIATGHSVKCDVIIDQIRKLEIETRTLELYLHETPEALIARAYDEYGNTFSTLDGIPFEW-LINHIGSNG--DAQNVLRFITWTESEYVTPSLIGNLEQQGLMGYMQLVSGLKTGAAEVSLTFRDEXXXXXXXXXXXXXXXMANAALSPPLAYLIPYTQLSYKIIVHSQGSTQEVIMPNNQYLLKINNT----------DLAQLDFKGSTITAKKYGQTEVILIDKNINED--FRHPSSLLYIVEPGFLTFHISPHENQWVLQTMKDNIYTITIRPYDFNSHPIFMSDNIRLETLIPKEYFEVLHSSLNGTYNVVKTIKEGKTSLKSKLNFILLPNKTEFKLENPVEGTQDLIIYPPITVLPKFVVLPWYPNIKSIPGYLFSATGGSGEYKWMAH-----DDNHKINNLSISVDNKGFIKPM-KLGLSNVVAADQRNLNNIGTAIVLVDIIKSLQFIIDIVEVEIHNELDLPIF------ATNSKANKISHCYWLPFNAISEDPSIIEVVKIAAVEHSKHPDACAFLKVRGLKPGFSKLTITLRNQPNEIIREMLTSSITIGSFIPTKFLDPLSGSTTIGVRSSITMNIAYGPLPWLLDPSNYFYEMVEDSTSKQIVKKLSLTDNRHNLKLRTLQLKVQCISVGEVNISIFISNKKSLKHPKP------VKSTGL--AKLNLMIILKFKQLL*IDLHC 2322
            KL+  KVLLP T    +N+T++ S   C+ W S  PEV  I P+ SS+  +CS++A + +      + T  ++A++I TG  ++CD I+D I  ++I + T ELYL ++P  L  +A D  GNTFSTL G+ F+W ++    +NG  D+ N LR +T+ ES Y+ PS I  +E+    G   LVSG+KTG++++    ++   K++  ++   L++           YL+  T + YK+    QG   E+ MP++QY L++ N+           +A L    S +TA + GQ+ ++L  ++I      R P+S +Y+VE G+L F + P  ++WVL+T   ++Y ITI  +D +S+ ++ SDNIR+E ++P E+FEVL SS NG+Y+ ++ I+ G+T++ + L  ++  +     L+ PV   Q++ I+ PIT+ P  +  PW P              G+ +Y   AH           +++  +V  KG +      GLS + A D +N  + G   V V    S++F    VE  + + L+LP+          S+   +S C         E+  + + +        +H   C+ +KV+    G + L ++  +         L + IT+ +++P K +DP S    + + SS  M    GP PW+L+PS +F  +  + T    +  L    +R+  + R L   + C ++GE  I++ + N+ SL +P P      VKS     ++L LM +    QL   DL C
Sbjct:   27 KLNIPKVLLPFTRATRVNFTLEASEG-CYRWSSTRPEVASIEPLGSSE-QQCSQKAVVQARLTQPARLTSIIFAEDITTGQVLRCDAIVDLIHGIQIVSTTRELYLEDSPLELKIQALDSEGNTFSTLAGLVFDWTIVKDTEANGFSDSHNALRILTFLESTYIPPSYISEMEKAAKQGDTILVSGMKTGSSKLKARIQEAVYKNVRPAEVRLLILENILLNPAYDVYLLVGTSIHYKVQKIRQGKITELSMPSDQYELQLQNSIPDPQGDPARPVAILTQDTSRVTAMQMGQSNLVLGHRSIRMQGASRLPNSTIYVVEAGYLGFTVYPG-DRWVLET--GHLYAITIEVFDRSSNKVYPSDNIRIEAVLPAEFFEVLSSSQNGSYHHIRAIQSGQTAISATLTSVVDQDGGVHVLQVPVWNQQEVDIHIPITLYPSILTFPWQPKT------------GAYQYTIKAHGGSGNFSWSSSSSMVATVTVKGVMTTSGDTGLSVIRAHDVQNPLHFGEMKVYVIEPSSMEFAPCQVEARVGHTLELPLTISGFMPGGGSEVVTLSDCSHFDLVVEVENQGVFQPLPGRLPPGPEH---CSGVKVKADAQGSTTLLVSYTHG-----HVHLDAKITLAAYLPLKAVDP-SSVAVVTLGSSKEMLFEGGPRPWVLEPSKFFRNVTSEDTGSISLSLLGPPASRNYQQHRVL---MTCQALGEQVIALSVGNRPSLSNPFPAVEPTVVKSICAPPSRLTLMPVYALPQL---DLSC 767          

HSP 2 Score: 95.9005 bits (237), Expect = 4.048e-18
Identity = 130/647 (20.09%), Postives = 276/647 (42.66%), Query Frame = 2
Query: 2702 PAFNLESHLQIQISRSMIVNPITILLYQHEKVSTKFYVNYGSGYFTVTTPNNDFLXXXXXXXXXXXXXXVSYEIIQTKV---DYSQRNAIINVIDACFSSLETEFENSKTIEIELVKPFKLQIFSLNRVQLGSQINVLLKIYDDNGREFPKDALHLLSMALHFTDRSNIVSANSLYSKDWVLTPNEFSESSGFVFKVNGEKLGFSSIYVELINTD---ITSNILKIEVFPPLKLLPKYTVLLEGSEIQLSTIGGPQNCHELLHYSIIKNETRNVKEAKIEFIIGPKGLLKAVSFGETSVVIKVEVIDADPTRNNRLTVLSKDEGRVGVVQIKSISIWSPTKNLLVGNSMPLWVTFASSSNDLQHIPITGFSITGLANSAISFKWHLNPPQGVISRLENVLEPAGINIGNKYLHSGMRLITSNPGKQTIEISISNVPKRWLSIDLQHNL--PLNSKINIAIIPKLEIIYPISYVQSVLVPPATKITLKTSLDDIALITYTLI--PYQVDKISSKAQSKIHSGNILETNPNLSDNKVENFILHVTSSQSIKLNTANEITANQTVALFFTVKHPTYSM--MSPYISSNSIFKQFQTTKFINKHSSIFVLPLGGPFEFHITNHDELGNIFDISPDTNMFSYQLHRSDNIGI 4606
            P   + + +++ +   + V+P  + +Y H  V  + Y+  GSGYF + T   D ++             V+Y+  +           ++ + V D C +     F       I +    +L +  +++V++G  +   +++ D   + F   A +   M L     S I++         ++T +E  ++    F V+G  +G +S+   + +     ++S   +IEVFPP +L+P+   L+ G+ +Q+++ GGPQ    +L    I NE+           +   GL++ +  G  SV+  V+ +DA+     ++ ++S+D   V V+Q++++ I +P   +  G  MP++VT  +S+        + FS  G A   ++F W +   +  +  L        I +  +Y +  M +     G+  + + +  +      +   H L   L+ +I I +  KL ++ P    + +L+ P + I L+T+ D  A+++Y ++  P +   + +  +  + SG+ +  +                   ++++        NQT+ +   V   +Y    MSP + +                 ++  LPLG    F +  HD  G+IF      ++ ++  +R D + I
Sbjct:  879 PLVPVSASIELILVEDVRVSPEEMTIYNHPGVQVELYITEGSGYFFLNTSTQDIIK-------------VAYQDTRGVALVHPLLPGSSTVMVHDLCLA-----FPAPAKAIIHVSDIQELYVRVVDKVEIGKAVKAYVRVLDFYKKPF--LAKYFTFMDLKLQAASQIIT---------LVTLDEALDNYTATFLVHGVAIGQTSLSASVTDKSGQRVSSTPQQIEVFPPFRLIPRKVTLIIGAMMQITSEGGPQPQSNILFS--INNESVAA--------VSSSGLVRGLMVGNGSVLGVVQAVDAE---TGKVIIVSQDLVEVEVLQLQAVRIRAPITRMRTGTQMPVFVTGITSNQ-------SPFSF-GNAVPGLTFHWSVT--KRDVLDLRGRHHEVSIRLPPQY-NFAMNVYGRVKGRTGLRVVVKALDPTAGQL---HGLGKELSDEIQIQVFEKLRLLNPEIEAEQILMSPNSFIKLQTNRDGAAILSYRVLDGPEKAPIVHTDEKGFLVSGSGIGVS-------------------TLEVIAQEPFGTNQTILVAVKVSPVSYLRISMSPVLHT-------------QHKEALTALPLGMTVTFIVHFHDSSGDIFHA--HNSVLNFATNRDDFVQI 1435          
BLAST of Nuclear pore membrane glycoprotein 210 vs. UniProt/SwissProt
Match: sp|Q5VU65|P210L_HUMAN (Nuclear pore membrane glycoprotein 210-like OS=Homo sapiens OX=9606 GN=NUP210L PE=2 SV=1)

HSP 1 Score: 278.485 bits (711), Expect = 9.129e-74
Identity = 201/705 (28.51%), Postives = 358/705 (50.78%), Query Frame = 1
Query:  190 CHEWISETPEVVVITPIYSSDGSKCSEQATITSVWQSNTKATGTVYAKNIATGHSVKCDVIIDQIRKLEIETRTLELYLHETPEALIARAYDEYGNTFSTLDGIPFEWLI--NHIGSNGDAQNVLRFITWTESEYVTPSLIGNLEQQGLMGYMQLVSGLKTGAAEVSLTFRDEXXXXXXXXXXXXXXXMANAALSPPL-AYLIPYTQLSYKIIVHSQGSTQEVIMPNNQYLLKINN----------TDLAQLDFKGSTITAKKYGQTEVILIDKNINEDFRH--PSSLLYIVEPGFLTFHISPHENQWVLQTMKDNIYTITIRPYDFNSHPIFMSDNIRLETLIPKEYFEVLHSSLNGTYNVVKTIKEGKTSLKSKLNFILLPNKTEFKLENPVEGTQDLIIYPPITVLPKFVVLPWYPNIKSIPGYLFSATGGSGEYKWMAHDDNHKINNLSISVDNKGFIKPMKL-GLSNVVAADQRNLNNIGTAIVLVDIIKSLQFIIDIVEVEIHNELDLPIFATN-----SKANKISHCYWLPFNAISEDPSIIEVVKIAAVEHSKHPDACAFLKVRGLKPGFSKLTITLRNQPNEIIREMLTSSITIGSFIPTKFLDPLSGSTTIGVRSSITMNIAYGPLPWLLDPSNYFYEMVEDSTSKQIVKKLSLTDNRHNLKLRTLQLKVQCISVGEVNISIFISNKKSLKHPKP 2241
            C+ W S   + V + P+Y  +G+ CS++A + +      + +  + A+ I T H ++CDV +D I  +EI +R  ELY+ ++P  L+ RA D  GNTFS+L G+ FEW I  ++  +  +  + +R + ++E+EY  P  I  +E++   G + LVSG++TGAA V +    E     + +  ++LLV+ N  L P    YL+  T + Y++    QG   EV  P   Y+L++ +            +A LD K + +TA + GQT ++ + KN++       P+  +Y+VEPGFL F + P  N+W L+     +Y IT+  +D +S  +++SDN+R+    PKEYFE   +++NG+Y++VK +K+G   + + L  I+  NK    ++  ++  Q++ IY PI + PKF+  P +P +  +  Y     GGSG + W +       N   + V  KG +   ++ G S V+A D +N    G   + V  +  ++ +    +VEI   +++PI   +      +A   + C  L  +   +   +  ++K         P  C+   +     G + +T+++    NE   + L SS T  ++ P K L+P+  +  +  +S   M    GP PW+L+PS +F E+  + T K  + ++ L   R   K      ++QC+ +GE  ++  I N   + +P P
Sbjct:   65 CYTWHSTHHDAVTVEPLYE-NGTLCSQKAVLIAESTQPIRLSSIILAREIVTDHELRCDVKVDVINSIEIVSRARELYVDDSPLELMVRALDAEGNTFSSLAGMMFEWSIAQDNESAREELSSKIRILKYSEAEYAPPIYIAEMEKEEKQGDVILVSGIRTGAAVVKVRIH-EPFYKKVAAALIRLLVLENIFLIPSHDIYLLVGTYIKYQVAKMVQGRVTEVKFPLEHYILELQDHRVALNGSHSEKVAILDDKTAMVTASQLGQTNLVFVHKNVHMRSVSGLPNCTIYVVEPGFLGFTVQP-GNRWSLEV--GQVYVITVDVFDKSSTKVYISDNLRITYDFPKEYFEEQLTTVNGSYHIVKALKDGVVVINASLTSIIYQNKDIQPIKFLIKHQQEVKIYFPIMLTPKFLAFPHHP-MGMLYRYKVQVEGGSGNFTWTSS------NETVVIVTTKGVVTAGQVRGNSTVLARDVQNPFRYGEIKIHVLKLNKMELLPFHADVEIGQIIEIPIAMYHINKETKEAMAFTDCSHLSLDLNMDKQGVFTLLKEGI--QRPGPMHCSSTHIAAKSLGHTLVTVSV----NE-CDKYLESSATFAAYEPLKALNPVEVA-LVTWQSVKEMVFEGGPRPWILEPSRFFLELNAEKTEKIGIAQVWLPSKR---KQNQYIYRIQCLDLGEQVLTFRIGNHPGVLNPSP 746          

HSP 2 Score: 86.2705 bits (212), Expect = 3.155e-15
Identity = 101/489 (20.65%), Postives = 220/489 (44.99%), Query Frame = 2
Query: 2750 MIVNPITIL-----LYQHEKVSTKFYVNYGSGYFTVTTPNNDFLXXXXXXXXXXXXXXVSYEIIQTKVDYSQRNA---IINVIDACFSSLETEFENSKTIEIELVKPFKLQIFSLNRVQLGSQINVLLKIYDDNGREFPKDALHLLSMALHFTDRSNIVSANSL-----YSKDWVLTPNEFSESSGFVFKVNGEKLGFSSIYVELINTDITSNILKIEVFPPLKLLPKYTVLLEGSEIQLSTIGGPQNCHELLHYSIIKNETRNVKEAKIEFIIGPKGLLKAVSFGETSVVIKVEVIDADPTRNNRLTVLSKDEGRVGVVQIKSISIWSPTKNLLVGNSMPLWVTFASSSNDLQHIPITGFSITGLANSAISFKWHLNPPQ--GVISRLENVLEPAGINIGNKYLHSGMRLITSNPGKQTIEISISNVPKRWLSIDLQHN-LPLNSKINIAIIPKLEIIYPISYVQSVLVPPATKITLKTSLDDIALIT 4168
            ++V+ +T++     +Y H  V   F +  GSGYF V +     +              ++Y   ++ V+    +     + V D C + L     + +  +I+     +L++  +++V++   + V +++   + R F     +  +M L     S IV+   +     YS++++L      +++  +  +  +K+G             TS    IEVFPP +LLP+   L+  + +Q+ + GGPQ    ++H+S I N+T  V        +  +G +     G   V   ++ ++ D     ++ V S+DE ++ VVQ++++ I +    L+    MP++V   +S+        T FS +  AN  ++F W ++      ++ R   V     + + + +    M + T   G+ +I++++  +     S   + N L L+ ++ I +  KL++ YP    + +L+P  +++ L T+ +  A ++
Sbjct:  895 LLVDDVTVVPENATIYNHPDVKETFSLVEGSGYFLVNSSEQGVVT-------------ITYMEAESSVELVPLHPGFFTLEVYDLCLAFLGPATAHLRVSDIQ-----ELELDLIDKVEIDKTVLVTVRVLGSSKRPFQNK--YFRNMELKLQLASAIVTLTPMEQQDEYSENYILRATTIGQTT--LVAIAKDKMG----------RKYTSTPRHIEVFPPFRLLPEKMTLIPMNMMQVMSEGGPQP-QSIVHFS-ISNQTVAV--------VNRRGQVTGKIVGTAVVHGTIQTVNED---TGKVIVFSQDEVQIEVVQLRAVRILAAATRLITATKMPVYVMGVTSTQ-------TPFSFSN-ANPGLTFHWSMSKRDVLDLVPRHSEVF--LQLPVEHNF---AMVVHTKAAGRTSIKVTVHCMNSS--SGQFEGNLLELSDEVQILVFEKLQLFYPECQPEQILMPINSQLKLHTNREGAAFVS 1323          
BLAST of Nuclear pore membrane glycoprotein 210 vs. TrEMBL
Match: A0A0R3TQB9 (Uncharacterized protein OS=Rodentolepis nana OX=102285 GN=HNAJ_LOCUS9728 PE=4 SV=2)

