fucolectin

Overview
Namefucolectin
Smed IDSMED30015677
Length (bp)624
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of fucolectin (SMED30015677) t-SNE clustered cells

Violin plots show distribution of expression levels for fucolectin (SMED30015677) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of fucolectin (SMED30015677) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for fucolectin (SMED30015677) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30015677

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 8

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
headSMED30015677SMESG000046841.1 SmedASXL_017061SmedAsxl_ww_GCZZ01PMID:27034770
Currie et al., 2016
whole organism asexual adult RNA-sequencing evidence
headSMED30015677SMESG000046841.1 SmedASXL_075937SmedAsxl_ww_GCZZ01PMID:27034770
Currie et al., 2016
whole organism asexual adult RNA-sequencing evidence
headSMED30015677SMESG000046841.1 SmedASXL_017060SmedAsxl_ww_GCZZ01PMID:27034770
Currie et al., 2016
whole organism asexual adult RNA-sequencing evidence
neuronSMED30015677SMESG000046841.1 dd_Smed_v4_12352_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
headSMED30015677SMESG000046841.1 dd_Smed_v6_22212_0_1dd_Smed_v6PMID:28171748
Stückemann et al., 2017
whole organism asexual adult RNA-sequencing evidence
headSMED30015677SMESG000046841.1 dd_Smed_v6_12352_0_1dd_Smed_v6PMID:28171748
Stückemann et al., 2017
whole organism asexual adult RNA-sequencing evidence
GABAergic neuronSMED30015677SMESG000046841.1 dd_Smed_v6_12352_0dd_Smed_v6PMID:29674432
Plass et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
nervous systemSMED30015677SMESG000046841.1 dd_Smed_v4_12352_0_1dd_Smed_v4PMID:30962434
Cote et al., 2019
whole organism asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of fucolectin vs. Ensembl Zebrafish
Match: si:ch73-359m17.2 (si:ch73-359m17.2 [Source:ZFIN;Acc:ZDB-GENE-141222-90])

HSP 1 Score: 58.151 bits (139), Expect = 2.105e-10
Identity = 38/131 (29.01%), Postives = 59/131 (45.04%), Query Frame = 1
Query:  115 PYWSSDKAVDGNYDSKMVDGHCYH-SKELNSTKWWLIILDSLSVVTRVVIYSRVDCCTYRTSLLSFYVXXXXXXXXXXXXXDFANVSYYPGPPPPGEFITTLNFTRLYARTLAISKPFAEQPLNLCELEVF 504
            P  +++ AVDGN ++    G C H S+E N   WW + L  +S V +V I +R DCC  R       +  +   + + N      +    G         T  F  +  R L +  P  ++ L+LCE+EVF
Sbjct:   40 PNGNAEHAVDGNTEADYRKGSCTHTSREFN--PWWRVDLGGVSSVNKVTITNRGDCCEERIRGAQIRIGDSLENNGNNNQLAATLLDAIKGS-------QTFEFQPIQGRYLNVFLPGNDETLSLCEVEVF 161          
BLAST of fucolectin vs. Ensembl Zebrafish
Match: si:ch73-359m17.2 (si:ch73-359m17.2 [Source:ZFIN;Acc:ZDB-GENE-141222-90])

HSP 1 Score: 59.3066 bits (142), Expect = 2.961e-10
Identity = 39/134 (29.10%), Postives = 60/134 (44.78%), Query Frame = 1
Query:  115 PYWSSDKAVDGNYDSKMVDGHCYH-SKELNSTKWWLIILDSLSVVTRVVIYSRVDCCTYRTSLLSFYVXXXXXXXXXXXXXDFANVSYYPGPPPPGEFITTLNFTRLYARTLAISKPFAEQPLNLCELEVFGYP 513
            P  +++ AVDGN ++    G C H S+E N   WW + L  +S V +V I +R DCC  R       +  +   + + N      +    G         T  F  +  R L +  P  ++ L+LCE+EVF  P
Sbjct:   40 PNGNAEHAVDGNTEADYRKGSCTHTSREFN--PWWRVDLGGVSSVNKVTITNRGDCCEERIRGAQIRIGDSLENNGNNNQLAATLLDAIKGS-------QTFEFQPIQGRYLNVFLPGNDETLSLCEVEVFSGP 164          
BLAST of fucolectin vs. Ensembl Zebrafish
Match: si:ch73-359m17.2 (si:ch73-359m17.2 [Source:ZFIN;Acc:ZDB-GENE-141222-90])

HSP 1 Score: 57.3806 bits (137), Expect = 1.047e-9
Identity = 38/131 (29.01%), Postives = 59/131 (45.04%), Query Frame = 1
Query:  115 PYWSSDKAVDGNYDSKMVDGHCYH-SKELNSTKWWLIILDSLSVVTRVVIYSRVDCCTYRTSLLSFYVXXXXXXXXXXXXXDFANVSYYPGPPPPGEFITTLNFTRLYARTLAISKPFAEQPLNLCELEVF 504
            P  +++ AVDGN ++    G C H S+E N   WW + L  +S V +V I +R DCC  R       +  +   + + N      +    G         T  F  +  R L +  P  ++ L+LCE+EVF
Sbjct:   40 PNGNAEHAVDGNTEADYRKGSCTHTSREFN--PWWRVDLGGVSSVNKVTITNRGDCCEERIRGAQIRIGDSLENNGNNNQLAATLLDAIKGS-------QTFEFQPIQGRYLNVFLPGNDETLSLCEVEVF 161          
BLAST of fucolectin vs. Ensembl Zebrafish
Match: si:ch211-215k15.4 (si:ch211-215k15.4 [Source:ZFIN;Acc:ZDB-GENE-131127-215])

HSP 1 Score: 49.2914 bits (116), Expect = 7.767e-7
Identity = 51/178 (28.65%), Postives = 81/178 (45.51%), Query Frame = 1
Query:    1 VFINSSKFLLFVFQITT---AQNALLSRGRPTFAANVIDNQPYWSSD----KAVDGNYDSKMVDGHCYHSKELNSTKWWLIILDSLSVVTRVVIYSRVDCCTYRTSLLSFYVXXXXXXXXXXXXXDFANVSYYPGPPPPGEFITTLNFTRLYARTLAISKPFAEQPLNLCELEVFGYP 513
            VF+    F++  F  TT   A+N  LS GR T  ++++ N   W+ +     A+DGN D     G C  + E+    WW + L    VV  + I +R DCC  R      ++  +   + ++N    A +S  P     G  +T      +  R + +    + + L LCELEV+GYP
Sbjct:    5 VFVLLHIFVMPYFTDTTTAKARNLALS-GRAT-QSDLLKNP--WTGEALASNAIDGNRDPDFYHGSCT-ATEVQDDPWWRLDLLDTYVVKSITITNRKDCCPERLDGAEVHIGNSLLNNGNSNPL-AAKISSIPA----GRSLTFKWKKGISGRYINVILRGSNRILTLCELEVYGYP 172          
BLAST of fucolectin vs. Ensembl Zebrafish
Match: si:ch211-215k15.4 (si:ch211-215k15.4 [Source:ZFIN;Acc:ZDB-GENE-131127-215])

HSP 1 Score: 48.1358 bits (113), Expect = 1.923e-6
Identity = 45/161 (27.95%), Postives = 73/161 (45.34%), Query Frame = 1
Query:   43 ITTAQNALLSRGRPTFAANVIDNQPYWSSD----KAVDGNYDSKMVDGHCYHSKELNSTKWWLIILDSLSVVTRVVIYSRVDCCTYRTSLLSFYVXXXXXXXXXXXXXDFANVSYYPGPPPPGEFITTLNFTRLYARTLAISKPFAEQPLNLCELEVFGYP 513
            +  A+N  LS GR T  ++++ N   W+ +     A+DGN D     G C  + E+    WW + L    VV  + I +R DCC  R      ++  +   + ++N    A +S  P     G  +T      +  R + +    + + L LCELEV+GYP
Sbjct:   17 LIAARNLALS-GRAT-QSDLLKNP--WTGEALASNAIDGNRDPDFYHGSCT-ATEVQDDPWWRLDLLDTYVVKSITITNRKDCCPERLDGAEVHIGNSLLNNGNSNPL-AAKISSIPA----GRSLTFKWKKGISGRYINVILRGSNRILTLCELEVYGYP 167          
BLAST of fucolectin vs. Ensembl Xenopus
Match: ncapg2 (non-SMC condensin II complex subunit G2 [Source:Xenbase;Acc:XB-GENE-1002744])

HSP 1 Score: 58.5362 bits (140), Expect = 9.656e-10
Identity = 43/145 (29.66%), Postives = 62/145 (42.76%), Query Frame = 1
Query:  112 QPYWSSDKAVDGNYDSKMVDGHCYHSKELNSTKWWLIILDSLSVVTRVVIYSRVDCCTYRTSLLSFYVXXXXXXXXXXXXXDFANVSYYPGP-----PPPGEFITTLNFTRLYARTLAISKPFAEQPLNLCELEVFGYPFIKTMP 531
            +P +S+  A DG+ ++ M  G C H+   N   WW + L     V +VVI +R DCC  R  LL   V                N +    P         E   T++  R+  R L +  P  E+ L LCE+EV+G  F   +P
Sbjct:  183 RPEYSASNANDGDANTDMRYGSCSHTGNDNPA-WWQLDLKKRYKVDKVVIVNRGDCCGER--LLGAQVR-------------VGNTANLNNPLCGTVTDVSEETITVSCHRMEGRYLTVVIPGREETLQLCEVEVYGQVFRAFIP 311          

HSP 2 Score: 51.9878 bits (123), Expect = 1.561e-7
Identity = 42/144 (29.17%), Postives = 72/144 (50.00%), Query Frame = 1
Query:   88 FAANVIDNQPY---WSSDKAVDGNYDSKMVDGHCYHSKELNSTKWWLIILDSLSVVTRVVIYSRVDCCTYRTSLLSFYVXXXXXXXXXXXXXD-FANVSYYPGPPPPGEFITTLNFTRLYARTLAISKPFAEQPLNLCELEVFG 507
            + A+V  +  Y   +S+D+A+DG+ D+ M+   C  +++ +S  WW   + ++  V  VVI +R+DCC+ R  LL   V   +S   +        +VS         +   TL    L  R +++  P  E+ L LCE+EV+G
Sbjct:   30 YGADVKQSSTYGLGFSADRAIDGSKDNNMLKRPCTQTQK-DSPAWWQADMINIYKVETVVIVNRMDCCSAR--LLGAEVRVGDSPDNNNPVCGIITDVS---------KSTITLCCNGLEGRYVSVVIPGREEHLTLCEVEVYG 161          
BLAST of fucolectin vs. Ensembl Xenopus
Match: ncapg2 (non-SMC condensin II complex subunit G2 [Source:Xenbase;Acc:XB-GENE-1002744])

HSP 1 Score: 58.151 bits (139), Expect = 1.093e-9
Identity = 45/141 (31.91%), Postives = 67/141 (47.52%), Query Frame = 1
Query:  112 QPYWSSDKAVDGNYDSKMVDGHCYHSKELNSTKWWLIILDSLSVVTRVVIYSRVDCCTYRTSLLSFYVXXXXXXXXXX-XXXDFANVSYYPGPPPPGEFITTLNFTRLYARTLAISKPFAEQPLNLCELEVFGYPFIKTMP 531
            +P +S+  A DG+ ++ M  G C H+   N   WW + L     V +VVI +R DCC  R  LL   V   N+ +L+        +VS         E   T++  R+  R L +  P  E+ L LCE+EV+G  F   +P
Sbjct:  183 RPEYSASNANDGDANTDMRYGSCSHTGNDNPA-WWQLDLKKRYKVDKVVIVNRGDCCGER--LLGAQVRVGNTANLNNPLCGTVTDVS---------EETITVSCHRMEGRYLTVVIPGREETLQLCEVEVYGQVFRAFIP 311          
BLAST of fucolectin vs. Ensembl Xenopus
Match: ncapg2 (non-SMC condensin II complex subunit G2 [Source:Xenbase;Acc:XB-GENE-1002744])