HSP 1 Score: 438.343 bits (1126), Expect = 1.786e-150
Identity = 288/821 (35.08%), Postives = 426/821 (51.89%), Query Frame = 1
Query:  103 EFKLSDSKVLLPRTSYLSINYTIKGSPNICHEWISETPEVVVITPIYSSDGSKCSEQATITSVWQSNTKATGTVYAKNIATGHSVKCDVIIDQIRKLEIETRTLELYLHETPEALIARAYDEYGNTFSTLDGIPFEWLINHIGSNGDAQ----NVLRFITWTESEYVTPSLIGNLEQQGLMGYMQLVSGLKTGAAEVSLTFRDEXXXXXXXXXXXXXXXMANAALSPPLAYLIPYTQLSYKIIVHSQGSTQEVIMPNNQYLLKINNTDLAQLDFK-GSTITAKKYGQTEVILIDKNINEDF---------------------RHPSSLLYIVEPGFLTFHISPHE----------------------NQWVLQTMKDNIYTITIRPYDFNSHPIFMSDNIRLETLIPKEYFEVLHSSLNGTYNVVKTIKEGKTSLKSKLNFILLPNKTEFKLENPVEGTQDLIIYPPITVLPKFVVLPWYPNIKSIPGYLFSATGGSGEYKWMAHDDNHKINNLSISVDNKGFIKPMKLGLSNVVAADQRNLNNIGTAIVLVDIIKSLQFI------------------------------IDIVEVEIHNE-----------------LDLPIFATNSKANKISHCYWLPFNAISEDPSIIEVVKIA-----AVEHSKHPDACAFLKVRGLKPGFSKLT--ITLRNQPNEIIREMLTSSITIGSFIPTKFLDPLSGSTTIGVRSSITMNIAYGPLPWLLDPSNYFYEM--VEDSTSKQ---IVKKLSLTDNRHNLKLRTLQLKVQCISVGEVNISIFISNKKSLKHPKPV 2244
            EFKLSDSK+LLP  S  S+NYT+ GS   C+EW S TPEVV + PI    G  C+E+A++T+VWQS+ + T T+YA++  T H +KCDVI+D I  ++++T T ELYLH TPE+L+  AYDE+GN FS+LDGIPFEW I   GS  D++     VLRF++WTESEY T   I  LE+ GL GYMQLVSGL+TG+A VS   R E   S +    V+LLVMANA L+PP+ YLIP  Q   ++IV  Q + +EV MP+NQY L +++  + +LD K GS I A++ GQT V L+DKN+ E                       R P S++ +VEP +  F + P                        N W L+T K   Y + +  YD N+H IF SDNIR+    PK+  EVL SS NGT ++V   K G  ++K+ L  ++  N+      +P+ G+Q+L  Y PI + PK V L W  ++ +  G+  SA GGSG+Y W    D +  +  + +V   GF+    +G + VV +D RN +    + V ++ +  L F                               +D++++  H++                 L + + A +   N I+ C+ LP +    DPS+++V+        +V + ++  ACAF++V GL+ GF++L    T   Q  E   +   S   +  +    F+ P +    I   SS  ++   GP PW LD +++F E+   E    K+   I +K      + N  L      + C S G   +S+ + N+ S  +P P 
Sbjct:   20 EFKLSDSKLLLPYFSTASVNYTLSGSAGSCYEWWSGTPEVVAVVPI-GDFGKTCTEKASVTAVWQSSLRRTATIYARDTVTSHVLKCDVIVDDIHSIKVDTTTQELYLHNTPESLVVIAYDEFGNKFSSLDGIPFEWKI-QPGSEKDSKVTGDGVLRFLSWTESEYTTSGRISMLEEDGLQGYMQLVSGLRTGSAVVSSALR-EPAYSHVHPAMVRLLVMANAQLNPPVLYLIPKAQAHLQVIVVRQDADEEVKMPSNQYYLSVSDESIVELDAKSGSLINAERNGQTTVTLLDKNVEEAISLLGSNVGDTIDLDPQMVAHHRRPMSIVNVVEPAYFRFSVQPVNEDAFLCVKAARQSSQAFGQGKFNHWTLETGKK--YNLQLDLYDQNNHRIFPSDNIRISVEFPKDSMEVLKSSQNGTSHIVVARKTGMITVKATLEGVMTGNEKLKLFSHPIMGSQELAAYSPIQIYPKQVHLAWDVSMNTSEGFNLSAKGGSGDYIWTVLSDKNNEDVSAANVSQDGFLFVNGIGSAVVVVSDLRNPSMCSHSTVHINYLADLGFSQGRVEIYLPKNPLGESENRLSSVLSTRPVELDMLDLLPHSQQFDQHPLNQQEKMGNSVLSVGLKAVDFDGNPITFCHNLPISVRPVDPSLVKVLPGVQYLPPSVINERNSSACAFVRVIGLREGFTELEAYFTTGEQKGE---QKAISKFPVVVYKDISFV-PNNAFVAIATGSSRRISFTDGPNPWELDVTSHFVELEFTEAPMGKKNPSIRQKPQAFAFQGNASLSGFTFVLHCESSGNFEVSVIVGNRPSSTNPLPA 831          

HSP 2 Score: 128.257 bits (321), Expect = 1.786e-150
Identity = 191/854 (22.37%), Postives = 356/854 (41.69%), Query Frame = 2
Query: 2291 LSSFYRLICTVPVRMKLVPRLISSNISTG---CPFQNTS---ENQHITVDNKNPSSVEIVFTDKNGVQLERSESFAVKVEIKSLNKKNIKEIVQVIYPTVIYXXXXXXXXXXXK--FLVTPYRFGESTGEIEVIVKSSSCISGKCPAFNLESHLQIQISRSMIVNPIT-ILLYQHEKVSTKFYVNYGSGYFTVTTPNNDFLXXXXXXXXXXXXXXVSYEIIQTKVDY-----SQRNAIINVIDACFSSLET-EFENSKTIE------IELVKPFKLQIFSLNRVQLGSQINVLLKIYDDNGREFPKDALHLLSM-----------ALHFTDRSNIVSANSLYSKDWVLTPNEFSESSGFVFKVNGEKLGFSSIYVELINTDITSNILKIEVFPPLKLLPKYTVLLEGSEIQLSTIGGPQNCHELLHYSIIKNETRNVKEAKIEFIIGPKGLLKAVSFGETSVVIKVEV---------IDADPTRNNRLT-----VLSKDEGRVGVVQIKSISIWSPTKNLLVGNSMPLWVTFASSSND--LQHIPITGFSITGLANSAIS--------------FKWHLNPPQ-GVISRLENVLEPAGINIGNKYLHSGMRLITSNPGKQTIEISI--------SNVPKRWLSIDLQHNLPLNSKINIAIIPKLEIIYPISYVQSVLVPPATK--ITLKTSLDDIALITYTL-----IPYQVDKISSKAQSKIHSGNILETNPNLSDNKVENFILHVTSSQSIKLNTANEITANQTVALFFTVKHPTYSMMSPYISSNSIFKQFQTTKFINKHSSIFVLPLGGPFEFHITNHDELGNIFDISPDTNMFSYQL--HRSDNIGITI 4612
            LS+   +IC +P +++L+P L    +  G   CP  N S    +  I   N  P +VE+V    +G++L   +S  +   I   N+   + +V   +P ++ S  + +S S S+  F++TP   GES G + V V +     G+    +LES L ++++  +++ P+    L  H   ST  ++++GSG+F                 + + +  +S E ++++ D+      +   II   D CF +      E++KT        + +V    L++++  ++++ S+  V ++ +D  G       ++LL +           ++ FT + +  ++   Y   W+  P+  +        + G+ LG S +  + ++  +TSNI  + VF PL L+P    LL G+  Q++T GGP +    L + +        K +  E     +G+L     G+                  +D        LT     + S+   RV VV +  I I  P      G+   + +  AS + +  L  +PI    I  L  + ++              F W L+PP     ++L + L    ++  +  L SGM L+   PG+  + +++          +     S   Q    L+++I   IIP L +I P      +LV P ++  +TL   +    ++ Y++      P  + ++SS  Q +  S +      +   N      L +    +I   +     ++Q++AL   VK P Y +        S+ K            S   LP GGP+   ++ HDE+G  FD   + N+ S QL  HRS  +  +I
Sbjct:  833 LSTPLSVICDIPSKIELLPHLDLPTLPKGFPVCPIINRSFGNSDDFIPFSNNAPLNVEVVIKGFSGLELSGVDSIEMSTHITVGNRDKAENLVIDYHPKILGSKQTGDSISPSRPHFIITPKILGESAGLMHVKVAAKH--KGE-QTTDLESLLNLKMAPKVVIEPLDDFQLLLHPNASTNVHLSHGSGFFHF---------EILSGSKAVGQACLSSEALKSQRDFVLHPKCKGKVIIRATDLCFLAEPVYGHESAKTAPAYDERVVSVVGLGSLRLYAPAQMEVNSKAPVYIRAFDSEGTALSAQFVNLLDLHVTAASPEGDQSVTFTCQDSAETSKGSY---WLSRPSTGNLPGLAKVIICGQALGLSKL--KAVSGYVTSNIEPVNVFAPLSLIPCDFNLLLGAAHQITTSGGPSS--RSLSFEVSTERPGQPKLSFTEVGEDGEGILLRAELGKVGSASVSVKTTSSSGYAGLDTRDFEAWGLTPPPKSLSSQASCRVNVVALSGIRIGCPLPLTSSGSGSEVRILVASPNGNTSLGGVPIWAEGIATLGGNELTVTPMGMADVRPPLHFAWRLSPPMPSAPAQLFHWLSKLNVDPDDTTLSSGMVLVGVTPGQVKLHLTVFTDDDALMGQLTSHPTSRSSQPVKQLSAEITFTIIPHLSLINPPHQNPRILVSPNSRLQLTLPQHVLMEGVVEYSIQCPSNSPTTMLRVSSTGQLEAGSHDRCGVWSDWRLNACR-CRLRIDYRSAIAGGSERNERSHQSLALDVIVKPPHYVLSRALSGPISLLK------------SSGGLPFGGPYPVALSLHDEIGETFDAVSE-NLLSLQLQAHRSGLLDFSI 1653          
BLAST of Nuclear pore membrane glycoprotein 210 vs. TrEMBL
Match: G4V642 (Nuclear pore membrane glycoprotein gp210-related OS=Schistosoma mansoni OX=6183 GN=Smp_142550 PE=4 SV=1)

HSP 1 Score: 403.29 bits (1035), Expect = 1.770e-143
Identity = 293/868 (33.76%), Postives = 423/868 (48.73%), Query Frame = 1
Query:  103 EFKLSDSKVLLPRTSYLSINYTIKGSPNICHEWISETPEVVVITPIYSSDGSKCSEQATITSVWQSNTKATGTVYAKNIATGHSVKCDVIIDQIRKLEIETRTLELYLHETPEALIARAYDEYGNTFSTLDGIPFEWLI--NHIGSNGDAQNVLRFITWTESEYVTPSLIGNLEQQGLMGYMQLVSGLKTGAAEVSLTFRDEXXXXXXXXXXXXXXXMANAALSPPLAYLIPYTQLSYKIIVHSQGSTQEVIMPNNQYLLKINNTDLAQLD-FKGSTITAKKYGQTEVILIDKNINEDF---------------------RHPSSLLYIVEPGFLTFHI--------------------SPHENQ-----------WVLQTMKDNIYTITIRPYDFNSHPIFMSDNIRLETLIPKEYFEVLHSSLNGTYNVVKTIKEGKTSLKSKLNFILLPNKTEFKLENPVEGTQDLIIYPPITVLPKFVVLPW-----YPNI-KSIPGYLFSATGGSGEYKWMA--------HDDNHK------INNLSISVDNKGFIKPMKLGLSNVVAADQRNLNNIGTAIVLVDIIKSLQFIIDIVEVEI---HNELDLPIFATNSKANKISHCYWLPFNAISEDPSIIE------------------------------------VVKIAAVEHSKH-----------PDACAFLKVRGLKPGFSKLTITLRNQPNEIIRE--MLTSSITIGSFIPTKFLDPLSGSTTIGVRSSITMNIAYGPLPWLLDPSNYFYEMV-----------------EDSTSKQIVKKLSLTDNRHNLK----------LRTLQLKVQCISVGEVNISIFISNKKSLKHPKPV 2244
            +FKLSDSK+LLP  S   +NYT+ GS   C+EW S TPEV V++    S  + CS  A IT+VWQS  +A  T+YAK I   H VKCDVI+D I ++EI T T ELYLH TP  LI  AYDEYGNTF++L+G+PFEW I  +     GD Q VLRFITW ESEY TPS +  LE +G+ GYMQL+SGL+TG+A VS+    E +   +    V+LLVMANA LSP LAYL+P + L++ + V  QG  QEV MP+ QY L++N+T+LA L+   GST+ A  YGQTEV L+D+N+ E                       R P+SL+ IVEP +L F +                      + NQ           W++++ K  +Y I +  YD N+H ++ SDN+RL    P+ +FE+L SSLN TY VV+    G  SLK+ L  ++  +    +  + + G QD+ IY PI + P  V+LPW      PN+  S  GY   A GG G+Y+W A        H D  K      + N  +S+   G I  +  G S +VA+   N    G  +V V     ++F+ +  EV I    N   +    T S +N+ ++  W        DPS +E                                    VVKI    H+              + C    V G+  GF+++       P     E  ++ S + + ++    F+DP+S  T + + S+  M + +GP PW L  S ++ ++                  E   SK + +K +  D    ++          +R +   ++C S+G     I I N+ +  +  P+
Sbjct:   16 DFKLSDSKLLLPYYSVNPVNYTLHGSEGACYEWHSGTPEVAVVS-PVVSSENSCSSAAVITAVWQSRHRAVATIYAKIINADHIVKCDVIVDDINRIEIATTTQELYLHNTPVPLIVTAYDEYGNTFTSLEGVPFEWRIFEDKYEEFGDIQGVLRFITWRESEYTTPSTMALLESKGMQGYMQLISGLRTGSAVVSVALH-ESIYKNVAPSQVRLLVMANAQLSPALAYLVPNSLLTFTVHVIQQGDDQEVSMPSLQYHLQVNDTNLAVLNPLDGSTLKALNYGQTEVTLLDRNVEEALEKLDEVLNSKVDDSDLRLPKRRRPTSLIQIVEPAYLGFTLIQKYTNKNPDICQLASFLNSGSYVNQVASGSYMPIRRWIMESGK--VYVINLDIYDRNNHRLYPSDNLRLSLYFPESHFEILKSSLNQTYVVVRAFSSGSVSLKAVLRGVVDQDGNVVEFNSTITGNQDVTIYSPIKIYPTPVILPWSTGLLSPNLTHSDHGYHLRANGGCGQYRWTALSVRALEHHSDPGKLPNSELLTNTVVSITKTGVISALNPGESIIVASSSSNPQICGYTVVYVRPPSEMKFVYERNEVLIPPRRNAKFIDEELTRSYSNQPTNEEW-----SVRDPSAVEFDLERLAIGLAVLDSDGQSMTDCRNLNIEIRAVDSNVVKIIPGFHAPRLNSSTEYGLFDSNECLHFYVIGVNVGFTEIKAIYNPSPVNKFDESVLIVSRVHVAAYRKINFIDPVSEVTPVAIGSTRNMLVTHGPQPWPLQLSEHYVDVFPQPDADNDISSLPTLISEPHFSKTVYQKTNFDDEAKPVQSYIMDQTEGHVRLVSFSLRCESIGMFEFVIEIGNRPTPSNLHPM 874          

HSP 2 Score: 139.813 bits (351), Expect = 1.770e-143
Identity = 208/914 (22.76%), Postives = 367/914 (40.15%), Query Frame = 2
Query: 2291 LSSFYRLICTVPVRMKLVPRLISSNISTG---CPFQNTSENQ----HITVDNKNPSSVEIVFTDKNGVQLERSESFAVKVEIKSLNKKNIK----EIVQVIYPTVIYXXXXXXXXXXXK-------FLVTPYRFGESTGEIEVIVKSSSCISGKCPAF-----NLESHLQIQISRSMIVNPITIL-LYQHEKVSTKFYVNYGSGYFTVT-----TPNNDFLXXXXXXXXXXXXXXVSYEIIQTKVDYSQR-----NAIINVIDACFSSLETEFENSKTIE-------IELVKPFKLQIFSLNRVQLGSQINVLLKIYDDNGREFPKDALHLLSMAL---HFT------------DRSNIVSANSLYSKD---WVLTPNEFSESSGFVFKVNGEKLGFSSIYVELI--------NTDITSNILKIEVFPPLKLLPKYTVLLEGSEIQLSTIGGP-QNCHELLHYSI------IKNETRNVKEAKIEFIIGPKGL--LKAVSFGETSVVIKVEVIDADPTRNNRLTVLSKDEGRVGVVQIKSISIWSPTKNL----------------------------LVG---------NSMPLWVT------FASSSNDLQHIPITGFSITGLA--NSAISFKWHLNPPQ-GVISRLENVLEPAGINIGNKYLHSGMRLITSNPGKQTIEISISNVPKRW-----LSIDLQHNLPLNSKINIAIIPKLEIIYPISYVQSVLVPPATKITL--KTSLDDIALITYTL--IPYQVDKISSKAQSKIHSGNILETNPN----LSDNKVENFILHVTSSQSIKLNTANEITAN----------QTVALFFTVKHPTYSMMSPYISSNSIFKQFQTTKFINKHSSIFVLPLGGPFEFHITNHDELGNIFD-ISPDTNMFSYQLHRSD 4594
            LSS + ++C V V ++L+P     ++      CP  N S N      + + N  P+ + ++F      +LE  +S    V I S++         ++VQ + P V       +  S ++       FL+TP   G S+G + V V   S +  +   F      L+S L I +S  +   P  ++ L+ H + S+  Y++ GSGY+ +      T  + +                +   I  +  Y  +        I  ID CF S ++   N   +        ++++    L +   N++QLG ++   ++    +G   P     LL +++   H T            D   I+     Y      W+   +   E     F V G  LG S + +  I           + SN+++I+VF PL+L P    LL G+E +L  +GGP Q   E +  SI      +K    +V     E +    GL  ++A + G T   +   +   D  R++ + + S+    + +V +  + I  P  NL                            L+           S PLWV       + S    + +I     S  G+A  N  + ++WHLNPP+     RLE  L+  GIN+   +L SGM L+   PG  T+ +++  V         +S D      L++++ I ++ +L +  P    Q +++ P +++ L   T L   +++ Y +  +P+      ++  S  H+   L   P+     +D   E+ ++   + Q   +   N + +           QT+ L   +K P Y M S  + S +I +  + +K +        LP+GGP+   I+ HDELG +FD +S D       LHRSD
Sbjct:  876 LSSKFTIMCDVAVSLQLLPVFQFPSLPPHFPPCPLVNISSNDWSHDKLILPNTIPTVIHLIFFGSESQELESVDSLVSNVVISSIDDDRGTTEKLQLVQYVDPPVQMDYSDYDKRSFNRRMHSRPYFLITPANLGHSSGSLAVHVTVHSSLPNRYVPFLPGIQGLKSILNIYLSPVINAVPSQLIKLFYHSEASSTVYIHGGSGYYYLENSGNLTDRHHYPIRITEKLNEPTLATHTIPYIMPRRTYEIQPQHVGRVTIQAIDLCFPSTKSNPSNEYNLSPSQAEFNVDVIGLSALNLRVHNQIQLGDEVTAFVEAIGTDGITLPSKCARLLKLSIISDHVTHSTSTGHKESSHDSKRILRVPETYVPSDSFWICDSSNAEEPCSGQFTVRGIALGTSKLMITSIVPGLLYGKPITVQSNVVEIQVFAPLRLTPCNFNLLLGAEYELHAVGGPSQASLEFIPESISSRIIIVKTNPSSVLIRASESL----GLANIRARAVGMTGNKLSSSL---DEKRDDYV-IYSETVCNIHIVALSGVRIRCPLANLDEITSQISDSSNANIPELSNSDRSDRHFLLACPPGRSDDCGSTPLWVEGTAYSPYFSEDQSISNI----VSPLGMAAVNPPLRYRWHLNPPEPNSFVRLEYWLDRFGINMDETHLASGMVLVGLKPGTVTVHLTVEPVEPYAKQIIAVSTDGMSTDRLHAQLTIVVLSRLGLSSPHREPQQIILSPNSQLNLIPWTDLHSDSILQYKILTVPH------NRNLSLEHASQFLTVTPDGILRANDKCSESGLVCRVTLQIQSMPNGNLVNSKYTHNFDNSLIQTLILDVLIKVPRYMMFS--VPSITIPQNERLSKVVG-------LPVGGPYNIKISYHDELGRVFDAVSNDFYRLKASLHRSD 1762          
BLAST of Nuclear pore membrane glycoprotein 210 vs. TrEMBL
Match: A0A5K3FY95 (Uncharacterized protein OS=Mesocestoides corti OX=53468 PE=4 SV=1)