HSP 1 Score: 56.9954 bits (136), Expect = 3.652e-9
Identity = 46/147 (31.29%), Postives = 74/147 (50.34%), Query Frame = 1
Query:   88 FAANVIDNQPY---WSSDKAVDGNYDSKMVDGHCYHSKELNSTKWWLIILDSLSVVTRVVIYSRVDCCTYRTSLLSFYVXXXXXXXXX----XXXXDFANVSYYPGPPPPGEFITTLNFTRLYARTLAISKPFAEQPLNLCELEVFG 507
            + A+V  +  Y   +S+D+A+DG+ D+ M+   C  +++ +S  WW   + ++  V  VVI +R+DCC+ R  LL   V   +S   +       NDF+N             ITTL       R +++  P   + LNLCELEV+G
Sbjct:   94 YGADVKQSSTYGLGFSADRAIDGSKDNNMLKRPCTQTQK-DSPAWWQADMINIYKVETVVIVNRMDCCSAR--LLGAEVRVGDSPDNNNPVCGIINDFSN------------LITTLCCDGKEGRYVSVVIPGRNEYLNLCELEVYG 225          

HSP 2 Score: 51.2174 bits (121), Expect = 3.536e-7
Identity = 38/130 (29.23%), Postives = 59/130 (45.38%), Query Frame = 1
Query:  115 PYWSSDKAVDGNYDSKMVDGHCYHSKELNSTKWWLIILDSLSVVTRVVIYSRVDCCTYRTSLLSFYVXXXXXXXXXXXXXDFANVSYYPGPPPPGEFITTLNFTRLYARTLAISKPFAEQPLNLCELEVF 504
            P +++  A+DGN +S M+ G C H+   N   WW + L     V +V+I +R DCC  R  LL   V   +S+S              P          TL+   +  R +++  P   + L LCE+EV+
Sbjct:  389 PMYNAATAIDGNTNSNMMAGSCSHTGNDNPA-WWQLDLKKPYRVEKVLIVNRGDCCGER--LLGAEVRVGSSSSRDNPVCGVVTDVSKP--------TITLSCNGMGGRYVSVVIPGRPETLQLCEVEVY 507          
BLAST of fucolectin vs. Ensembl Xenopus
Match: ncapg2 (non-SMC condensin II complex subunit G2 [Source:Xenbase;Acc:XB-GENE-1002744])

HSP 1 Score: 56.9954 bits (136), Expect = 3.855e-9
Identity = 46/147 (31.29%), Postives = 74/147 (50.34%), Query Frame = 1
Query:   88 FAANVIDNQPY---WSSDKAVDGNYDSKMVDGHCYHSKELNSTKWWLIILDSLSVVTRVVIYSRVDCCTYRTSLLSFYVXXXXXXXXX----XXXXDFANVSYYPGPPPPGEFITTLNFTRLYARTLAISKPFAEQPLNLCELEVFG 507
            + A+V  +  Y   +S+D+A+DG+ D+ M+   C  +++ +S  WW   + ++  V  VVI +R+DCC+ R  LL   V   +S   +       NDF+N             ITTL       R +++  P   + LNLCELEV+G
Sbjct:   30 YGADVKQSSTYGLGFSADRAIDGSKDNNMLKRPCTQTQK-DSPAWWQADMINIYKVETVVIVNRMDCCSAR--LLGAEVRVGDSPDNNNPVCGIINDFSN------------LITTLCCDGKEGRYVSVVIPGRNEYLNLCELEVYG 161          

HSP 2 Score: 51.2174 bits (121), Expect = 3.222e-7
Identity = 38/130 (29.23%), Postives = 59/130 (45.38%), Query Frame = 1
Query:  115 PYWSSDKAVDGNYDSKMVDGHCYHSKELNSTKWWLIILDSLSVVTRVVIYSRVDCCTYRTSLLSFYVXXXXXXXXXXXXXDFANVSYYPGPPPPGEFITTLNFTRLYARTLAISKPFAEQPLNLCELEVF 504
            P +++  A+DGN +S M+ G C H+   N   WW + L     V +V+I +R DCC  R  LL   V   +S+S              P          TL+   +  R +++  P   + L LCE+EV+
Sbjct:  325 PMYNAATAIDGNTNSNMMAGSCSHTGNDNPA-WWQLDLKKPYRVEKVLIVNRGDCCGER--LLGAEVRVGSSSSRDNPVCGVVTDVSKP--------TITLSCNGMGGRYVSVVIPGRPETLQLCEVEVY 443          
BLAST of fucolectin vs. Ensembl Xenopus
Match: fucolectin (x-epilectin [Source:NCBI gene;Acc:100144955])

HSP 1 Score: 55.0694 bits (131), Expect = 1.282e-8
Identity = 37/131 (28.24%), Postives = 60/131 (45.80%), Query Frame = 1
Query:  115 PYWSSDKAVDGNYDSKMVDGHCYHSKELNSTKWWLIILDSLSVVTRVVIYSRVDCCTYRTSLLSFYVXXXXXXXXXXXXXDFANVSYYPGPPPPGEFITTLNFTRLYARTLAISKPFAEQPLNLCELEVFG 507
            P +++  A+DGN D+ M+ G C H+   N   WW + L     V +VVI +R DCC  R       V  +   +    +    +VS         +   TL+   +  R +++  P   + L LCE+EV+G
Sbjct:  206 PKYNAAAAIDGNKDTNMMAGSCSHTNSDNPA-WWQLDLKKRYQVEKVVIVNRGDCCGERLRGAEIRVGDSPDNNNPVCAT-VTDVS---------QLTLTLSCKGIPGRYVSVVIPGRAEYLQLCEVEVYG 325          
BLAST of fucolectin vs. UniProt/SwissProt
Match: sp|Q9I929|FUCL3_ANGJA (Fucolectin-3 OS=Anguilla japonica OX=7937 PE=2 SV=1)

HSP 1 Score: 52.7582 bits (125), Expect = 1.979e-7
Identity = 29/82 (35.37%), Postives = 41/82 (50.00%), Query Frame = 1
Query:   55 QNALLSRGRPTFAANVIDN-QPYWSSDKAVDGNYDSKMVDGHCYHSKELNSTKWWLIILDSLSVVTRVVIYSRVDCCTYRTS 297
            Q  +  RGR T +A +      +  +  A+DGN DS    G C H++  NS  WW + L  +  +T V I +R DCC  R S
Sbjct:   31 QENVALRGRATQSAQLKGEFAGFAHASNAIDGNRDSNYHHGSCSHTEGDNS--WWRVDLKQVYTITSVTITNRGDCCGERIS 110          
BLAST of fucolectin vs. UniProt/SwissProt
Match: sp|Q9I925|FUCL7_ANGJA (Fucolectin-7 OS=Anguilla japonica OX=7937 PE=2 SV=1)

HSP 1 Score: 52.373 bits (124), Expect = 2.379e-7
Identity = 44/150 (29.33%), Postives = 63/150 (42.00%), Query Frame = 1
Query:   55 QNALLSRGRPTFAANVI-DNQPYWSSDKAVDGNYDSKMVDGHCYHSKELNSTKWWLIILDSLSVVTRVVIYSRVDCCTYRTSLLSFYVXXXXXXXXXXXXXDFANVSYYPGPPPPGEFITTLNFTRLYARTLAISKPFAEQPLNLCELEV 501
            Q  +  RGR T +A +  D+     +  A+DGN DS    G C H++      WW + L  +  +T V I +R DCC  R S     +      +   N           GP   GE  T      +  R + +  P AE  L+LCE+EV
Sbjct:   40 QENVALRGRATQSAQLRGDHSGIAHASNAIDGNRDSVFYHGSCTHTEA--DKPWWRVDLLQVYTITSVTITNRGDCCEERISGARILIGKHLENNGINNPQ-----CSVIGPMAAGETKTFRCPQPMIGRYVTVYLPKAES-LHLCEVEV 181          
BLAST of fucolectin vs. UniProt/SwissProt
Match: sp|Q7SIC1|FUCL_ANGAN (Fucolectin OS=Anguilla anguilla OX=7936 PE=1 SV=1)

HSP 1 Score: 48.521 bits (114), Expect = 3.789e-6
Identity = 28/82 (34.15%), Postives = 39/82 (47.56%), Query Frame = 1
Query:   55 QNALLSRGRPTFAANVIDNQPYWS-SDKAVDGNYDSKMVDGHCYHSKELNSTKWWLIILDSLSVVTRVVIYSRVDCCTYRTS 297
            Q  +  RG+ T +A +       S +  A+DGN DS    G C HS    +  WW + L  +  +T V I +R DCC  R S
Sbjct:    8 QENVAVRGKATQSAQLRGEHAANSEASNAIDGNRDSNFYHGSCTHSSG-QANPWWRVDLLQVYTITSVTITNRGDCCGERIS 88          
BLAST of fucolectin vs. TrEMBL
Match: A0A1S3KEU6 (fucolectin OS=Lingula unguis OX=7574 GN=LOC106181345 PE=4 SV=1)

HSP 1 Score: 81.2629 bits (199), Expect = 5.644e-15
Identity = 57/188 (30.32%), Postives = 98/188 (52.13%), Query Frame = 1
Query:   67 LSRGRPTFAANVIDNQPYWSSDKAVDGNYDSKMVDGHCYHSKELNSTKWWLIILDSLSVVTRVVIYSRVDCCTYRTSLLSFYVXXXXXXXXXXXXXDFANVSYYPGPPPPGEFITTLNF-TRLYARTLAISKPFAEQ-PLNLCELEVFGYPFIKTMPMTFKYLRALSIYDSLGNIGTFPVLSNLDCAM 624
            +++G+P   ++    +  +++  AVDGNYD     G C H+++     WWL+ L+S +++  VV+ +R +CC+ R  L++F V    S   +++   +   + YPG  P G   T+L+  + L  R + I K  ++  PL LCE+EV G+P   T  +     RA     SL  I T  V S  +C++
Sbjct:   26 VAKGKPAHQSSTYMYEGSYNASLAVDGNYDDNWQQGSCSHTED-GQGNWWLVDLESTAILAGVVLTNRGECCSER--LVNFEVRVGYSFVGTSSFTQYRLCASYPGVAPVGN--TSLSCRSPLRGRYVLIIKVGSDDLPLQLCEVEVHGFPSTTTFQLVGAGARA-----SLSPISTLNVRSLTECSI 203          
BLAST of fucolectin vs. TrEMBL
Match: A0A3Q4HN98 (Si:ch211-215k15.4 OS=Neolamprologus brichardi OX=32507 PE=4 SV=1)

HSP 1 Score: 78.5666 bits (192), Expect = 1.251e-13
Identity = 50/161 (31.06%), Postives = 85/161 (52.80%), Query Frame = 1
Query:   34 VFQITTAQNALLSRGRPTFAANVIDNQPYWSSDKAVDGNYDSKMVDGHCYHSKELNSTKWWLIILDSLSVVTRVVIYSRVDCCTYRTSLLSFYVXXXXXXXXXXXXXDFANVSYYPGPPPPGEFITTLNFT-RLYARTLAISKPFAEQPLNLCELEVFGYP 513
            +  ++T QN  L RG+ T +  + DN P  ++  A+DGN +S+  DG C H+ +  +  WW + L    ++T V I++R DCC +R S L  ++   +  +    +     +S        GE  + L FT R+  R + ++ P + + L LCE+EV+GYP
Sbjct:   15 ISSVSTYQNVAL-RGKATQSTRLTDN-PVSAAHNAIDGNRNSEFSDGSCTHTND-QTNPWWRVDLLQSYIITSVTIFNRGDCCQHRLSGLEIHI-GNSLNNEGLENPKVGTIS----EGRTGE--SKLTFTNRVEGRYITLTLPGSSRILTLCEVEVYGYP 165          
BLAST of fucolectin vs. TrEMBL
Match: A0A1S3HEB9 (fucolectin-like OS=Lingula unguis OX=7574 GN=LOC106153850 PE=4 SV=1)