HSP 1 Score: 414.846 bits (1065), Expect = 5.768e-143
Identity = 276/836 (33.01%), Postives = 435/836 (52.03%), Query Frame = 1
Query:  100 NEFKLSDSKVLLPRTSYLSINYTIKGSPNICHEWISETPEVVVITPIYSSDGSKCSEQATITSVWQSNTKATGTVYAKNIATGHSVKCDVIIDQIRKLEIETRTLELYLHETPEALIARAYDEYGNTFSTLDGIPFEWLINH-------IGSNGDAQNVLRFITWTESEYVTPSLIGNLEQQGLMGYMQLVSGLKTGAAEVSLTFRDEXXXXXXXXXXXXXXXMANAALSPPLAYLIPYTQLSYKIIVHSQGSTQEVIMPNNQYLLKINNTDLAQLDFK-GSTITAKKYGQTEVILIDKNINEDF---------------------RHPSSLLYIVEPGFLTFHISP-------------HE-----------NQWVLQTMKDNIYTITIRPYDFNSHPIFMSDNIRLETLIPKEYFEVLHSSLNGTYNVVKTIKEGKTSLKSKLNFILLPNKTEFKLENPVEGTQDLIIYPPITVLPKFVVLPWYPNIKSIPGYLFSATGGSGEYKW-------MAHDDNHKINNLSISVDNKGFIKPMKLGLSNVVAADQRNLNNIGTAIVLVDIIKSLQFIIDIVEVEIHNE----------------------------------------------LDLPIFATNSKANKISHCYWLPFNAISEDPSIIEVVKIA-----AVEHSKHPDACAFLKVRGLKPGFSKLTITL----RNQPNEIIREMLTSSITIGSFIPTKFLDPLSGST-TIGVRSSITMNIAYGPLPWLLDPSNYFYEM--VEDSTSK---QIVKKLSLTDNRHNLKLRTLQLKVQCISVGEVNISIFISNKKSLKHPKPV 2244
            +EFKLSDSK+LLP  S  S+NYTI GS   C+EW S TPEVV + PI  S G+ C+++A++T+VWQS  + T T+YA++  TG  +KCDVI+D I  ++++T T ELYLH TPE+L+   YDE+GNTFS+LDGIPFEW I+        I SNG    VLRF+TWTESEY TPS IG LE +G+ GYMQLVSGL+TG+A VS+  R E   S +K   V+LLVMANA L+PP+ Y++P +   +++ V  Q + +E+ MP+ QY L +++  + +L+ + G+ ITA+K GQT V L+D+N+ E                       R P+S++++VEP +  F + P             H            N W L+T K   Y + +  YD N+H +F SDNIR+  + P + F+ ++ + NGT   +  +K G  +LK+ L+ ++        L + + G+Q++++Y P+TVLPK + + W  +  +  GY  +A GGSG+Y W       +   +        +SV + G + P  LG + VVA+D RN +    + + V+ + ++ F     EV +                                                 L + + A +++ N I++C+ LP      D SI+ V+          +     + CAF+++ GL+ GF++L +      R++ N++      +   +  +    FL    GS   + V SS  ++  +GP PW LDP  +F E+  V  S  K    + ++     +++N  +      ++C S G   +++ I N  S  +P P 
Sbjct:   19 SEFKLSDSKLLLPYFSSASVNYTITGSGGSCYEWWSGTPEVVSVVPI-GSVGNTCTDRASVTAVWQSPLRRTSTIYARDQVTGRVLKCDVIVDDIHSIKVDTTTQELYLHNTPESLVVIGYDEFGNTFSSLDGIPFEWKIHQASDQSSTINSNG----VLRFLTWTESEYTTPSRIGLLEAEGMQGYMQLVSGLRTGSAVVSVVLR-EPAYSHVKPAKVRLLVMANAQLNPPVLYVMPNSIARFRVNVVRQDADEEISMPSPQYYLSVSDDSIVELEPETGAVITARKCGQTTVTLLDRNVEEAIHLLGSNPSDSNDTETQLLSYHRRPTSIVFVVEPAYFRFTVQPVGDGAQICVSAARHSSFSLTFGQGLYNHWTLETGK--TYLLALELYDQNNHRLFPSDNIRISIMYPGDMFKAVNRTENGTVYTIVPLKTGTVTLKASLDGVVSKTGETKLLNHLISGSQEVVVYSPLTVLPKQLTIAWDFSENNSEGYALAAVGGSGDYVWTVLPTSSLPFAEIQSSGLEVVSVTSNGALFPKGLGSAVVVASDLRNPDMCSHSSIRVNSLSTVNFSPGRAEVYLPKHPLLADEARISSLLSTRSISEDVKDLIPDSLVDRIPQDPQEKMAKSILSVGLTAMDTEGNTITNCHNLPIKVRPLDSSIVSVLPGVYYLPPTTKGLNGSNVCAFVRLFGLREGFTELGVFYSSGERSKENKV-----PARFPVAVYKDITFL--AEGSVIAVAVGSSRRISHIHGPNPWRLDPGLHFVELDVVTQSGGKTKPTVRQQPKPLVSQNNNSITGYSFILRCESSGSFQLNVIIGNHPSSTNPVPA 839          

HSP 2 Score: 126.716 bits (317), Expect = 5.768e-143
Identity = 229/1002 (22.85%), Postives = 409/1002 (40.82%), Query Frame = 2
Query: 2291 LSSFYRLICTVPVRMKLVPRLISSNISTG---CPFQNTS---ENQHITVDNKNPSSVEIVFTDKNGVQLERSESFAVKVEIKSLNKKNIKEIVQVIYPTVI----YXXXXXXXXXXXKFLVTPYRFGESTGEIEVIVKSSSCISGKCPAFNLESHLQIQISRSMIVNPIT--ILLYQHEKVSTKFYVNYGSGYFTVTTPNNDFLXXXXXXXXXXXXXXVSYEIIQTKV--DYSQR-----NAIINVIDACFSSLETEFENSKTIE------------IELVKPFKLQIFSLNRVQLGSQINVLLKIYDDNGREFPKDALHLLSMALHFT---------------------DRSNIVSANSLYSKD--WVLTPNEFS-ESSGFV-FKVNGEKLGFSSIYVELINTDITSNILKIEVFPPLKLLPKYTVLLEGSEIQLSTIGGPQNCHELLHYSIIKNETRNVKEAKIEFIIGPKGLLKAVSFGET-SVVIKVEV-------------IDADPTRNNRLTVLSKDEGRVGVVQIKSISIWS--PTKNLLVG--------------NSMPLWV-TFASSSNDLQHIPITGFSITGLAN--SAISFKWHLNPPQ-GVISRLENVLEPAGINIGNKYLHSGMRLITSNPGKQTIEISI------SNVPKRWLSIDLQHNL-PLN---SKINIAIIPKLEIIYPISYVQSVLVPPATKITLKTSLDDIA--LITYTLIPYQVDKISSKAQSKIHSGNILETNPN-----LSDNKVENFILHVT---SSQSIKLNTANEITANQTVALFFTVKHPTYSMMSPYISSNSIFKQFQTTKFINKHSSIFVLPLGGPFEFHITNHDELGNIFD-ISPDTNMFSYQLHRSDNIGITICSSESIRKSDSLKESTTLNIDPILTFIDSKSFSSQKVLQFQGLSTGENTIQLFYHD-LLSDSPQL--TDIISIPTGSVLEMKKFPQNLATEGSRVKYEAPFSGGYWYSSEGDIVSID 4954
            LS+   LIC +P ++ LVP L+   +      CPF N S       I   N  P  +EIVF   +G +L   +S   +  + S  +K I EIV V+ P ++    +S       +N   ++TP   GES G + V V +S    G+  +  LE+ L +++S  + + P+    LL  HE V    ++++GSG+F     + D +        +     + ++   ++   D+S R       II V D CF +    F     ++            + +V    L++F+ ++++L S+  V ++ +D +G+        LL + L  +                     D  N+   +S+ S    W+  P +   E  G   F + G+ LG S +  + ++ ++TSN+  + VF PL L P    LL G+  +++T GGP +       +  +    N++  ++       G++     G+T S  +  +               DA    +   ++ S+    V VV +  + I    PT +   G                +P+W    A+  NDL   P+      GLA+    + F W L+PP     + L + L    ++  +  L SGM L+   PG+  +++++      S       S D +  L P+N   +++   I+P L ++ P      +L+ P ++I LK     +A     YT+        S  +  ++  G  LE+  +      S+ ++++   H+    SS S       E T  Q++A    VK P Y +       +S+ K                LP GGP+   ++ HDELG  FD ++ +   F  + HRS+ +  ++ S  S   S        L + P L   D  +  S              TIQL Y + L++D   +     ++IPTG  L++    +    + + +    P   G W SS+  ++ ID
Sbjct:  841 LSASITLICDIPSKIHLVPHLVLPALPENFPPCPFTNRSFEDSEDFIPFSNNAPLKIEIVFAGLSGYELTGVDSINARTHLLSETEK-IDEIVSVLEPQILTFRPFSDVDVARPANPYLIITPRTLGESAGRLRVQVVASHRWPGE-QSVELEATLPLKMSPKVEIKPLGDFQLLLHHEAV-VDIHLSHGSGFFHFNIFSLDSMSALSNQTCLSIYPHLDHKSGGSRTLRDFSLRPKCKGKVIIRVTDLCFPA-GLAFPGDTKLKPGEIGLAIDERLVSIVGLGSLRLFAPSQLELLSKAPVYVRAFDTDGKVLSARFASLLDLRLISSSDGQSPESYSQIVSPCPDAPPDSDNLGLPHSIVSSTDFWLPPPTDCPHELPGIARFNLCGQSLGPSKL--KALSGNVTSNVEVVNVFAPLSLKPCNLNLLLGAAHKMTTSGGPSSRSIAFQVTPERGGRPNLRTIQVHEEGEESGVVLRAELGQTGSATVSAKATSSTGYTDLDTSDFDAWGLTSPPASLSSEASCLVNVVALAGVRIGCSLPTSDRTSGSRTLVASTNSNSTMGGVPVWAEGVAAIENDLVVTPM------GLADVQPPLHFSWGLSPPMPNSPAHLVHWLSQLNVDPDDINLSSGMVLVGVAPGQVKLQLTVFTEGGASTGQLVSFSSDGRDGLHPVNKLSAEVVFTIVPHLRLLNPPRQNPRLLISPNSQIQLKLPSHILADGGTDYTI---NCPSDSPPSLLQLSPGGFLESGAHGRCDAWSNWRLKDCRCHLRIDYSSMSTSSVGRKERTL-QSLAFDVVVKPPLYLLARAQPGHHSLLKPSTG------------LPFGGPYPIILSFHDELGEAFDAVAEEFLSFRIRAHRSNLLDYSVVSDGS--GSHHPLGRLMLRLTPPL-HADLTTLQSA------------TTIQLTYSNSLMADETTILAPSYLTIPTGPPLDVCGNSELTVGQWACLPI-LPQGDGIWSSSDPSLLWID 1798          
BLAST of Nuclear pore membrane glycoprotein 210 vs. TrEMBL
Match: V3Z185 (Uncharacterized protein OS=Lottia gigantea OX=225164 GN=LOTGIDRAFT_236288 PE=4 SV=1)

HSP 1 Score: 399.823 bits (1026), Expect = 1.543e-141
Identity = 258/740 (34.86%), Postives = 415/740 (56.08%), Query Frame = 1
Query:  109 KLSDSKVLLPRTSYLSINYT--IKGSPN-----ICHEWISETPEVVVITPIYSSDGSKCSEQATITSVWQSNTKATGTVYAKNIATGHSVKCDVIIDQIRKLEIETRTLELYLHETPEALIARAYDEYGNTFSTLDGIPFEWLINHIGSNG----DAQNVLRFITWTESEYVTPSLIGNLEQQGLMGYMQLVSGLKTGAAEVSLTFRDEXXXXXXXXXXXXXXXMANAALSPPLAYLIPYTQLSYKIIVHSQGSTQEVIMPNNQYLLKINNTDLAQLDFKGSTITAKKYGQTEVILIDKNINEDFRHPSSLLYIVEPGFLTFHISPHENQWVLQTMKDNIYTITIRPYDFNSHPIFMSDNIRLETLIPKEYFEVLHSSLNGTYNVVKTIKEGKTSLKSKLNFILLPNKTEFKLENPVEGTQDLIIYPPITVLPKFVVLPWYPNIKSIPGYLFSATGGSGEYKWMAHDDNHKINNLSISVDNKGFIKPMKLGLSNVVAADQRNLNNIGTAIVLVDIIKSLQFIIDIVEVEIHNELDLP------------IFATN-SKANKISHCYWLPFNAISEDPSIIEVVKIAAVEHSKHPDACAFLKVRGLKPGFSKLTITLRNQPNEIIREMLTSSITIGSFIPTKFLDPLSGSTTIGVRSSITMNIAYGPLPWLLDPSNYFYEMVEDSTSKQIVKKLSLTDNRHNLKLRTLQLKVQCISVGEVNISIFISNKKSLKHPKPVKSTG 2256
            KL+  KVLLP  S +  N+T  ++ SP       C++W +  PEV  +T I S+DG +C+  A ++++ +++ + T  V A+N+ TG  ++CD+I+++I KLEIET T  LYL ++P+ L+A+ +D  GN F++LDG+ +EW +      G    DA N+LR   +T+S Y TP+ I  LE++GL G   LV G++TG+A+VS   +D   K LI      ++ +AN  L+P   Y++P++++ Y++ +       E+ MP+NQY L++ + ++  L+   S  TA+K G TEV+L DK I E  R PS+L ++V P ++ F + P + +WVL+T  D  Y I I  YD +SH IF SDN+R+E   P  YF+VL SS+NGTY+ VKT+  G+T +  +L  I+  + + +++   V+G+Q++ IY PI V+P  +  PW P  ++   YL  A+GGSG+Y W + D +    N+      KG I    +G +NV AAD +N  + G++IV V     + F+   VE  + + L LP            IF  +  K    + C+ L  N    D ++   V+      SKH   C  LKV  +  G +++T +   Q N++   +LT++ITI +F P + +DP    T + V SS  +    GP PW+LD S YF ++  +  S   +KK  +T     L + T    V CI +GE  +++ + N K+ K+  P+  T 
Sbjct:   38 KLNTPKVLLPYYSTVISNFTLEVEFSPEEAEVPTCYQWRTTRPEVAQVTLINSTDG-ECALAAKVSAISKASHQMTTVVLAENMVTGEILRCDLIVNKIVKLEIETTTRVLYLEDSPDELLAKGFDSEGNIFTSLDGLAYEWSLVSDTETGHVVVDAHNILRIKRYTDSHYTTPAHIEPLEERGLQGDRILVEGIRTGSAKVSARLKDPVYKQLIPEDIRIMV-IANLMLNPADVYVLPFSEVRYRVELLKHNKVSEITMPSNQYYLEVKDGEICTLEKSTSIATAQKIGSTEVVLKDK-ITEFHRQPSALFHVVNPSYIAFVVLPGK-KWVLET--DREYDILIEVYDTDSHMIFPSDNVRIEAEFPSTYFKVLFSSINGTYHRVKTLVRGRTEIDGELTAIIKKDGSRYEINPEVKGSQEVDIYDPIIVVPARLYFPWDPVTQAKHTYLLKASGGSGDYTWTSTDTDVTTVNI------KGQITTTGMGRANVTAADAKNNAHTGSSIVHVLPPNEMMFLSTPVEATVGSVLQLPLAINAIYNGNISIFTLDRGKKVAFTDCHLLNLNISFSDVTVFTQVE----GFSKHDTGCMCLKVMAVHQGHTEVTASY--QRNKV---LLTTTITIAAFNPLQPVDP-EVETVVTVASSKDVVFKGGPQPWILDSSQYFQDLSAERRSLLDMKKKKMTGMNRGLHVFT----VLCIELGEQELTLKVGNHKTAKNQFPITQTA 751          

HSP 2 Score: 136.732 bits (343), Expect = 1.543e-141
Identity = 179/768 (23.31%), Postives = 324/768 (42.19%), Query Frame = 2
Query: 2306 RLICTVPVRMKLVPRLISSNISTGCPFQNTSENQ-HITVDNKNPSSVEIVFTDKNGVQLERSESFAVKVEIKSLNKKNIKEIVQVIYPTVIYXXXXXXXXXXXKF-LVTPYRFGESTGEIEVIVK-SSSCISGKCPAFNLESH------LQIQISRSMIVNPITILLYQHEKVSTKFYVNYGSGYFTVTTPNNDFLXXXXXXXXXXXXXXVSYEIIQTKVDYSQRNAIIN----------VIDACFSSLETEFENSKTIEIELVKPFKLQIFSLNRVQLGSQINVLLKIYDDNGREFPKDALHLLSMALHFTDRSNIVSANSLYSKDWVLTPNEFSESSGFVFKVNGEKLGFSSIY--VELINTD-ITSNILKIEVFPPLKLLPKYTVLLEGSEIQLSTIGGPQNCHELLHYSIIKNETRNVKEAKIEFIIGPKGLLKAVSFGETSVVIKVEVIDADPTRNNRLTVLSKDEGRVGVVQIKSISIWSPTKNLLVGNSMPLWVTFASSSNDLQHIPITGFSITGLANSAISFKWHLNPPQGVISRLENVLEPAGINIGNKYLHSGMRLITSNPGKQTIEISISNVPKRWLSIDLQHNLPLNSKINIAIIPKLEIIYPISYVQSVLVPPATKITLKTSLDDIALITYTLIPYQVDKISSKAQSKIHSGNILETNPNLSDNKVENFILHVTSSQSIKLNTANEITANQTVALFFTVKHPTYSMMSPYISSNSIFKQFQTTKFINKHSSIFVLPLGGPFEFHITNHDELGNIF 4543
            R ICT PV + L P L        CP   T E Q  + V  K   +++ + TD +G + +   S A++ +   L+   + E+      TV  ++D+D       F  V P+    S      IV   SS     C + +   H      L++ + +  ++ P  I ++ H        V  GSGYF +                    D+V  + +  K D  Q+  ++N          V D C   LE     S T+ +  V    + +  L++V++G ++   +++ D +G         L+++ L     S+I++             N+ S+     + V+G  +G +++   V+L N   I S+   +EVFPPL+L PK   L+ G++ Q+   GGPQ            N   ++K++KI  + G  G+L+A+  G T VV K    D+    +    + S+DE  V V+ +  I I +P   L  G  MP++    +     Q  P T     G A   ++F W  N  + ++  L +V   +G+ + ++   + M+L     G  T+++ ++  PK+   + +++   L  ++ I +  KL +I P+     VL+ P T+  +KT+ D  A +TY L+  Q     S    ++  G  L++ P +    +E             + +  E   NQT+ L   +K  +Y M++              TK       +  +P+G   +F ++ HD++G  F
Sbjct:  754 RYICTRPVELYLQPILNFDPRLPPCPV--TRETQLPMPVHCKKDVNIQAIVTDSSGRKFDNFSSLAIEWK---LSDNQLAELEDTTDLTVDITTDNDGKKLVKAFQTVHPFGVEGSVVVTATIVSYKSSYFKIACSSLSEVVHPTISKSLELLLRQEAVIEPSRISVFNHPSNKVTIEVQKGSGYFHL--------------------DDVETDTMSIKYDAKQKAVLVNPIKDGSKSITVYDLC---LEVTDHPSATVHVSGVG--GVDVIILDKVEVGKELKAKVQVLDIHGNPLLSSFFSLMNLKLE--GGSDIITVRP--------AANQPSDKITAFYTVHGSYVGHTNVRASVKLPNGQVIYSSPKPLEVFPPLRLDPKNITLIVGAKFQVLAHGGPQPQ---------SNVEFSIKDSKISTVSG-GGMLEALEIGSTRVVGKAVGTDS---LSGETVIYSQDEAIVNVIILTGIRIHAPLTRLQTGTKMPVYAVGITE----QETPFT----FGSAVIPLTFTWTYNSREPIV--LHSVYYQSGVKLSDESKFA-MQLTAVEAGHVTLKLQVT--PKKGSRLQIKNMADLKDEVQIQVFEKLAVISPMVCGGQVLMTPNTETIVKTNRDSAAKLTYKLLTDQ-----STDLIQVKDGGQLKSGPGIGQAMLE-------------IISEEEFGVNQTIVLLVKIKPISYLMIN------------AETKLATLGGHVTSIPVGTSLQFKVSYHDDVGEKF 1425          
BLAST of Nuclear pore membrane glycoprotein 210 vs. TrEMBL
Match: A0A0X3PJI2 (Nuclear pore membrane glycoprotein 210 OS=Schistocephalus solidus OX=70667 GN=PO210 PE=4 SV=1)