HSP 1 Score: 75.0998 bits (183), Expect = 1.045e-12
Identity = 59/192 (30.73%), Postives = 97/192 (50.52%), Query Frame = 1
Query:   67 LSRGRPTFAANVIDNQ----PYWSSDKAVDGNYDSKMVDGHCYHSKELNSTKWWLIILDSLSVVTRVVIYSRVDCCTYRTSLLSFYVXXXXXXXXXXXXXDFANVSYYPGPPPPGEFITTLNFTR-LYARTLAISKPFA-EQPLNLCELEVFGYPFIKTMPMTFKYLRALSIYDSLGNIGTFPVLSNLDCAM 624
            L++G+P + ++   N+      + + +AVDGNY+     G C H+ +     WWL+ L + + V  V+I +R DCC+YR  L +F V    S   S++   +   + YPG  P G   T+L+    L  R + I K  + +Q L LCE+EV G+       M FK + A     +L  + T  V S ++C++
Sbjct:   33 LAKGKPAYQSSTYQNRYGITDLYYASRAVDGNYNDNGNHGSCSHT-DAGQGGWWLVDLKTTARVAGVIITNRRDCCSYR--LTNFEVKVGTSYDNSSSFTQYKLCASYPGQAPVGN--TSLSCESPLTGRYVLIIKVGSDDQALQLCEVEVHGFR----RSMKFKQV-AADARATLVPLSTLNVGSLIECSI 214          
BLAST of fucolectin vs. TrEMBL
Match: A0A3P8NS80 (Si:ch211-215k15.4 OS=Astatotilapia calliptera OX=8154 PE=4 SV=1)

HSP 1 Score: 75.485 bits (184), Expect = 1.479e-12
Identity = 50/161 (31.06%), Postives = 84/161 (52.17%), Query Frame = 1
Query:   34 VFQITTAQNALLSRGRPTFAANVIDNQPYWSSDKAVDGNYDSKMVDGHCYHSKELNSTKWWLIILDSLSVVTRVVIYSRVDCCTYRTSLLSFYVXXXXXXXXXXXXXDFANVSYYPGPPPPGEFITTLNFT-RLYARTLAISKPFAEQPLNLCELEVFGYP 513
            +  ++T QN  L RG+ T +  + DN P  ++  A+DGN +S+   G C H+ E  +  WW + L    ++T V I++R DCC +R S L  ++   +  +    +     +S        GE  + L FT R+  R + ++ P + + L LCE+EV+GYP
Sbjct:   15 ISSVSTYQNVAL-RGKATQSTRLTDN-PVSAAHNAIDGNRNSEFSVGSCTHTNE-QTNPWWRVDLLQSYIITSVTIFNRGDCCQHRLSGLEIHI-GNSLNNEGLENPKVGTIS----EGRTGE--SKLTFTNRVEGRYVTLTLPGSGRILTLCEVEVYGYP 165          
BLAST of fucolectin vs. TrEMBL
Match: A0A3P9BXB6 (Si:ch211-215k15.4 OS=Maylandia zebra OX=106582 PE=4 SV=1)

HSP 1 Score: 75.485 bits (184), Expect = 1.479e-12
Identity = 50/161 (31.06%), Postives = 84/161 (52.17%), Query Frame = 1
Query:   34 VFQITTAQNALLSRGRPTFAANVIDNQPYWSSDKAVDGNYDSKMVDGHCYHSKELNSTKWWLIILDSLSVVTRVVIYSRVDCCTYRTSLLSFYVXXXXXXXXXXXXXDFANVSYYPGPPPPGEFITTLNFT-RLYARTLAISKPFAEQPLNLCELEVFGYP 513
            +  ++T QN  L RG+ T +  + DN P  ++  A+DGN +S+   G C H+ E  +  WW + L    ++T V I++R DCC +R S L  ++   +  +    +     +S        GE  + L FT R+  R + ++ P + + L LCE+EV+GYP
Sbjct:   15 ISSVSTYQNVAL-RGKATQSTRLTDN-PVSAAHNAIDGNRNSEFSVGSCTHTNE-QTNPWWRVDLLQSYIITSVTIFNRGDCCQHRLSGLEIHI-GNSLNNEGLENPKVGTIS----EGRTGE--SKLTFTNRVEGRYVTLTLPGSGRILTLCEVEVYGYP 165          
BLAST of fucolectin vs. Ensembl Cavefish
Match: ENSAMXT00000008051.2 (pep primary_assembly:Astyanax_mexicanus-2.0:APWO02000995.1:49634:61503:-1 gene:ENSAMXG00000007830.2 transcript:ENSAMXT00000008051.2 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 56.6102 bits (135), Expect = 3.278e-9
Identity = 45/169 (26.63%), Postives = 70/169 (41.42%), Query Frame = 1
Query:   28 LFVFQITTAQNALLSRGRPTFAANVIDNQPYWSSDKAVDGNYDSKMVDGHCYHSKELNSTKWWLIILDSLSVVTRVVIYSRVDCCTYRTSLLSFYVXXXXXXXXXXXXXDFANVSYYPGPP--------PPGEFITTLNFTRLYARTLAISKPFAEQPLNLCELEVFGY 510
            +F +  +  +N L  RG+ T ++   D  P     KA+D N D+    G C H+  +    WW + L     +T +VI +R DCC  R      +V  +              ++   G P        P G+  T      +  R + +  P + Q L LCE+EVFGY
Sbjct:  166 VFGYHPSQVKN-LAPRGKATQSSLAFDGHP----SKAIDKNKDTNYHQGSCTHTV-IQQNPWWRVDLLDEFTITSIVITNRGDCCAGRLEGAEIHVGNSL-------------INNGNGNPRVEVIKSIPAGKSQTFHLKKEVSGRYVNLIIPGSNQILTLCEVEVFGY 315          
BLAST of fucolectin vs. Ensembl Cavefish
Match: ENSAMXT00000056118.1 (fucolectin-4-like [Source:NCBI gene;Acc:103037148])

HSP 1 Score: 52.373 bits (124), Expect = 2.184e-8
Identity = 36/126 (28.57%), Postives = 57/126 (45.24%), Query Frame = 1
Query:  133 KAVDGNYDSKMVDGHCYHSKELNSTKWWLIILDSLSVVTRVVIYSRVDCCTYRTSLLSFYVXXXXXXXXXXXXXDFANVSYYPGPPPPGEFITTLNFTRLYARTLAISKPFAEQPLNLCELEVFGY 510
             A+DGN +S   DG C H+   N+  WW + L     +T + I +R DCC  R +     V  +   + ++N+      S  PG         T   + +  R + +  P   + L LCE+EV+GY
Sbjct:   48 NAIDGNPNSNYHDGSCSHTSTQNN-PWWRVDLLYKYKITSITITNRGDCCANRINGAEIRVGNSLYNNGNSNTRVAVVSSILPGKS------VTFKLSNISGRYINVILPGYNRILTLCEVEVYGY 166          
BLAST of fucolectin vs. Ensembl Cavefish
Match: ENSAMXT00000052670.1 (fucolectin-4-like [Source:NCBI gene;Acc:103030634])

HSP 1 Score: 51.6026 bits (122), Expect = 1.077e-7
Identity = 37/127 (29.13%), Postives = 57/127 (44.88%), Query Frame = 1
Query:  133 KAVDGNYDSKMVDGHCYHSKELNSTKWWLIILDSLSVVTRVVIYSRVDCCTYRTSLLSFYVXXXXXXXXXXXXXDFANVSYYPGPPPPGEFITTLNFTRLYARTLAISKPFAEQPLNLCELEVFGYP 513
             A+DGN DS    G C  +       WW + L     +T + I +R DCC  R +    ++  +   + + N   +A V       P G+ +T    T L  R + +  P   + LN CE+EV+GYP
Sbjct:   53 NAIDGNTDSNYDHGSCT-ATTWQQNPWWRVDLLDEYTITSITITNRGDCCAERINGAEIHIGNSLVNNGNNNP--WAGVI---STIPAGKSMTFTFQTGLSGRYINVVIPGDNRLLNFCEIEVYGYP 173          
BLAST of fucolectin vs. Ensembl Cavefish
Match: ENSAMXT00000042585.1 (fucolectin-4-like [Source:NCBI gene;Acc:103030634])

HSP 1 Score: 51.6026 bits (122), Expect = 1.118e-7
Identity = 37/127 (29.13%), Postives = 57/127 (44.88%), Query Frame = 1
Query:  133 KAVDGNYDSKMVDGHCYHSKELNSTKWWLIILDSLSVVTRVVIYSRVDCCTYRTSLLSFYVXXXXXXXXXXXXXDFANVSYYPGPPPPGEFITTLNFTRLYARTLAISKPFAEQPLNLCELEVFGYP 513
             A+DGN DS    G C  +       WW + L     +T + I +R DCC  R +    ++  +   + + N   +A V       P G+ +T    T L  R + +  P   + LN CE+EV+GYP
Sbjct:   53 NAIDGNTDSNYDHGSCT-ATTWQQNPWWRVDLLDEYTITSITITNRGDCCAERINGAEIHIGNSLVNNGNNNP--WAGVI---STIPAGKSMTFTFQTGLSGRYINVVIPGDNRLLNFCEIEVYGYP 173          
BLAST of fucolectin vs. Ensembl Cavefish
Match: ENSAMXT00000054425.1 (fucolectin-4-like [Source:NCBI gene;Acc:103030634])

HSP 1 Score: 51.6026 bits (122), Expect = 1.121e-7
Identity = 37/127 (29.13%), Postives = 57/127 (44.88%), Query Frame = 1
Query:  133 KAVDGNYDSKMVDGHCYHSKELNSTKWWLIILDSLSVVTRVVIYSRVDCCTYRTSLLSFYVXXXXXXXXXXXXXDFANVSYYPGPPPPGEFITTLNFTRLYARTLAISKPFAEQPLNLCELEVFGYP 513
             A+DGN DS    G C  +       WW + L     +T + I +R DCC  R +    ++  +   + + N   +A V       P G+ +T    T L  R + +  P   + LN CE+EV+GYP
Sbjct:   53 NAIDGNTDSNYDHGSCT-ATTWQQNPWWRVDLLDEYTITSITITNRGDCCAERINGAEIHIGNSLVNNGNNNP--WAGVI---STIPAGKSMTFTFQTGLSGRYINVVIPGDNRLLNFCEIEVYGYP 173          
BLAST of fucolectin vs. Ensembl Nematostella
Match: EDO29994 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7T225])

HSP 1 Score: 53.1434 bits (126), Expect = 1.296e-8
Identity = 38/126 (30.16%), Postives = 61/126 (48.41%), Query Frame = 1
Query:  127 SDKAVDGNYDSKMVDGHCYHSKELNSTKWWLIILDSLSVVTRVVIYSRVDCCTYRTSLLSFYVXXXXXXXXXXXXXDFANVSYYPGPPPPGEFITTLNFTRLYARTLAISKPFAEQPLNLCELEVF 504
            +  AVDGN D    +  C H+    +  WW + L +   V +V I +R DCC  +  L +  +   +S + + N+N     +Y     P G+ +T      L  R ++I  P A+Q L LCE+EV+
Sbjct:  158 ASHAVDGNRDGNYGNWSCTHTN-AETNPWWRVDLGASHRVAQVFIVARSDCCGDKQELRNIVIHVGDSLANNGNTNARCGGAY---TIPQGKNLTITCSPALQGRYVSIMLPGAKQILTLCEVEVY 279          
BLAST of fucolectin vs. Ensembl Nematostella
Match: EDO25871 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7TDH1])