HSP 1 Score: 416.387 bits (1069), Expect = 6.183e-137
Identity = 277/838 (33.05%), Postives = 427/838 (50.95%), Query Frame = 1
Query:  106 FKLSDSKVLLPRTSYLSINYTIKGSPNICHEWISETPEVVVITPIYSSDGSKCSEQATITSVWQSNTKATGTVYAKNIATGHSVKCDVIIDQIRKLEIETRTLELYLHETPEALIARAYDEYGNTFSTLDGIPFEWLINHIGSNG---DAQNVLRFITWTESEYVTPSLIGNLEQQGLMGYMQLVSGLKTGAAEVSLTFRDEXXXXXXXXXXXXXXXMANAALSPPLAYLIPYTQLSYKI-IVHSQGSTQEVIMPNNQYLLKINNTDLAQLD-FKGSTITAKKYGQTEVILIDKNINEDF---------------------RHPSSLLYIVEPGFLTFHISPH-----------------------ENQWVLQTMKDNIYTITIRPYDFNSHPIFMSDNIRLETLIPKEYFEVLHSSLNGTYNVVKTIKEGKTSLKSKLNFILLPNKTEFKLENPVEGTQDLIIYPPITVLPKFVVLPWYPNIKSI-----PGYLFSATGGSGEYKWMAHDDN------HKINNLSISVDNKGFIKPMKLGLSNVVAADQRNLNNIGTAIVLVDIIKSLQFIIDIVEVEIHNE----------------------------------LDLP---------------IFATNSKANKISHCYWLPFNAISEDPSIIEVVK----IAAVEHSKHPDACAFLKVRGLKPGFSKLTITLRNQPNEIIREMLTSSITIGSFIPTKFLDPLSGSTTIGVRSSITMNIAY--GPLPWLLDPSNYFYEMVEDSTSKQI----VKKLSLTDNRHNLKL------RTLQLKVQCISVGEVNISIFISNKKSLKHPKPV 2244
            FKLSDSK+LLP  SY  +NYT+ GS + C++W S TPEVV + P+  S G  CS + ++T+VWQS  + T T+YA++  TGH +KCDVI+D I  ++I T T ELYLH TPE+L+  AYDEYGNTFS+LDGIPFEW I      G       VLRF+TWTESEY TP  +  LE +GL GYMQLVSGL+TG+A VS++ + E V   +    V LLVMANA L PP+ Y+IP T  ++ + +V S GS +E+ +P+  Y L + +T +A LD   G+TITA  YGQT V L+D+N+ +                       R P+S++ +VEP +  F + P+                        NQW L+T K   Y + I  +D N+H I+ +DN R+     +   E++ S+  G+ +V++ ++ G  +LK+ L  ++  +     L++P+ G+Q++ I+  +++LP  + L W P++          Y    +GGSGEY W   + +      H  ++   +V N G + P   G + VV +D RN      +IV +  + +L F +  VEV +  +                                  L LP               + A ++ +N ++ C+ LP      DP I++V+          +   P  CAF +V GL+ GF++L  +      E +R   +S   +  +   KF   L+G++T+ V    ++ +++  GPLPW LD S+YF + V  STS QI    + KL        +K             ++C + G  ++ + + N+ S  + KP 
Sbjct:   21 FKLSDSKLLLPYYSYTPVNYTLTGSGSSCYKWWSGTPEVVTVVPLGES-GELCSNKVSVTAVWQSKVRVTSTIYAEDSHTGHILKCDVIVDDIHSIKIGTTTQELYLHNTPESLVVNAYDEYGNTFSSLDGIPFEWKIQSDSEQGLDTSGNGVLRFLTWTESEYSTPYRLSALESEGLQGYMQLVSGLRTGSAVVSVSLK-ESVYDNVPPARVHLLVMANAQLHPPVLYMIPNTLATFHVHVVRSDGS-EEIKLPSKHYFLSVTDTHIADLDPPTGATITALVYGQTTVTLLDRNVEDAISSLRLNLTDAMDNDTQLLAHHRRPTSIVNVVEPAYFRFTLEPYLVSNETSFCVSASLHSSAAQNHLPNQWTLETGK--TYKLIINVFDQNNHKIYSADNQRILANFSQPKVEIVSSTSCGSMHVIRPLETGAVTLKANLIEVIHKSGRSIPLDHPISGSQEITIFSSVSLLPNRLNLAWNPSLNGTITDFGGAYALKPSGGSGEYTWTVLEASKNSKGMHAESSAVATVSNNGELLPRNFGTAVVVVSDLRNPATCSYSIVNISPVSNLAFSLGRVEVFLPRQPLSLDSDRLKSALQTRQIETDLADLTFTSIPEAKLRLPLSSSEKNSNAILTIGLTAVDADSNPLTACHNLPIRIHPTDPLIVKVLPGFSYPPPTANLSDPLPCAFFRVIGLREGFTELEASYVGPSEETMRS--SSLFPVAVYRDIKF---LAGASTLAVAVGSSLRVSHIRGPLPWPLDSSHYFID-VRMSTSPQIQTSALPKLLQAPRPVTMKPVPNEDNSVYSFVLRCEASGRFDVHVIVGNEPSRTNVKPA 847          

HSP 2 Score: 105.145 bits (261), Expect = 6.183e-137
Identity = 223/1071 (20.82%), Postives = 404/1071 (37.72%), Query Frame = 2
Query: 2291 LSSFYRLICTVPVRMKLVPRLISSNISTG---CPFQNTSE---NQHITVDNKNPSSVEIVFTDKNGVQLERSESFAVKVEIKSLNK--KNIKEIVQVIY-PTVIYXXXXXXXXXXXKFL-VTPYRFGESTGEIEVIVKSSSCISGK-CPAFNLESHLQIQISRSMIVNPIT-ILLYQHEKVSTKFYVNYGSGYFTVTT------PNNDFLXXXXXXXXXXXXXXVSYEIIQTKVD---YSQRN----------AIINVIDACFSS-LETEFENSKTIE---IELVKPFKLQIFSLNRVQLGSQINVLLKIYDDNGREFPKDALHLLSMALHFTDRSNIVSAN---------SLYSKD---WVL--TPNEFSESSGFVFKVNGEKLGFSSIYVE------LINTDITSNILKIEVFPPLKLLPKYTVLLEGSEIQLSTIGGPQNCHELLHYSIIKNETRNVKEAKIEFIIGPKGLLKAVSFGET-SVVIKVEVIDADPTRNNRLT-------------VLSKDEGRVGVVQIKSISIWSPTKNLLVGN--------------------------------------SMPLWVT--FASSSNDLQHIP--ITGFSITGLANSAISFKWHLNPPQGVIS-RLENVLEPAGINIGNKYLHSGMRLITSNPGKQTIEISI----SNVPKRWLSIDLQHN-------LPLNSKINIAIIPKLEIIYPISYVQSVLVPPATKITLKTSLDDIALITYTLIPYQVDKISS----------------KAQSKIHSGNILETNPNLSDNKVENF-ILHVTSSQSIKLNTANEI-TANQTVALFFTVKHPTYSMMSPYISSNSIFKQFQTTKFINKHSSIFVLPLGGPFEFHITNHDELGNIFDISPDTNM-FSYQLHRSDNIG----------------------ITICSSESIRKSDSLKESTTLNIDPILTFIDSKSFSSQKVLQFQGLSTGENTIQLFYHDLLSDSPQLTDIISIPTGSVLEMKKFPQNLATEGSRVKYEAPFSGGYWYSSEGDIVSIDSSFGDAILKNRGSSNIFYS 5011
            L++   L+C VP  + L+P+L    +  G   CPF N S       + V NK P  VE++F   +G++L  ++S      +    K  K   ++   I+ PT +       +     F  +TP   G S G + V V +     G+  P   L + L ++ S  + + P     L  H K ++  ++  GSG+F ++       PN +  +   +          +  I Q       +++RN          A+  V D CF      E  N    +   + +V    L++++ ++++L ++ +  ++ +D +G         L+ + L   +R    S +         +  S+D   W    TP   S     VF+V G+ +G + + V       LI   I SN + I +F PL+L P    LL G   +++  GGPQ     L +S+  +  + ++           G+L     G T +VV+K +        N  +T             + S+ E  V +V +  I I  P +  + G+                                        P+W     A    D +H P  +T   ++ L    + F W L PP    S  L + L    +      L SGM L+  +PG+  +++++     ++  + +S   + N         L+ ++ I +IP+L + +P      +L+ P  ++ ++     IA  +   + Y +D  SS                 A   + +G     N   +    E F +LHV+ S S       +  +A Q++ +   VK P Y           +  + Q T  + K +    LP GGP+   ++ HDE G  FD   D  M F  + HRS+ +                       + + S      SD L+ +TTLN+ P  T   +   S             +  +  F           +  +++PTG  L +    + +A + + +    P   G W SS+  ++ ID+  G  +    G  ++ +S
Sbjct:  849 LTAPITLLCEVPSSLNLIPQLHLPILPPGLPACPFANRSSWSTEDTVLVTNKAPLRVELMFKGSSGLELFGTDSLVTVAHLSGDTKTEKIFTDVEPHIHVPTSLSVVSDLATHRQRSFFDITPRLPGVSAGTVLVKVVAKHEWPGEESPV--LAASLSVRFSPPVSIYPSNDFQLLFHTKAASDVHLADGSGFFHLSVFSANDQPNTNTPRQLCLAVNSQPLGSDTENIDQLSPSDRLHTKRNFVLSPKCLGRAVFKVTDVCFPDPTSNEKANHAATDQRIVSVVGLGSLRLYAPSQIELNTEADAFVRAFDTDGNLLSSRFASLVPLKLLPFERDGGPSPSPDTILGLPKAWASQDVGFWAASKTPGSASRPGIAVFRVRGQAVGSTRLRVRSDVNTGLIGAGILSNAVDINIFSPLRLEPCNFNLLLGGAYEINAFGGPQP--RSLDFSVSGSGQQPLEVELSSISSTENGVLVRSGLGSTGTVVVKAKAFSTTGYANLNVTDFDFWNLSVPTGALSSESECPVNLVALSGIRIGCPLREYVGGSNAARDASGAAAEEAVTTPTGDSRVLIASRRSADGSYEGGAPIWAEGIVARRGRD-RHQPALVTPMGMSDLL-PPLRFSWRLTPPMPSASAELVHWLSQLNVEPDETNLVSGMVLVGLSPGQVRLQLTVFTEDESLTGQLVSFVGEQNDRRVKPVSRLSKELLINVIPRLSLAFPPRMNPQILMSPHGRLRIRLPAS-IATESSVGVKYSIDCPSSIVMHNTSSSVTKLASVSASGLLEAGAAEACNGWSTWRAAECFCLLHVSYSSSPSSEQHQQSESATQSLKIEVVVKPPRY-----------VLARAQRTAGMLKSAG---LPFGGPYPIALSFHDEQGEAFDAVADEFMGFHVEAHRSNLVDYYMEQRSDAQEGSWPPCLGLLMVRMVSPLHAADSDVLQAATTLNLRPGNTASAAAMSSDSVAAP-------DRHVYFF-----------SSYVTLPTGPQLTVDGVSEFVAGQWTCLP-SMPQGPGLWSSSDPSVLWIDNESGFMLPLRAGRVHLLFS 1879          
BLAST of Nuclear pore membrane glycoprotein 210 vs. Ensembl Cavefish
Match: nup210 (nucleoporin 210 [Source:ZFIN;Acc:ZDB-GENE-050208-132])

HSP 1 Score: 325.479 bits (833), Expect = 2.964e-89
Identity = 228/686 (33.24%), Postives = 367/686 (53.50%), Query Frame = 1
Query:  109 KLSDSKVLLPRTSYLSINYTIKGSPNICHEWISETPEVVVITPIYSSDGSKCSEQATITSVWQSNTKATGTVYAKNIATGHSVKCDVIIDQIRKLEIETRTLELYLHETPEALIARAYDEYGNTFSTLDGIPFEWLI---NHIGSNGDAQNVLRFITWTESEYVTPSLIGNLEQQGLMGYMQLVSGLKTGAAEVSLTFRDEXXXXXXXXXXXXXXXMANAALSPPL-AYLIPYTQLSYKIIVHSQGSTQEVIMPNNQYLLKINNT----------DLAQLDFKGSTITAKKYGQTEVILIDKNINED--FRHPSSLLYIVEPGFLTFHISPHENQWVLQTMKDNIYTITIRPYDFNSHPIFMSDNIRLETLIPKEYFEVLHSSLNGTYNVVKTIKEGKTSLKSKLNFILLPNKTEFKLENPVEGTQDLIIYPPITVLPKFVVLPWYPNIKSIPGYLFSATGGSGEYKWMAHDDNHKINNLSISVDNKGFIKPMK-LGLSNVVAADQRNLNNIGTAIVLVDIIKSLQFIIDIVEVEIHNELDLP--IFATNS----KANKISHCYWLPFNAISEDPSIIEVVKIAAVEHSKHPDACAFLKVRGLKPGFSKLTITLRNQPNEIIREMLTSSITIGSFIPTKFLDPLS-GSTTIGVRSSITMNIAYGPLPWLLDPSNYFYEM-VEDSTS 2091
            KL+  KVLLP      IN+T++ +   C+ W S  PEV  I  +   D ++CS++A + +     ++ T  + A++I TG  ++CD I+D I ++++ + T ELYL ++P  L   A D  GNTFSTL G+ F+W +     + +  D+ N LR + ++ES Y  PS I ++E+ G  G + LVSG+KTG A++    + E + S + +  V+LL++ N  LSP    YL+  T + YK+    QG   EV+MP +QY L + N+           +A+L+   ST+ A ++G T ++L  K++      R P+  +Y+VEPG+L F I P + +W+L+T +  IY I+I  +D +S+ I++SDNIR+ET  PKEYFEVL SS NG+Y+ VK +K+G+T +   L  ++    +   L  PV   QD+ IY PI + P  +  PW P  +    Y   ATGGSG + W +       N    +V  KG +  ++ +G+S + A D RN  + G   V V     ++F    VE  +   L+LP  IF   S    +   +S C         E+  I ++++   +   +  D C+ ++V+ L PG++ + ++  +         L + ITI ++ P +  DP S    T+G  SS  M    GP PW+L+PS +F  +  ED  S
Sbjct:   25 KLNIPKVLLPLARSTKINFTLEATEG-CYRWSSNRPEVASIEAV-DVDENQCSQRAVLQARSTQPSRLTSIILAEDILTGQVLRCDAIVDIISEIQVVSTTRELYLEDSPLELKIHALDSEGNTFSTLAGLVFDWSLVKGTEMATYPDSYNSLRVLKFSESTYTPPSYISDMERVGKQGDIILVSGIKTGHAKLKAKIQ-ETLYSNVGAAEVRLLILENILLSPAYDIYLLAGTSIQYKVQKIRQGKITEVVMPCDQYELHLKNSVVSAGGNPDAAVAELEQSSSTVLALQHGHTNIVLDHKSLGMKGASRLPNGTIYVVEPGYLVFKIHPGD-RWILETSR--IYEISIEVFDKSSNKIYLSDNIRIETAFPKEYFEVLESSQNGSYHRVKALKQGQTVIDGTLKSVVDQRGSVRLLPVPVRNEQDVEIYNPIVLTPSILTFPWQPK-EGAYQYTIKATGGSGNFSWSSS------NTAVATVTVKGVMTTVRDIGVSTIYAHDLRNPLHYGEMKVFVIEPVGMEFSPCAVEARVGLGLELPLRIFGQLSWEAGERVTLSDCSHFDLQVEMENSGIFQLLEGEPLPPGQ--DHCSGVRVQALAPGYTSVLVSYTHG-----NVHLNAKITIAAYPPLRAEDPPSVAVVTLG--SSKDMLFEGGPKPWVLEPSKFFRNLTAEDPNS 688          

HSP 2 Score: 117.087 bits (292), Expect = 1.483e-25
Identity = 156/738 (21.14%), Postives = 307/738 (41.60%), Query Frame = 2
Query: 2951 RNAIINVI--DACFSSLETEFENSKTIEIELVKPFKLQIFSLNRVQLGSQINVLLKIYDDNGREFPKDALHLLSMALHFTDRSNIVSANSLYSKDWVLTPNEFSESSGFVFKVNGEKLGFSSIYVELINTD---ITSNILKIEVFPPLKLLPKYTVLLEGSEIQLSTIGGPQNCHELLHYSIIKNETRNVKEAKIEFIIGPKGLLKAVSFGETSVVIKVEVIDADPTRNNRLTVLSKDEGRVGVVQIKSISIWSPTKNLLVGNSMPLWVTFASSSNDLQHIPITGFSITGLANSAISFKWHLNPPQGVISRLENVLEPAGINIGNKYLHSGMRLITSNPGKQTIEISISNVPKRWLSIDLQHN-LPLNSKINIAIIPKLEIIYPISYVQSVLVPPATKITLKTSLDDIALITYTLI--PYQVDKISSKAQSKIHSGNILETNPNLSDNKVENFILHVTSSQSIKLNTANEITANQTVALFFTVKHPTYSMMSPYISSNSIFKQFQTTKFINKHSSIFVLPLGGPFEFHITNHDELGNIFDISPDTNMFSYQLHRSDNIGITICSSESIRKSDSLKESTTLNIDPILTFI-----DSKSFSSQKVLQFQGLSTGENTIQLFYHDLLSDSPQLTDIISIPTGSVLEMKKFPQNLATEGSRVKYEAPFSGGYWYSSEGDIVSIDSSFGDAILKNRGSSNIFYSLANAYPNIEKVQNKNVLISHELIVHGASKISMKIIEGT 5125
            R  ++ V+  D C +     F    T  + +    ++ +  +++V++G  +   +++ DDN + F   A +   M L     S+IVS   L          E+SE     F V G  +G +S+   +++ +   ITS   +IEVFPP +LLP+   L+ G+ +Q+++ GGPQ    +L +S+   E  +V            GL++ V+ G  +V   V+ +D   T + +L V+S+D+  V V+Q+K+I I +P   +  G  MP+ V   +S+        T FS  G A   ++F W +      I  L      A + +  ++ +  M ++  + G+  +++ +  V     +  L++N + L+ +I I +  KL ++ P    + +L+ P + + L+T+ D    ++Y ++  P +   I    +  + SG++                   T   S+++ +      NQT+ L   V   +Y  +S   + ++  ++           ++  +PLG    F +  HD  G    +    +  ++  +R D +         + K  S    T   ++  LT +     D    +    L  Q      +   L   D++  S Q   IIS            P+ L+              G W SS   ++ I    G A+ ++ G+  ++Y +A             +    E++V+ AS+ ++ +  G 
Sbjct:  922 RPGVLQVMVHDLCLT-----FPAPATATVHVSDILEVYVRVVDKVEIGKSVRAYVRVLDDNKKPFL--AKYFSHMNLKLKAASSIVSLQPLL---------EYSEKDTATFLVKGLVIGQTSVSAVVMDKNGRRITSAPQQIEVFPPFRLLPRKVTLIIGAVMQITSEGGPQPQSNIL-FSLSNAEIASVNST---------GLVRGVAVGNMTVTGVVQAVD---TESGKLVVVSQDQVEVEVIQLKAIRIRAPITRMKSGTMMPVHVMGLTSTQ-------TPFSF-GNALPGLTFHWSVTKRD--ILELHTRHSEASLQLSAEH-NFAMSVVGRSKGRTGLKVVVRAVAPE--ASHLENNAVELSDEIQIQVYEKLHLLNPEVAAEEILMSPNSLLKLQTNRDGQGALSYRVLDCPDKAALIQVDDKGYLSSGSL-------------------TGMASLQITSQETFGVNQTIILAVKVVTVSYMRLSTSPALHTANRE-----------TLSAVPLGTVLTFTVHFHDSTGEA--LHAHNSHLTFSTNRDDLV--------QVGKGQSNGTLTVRTVNVGLTLLGVWDSDQAGLADYIALPVQHAIHPADAQSLIVGDVICFSAQ---IIS------------PEGLS--------------GTWSSSSDAVLQIHPKTGTAVARDTGTVTVYYEIAG-----------QLRTYREVVVNSASRTAVMVPSGA 1537          
BLAST of Nuclear pore membrane glycoprotein 210 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000000425.1 (pep scaffold:Pmarinus_7.0:GL482109:412:16090:-1 gene:ENSPMAG00000000372.1 transcript:ENSPMAT00000000425.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 315.849 bits (808), Expect = 9.178e-92
Identity = 208/702 (29.63%), Postives = 370/702 (52.71%), Query Frame = 1
Query:  205 SETPEVVVITPIYSSD--GSKCSEQATITSVWQSNTKATGTVYAKNIATGHSVKCDVIIDQIRKLEIETRTLELYLHETPEALIARAYDEYGNTFSTLDGIPFEWLI---NHIGSNGDAQNVLRFITWTESEYVTPSLIGNLEQQGLMGYMQLVSGLKTGAAEVSLTFRDEXXXXXXXXXXXXXXXMANAALSPPL-AYLIPYTQLSYKIIVHSQGSTQEVIMPNNQYLLKIN-----NTDLAQLDFKGSTITAKKYGQTEVILIDKNINED--FRHPSSLLYIVEPGFLTFHISPHENQWVLQTMKDNIYTITIRPYDFNSHPIFMSDNIRLETLIPKEYFEVLHSSLNGTYNVVKTIKEGKTSLKSKLNFILLPNKTEFKLENPVEGTQDLIIYPPITVLPKFVVLPWYPNIKSIPGYLFSATGGSGEYKWMAHDDNHKINNLSISVDNKGFIKPM-KLGLSNVVAADQRNLNNIGTAIVLVDIIKSLQFIIDIVEVEIHNELDLPIFATN------SKANKISHCYWLPFNAISEDPSIIEVVKIAAVEHSKHPDACAFLKVRGLKPGFSKLTITLRNQPNEIIREMLTSSITIGSFIPTKFLDPLSGS-TTIGVRSSITMNIAYGPLPWLLDPSNYFYEMVEDSTSKQIVKKLSLTDNRHNLKLRTLQLKVQCISVGEVNISIFISNKKSLKHPKPVK 2247
            S  PEV  +  +YS+D  G +CS +A +++    +T+ T  V A++  +G  ++CDVI+D I+ ++I + T ELYL ++P  L  +A D  GNTF+TL G+ F+W       + S  D  N LRF+ ++E+ Y  P+ I  +E++G  G   LVSGLKTG+A V    R E +   +++  V+L+++ +  L+P    YL+  T + Y+++   QG   ++ MP+ QY L++      N  +A+LD + S + A+  GQT ++L+ KNI      R P+S +Y++E  FL F I P E+ WVL+  ++  Y IT+  +D N + I ++DN+R+ET  PK++F VL S+ NG+ + V+ +  G+T +K+ L  +L PN     L   +   Q++ I+ PI + P  ++ PW P+ +    Y   A GGSG + W + +          +V  +G +     +G S + A D +N  + G+  V +  +  L+F    +E  +   L+LP+ A+        +      C  + F     + ++ +VV+      + +   C  ++VR L  G + ++I+  +         L  SITI +++P K +DP+S +  T+G    +      GP PW+L+PS ++  +  D+  + +V K ++         R    +V C ++GE  +++ + N +S  +P P +
Sbjct:    8 SSRPEVASVEAVYSTDDAGQRCSSRAVVSARAAQHTRLTTIVIAEDTVSGQVLRCDVIVDTIQHIQIVSTTRELYLDDSPLELTIQAGDREGNTFTTLAGLQFDWTTIKDEEVLSTADGHNALRFLRFSEAAYRPPAYILEMERKGRQGDRMLVSGLKTGSARVKTKIR-EPLYKGVEATEVRLVILESILLNPAHDVYLLVNTHIHYRVLKVKQGRLIDIPMPSEQYELQLQGPVTKNGPVARLDVQTSVLVAQNLGQTSLLLVHKNIRMQGVSRLPNSTVYVIEAAFLGFLIEPGEH-WVLEVGRE--YWITVEVFDKNGNRIHLTDNVRIETTFPKKFFNVLESNQNGSQHRVQALHRGQTEVKAILAHVLAPNGKSLALPQTISNQQEVEIFDPIVLQPPLLIYPWQPS-RVHYHYTLKAEGGSGNFSWSSTETE------VATVTVRGLLTTADAVGTSVIRARDVQNPLHFGSMKVRMLEVVLLEFGRSKLEARVGGVLELPVRASGLVDPATRQTMMFFDCSQMHFTTDLANTAVFQVVEGNLPPGNGY---CMAVRVRALSAGHTTISISYTHGTTH-----LHDSITIAAYLPLKVVDPISVALVTLGASKEVVFE--GGPRPWVLEPSKFYARL--DAQDEDLVTKHAVGYGEQQWHQRH-TFRVLCTALGEQALTLTVGNHESASNPLPAE 685          
BLAST of Nuclear pore membrane glycoprotein 210 vs. Ensembl Nematostella
Match: EDO39640 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S9N9])

HSP 1 Score: 165.622 bits (418), Expect = 8.807e-41
Identity = 133/448 (29.69%), Postives = 221/448 (49.33%), Query Frame = 1
Query:  982 EDFRHPSSLLYIVEPGFLTFHISPHENQWVLQTMKDNIYTITIRPYDFNSHPIFMSDNIRLETLIPKEYFEVLHSSLNGTYNVVKTIKEGKTSLKSKLNFI------LLPNKT-----EFKLENPVEGTQDLIIYPPITVLPKFVVLPWYPNIKSIP------GYLFSATGGSGEYKWMAHDDNHKINNLSI-SVDNKGFI-KPMKLGLSNVVAADQRNLNNIGTAIVLVDIIKSLQFIIDIVEVEIHNELDLP-IFATNSKANK-----ISHCYWLPFNAISEDPSIIEVVKIAAVEHSKHPDACAFLKVRGLKPGFSKLTITLRNQPNEIIREMLTSSITIGSFIPTKFLDPLSGSTTIGVRSSITMNIAYGPLPWLLDPSNYFYEMVEDSTSKQIVKKLSLTDNRHNLKLRTLQLKVQCISVGEVNISIFISNKKSLKHPKPVKS 2250
            E    P++ L++V P +L F I    N WVL+  K   Y ++I+ Y  ++H IFM++NI ++       F+VL SS NG+Y+++K    G T + +    I       +P++      +FK+  P+ G Q + I+ P+ V+P+ +V PW+P ++          Y   A GGSG Y W +       +N SI SV+ KG I     +G + V A+D +N+++ GT  V V     + FI   VE E+ + L LP + A  +K +       S C  LP      D SI +V++  A ++   P +C  +++  L+ GF+ L +T   Q   I+   L +SITIGS+ P K LDP S    + V +   + ++ GPLPW+LD S Y+ ++  ++     +      D             V C  +GE  +++ + NK + K+  P  +
Sbjct:    5 EASHQPTATLHVVGPAYLGFSIVSDSN-WVLEVGK--TYAVSIQLYTKDNHKIFMAENIEIKATFSSN-FDVLWSSTNGSYHIIKAKSSGSTVINAAYTSIKIGGGCSMPSQVADEVVQFKV--PISGQQVVEIFDPVVVIPEELVFPWHPQMEQRVLAVHQYHYQLKAAGGSGSYIWTS-------SNASIASVNTKGIIMTTTSIGHTQVKASDTKNMDHFGTMEVYVLPPSKMNFIPSAVEAEVGSRLSLPLVVAALAKRDSQDFHTFSDCKALPLTFSLSDSSIFQVIEDEA-DYEVAPGSCMSVRLLALRVGFTTLIVTY--QYKSIV---LKASITIGSYNPLKALDP-SDVAVVTVGAVKNIMLSGGPLPWILDTSGYYEKVRAENPDIVEIGDGHTRDYFVETSGSYHFFTVLCQELGEQVLTVEVGNKPTAKNLYPATA 432          

HSP 2 Score: 97.8265 bits (242), Expect = 4.471e-20
Identity = 168/705 (23.83%), Postives = 281/705 (39.86%), Query Frame = 2
Query: 2969 VIDACFSSLETEFENSKTIEIELVKPFKLQIFSLNRVQLGSQINV---LLKIYDDNGREFPKDALHLLSMALHFTDRSNIVSANSLYSKDWVLTPNEFSESSGFVFKVNGEKLGFSSI---YVELINTDITSNILKIEVFPPLKLLPKYTVLLEGSEIQLSTIGGPQNCHELLHYSIIKNETRNVKEAKIEFIIGPKGLLKAVSFGETSVVIKVEVIDADPTRNNRLTVLSKDEGRVGVVQIKSISIWSPTKNLLVGNSMPLWVTFASSSNDLQHIPITGFSITGLANSAISFKWHLNPPQGVISRLENVLEPAGINIGN-KYLHSGMRLITSNPGKQTIEISISNVPKRWLSIDLQHNLPLNSKINIAIIPKLEIIYPISYVQSVLVPPATKITLKTSLDDIALITYTLIPYQVDKISSKAQSKIHSGNILETNPNLSDNKVENFILHVTSSQSIKLNTAN-EITANQTVALFFTVKHPTYSMMSPYISSNSIFKQFQTTKFINKHSSIFVLPLGGPFEFHITNHDELGNIFDISPDTNM-FSYQLHRSDNIGITICSSESIRKSDSLKESTTLNIDPILTFIDSKSFSSQKVLQFQGLSTGENTIQLFYHDLLSDSPQLTDIISI-------PTGSVLEM---KKFPQNLATEGSRVKYEAPFSGGYWYSSEGDIVSIDSSFGDAILKNRGSSNIFYSLANAY 5026
            V D C  S      +  ++ I++   +K+++  +N+++LGS   +   LL ++D          + LL  +  F   +  V+ N L  +      ++        F ++G  LG +S+      +     TS    ++VFPPL+L P+   LL G+  Q+   GGP        ++I       V            GL+KA + G T++   V   DA+          SKD   V VVQ+  + I S T NL+ G  + L   FA+   D         ++ GL      F W  N P   +  L++    +GI+I N +  H  + L  +NPG+ T+ + +    K  L+  ++    LN  +   +  +LE+++P +    +L+P      +KT  D  A ITY LI     ++   A   I           L+ +K         S  ++ L T + E   NQT  +   VK          +SS SI  Q        K  S    PLG    F +  HD +G  F     T +   ++L+R D +                          IL   ++ +F +      + ++TGE    ++     S SP +TD I I       P  + L +   ++F   +  EG           G W SS+ DIV+ID+  G A+  + GS+ + Y + N +
Sbjct:  624 VYDLCLDS-----PHPASVSIQMSDIYKVEVKVVNKIELGSTAPLKIQLLDMFD----------VPLLLGSFGFIQLTPQVNPNILNLRQDNSQNDDSPNKEVSYFIMHGIVLGTASLTFTATSITGRTATSEAKDVQVFPPLRLDPRVVTLLPGATFQVRATGGP-TPQSTTSFNIGNQTVATVSSV---------GLVKAENLGVTNLTGMVLASDAE---QGHTITYSKDVVMVHVVQLGGVRISSATTNLVTGTQVSL---FATGWMDESPFAFAN-AVPGLV-----FNWKSNNPD--VCHLKSTYHLSGISIENERDFH--VELHCTNPGQTTVHLRLEV--KDPLAGQVKTTAVLNDDVTFQVFQRLELVFPAN--GYLLLPHNVNTWIKTVRDGSARITYELITGCPQRLHPTAAPSI-----------LALDKSGRISTSTVSGTAVVLVTVHEEFGINQTAVVHVEVK---------AVSSLSITSQSAVRATSEKLHS---FPLGMNALFVVVLHDNIGRKFH---STGIPLKHRLNRFDAVH-------------------------ILPGPENGTFYA------RAMNTGEAIFTVWD----SSSPSVTDYIRIRVDHGLTPITATLLLGMAQQFQATVWAEGQV---------GKWSSSQPDIVTIDAKSGVALALSSGSTTLLYCIPNVF 1213          
BLAST of Nuclear pore membrane glycoprotein 210 vs. Ensembl Nematostella
Match: EDO39641 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S9P0])

HSP 1 Score: 129.798 bits (325), Expect = 2.160e-32
Identity = 93/304 (30.59%), Postives = 159/304 (52.30%), Query Frame = 1
Query:  124 KVLLPRTSYLS--INYTIKGSPNICHEWISETPEVVVITPIY--------SSDGSKCSEQATITSVWQSNTKATGTVYAKNIATGHSVKCDVIIDQIRKLEIETRTLELYLHETPEALIARAYDEYGNTFSTLDGIPFEW-LINHIG-SNGDAQNVLRFITWTESEYVTPSLIGNLEQQGLMGYMQLVSGLKTGAAEVSLTFRDEXXXXXXXXXXXXXXXMANAALSPPL-AYLIPYTQLSYKIIVHSQGSTQEVIMPNNQYLLKINNTDLAQLDFKGSTITAKKYGQTEVILIDKNINEDFRH 996
            ++LLP  +  S  +N+T+K     C+ W S  P+VV + P+Y           G +CS  A +T   + + K    V A+   TG  ++CDV + +I +++I + + EL+L E P  L  +A+D   N FSTL  + F W LI   G S+  A +++R +++ +S Y T   I  LE + L G   ++  + TG A+V    R E +   +K  +VKL+V+    L P    Y++  T + Y ++   QG    + MP+ Q+  K+ + +   LD + S++T  K G T+++L+DK+I    +H
Sbjct:   33 QLLLPYAASGSDPVNFTLKAVDG-CYSWSSNRPDVVTVEPLYLDFDDENAKPYGKQCSRSAIVTVQRRQSEKQMAEVIAEEEVTGLLLECDVFVAKIERIDITSTSRELFLGEAPTVLEVQAFDAEDNMFSTLGALAFTWDLITVDGPSSVSANSIIRIMSFEDSTYETTPEIYGLEARSLRGSEVIIEPINTGTAKVRAKLR-ESIFEDVKPSTVKLVVLDKVLLRPAYDMYIMINTCVKYTVVRLRQGQATVLQMPSPQFQFKLMDNEAGYLDVQKSSVTGIKEGVTKIVLVDKSILLQKKH 334          
BLAST of Nuclear pore membrane glycoprotein 210 vs. Ensembl Nematostella
Match: EDO28443 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7T6G2])

HSP 1 Score: 72.7886 bits (177), Expect = 5.318e-13
Identity = 51/173 (29.48%), Postives = 90/173 (52.02%), Query Frame = 1
Query: 1189 FEVLHSSLNGTYNVVKTIKEGKTSLKSKLNFIL------LPNKT-----EFKLENPVEGTQDLIIYPPITVLPKFVVLPWYPNIKSIP------GYLFSATGGSGEYKWMAHDDNHKINNLSI-SVDNKGFI-KPMKLGLSNVVAADQRNLNNIGTAIVLVDIIKSLQFIIDI 1650
            F+VL SS NG+Y+++K    G T + +    I       +P++      +FK+  P+ G Q + I+ P+ V+P+ +V PW+P ++          Y   A GGSG Y W +       +N SI SV+ KG I     +G + V A+D +N+++ GT  + V   + L+ ++++
Sbjct:  176 FDVLWSSTNGSYHIIKAKSSGSTVIDAAYTSIKIGGGCSMPSQVTEKVVQFKV--PISGQQVVEIFDPVVVIPEELVFPWHPQMEQRVLAVHQYHYQLKAAGGSGSYIWTS-------SNASIASVNTKGIIMTTTSIGHTQVKASDTKNMDHFGTMEIHVKNDQDLRLLLNV 339          