HSP 1 Score: 50.8322 bits (120), Expect = 1.351e-8
Identity = 41/130 (31.54%), Postives = 61/130 (46.92%), Query Frame = 1
Query:  127 SDKAVDGNYDSKMVDGHCYHSKELNSTKWWLIILDSLSVVTRVVIYSRVDCCTYRTSLLSFYVXXXXXXXXXXXXXDFANVSYYPGPPPPGEFITTLNFTRLYARTLAISKPFAEQPLNLCELEVFGYPF 516
            ++ AVDG+   +  D  C  +K + S  WW + L    V+ R+ I +R DCC  R  L +F +   +S   +   N     SY     P G   +    T L  R + I  P +++ L LCE+EV  YPF
Sbjct:    3 AEHAVDGDRSGRFADLSCTETK-VQSNPWWRVDLQKSYVILRLFIVNRADCCGER--LDNFEIRIGDSLENNGTDNPSCGSSYI---IPHGGSKSISCHTLLKGRYVNIWIPGSDRRLTLCEVEV--YPF 124          
BLAST of fucolectin vs. Ensembl Nematostella
Match: EDO34462 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SPB1])

HSP 1 Score: 49.6766 bits (117), Expect = 3.965e-8
Identity = 36/131 (27.48%), Postives = 54/131 (41.22%), Query Frame = 1
Query:  127 SDKAVDGNYDSKMVDGHCYHSKELNSTKWWLIILDSLSVVTRVVIYSRVDCCTYRTSLLSFYVXXXXXXXXXXXXXDFANVSYYPGPPPPGEFITTLN-----FTRLYARTLAISKPFAEQPLNLCELEVF 504
            ++ AVDGN + +  D  C  +K + S  WW + L    V+ R+ I +R DCC +R       +             D    +    P   G +I   N      T L  R + I  P   + L LCE+EV+
Sbjct:   11 AEHAVDGNRNGRYFDLSCTETK-VQSNPWWRVDLQKSYVILRLFIVNRADCCNHRLDNFEIRI------------GDSLENNGNDNPTCGGSYIIPKNGSIACHTLLKGRYVNIWIPGPNRLLTLCEVEVY 128          
BLAST of fucolectin vs. Ensembl Nematostella
Match: EDO33194 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SSX9])

HSP 1 Score: 49.2914 bits (116), Expect = 5.103e-8
Identity = 39/125 (31.20%), Postives = 58/125 (46.40%), Query Frame = 1
Query:  127 SDKAVDGNYDSKMVDGHCYHSKELNSTKWWLIILDSLSVVTRVVIYSRVDCCTYRTSLLSFYVXXXXXXXXXXXXXDFANVSYYPGPPPPGEFITTLNFTRLYARTLAISKPFAEQPLNLCELEV 501
            ++ AVDGN   +  D  C  +K + S  WW + L    V+ R+ I +R DCC  R  L +F +   +S   +   N     SY     P G   +    T L  R + I  P +++ L LCE+EV
Sbjct:    1 AEHAVDGNRSGRFSDLSCTETK-VQSNPWWRVDLQKSYVILRLFIVNRADCCGER--LDNFEIRIGDSLENNGTDNPSCGSSYI---IPHGGSKSISCHTLLKGRYVNIWIPGSDRRLTLCEVEV 119          
BLAST of fucolectin vs. Ensembl Nematostella
Match: EDO40750 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S6H5])

HSP 1 Score: 44.669 bits (104), Expect = 3.242e-6
Identity = 42/132 (31.82%), Postives = 56/132 (42.42%), Query Frame = 1
Query:  127 SDKAVDGNYDSKMVDGHCYHSKELNSTKWWLIILDSLSVVTRVVIYSRVDCCTYRTSLLSFYVXXXXXXXXXXXXXDFANVSYYPGPPPPGEFITTLNFTRLYARTLAISKPFAEQPLNLCELEVFGYPFIK 522
            S+ AVDGN         C  S    +  WW + L    V  R+ + +R DCC  R  L +F +   +S     N N     SY     P G   T    T L  R + I     ++ L LCE+EV  YPFI+
Sbjct:   24 SNHAVDGNRSGNYYQKSC-SSTTAQTNPWWRVDLQKSHVNLRLFVVNRADCCGER--LDNFEIRIGDSLVNDGNDNPSCGSSYI---IPQGRGNTIACHTLLKGRYVNIWIQGPDKVLTLCEVEV--YPFIE 147          
BLAST of fucolectin vs. Planmine SMEST
Match: SMESG000046841.1 (SMESG000046841.1)

HSP 1 Score: 382.104 bits (980), Expect = 2.211e-136
Identity = 198/208 (95.19%), Postives = 200/208 (96.15%), Query Frame = 1
Query:    1 VFINSSKFLLFVFQITTAQNALLSRGRPTFAANVIDNQPYWSSDKAVDGNYDSKMVDGHCYHSKELNSTKWWLIILDSLSVVTRVVIYSRVDCCTYRTSLLSFYVXXXXXXXXXXXXXDFANVSYYPGPPPPGEFITTLNFTRLYARTLAISKPFAEQPLNLCELEVFGYPFIKTMPMTFKYLRALSIYDSLGNIGTFPVLSNLDCAM 624
            VFINSSKFLLFVFQITTAQNALLSRGRPTFAANVIDNQPYWSSDKAVDGNYD  MVDGHCYHSKELNSTKWWLIILDSLSVVTRVVIYSR +CCT RTSLLSFYVSYTNSTSLSTNSNDF NVSYYPG PPPGEFITTLNFTRLYARTLAISKPFAEQP NLCELEV+GYPFIKTMPMTFKYLRALSIYDSLGNIGTFPVLSNLD AM
Sbjct:    4 VFINSSKFLLFVFQITTAQNALLSRGRPTFAANVIDNQPYWSSDKAVDGNYDGNMVDGHCYHSKELNSTKWWLIILDSLSVVTRVVIYSRTECCTQRTSLLSFYVSYTNSTSLSTNSNDFTNVSYYPGSPPPGEFITTLNFTRLYARTLAISKPFAEQPFNLCELEVYGYPFIKTMPMTFKYLRALSIYDSLGNIGTFPVLSNLDSAM 211          
BLAST of fucolectin vs. Planmine SMEST
Match: SMESG000046835.1 (SMESG000046835.1)