HSP 2 Score: 69.3218 bits (168), Expect = 6.790e-12
Identity = 40/120 (33.33%), Postives = 67/120 (55.83%), Query Frame = 1
Query:  346 GHSVKCDVIIDQIRKLEIETRTLELYLHETPEALIARAYDEYGNTFSTLDGIPFEW-LINHIG-SNGDAQNVLRFITWTESEYVTPSLIGNLEQQGLMGYMQLVSGLKTGAAEVSLTFRD 699
            G  ++CDV + +I +++I + + EL+L E P  L  +A+D   N FSTL  + F W LI   G S+  A +++R +++ +S Y T   I  LE + L G   ++  + TG A+V    R+
Sbjct:    2 GLLLECDVFVAKIERIDITSTSRELFLGEAPTVLEVQAFDAEDNMFSTLGALAFTWDLITVDGPSSVSANSIIRIMSFEDSTYETTPEIYGLEARSLRGSEVIIEPINTGTAKVRAKLRE 121          
BLAST of Nuclear pore membrane glycoprotein 210 vs. Ensembl Medaka
Match: nup210 (nucleoporin 210 [Source:NCBI gene;Acc:101172656])

HSP 1 Score: 335.88 bits (860), Expect = 1.584e-92
Identity = 250/771 (32.43%), Postives = 394/771 (51.10%), Query Frame = 1
Query:  109 KLSDSKVLLPRTSYLSINYTIKGSPNICHEWISETPEVVVITPIYSSDGSKCSEQATITSVWQSNTKATGTVYAKNIATGHSVKCDVIIDQIRKLEIETRTLELYLHETPEALIARAYDEYGNTFSTLDGIPFEW-LINHIGSNG--DAQNVLRFITWTESEYVTPSLIGNLEQQGLMGYMQLVSGLKTGAAEVSLTFRDEXXXXXXXXXXXXXXXMANAALSPPL-AYLIPYTQLSYKIIVHSQGSTQEVIMPNNQYLLKINNT----------DLAQLDFKGSTITAKKYGQTEVILIDKNINED--FRHPSSLLYIVEPGFLTFHISPHENQWVLQTMKDNIYTITIRPYDFNSHPIFMSDNIRLETLIPKEYFEVLHSSLNGTYNVVKTIKEGKTSLKSKLNFILLPNKTEFKLENPVEGTQDLIIYPPITVLPKFVVLPWYPNIKSIPGYLFSATGGSGEYKWMAHDDNHKINNLSISVDNKGFIKPMK-LGLSNVVAADQRNLNNIGTAIVLVDIIKSLQFIIDIVEVEIHNELDLP--IFAT----NSKANKISHCYWLPFNAISEDPSIIEVVKIAAVEHSKHPDACAFLKVRGLKPGFSKLTITLRNQPNEIIREMLTSSITIGSFIPTKFLDPLS-GSTTIGVRSSITMNIAYGPLPWLLDPSNYFYEM-VEDSTSKQIVKKLSLTDNRHNLKLRTLQLKVQCISVGEVNISIFISNKKSLKHPKPVKSTGLAK--------LNLMIILKFKQLL*IDLHC 2322
            KLS  KVLLP      IN+T++ + + C+ W S  PEV  I          CS +A + ++    ++ T  + A+++ TG  ++CD I+D I +++I + T EL+L ++P  L   A D  GNTFSTL G+ F+W  +  I  NG  D+ N LR + ++ES Y  P+ I  +E+ G  G + LVSGLKTG A++    + E +   + +  V+LL++ N  LSP    YL+  T + Y+++   QG+  E+ MP +QY L + N+           +A LD   ST+T  + G   V+L  K++      R P+S LY+VEPG+L F I P ++ WVL+T +   Y I I  +D + + I++SDNIR+ T+  +EYFEVLHSS NG+Y+ VK +K+G T + + L  +         L NPV   QD+ IY PI + P  +  PW P + +   Y   ATGGSG + W +   N  +  +++    KG +      G+S V A D RN  + G   V V    ++ F    VE  +   LDLP  IF       ++   +S C         E   + E++         H   C+ ++ + L PG++ LT++  +         L++ ITI +++P   +DP+S    T+G  SS  M    GP PW+L+PS +F  +  ED TS  +   +S + +  N  L    ++  C+++GE  + + + NK S+ +P P     + K        L L+ I    QL   DL C
Sbjct:   24 KLSIPKVLLPLARGTLINFTLE-TTDGCYRWSSTRPEVASIQAADEDLSRGCSRRAVVQALSTQPSRLTSIILAEDVVTGQVLRCDAIVDVISEIQIVSTTRELHLEDSPLELKIHALDSEGNTFSTLAGLVFDWSFVKDIDVNGFPDSYNSLRVLKFSESTYTPPAYISEMERVGKQGDIILVSGLKTGHAKLKAKIQ-ESLYKDVGAAEVRLLILENILLSPAHDIYLLAGTSIHYRVLKIRQGTITELSMPCDQYELHLQNSVAVPAGSQDAPVASLDQSTSTVTGLQLGHINVVLDHKSLRMQGVSRLPNSTLYVVEPGYLGFKIHPGDS-WVLETGRK--YDIFIEVFDKSGNKIYLSDNIRIRTVFAEEYFEVLHSSKNGSYHYVKALKDGLTLIDATLRAVEDDRGRVHDLTNPVHNEQDVEIYNPIVLRPSILTFPWQPKVGAYQ-YTIMATGGSGNFSWTS--SNTAVATMTV----KGVMTTASDKGVSVVYAHDLRNPLHFGQMKVYVVEPVAMDFAPCAVEARLGQVLDLPLRIFGLLEEFENERVMLSDCSHFELLVAEETRDVFELLDGRLAPGQDH---CSGVRAKALSPGYTVLTVSYTHG-----NIHLSAKITIAAYLPLIAVDPVSVAVVTLG--SSKDMLFEDGPQPWVLEPSKFFCNLRAEDETSLSLT-LISPSSHSFNHHL----VRATCMALGEQVLEVTVGNKASVTNPYPAVEHAVVKFVCAPPSRLTLLPIYSSPQL---DLTC 764          

HSP 2 Score: 99.7525 bits (247), Expect = 3.245e-20
Identity = 112/502 (22.31%), Postives = 230/502 (45.82%), Query Frame = 2
Query: 2702 PAFNLESHLQIQISRSMIVNPITILLYQHEKVSTKFYVNYGSGYFTVTTPNNDFLXXXXXXXXXXXXXXVSYEIIQTKVDYSQRN-AIINVI--DACFSSLETEFENSKTIEIELVKPFKLQIFSLNRVQLGSQINVLLKIYDDNGREFPKDALHLLSMALHFTDRSNIVSANSLYSKDWVLTPNEFSESSGFVFKVNGEKLGFSSIYVELINTD---ITSNILKIEVFPPLKLLPKYTVLLEGSEIQLSTIGGPQNCHELLHYSIIKNETRNVKEAKIEFIIGPKGLLKAVSFGETSVVIKVEVIDADPTRNNRLTVLSKDEGRVGVVQIKSISIWSPTKNLLVGNSMPLWVTFASSSNDLQHIPIT-GFSITGLANSAISFKWHLNPPQGVISRLENVLEPAGINIGNKYLHSGMRLITSNPGKQTIEI--SISNVPKRWLSIDLQHNLPLNSKINIAIIPKLEIIYPISYVQSVLVPPATKITLKTSLDDIALITYTLI 4180
            P   + + L++ +   + V+P  + +Y H  V     +  GSG+F + T                    V ++  Q     S  +   +NV+  D C +     F       + +    ++ +  +++V++G+ +   +++ DD  + F       +++ L+    S IVS   L          E +E+   VF V G  +G +S+   +++ +   I S   +IEVFPP KL+P+   LL G+ +Q+++ GGPQ    +L +SI   +   V            G ++ V+ G  +V   V+V+DA+     +L ++S+D+  V VV +  I I +P   +  G  MP++V   +++      P++ G  + GL     +F W     + V+      +E A I++ +++ + GM ++    G+  +++   +++   + L  +L   L L  +I I +  KL+++ P    + +L+ P + I L+T+ D +  ++Y ++
Sbjct:  874 PLMPVSAMLELLLVEDVKVSPDLVTIYNHPNVHANLALQEGSGHFYLNTSARGI-------------ANVKFQKAQGATQVSPVHPGTVNVMVHDLCLA-----FPVPAKATVHVSDILEVYVRVVDKVEIGTSVRAYVRVLDDKKKPFSASYFQFMNLKLNAA--SEIVSLKPL---------PESTENDTAVFWVRGVSIGQTSLSAVVMDKNGRKIASAPQQIEVFPPFKLIPRKITLLIGAMMQITSEGGPQPQSNIL-FSISNEDMATVNAL---------GHVRGVTVGNVTVTGMVQVVDAE---TGKLVIISQDQVDVEVVVLTGIRIRAPITRMKTGTQMPVYVMGMTNNQS----PLSFGSVLPGL-----TFHWSTT-KRDVLDIQSRQIE-ANIDLQSEH-NFGMTVVGRTRGRTGLKVVLRVTDPTAKQLERNL---LELRDEIQIQVYDKLQMLNPQVEAEEILMAPNSAIKLQTNRDGMGALSYQML 1318          
BLAST of Nuclear pore membrane glycoprotein 210 vs. Ensembl Medaka
Match: nup210 (nucleoporin 210 [Source:NCBI gene;Acc:101172656])

HSP 1 Score: 335.495 bits (859), Expect = 2.428e-92
Identity = 250/771 (32.43%), Postives = 393/771 (50.97%), Query Frame = 1
Query:  109 KLSDSKVLLPRTSYLSINYTIKGSPNICHEWISETPEVVVITPIYSSDGSKCSEQATITSVWQSNTKATGTVYAKNIATGHSVKCDVIIDQIRKLEIETRTLELYLHETPEALIARAYDEYGNTFSTLDGIPFEW-LINHIGSNG--DAQNVLRFITWTESEYVTPSLIGNLEQQGLMGYMQLVSGLKTGAAEVSLTFRDEXXXXXXXXXXXXXXXMANAALSPPL-AYLIPYTQLSYKIIVHSQGSTQEVIMPNNQYLLKINNT----------DLAQLDFKGSTITAKKYGQTEVILIDKNINED--FRHPSSLLYIVEPGFLTFHISPHENQWVLQTMKDNIYTITIRPYDFNSHPIFMSDNIRLETLIPKEYFEVLHSSLNGTYNVVKTIKEGKTSLKSKLNFILLPNKTEFKLENPVEGTQDLIIYPPITVLPKFVVLPWYPNIKSIPGYLFSATGGSGEYKWMAHDDNHKINNLSISVDNKGFIKPMK-LGLSNVVAADQRNLNNIGTAIVLVDIIKSLQFIIDIVEVEIHNELDLP--IFAT----NSKANKISHCYWLPFNAISEDPSIIEVVKIAAVEHSKHPDACAFLKVRGLKPGFSKLTITLRNQPNEIIREMLTSSITIGSFIPTKFLDPLS-GSTTIGVRSSITMNIAYGPLPWLLDPSNYFYEM-VEDSTSKQIVKKLSLTDNRHNLKLRTLQLKVQCISVGEVNISIFISNKKSLKHPKPVKSTGLAK--------LNLMIILKFKQLL*IDLHC 2322
            KLS  KVLLP      IN+T++ +   C+ W S  PEV  I          CS +A + ++    ++ T  + A+++ TG  ++CD I+D I +++I + T EL+L ++P  L   A D  GNTFSTL G+ F+W  +  I  NG  D+ N LR + ++ES Y  P+ I  +E+ G  G + LVSGLKTG A++    + E +   + +  V+LL++ N  LSP    YL+  T + Y+++   QG+  E+ MP +QY L + N+           +A LD   ST+T  + G   V+L  K++      R P+S LY+VEPG+L F I P ++ WVL+T +   Y I I  +D + + I++SDNIR+ T+  +EYFEVLHSS NG+Y+ VK +K+G T + + L  +         L NPV   QD+ IY PI + P  +  PW P + +   Y   ATGGSG + W +   N  +  +++    KG +      G+S V A D RN  + G   V V    ++ F    VE  +   LDLP  IF       ++   +S C         E   + E++         H   C+ ++ + L PG++ LT++  +         L++ ITI +++P   +DP+S    T+G  SS  M    GP PW+L+PS +F  +  ED TS  +   +S + +  N  L    ++  C+++GE  + + + NK S+ +P P     + K        L L+ I    QL   DL C
Sbjct:   24 KLSIPKVLLPLARGTLINFTLETTDG-CYRWSSTRPEVASIQAADEDLSRGCSRRAVVQALSTQPSRLTSIILAEDVVTGQVLRCDAIVDVISEIQIVSTTRELHLEDSPLELKIHALDSEGNTFSTLAGLVFDWSFVKDIDVNGFPDSYNSLRVLKFSESTYTPPAYISEMERVGKQGDIILVSGLKTGHAKLKAKIQ-ESLYKDVGAAEVRLLILENILLSPAHDIYLLAGTSIHYRVLKIRQGTITELSMPCDQYELHLQNSVAVPAGSQDAPVASLDQSTSTVTGLQLGHINVVLDHKSLRMQGVSRLPNSTLYVVEPGYLGFKIHPGDS-WVLETGRK--YDIFIEVFDKSGNKIYLSDNIRIRTVFAEEYFEVLHSSKNGSYHYVKALKDGLTLIDATLRAVEDDRGRVHDLTNPVHNEQDVEIYNPIVLRPSILTFPWQPKVGAYQ-YTIMATGGSGNFSWTS--SNTAVATMTV----KGVMTTASDKGVSVVYAHDLRNPLHFGQMKVYVVEPVAMDFAPCAVEARLGQVLDLPLRIFGLLEEFENERVMLSDCSHFELLVAEETRDVFELLDGRLAPGQDH---CSGVRAKALSPGYTVLTVSYTHG-----NIHLSAKITIAAYLPLIAVDPVSVAVVTLG--SSKDMLFEDGPQPWVLEPSKFFCNLRAEDETSLSLT-LISPSSHSFNHHL----VRATCMALGEQVLEVTVGNKASVTNPYPAVEHAVVKFVCAPPSRLTLLPIYSSPQL---DLTC 764          

HSP 2 Score: 100.138 bits (248), Expect = 2.391e-20
Identity = 112/502 (22.31%), Postives = 230/502 (45.82%), Query Frame = 2
Query: 2702 PAFNLESHLQIQISRSMIVNPITILLYQHEKVSTKFYVNYGSGYFTVTTPNNDFLXXXXXXXXXXXXXXVSYEIIQTKVDYSQRN-AIINVI--DACFSSLETEFENSKTIEIELVKPFKLQIFSLNRVQLGSQINVLLKIYDDNGREFPKDALHLLSMALHFTDRSNIVSANSLYSKDWVLTPNEFSESSGFVFKVNGEKLGFSSIYVELINTD---ITSNILKIEVFPPLKLLPKYTVLLEGSEIQLSTIGGPQNCHELLHYSIIKNETRNVKEAKIEFIIGPKGLLKAVSFGETSVVIKVEVIDADPTRNNRLTVLSKDEGRVGVVQIKSISIWSPTKNLLVGNSMPLWVTFASSSNDLQHIPIT-GFSITGLANSAISFKWHLNPPQGVISRLENVLEPAGINIGNKYLHSGMRLITSNPGKQTIEI--SISNVPKRWLSIDLQHNLPLNSKINIAIIPKLEIIYPISYVQSVLVPPATKITLKTSLDDIALITYTLI 4180
            P   + + L++ +   + V+P  + +Y H  V     +  GSG+F + T                    V ++  Q     S  +   +NV+  D C +     F       + +    ++ +  +++V++G+ +   +++ DD  + F       +++ L+    S IVS   L          E +E+   VF V G  +G +S+   +++ +   I S   +IEVFPP KL+P+   LL G+ +Q+++ GGPQ    +L +SI   +   V            G ++ V+ G  +V   V+V+DA+     +L ++S+D+  V VV +  I I +P   +  G  MP++V   +++      P++ G  + GL     +F W     + V+      +E A I++ +++ + GM ++    G+  +++   +++   + L  +L   L L  +I I +  KL+++ P    + +L+ P + I L+T+ D +  ++Y ++
Sbjct:  876 PLMPVSAMLELLLVEDVKVSPDLVTIYNHPNVHANLALQEGSGHFYLNTSARGI-------------ANVKFQKAQGATQVSPVHPGTVNVMVHDLCLA-----FPVPAKATVHVSDILEVYVRVVDKVEIGTSVRAYVRVLDDKKKPFSASYFQFMNLKLNAA--SEIVSLKPL---------PESTENDTAVFWVRGVSIGQTSLSAVVMDKNGRKIASAPQQIEVFPPFKLIPRKITLLIGAMMQITSEGGPQPQSNIL-FSISNEDMATVNAL---------GHVRGVTVGNVTVTGMVQVVDAE---TGKLVIISQDQVDVEVVVLTGIRIRAPITRMKTGTQMPVYVMGMTNNQS----PLSFGSVLPGL-----TFHWSTT-KRDVLDIQSRQIE-ANIDLQSEH-NFGMTVVGRTRGRTGLKVVLRVTDPTAKQLERNL---LELRDEIQIQVYDKLQMLNPQVEAEEILMAPNSAIKLQTNRDGMGALSYQML 1320          
BLAST of Nuclear pore membrane glycoprotein 210 vs. Planmine SMEST
Match: SMESG000046650.1 (SMESG000046650.1)

HSP 1 Score: 2651.31 bits (6871), Expect = 0.000e+0
Identity = 1336/1345 (99.33%), Postives = 1340/1345 (99.63%), Query Frame = 2
Query: 2294 SSFYRLICTVPVRMKLVPRLISSNISTGCPFQNTSENQHITVDNKNPSSVEIVFTDKNGVQLERSESFAVKVEIKSLNKKNIKEIVQVIYPTVIYXXXXXXXXXXXKFLVTPYRFGESTGEIEVIVKSSSCISGKCPAFNLESHLQIQISRSMIVNPITILLYQHEKVSTKFYVNYGSGYFTVTTPNNDFLXXXXXXXXXXXXXXVSYEIIQTKVDYSQRNAIINVIDACFSSLETEFENSKTIEIELVKPFKLQIFSLNRVQLGSQINVLLKIYDDNGREFPKDALHLLSMALHFTDRSNIVSANSLYSKDWVLTPNEFSESSGFVFKVNGEKLGFSSIYVELINTDITSNILKIEVFPPLKLLPKYTVLLEGSEIQLSTIGGPQNCHELLHYSIIKNETRNVKEAKIEFIIGPKGLLKAVSFGETSVVIKVEVIDADPTRNNRLTVLSKDEGRVGVVQIKSISIWSPTKNLLVGNSMPLWVTFASSSNDLQHIPITGFSITGLANSAISFKWHLNPPQGVISRLENVLEPAGINIGNKYLHSGMRLITSNPGKQTIEISISNVPKRWLSIDLQHNLPLNSKINIAIIPKLEIIYPISYVQSVLVPPATKITLKTSLDDIALITYTLIPYQVDKISSKAQSKIHSGNILETNPNLSDNKVENFILHVTSSQSIKLNTANEITANQTVALFFTVKHPTYSMMSPYISSNSIFKQFQTTKFINKHSSIFVLPLGGPFEFHITNHDELGNIFDISPDTNMFSYQLHRSDNIGITICSSESIRKSDSLKESTTLNIDPILTFIDSKSFSSQKVLQFQGLSTGENTIQLFYHDLLSDSPQLTDIISIPTGSVLEMKKFPQNLATEGSRVKYEAPFSGGYWYSSEGDIVSIDSSFGDAILKNRGSSNIFYSLANAYPNIEKVQNKNVLISHELIVHGASKISMKIIEGTSLPLDDSCLKSECIPISLNYQSNFLVASIYVSSSDLLNYEKENYHKFEKEYTPNYSERLQNDIPLECDIDVNSYEESLMSFQEIFKSLFRVSILPVTTEFDNELGIKQWACLILPNFVNAVTHDQMMQLIRAQFKLNLHIQTRLRHSGVKSPRISVPVVLGYVLLMNDTSRNNLVIKESGEVITAIQVAIPLSTKLLLNENKNIKFSVLSTRPNLLEVLAPREGTSDSGIETLIYPLKAVVVDKMINEKVEVIIEFPITKQRDVIYLQIDIHTRSTAANPLSPGDSIDDLELSSVNWFAPIVVVFLTATFAISIVMFVNHFIQPKLNDDRSMPSPIKDPNSSFSDHNYPYSPLYTSPRYTQHIWNSMGPRRDYSPPYQSRHTRYPFYSNNQELHDSYKSNL 6328
            +   +LICTVPVRMKLVPRLISSNISTGCPFQNTSENQHITVDNKNPSSVEIVFTDKNGVQLERSESFAVKVEIKSLNKKNIKEIVQVIYPTVIYSSDSDESFSNSKFLVTPYRFGESTGEIEVIVKSSSCISGKCPAFNLESHLQIQISRSMIVNPITILLYQHEKVSTKFYVNYGSGYFTVTTPNNDFLQIKKIDKQIIDEDEVSYEIIQTKVDYSQRNAIINVIDACFSSLETEFENSK IEIELVKPFKLQIFSLNRVQLGSQINVLLKIYDDNGREFPKDALHLLSMALHFTDRSNIVSANSLYSKDWVLTPNEFSESSGFVFKVNGEKLGFSSIYVELINTDITSNILKIEVFPPLKLLPKYTVLLEGSEIQLSTIGGPQNCHELLHYSIIKNETRNVKEAKIEFIIGPKGLLKAVSFGETS+VIKVEVIDADPTRNNRLTVLSKDEGRVGVVQIKSISIWSPTKNLLVGNSMPLWVTFASSSNDLQHIPITGFSITG ANSAISFKWHLNPPQGVISRLENVLEPAGINIGNKYLHSGMRLITSNPGKQTIEISISNVPKRWLSIDLQHNLPLNSKINIAIIPKLEIIYPISYVQSVLVPPATKITLKTSLDDIALITYTLIPYQVDKISSKAQSKIHSGNILETNPNLSDNKVENFILHVTSSQSIKLNTANEITANQTVALFFTVKHPTYSMMSPYISSNSIFKQFQTTKFINKHSSIFVLPLGGPFEFHITNHDELGNIFDISPDTNMFSYQLHRSDNIGITICSSESIRKSDSLKESTTLNIDPILTFIDSKSFSSQKVLQFQGLSTGENTIQLFYHDLLSDSPQLTDIISIPTGSVLEMKKFPQNLATEGSRVKYEAPFSGGYWYSSEGDIVSIDSSFGDAILKNRGSSNIFYSLANAYPNIEKVQNKNVLISHELIVHGASKISMKIIEGTSLPLDDSCLKSECIPISLNYQSNFLVASIYVSSSDLLNYEKENYHKFEKEYTPNYSERLQNDIPLECDIDVNSYEESLMSFQEIFKSLFRVSILPVTTEFDNELGIKQWACLILPNFVNAVTHDQMMQLIRAQFKLNLHIQTRLRHSGVKSPRISVPVVLGYVLLMNDTSRNNLVIKESGEVITAIQVAIPLSTKLLLNENKNIKFSVLSTRPNLLEVLAPREGTSDSGIETLIYPLKAVVVDKMINEKVEVIIEFPITKQRDVIYLQIDIHTRSTAANPLSPGDSIDDLELSSVNWFAPIVVVFLTATFAISIVMFVNHFIQPKLNDDRSMPSPIKDPNSSFSDHNYPYSPLYTSPRYTQHIWNSMGPRRD+SPPYQSRHTRYPFYSNNQELHDSYKSNL
Sbjct:  733 TGLAKLICTVPVRMKLVPRLISSNISTGCPFQNTSENQHITVDNKNPSSVEIVFTDKNGVQLERSESFAVKVEIKSLNKKNIKEIVQVIYPTVIYSSDSDESFSNSKFLVTPYRFGESTGEIEVIVKSSSCISGKCPAFNLESHLQIQISRSMIVNPITILLYQHEKVSTKFYVNYGSGYFTVTTPNNDFLQIKKIDKQIIDEDEVSYEIIQTKVDYSQRNAIINVIDACFSSLETEFENSKIIEIELVKPFKLQIFSLNRVQLGSQINVLLKIYDDNGREFPKDALHLLSMALHFTDRSNIVSANSLYSKDWVLTPNEFSESSGFVFKVNGEKLGFSSIYVELINTDITSNILKIEVFPPLKLLPKYTVLLEGSEIQLSTIGGPQNCHELLHYSIIKNETRNVKEAKIEFIIGPKGLLKAVSFGETSIVIKVEVIDADPTRNNRLTVLSKDEGRVGVVQIKSISIWSPTKNLLVGNSMPLWVTFASSSNDLQHIPITGFSITGSANSAISFKWHLNPPQGVISRLENVLEPAGINIGNKYLHSGMRLITSNPGKQTIEISISNVPKRWLSIDLQHNLPLNSKINIAIIPKLEIIYPISYVQSVLVPPATKITLKTSLDDIALITYTLIPYQVDKISSKAQSKIHSGNILETNPNLSDNKVENFILHVTSSQSIKLNTANEITANQTVALFFTVKHPTYSMMSPYISSNSIFKQFQTTKFINKHSSIFVLPLGGPFEFHITNHDELGNIFDISPDTNMFSYQLHRSDNIGITICSSESIRKSDSLKESTTLNIDPILTFIDSKSFSSQKVLQFQGLSTGENTIQLFYHDLLSDSPQLTDIISIPTGSVLEMKKFPQNLATEGSRVKYEAPFSGGYWYSSEGDIVSIDSSFGDAILKNRGSSNIFYSLANAYPNIEKVQNKNVLISHELIVHGASKISMKIIEGTSLPLDDSCLKSECIPISLNYQSNFLVASIYVSSSDLLNYEKENYHKFEKEYTPNYSERLQNDIPLECDIDVNSYEESLMSFQEIFKSLFRVSILPVTTEFDNELGIKQWACLILPNFVNAVTHDQMMQLIRAQFKLNLHIQTRLRHSGVKSPRISVPVVLGYVLLMNDTSRNNLVIKESGEVITAIQVAIPLSTKLLLNENKNIKFSVLSTRPNLLEVLAPREGTSDSGIETLIYPLKAVVVDKMINEKVEVIIEFPITKQRDVIYLQIDIHTRSTAANPLSPGDSIDDLELSSVNWFAPIVVVFLTATFAISIVMFVNHFIQPKLNDDRSMPSPIKDPNSSFSDHNYPYSPLYTSPRYTQHIWNSMGPRRDHSPPYQSRHTRYPFYSNNQELHDSYKSNL 2077          

HSP 2 Score: 1455.66 bits (3767), Expect = 0.000e+0
Identity = 738/747 (98.80%), Postives = 742/747 (99.33%), Query Frame = 1
Query:   55 MRVLLXXXXXXXXXXNEFKLSDSKVLLPRTSYLSINYTIKGSPNICHEWISETPEVVVITPIYSSDGSKCSEQATITSVWQSNTKATGTVYAKNIATGHSVKCDVIIDQIRKLEIETRTLELYLHETPEALIARAYDEYGNTFSTLDGIPFEWLINHIGSNGDAQNVLRFITWTESEYVTPSLIGNLEQQGLMGYMQLVSGLKTGAAEVSLTFRDEXXXXXXXXXXXXXXXMANAALSPPLAYLIPYTQLSYKIIVHSQGSTQEVIMPNNQYLLKINNTDLAQLDFKGSTITAKKYGQTEVILIDKNINEDFRHPSSLLYIVEPGFLTFHISPHENQWVLQTMKDNIYTITIRPYDFNSHPIFMSDNIRLETLIPKEYFEVLHSSLNGTYNVVKTIKEGKTSLKSKLNFILLPNKTEFKLENPVEGTQDLIIYPPITVLPKFVVLPWYPNIKSIPGYLFSATGGSGEYKWMAHDDNHKINNLSISVDNKGFIKPMKLGLSNVVAADQRNLNNIGTAIVLVDIIKSLQFIIDIVEVEIHNELDLPIFATNSKANKISHCYWLPFNAISEDPSIIEVVKIAAVEHSKHPDACAFLKVRGLKPGFSKLTITLRNQPNEIIREMLTSSITIGSFIPTKFLDPLSGSTTIGVRSSITMNIAYGPLPWLLDPSNYFYEMVEDSTSKQIVKKLSLTDNRHNLKLRTLQLKVQCISVGEVNISIFISNKKSLKHPKPVKSTGLAKLNLMIILKFK 2295
            MRVLLIIIAIISAKANEFKLSDSKVLLPRTSYLSINYTIKGSPNICHEWISETPEVVVITPIYSSDGSKCSEQATITSVWQSNTKATGTVYAKNIATGHSVKCDVIIDQIRKLEIETRTLELYLHETPEALIARAYDEYGNTFSTLDGIPFEWLINHIGSNGDAQNVLRFITWTESEYVTPSLIGNLEQQGLMGYMQLVSGLKTGAAEVSLTFRDEKVKSLIKSKSVKLLVMANAALSPPLAYLIPYTQLSYKIIVHSQGSTQEVIMPNNQYLLKINNTDLAQLDFKGSTITAKKYGQTEVILIDKNINEDFRHPSSLLYIVEPGFLTFHISPHENQWVLQTMKDNIYTITIRPYDFNSHPIFMSDNIRLETLIPKEYFEVLHSSLNGTYNVVKTIKEGKTSLKSKLNFILLPNKTEFKLENPVEGTQDLIIYPPITVLPKFVVLPWYPNIKSIPGYLFSATGGSGEYKWMAHDDNHKINNLSISVDNKGFIKPM+LGLSNVVAADQRNLNNIGTAIVLVDIIKSLQFIIDIVEVEIHNELDLPIFATNSKANKISHCYWLPFNAISEDPSIIEVVKIAAVEHSKHPDACAFLKVRGLKPGFSKLTITLRNQPNEIIREMLTSSITIGSFIPTKFLDPLSGSTTIGVRSSITMNIAYGPLPWLLDPSNYFYEMVEDSTSKQIVKKLSLTDNRHNLKLRTLQLKVQCISVGEVNISIFISNKKSLKHPKPVKSTGLAKL   + ++ K
Sbjct:    1 MRVLLIIIAIISAKANEFKLSDSKVLLPRTSYLSINYTIKGSPNICHEWISETPEVVVITPIYSSDGSKCSEQATITSVWQSNTKATGTVYAKNIATGHSVKCDVIIDQIRKLEIETRTLELYLHETPEALIARAYDEYGNTFSTLDGIPFEWLINHIGSNGDAQNVLRFITWTESEYVTPSLIGNLEQQGLMGYMQLVSGLKTGAAEVSLTFRDEKVKSLIKSKSVKLLVMANAALSPPLAYLIPYTQLSYKIIVHSQGSTQEVIMPNNQYLLKINNTDLAQLDFKGSTITAKKYGQTEVILIDKNINEDFRHPSSLLYIVEPGFLTFHISPHENQWVLQTMKDNIYTITIRPYDFNSHPIFMSDNIRLETLIPKEYFEVLHSSLNGTYNVVKTIKEGKTSLKSKLNFILLPNKTEFKLENPVEGTQDLIIYPPITVLPKFVVLPWYPNIKSIPGYLFSATGGSGEYKWMAHDDNHKINNLSISVDNKGFIKPMRLGLSNVVAADQRNLNNIGTAIVLVDIIKSLQFIIDIVEVEIHNELDLPIFATNSKANKISHCYWLPFNAISEDPSIIEVVKIAAVEHSKHPDACAFLKVRGLKPGFSKLTITLRNQPNEIIREMLTSSITIGSFIPTKFLDPLSGSTTIGVRSSITMNIAYGPLPWLLDPSNYFYEMVEDSTSKQIVKKLSLTDNRHNLKLRTLQLKVQCISVGEVNISIFISNKKSLKHPKPVKSTGLAKLICTVPVRMK 747          
The following BLAST results are available for this feature:
BLAST of Nuclear pore membrane glycoprotein 210 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 4
Match NameE-valueIdentityDescription
NUP2102.293e-11329.99nucleoporin 210 [Source:HGNC Symbol;Acc:HGNC:30052... [more]
NUP210L9.583e-7528.51nucleoporin 210 like [Source:HGNC Symbol;Acc:HGNC:... [more]
NUP210L1.901e-7428.51nucleoporin 210 like [Source:HGNC Symbol;Acc:HGNC:... [more]
NUP210L1.254e-1224.01nucleoporin 210 like [Source:HGNC Symbol;Acc:HGNC:... [more]
back to top
BLAST of Nuclear pore membrane glycoprotein 210 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 1
Match NameE-valueIdentityDescription
npp-129.532e-5925.86Nuclear Pore complex Protein [Source:UniProtKB/Tr... [more]
back to top
BLAST of Nuclear pore membrane glycoprotein 210 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 2
Match NameE-valueIdentityDescription
Gp2102.593e-4824.67gene:FBgn0266580 transcript:FBtr0086044[more]
Gp2102.593e-4824.67gene:FBgn0266580 transcript:FBtr0335270[more]
back to top
BLAST of Nuclear pore membrane glycoprotein 210 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 1
Match NameE-valueIdentityDescription
nup2101.399e-12631.99nucleoporin 210 [Source:ZFIN;Acc:ZDB-GENE-050208-1... [more]
back to top
BLAST of Nuclear pore membrane glycoprotein 210 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 3
Match NameE-valueIdentityDescription
NUP2101.966e-11730.13nucleoporin 210kDa [Source:NCBI gene;Acc:100493693... [more]
NUP2101.343e-11530.01nucleoporin 210kDa [Source:NCBI gene;Acc:100493693... [more]
NUP2101.048e-10929.69nucleoporin 210kDa [Source:NCBI gene;Acc:100493693... [more]
back to top
BLAST of Nuclear pore membrane glycoprotein 210 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Nup210l6.995e-9328.85nucleoporin 210-like [Source:MGI Symbol;Acc:MGI:19... [more]
Nup210l9.672e-9328.85nucleoporin 210-like [Source:MGI Symbol;Acc:MGI:19... [more]
Nup2106.443e-8629.88nucleoporin 210 [Source:MGI Symbol;Acc:MGI:1859555... [more]
Nup2102.453e-8129.72nucleoporin 210 [Source:MGI Symbol;Acc:MGI:1859555... [more]
Nup2104.212e-1920.29nucleoporin 210 [Source:MGI Symbol;Acc:MGI:1859555... [more]
back to top
BLAST of Nuclear pore membrane glycoprotein 210 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q8TEM1|PO210_HUMAN1.017e-11229.99Nuclear pore membrane glycoprotein 210 OS=Homo sap... [more]
sp|Q9D2F7|P210L_MOUSE4.273e-9228.85Nuclear pore membrane glycoprotein 210-like OS=Mus... [more]
sp|P11654|PO210_RAT2.327e-9030.73Nuclear pore membrane glycoprotein 210 OS=Rattus n... [more]
sp|Q9QY81|PO210_MOUSE4.507e-8529.88Nuclear pore membrane glycoprotein 210 OS=Mus musc... [more]
sp|Q5VU65|P210L_HUMAN9.129e-7428.51Nuclear pore membrane glycoprotein 210-like OS=Hom... [more]
back to top
BLAST of Nuclear pore membrane glycoprotein 210 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A0R3TQB91.786e-15035.08Uncharacterized protein OS=Rodentolepis nana OX=10... [more]
G4V6421.770e-14333.76Nuclear pore membrane glycoprotein gp210-related O... [more]
A0A5K3FY955.768e-14333.01Uncharacterized protein OS=Mesocestoides corti OX=... [more]
V3Z1851.543e-14134.86Uncharacterized protein OS=Lottia gigantea OX=2251... [more]
A0A0X3PJI26.183e-13733.05Nuclear pore membrane glycoprotein 210 OS=Schistoc... [more]
back to top
BLAST of Nuclear pore membrane glycoprotein 210 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 1
Match NameE-valueIdentityDescription
nup2102.964e-8933.24nucleoporin 210 [Source:ZFIN;Acc:ZDB-GENE-050208-1... [more]
back to top
BLAST of Nuclear pore membrane glycoprotein 210 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 1
Match NameE-valueIdentityDescription
ENSPMAT00000000425.19.178e-9229.63pep scaffold:Pmarinus_7.0:GL482109:412:16090:-1 ge... [more]
back to top
BLAST of Nuclear pore membrane glycoprotein 210 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Nuclear pore membrane glycoprotein 210 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 3
Match NameE-valueIdentityDescription
EDO396408.807e-4129.69Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO396412.160e-3230.59Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO284435.318e-1329.48Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Nuclear pore membrane glycoprotein 210 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 2
Match NameE-valueIdentityDescription
nup2101.584e-9232.43nucleoporin 210 [Source:NCBI gene;Acc:101172656][more]
nup2102.428e-9232.43nucleoporin 210 [Source:NCBI gene;Acc:101172656][more]
back to top
BLAST of Nuclear pore membrane glycoprotein 210 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 1
Match NameE-valueIdentityDescription
SMESG000046650.10.000e+099.33SMESG000046650.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30015686 ID=SMED30015686|Name=Nuclear pore membrane glycoprotein 210|organism=Schmidtea mediterranea sexual|type=transcript|length=6361bp
ATTTTCATTTTTATTTTAAAGTTTTATCTTTATATTTTAGTTAAACTTTT
TGGTATGAGAGTTTTATTAATTATAATAGCGATAATAAGTGCAAAAGCAA
ATGAATTTAAACTTAGTGATTCCAAAGTTCTTTTGCCTAGAACTAGTTAT
CTTTCTATAAATTACACTATTAAAGGATCTCCCAATATTTGCCATGAATG
GATTTCTGAAACTCCTGAGGTAGTGGTTATTACTCCAATTTATAGTTCAG
ATGGATCAAAATGCTCAGAACAAGCAACTATAACTTCTGTTTGGCAATCA
AATACCAAAGCAACAGGAACTGTTTATGCTAAAAATATTGCTACCGGACA
CAGTGTAAAATGTGATGTTATTATTGACCAAATTAGAAAACTTGAAATAG
AAACTAGAACATTGGAATTATATCTACACGAAACTCCAGAGGCTTTGATA
GCAAGAGCATATGATGAATATGGAAATACATTTTCAACTTTAGATGGTAT
CCCATTTGAATGGTTAATTAATCATATTGGTTCGAATGGTGATGCTCAAA
ATGTTCTCCGATTTATTACATGGACGGAATCTGAATATGTTACTCCATCT
TTAATAGGAAACTTAGAGCAGCAAGGCCTCATGGGTTACATGCAATTAGT
GAGTGGCCTTAAAACTGGAGCTGCTGAAGTTTCTCTTACTTTTAGAGATG
AGAAAGTTAAAAGTCTTATTAAAAGCAAAAGTGTAAAGCTTCTGGTTATG
GCTAATGCGGCTTTGAGTCCTCCATTGGCCTACCTCATTCCTTATACTCA
ACTGTCATACAAGATTATTGTCCACAGTCAGGGTTCTACTCAAGAAGTGA
TTATGCCAAATAACCAATATCTTCTTAAAATCAATAATACCGATTTAGCC
CAGTTAGATTTCAAAGGATCGACTATAACTGCTAAAAAATATGGTCAAAC
CGAAGTGATTTTAATCGACAAAAATATTAATGAAGATTTTCGACATCCAT
CTTCTTTATTATACATAGTGGAACCGGGGTTCCTTACATTTCATATTAGT
CCTCATGAAAATCAGTGGGTATTACAGACCATGAAAGATAATATCTACAC
TATAACCATACGCCCATATGATTTCAATAGTCACCCTATCTTTATGTCCG
ATAATATTAGATTGGAAACTCTTATCCCAAAGGAATATTTTGAAGTCCTC
CATTCTTCTCTTAACGGCACATATAATGTGGTTAAAACTATCAAGGAAGG
CAAAACGAGTTTAAAATCGAAATTAAACTTTATTTTATTACCGAATAAAA
CTGAATTTAAACTTGAGAATCCCGTTGAAGGAACTCAAGATTTAATTATT
TATCCTCCAATAACAGTGTTACCAAAATTTGTGGTTTTACCCTGGTATCC
GAATATAAAATCTATACCGGGATATTTATTTTCAGCCACTGGCGGAAGCG
GTGAATATAAATGGATGGCTCACGATGATAATCACAAAATAAATAATCTA
TCCATTTCAGTTGATAATAAAGGATTTATTAAACCCATGAAACTAGGTTT
GTCAAATGTGGTTGCTGCTGATCAGAGAAATCTTAATAATATAGGAACCG
CTATTGTTTTAGTTGATATTATTAAGTCACTTCAGTTTATTATTGATATA
GTTGAAGTTGAAATACACAATGAATTGGATTTGCCTATTTTTGCAACTAA
CAGCAAAGCTAATAAGATATCACATTGTTATTGGTTACCTTTTAATGCCA
TTTCAGAGGATCCCTCTATTATTGAAGTAGTTAAAATCGCCGCTGTGGAA
CATTCAAAGCATCCAGATGCTTGTGCGTTTTTAAAAGTTCGAGGCCTGAA
GCCTGGATTTTCAAAATTAACAATAACATTGAGAAATCAGCCGAATGAAA
TCATTCGAGAAATGTTAACTTCATCCATTACAATCGGATCATTCATTCCG
ACGAAGTTTCTAGATCCATTGTCTGGTTCGACCACAATTGGTGTTCGATC
TAGTATCACAATGAATATAGCTTATGGGCCATTGCCATGGCTTTTAGATC
CCTCTAATTACTTTTATGAAATGGTGGAAGATTCCACTAGTAAACAGATA
GTTAAAAAACTCAGCCTGACTGATAATAGACATAATCTCAAACTCCGAAC
GTTGCAATTGAAAGTTCAGTGTATTAGTGTCGGTGAAGTTAATATTTCTA
TCTTTATAAGTAATAAAAAATCATTGAAACATCCTAAACCAGTCAAATCA
ACTGGTCTTGCAAAGTTAAATTTGATGATTATTTTAAAATTTAAGCAGCT
TTTATAGATTGATTTGCACTGTTCCTGTGCGAATGAAGTTGGTACCTCGG
TTGATTTCTTCAAATATATCAACCGGCTGTCCTTTCCAGAACACTTCTGA
AAATCAACATATAACAGTGGATAATAAAAATCCATCGTCTGTTGAAATTG
TATTTACTGACAAAAATGGTGTTCAGTTAGAACGATCAGAGTCATTTGCA
GTAAAAGTTGAAATTAAAAGTTTAAACAAGAAAAATATTAAAGAAATAGT
CCAGGTTATTTACCCGACTGTTATTTATTCATCTGACAGCGACGAATCGT
TTTCTAACTCAAAATTCCTTGTTACTCCTTATCGTTTTGGCGAATCAACT
GGAGAGATTGAAGTTATTGTAAAAAGTAGTTCTTGTATTAGCGGTAAATG
TCCGGCTTTCAACCTGGAATCTCACCTTCAAATACAAATCAGTAGATCCA
TGATTGTCAATCCTATTACAATTCTTCTTTATCAACATGAAAAAGTATCA
ACAAAATTTTATGTGAATTATGGATCTGGATATTTTACTGTAACGACACC
AAATAATGATTTTCTTCAAATAAAAAAAATTGACAAACAAATTATCGATG
AAGATGAAGTTTCATATGAAATTATTCAAACTAAAGTTGATTATTCTCAA
CGAAACGCAATTATCAATGTGATAGATGCTTGTTTTAGTTCTTTAGAAAC
AGAATTCGAAAATTCCAAAACAATAGAAATTGAATTAGTCAAACCATTTA
AACTTCAAATTTTTTCTTTAAATAGAGTTCAATTAGGTTCACAAATAAAT
GTTCTTTTAAAAATATATGATGATAATGGCCGAGAATTCCCAAAGGATGC
CCTTCATTTATTATCAATGGCTTTGCATTTTACTGACAGATCTAATATCG
TTTCTGCTAATTCTCTATATTCTAAAGATTGGGTTTTGACACCAAATGAG
TTTTCAGAAAGTTCTGGTTTTGTTTTTAAAGTCAATGGTGAAAAGTTAGG
ATTCAGTTCTATATATGTTGAACTCATAAACACAGATATTACAAGCAACA
TTTTAAAAATTGAGGTATTTCCTCCATTGAAACTTTTACCTAAGTACACA
GTGCTTTTGGAAGGTTCTGAGATTCAACTAAGTACTATTGGTGGACCTCA
AAATTGCCATGAATTACTTCATTATTCGATTATTAAAAATGAAACACGAA
ATGTTAAAGAAGCTAAAATTGAATTCATAATCGGACCAAAAGGTCTTCTT
AAAGCTGTAAGTTTTGGAGAAACATCTGTTGTTATTAAAGTCGAAGTAAT
TGATGCAGATCCAACACGAAACAATCGATTAACAGTTTTATCAAAGGACG
AAGGCCGCGTTGGTGTTGTCCAAATAAAAAGTATATCTATTTGGTCACCA
ACAAAAAACTTGCTTGTCGGAAATTCCATGCCTTTATGGGTGACATTTGC
ATCTTCATCAAATGATTTGCAACACATTCCTATCACTGGATTTTCTATCA
CCGGATTAGCCAATTCCGCTATATCATTTAAATGGCATTTAAATCCACCA
CAAGGAGTCATTTCAAGATTGGAAAATGTACTGGAACCTGCTGGTATTAA
TATAGGAAATAAATATCTTCATAGTGGAATGAGACTCATCACATCAAATC
CTGGAAAGCAAACAATTGAAATTTCCATTTCAAATGTTCCAAAAAGATGG
CTATCTATTGATTTGCAACATAATTTGCCATTAAATTCCAAGATAAATAT
TGCCATAATACCTAAATTGGAAATAATTTATCCAATTTCTTATGTACAGA
GTGTATTAGTGCCACCTGCTACCAAAATAACCTTAAAGACATCACTGGAT
GACATTGCTTTGATTACATATACTCTAATTCCATATCAAGTTGATAAAAT
TTCATCAAAAGCTCAATCGAAAATACATTCTGGAAATATTTTGGAAACGA
ATCCGAATTTATCGGACAATAAAGTAGAAAATTTTATTTTACACGTAACG
TCAAGCCAGTCAATAAAATTAAATACTGCCAATGAAATAACTGCAAATCA
AACGGTTGCATTATTCTTCACTGTAAAACACCCTACTTATTCAATGATGT
CTCCTTATATTTCCTCTAATTCCATTTTCAAACAATTTCAAACAACTAAA
TTCATTAATAAACATTCTAGCATTTTCGTTTTACCCCTAGGTGGACCCTT
CGAGTTTCATATAACTAATCACGATGAACTAGGAAATATTTTCGATATTT
CACCAGATACAAATATGTTTTCCTACCAGTTACACCGATCTGACAATATC
GGAATAACTATTTGTTCAAGCGAATCTATAAGAAAATCTGATTCACTGAA
GGAATCAACAACATTAAATATTGATCCAATTTTAACGTTTATTGATTCAA
AATCGTTTTCATCTCAGAAAGTTTTACAGTTCCAAGGTTTAAGTACTGGA
GAAAATACAATACAACTTTTTTACCATGATTTATTATCGGATTCACCCCA
ATTAACCGATATAATATCTATTCCTACTGGATCGGTTTTAGAAATGAAAA
AGTTTCCCCAAAATTTAGCAACTGAGGGTAGTCGTGTAAAATATGAAGCA
CCTTTTAGCGGTGGCTATTGGTATTCATCTGAAGGAGATATTGTGTCTAT
AGATAGCTCATTTGGTGATGCGATTTTAAAAAATCGAGGATCAAGCAACA
TTTTTTATAGCCTCGCTAATGCATATCCGAACATCGAAAAAGTTCAAAAC
AAAAATGTCCTTATTAGTCATGAATTAATTGTTCACGGTGCCTCCAAAAT
ATCAATGAAAATTATTGAAGGTACGTCGTTACCCTTAGATGATTCTTGTT
TGAAAAGTGAATGCATTCCAATCAGTCTTAATTATCAATCAAATTTTTTG
GTGGCATCAATATACGTTTCTTCGTCTGATTTATTAAATTATGAAAAAGA
AAATTATCATAAATTTGAAAAAGAATACACTCCAAATTATTCCGAACGAC
TTCAGAACGATATTCCTTTAGAGTGTGATATTGATGTGAATTCTTATGAA
GAATCTTTGATGAGTTTCCAAGAGATTTTTAAATCCCTTTTTCGAGTCAG
TATACTACCAGTCACTACAGAATTCGATAACGAACTCGGTATTAAGCAGT
GGGCTTGTTTAATCCTACCTAATTTTGTAAATGCTGTTACACATGACCAA
ATGATGCAGCTTATTCGCGCTCAATTCAAATTAAATTTACATATTCAAAC
ACGACTTCGACATAGTGGTGTCAAATCACCAAGAATTTCCGTTCCCGTCG
TTCTGGGTTATGTTCTTCTAATGAACGATACGAGTCGAAACAATTTAGTC
ATCAAAGAAAGTGGTGAAGTAATCACTGCAATTCAAGTGGCAATACCTCT
CAGCACGAAATTGTTGTTGAATGAGAATAAAAACATAAAATTTTCAGTTT
TAAGCACCCGTCCCAACCTTCTCGAGGTCCTAGCTCCCCGGGAAGGTACT
AGCGACTCTGGCATAGAGACATTGATTTATCCATTAAAAGCAGTCGTTGT
CGATAAAATGATAAATGAGAAAGTCGAAGTTATAATTGAATTTCCAATTA
CAAAACAAAGAGACGTTATATATTTACAAATTGATATACATACTAGATCA
ACTGCTGCAAACCCGTTGTCACCAGGGGATTCAATTGATGATTTGGAACT
TTCTTCTGTTAATTGGTTTGCACCAATTGTTGTCGTTTTTCTAACGGCGA
CTTTTGCCATTTCAATTGTTATGTTCGTCAATCATTTTATCCAACCAAAA
TTGAATGATGATAGAAGCATGCCATCGCCTATTAAAGATCCAAACAGCTC
ATTTAGTGACCATAACTATCCATATTCACCGCTATATACCAGTCCCAGAT
ATACCCAGCACATTTGGAATAGTATGGGGCCAAGAAGAGATTATTCGCCG
CCCTATCAGTCACGTCACACACGATACCCATTTTATTCCAATAATCAAGA
ATTACATGATAGCTATAAATCGAATTTGTAGTGATTGTTTGGATGTAGTC
ATTATTTTGTG
back to top

protein sequence of SMED30015686-orf-1

>SMED30015686-orf-1 ID=SMED30015686-orf-1|Name=SMED30015686-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=1333bp
MKLVPRLISSNISTGCPFQNTSENQHITVDNKNPSSVEIVFTDKNGVQLE
RSESFAVKVEIKSLNKKNIKEIVQVIYPTVIYSSDSDESFSNSKFLVTPY
RFGESTGEIEVIVKSSSCISGKCPAFNLESHLQIQISRSMIVNPITILLY
QHEKVSTKFYVNYGSGYFTVTTPNNDFLQIKKIDKQIIDEDEVSYEIIQT
KVDYSQRNAIINVIDACFSSLETEFENSKTIEIELVKPFKLQIFSLNRVQ
LGSQINVLLKIYDDNGREFPKDALHLLSMALHFTDRSNIVSANSLYSKDW
VLTPNEFSESSGFVFKVNGEKLGFSSIYVELINTDITSNILKIEVFPPLK
LLPKYTVLLEGSEIQLSTIGGPQNCHELLHYSIIKNETRNVKEAKIEFII
GPKGLLKAVSFGETSVVIKVEVIDADPTRNNRLTVLSKDEGRVGVVQIKS
ISIWSPTKNLLVGNSMPLWVTFASSSNDLQHIPITGFSITGLANSAISFK
WHLNPPQGVISRLENVLEPAGINIGNKYLHSGMRLITSNPGKQTIEISIS
NVPKRWLSIDLQHNLPLNSKINIAIIPKLEIIYPISYVQSVLVPPATKIT
LKTSLDDIALITYTLIPYQVDKISSKAQSKIHSGNILETNPNLSDNKVEN
FILHVTSSQSIKLNTANEITANQTVALFFTVKHPTYSMMSPYISSNSIFK
QFQTTKFINKHSSIFVLPLGGPFEFHITNHDELGNIFDISPDTNMFSYQL
HRSDNIGITICSSESIRKSDSLKESTTLNIDPILTFIDSKSFSSQKVLQF
QGLSTGENTIQLFYHDLLSDSPQLTDIISIPTGSVLEMKKFPQNLATEGS
RVKYEAPFSGGYWYSSEGDIVSIDSSFGDAILKNRGSSNIFYSLANAYPN
IEKVQNKNVLISHELIVHGASKISMKIIEGTSLPLDDSCLKSECIPISLN
YQSNFLVASIYVSSSDLLNYEKENYHKFEKEYTPNYSERLQNDIPLECDI
DVNSYEESLMSFQEIFKSLFRVSILPVTTEFDNELGIKQWACLILPNFVN
AVTHDQMMQLIRAQFKLNLHIQTRLRHSGVKSPRISVPVVLGYVLLMNDT
SRNNLVIKESGEVITAIQVAIPLSTKLLLNENKNIKFSVLSTRPNLLEVL
APREGTSDSGIETLIYPLKAVVVDKMINEKVEVIIEFPITKQRDVIYLQI
DIHTRSTAANPLSPGDSIDDLELSSVNWFAPIVVVFLTATFAISIVMFVN
HFIQPKLNDDRSMPSPIKDPNSSFSDHNYPYSPLYTSPRYTQHIWNSMGP
RRDYSPPYQSRHTRYPFYSNNQELHDSYKSNL*
back to top

protein sequence of SMED30015686-orf-2

>SMED30015686-orf-2 ID=SMED30015686-orf-2|Name=SMED30015686-orf-2|organism=Schmidtea mediterranea sexual|type=polypeptide|length=769bp
IFIFILKFYLYILVKLFGMRVLLIIIAIISAKANEFKLSDSKVLLPRTSY
LSINYTIKGSPNICHEWISETPEVVVITPIYSSDGSKCSEQATITSVWQS
NTKATGTVYAKNIATGHSVKCDVIIDQIRKLEIETRTLELYLHETPEALI
ARAYDEYGNTFSTLDGIPFEWLINHIGSNGDAQNVLRFITWTESEYVTPS
LIGNLEQQGLMGYMQLVSGLKTGAAEVSLTFRDEKVKSLIKSKSVKLLVM
ANAALSPPLAYLIPYTQLSYKIIVHSQGSTQEVIMPNNQYLLKINNTDLA
QLDFKGSTITAKKYGQTEVILIDKNINEDFRHPSSLLYIVEPGFLTFHIS
PHENQWVLQTMKDNIYTITIRPYDFNSHPIFMSDNIRLETLIPKEYFEVL
HSSLNGTYNVVKTIKEGKTSLKSKLNFILLPNKTEFKLENPVEGTQDLII
YPPITVLPKFVVLPWYPNIKSIPGYLFSATGGSGEYKWMAHDDNHKINNL
SISVDNKGFIKPMKLGLSNVVAADQRNLNNIGTAIVLVDIIKSLQFIIDI
VEVEIHNELDLPIFATNSKANKISHCYWLPFNAISEDPSIIEVVKIAAVE
HSKHPDACAFLKVRGLKPGFSKLTITLRNQPNEIIREMLTSSITIGSFIP
TKFLDPLSGSTTIGVRSSITMNIAYGPLPWLLDPSNYFYEMVEDSTSKQI
VKKLSLTDNRHNLKLRTLQLKVQCISVGEVNISIFISNKKSLKHPKPVKS
TGLAKLNLMIILKFKQLL*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000014zeta neoblast
PLANA:0000429neoblast
PLANA:0002109X1 cell
PLANA:0002111X2 cell
Vocabulary: INTERPRO
TermDefinition
IPR008964Invasin/intimin_cell_adhesion
Vocabulary: cellular component
TermDefinition
GO:0016020membrane
GO:0016021integral component of membrane
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
NoneNo IPR availablePANTHERPTHR23019NUCLEAR PORE MEMBRANE GLYCOPROTEIN GP210-RELATEDcoord: 16..1292
NoneNo IPR availableTMHMMTMhelixcoord: 1231..1253