HSP 1 Score: 296.204 bits (757), Expect = 3.313e-100
Identity = 152/190 (80.00%), Postives = 164/190 (86.32%), Query Frame = 1
Query:   55 QNALLSRGRPTFAANVIDNQPYWSSDKAVDGNYDSKMVDGHCYHSKELNSTKWWLIILDSLSVVTRVVIYSRVDCCTYRTSLLSFYVXXXXXXXXXXXXXDFANVSYYPGPPPPGEFITTLNFTRLYARTLAISKPFAEQPLNLCELEVFGYPFIKTMPMTFKYLRALSIYDSLGNIGTFPVLSNLDCAM 624
            +N LLSR RPTFAANVI N P W+SDKAVDGNYD  M  G+CYHS+ELNSTKWWL+ILDSLSVVTRVVIYSR +CCT RTSLLSFYVSYTNSTSLSTNSNDF N+SYY GPPPPGEFITTLNFTRLY RTLAISKPF EQ LN+CELEV+GY FIK M M FKY    S+YDSLGN GTFPV SN+DCA+
Sbjct:  188 RNQLLSRSRPTFAANVIANYPLWTSDKAVDGNYDCNMHHGYCYHSEELNSTKWWLVILDSLSVVTRVVIYSRTECCTQRTSLLSFYVSYTNSTSLSTNSNDFVNISYYVGPPPPGEFITTLNFTRLYMRTLAISKPFGEQALNICELEVYGYTFIKKMSMIFKYFGRQSLYDSLGNFGTFPVQSNIDCAI 377          
BLAST of fucolectin vs. Planmine SMEST
Match: SMESG000024705.1 (SMESG000024705.1)

HSP 1 Score: 285.034 bits (728), Expect = 4.655e-98
Identity = 150/208 (72.12%), Postives = 168/208 (80.77%), Query Frame = 1
Query:    1 VFINSSKFLLFVFQITTAQNALLSRGRPTFAANVIDNQPYWSSDKAVDGNYDSKMVDGHCYHSKELNSTKWWLIILDSLSVVTRVVIYSRVDCCTYRTSLLSFYVXXXXXXXXXXXXXDFANVSYYPGPPPPGEFITTLNFTRLYARTLAISKPFAEQPLNLCELEVFGYPFIKTMPMTFKYLRALSIYDSLGNIGTFPVLSNLDCAM 624
            +FIN+   L+ + +I  A+++LLS GRPTFA N +     W+SDKAVDGNY+  M  G CYHS+  N  KWWL+ILDSLSVVT+VVIYSR DCCT RTSLLSFYVSY +STSLS N+NDF NVSYY GPPPPGEFITTLNFTRLYARTLAISKP  E  +NLCELEV+GYPF KTM MTFKY  ALSIYDSLGN GTFPV SNLDCAM
Sbjct:    4 IFINNIYLLVIIVEIIVAEDSLLSIGRPTFANNAMFP---WTSDKAVDGNYNGNMSKGSCYHSETFNYDKWWLVILDSLSVVTKVVIYSRTDCCTQRTSLLSFYVSYKSSTSLSNNNNDFVNVSYYAGPPPPGEFITTLNFTRLYARTLAISKPSLEDAINLCELEVYGYPFTKTMSMTFKYFGALSIYDSLGNFGTFPVQSNLDCAM 208          
BLAST of fucolectin vs. Planmine SMEST
Match: SMESG000024705.1 (SMESG000024705.1)

HSP 1 Score: 279.256 bits (713), Expect = 2.986e-95
Identity = 146/199 (73.37%), Postives = 162/199 (81.41%), Query Frame = 1
Query:   28 LFVFQITTAQNALLSRGRPTFAANVIDNQPYWSSDKAVDGNYDSKMVDGHCYHSKELNSTKWWLIILDSLSVVTRVVIYSRVDCCTYRTSLLSFYVXXXXXXXXXXXXXDFANVSYYPGPPPPGEFITTLNFTRLYARTLAISKPFAEQPLNLCELEVFGYPFIKTMPMTFKYLRALSIYDSLGNIGTFPVLSNLDCAM 624
            + + +I  A+++LLS GRPTFA N +     W+SDKAVDGNY+  M  G CYHS+  N  KWWL+ILDSLSVVT+VVIYSR DCCT RTSLLSFYVSY +STSLS N+NDF NVSYY GPPPPGEFITTLNFTRLYARTLAISKP  E  +NLCELEV+GYPF KTM MTFKY  ALSIYDSLGN GTFPV SNLDCAM
Sbjct:   52 VIIVEIIVAEDSLLSIGRPTFANNAMFP---WTSDKAVDGNYNGNMSKGSCYHSETFNYDKWWLVILDSLSVVTKVVIYSRTDCCTQRTSLLSFYVSYKSSTSLSNNNNDFVNVSYYAGPPPPGEFITTLNFTRLYARTLAISKPSLEDAINLCELEVYGYPFTKTMSMTFKYFGALSIYDSLGNFGTFPVQSNLDCAM 247          
BLAST of fucolectin vs. Planmine SMEST
Match: SMESG000024886.1 (SMESG000024886.1)

HSP 1 Score: 248.825 bits (634), Expect = 1.833e-83
Identity = 134/225 (59.56%), Postives = 156/225 (69.33%), Query Frame = 1
Query:    1 VFINSSKFLLFVFQITTAQ-----------------NALLSRGRPTFAANVIDNQPYWSSDKAVDGNYDSKMVDGHCYHSKELNSTKWWLIILDSLSVVTRVVIYSRVDCCTYRTSLLSFYVXXXXXXXXXXXXXDFANVSYYPGPPPPGEFITTLNFTRLYARTLAISKPFAEQPLNLCELEVFGYPFIKTMPMTFKYLRALSIYDSLGNIGTFPVLSNLDCAM 624
            +F N    L+ + +I TAQ                 + +LSRGRPTF   +I     W   KAVDGNYD    +G C+HS+  N  KWWL+ILDSLSVVT+VVIYSR DCCT RTS +SFYVSY NSTSL+ N NDF N+SYY GPPPPGE ITTLNF RLYARTLAISKP A   +NLCELEV+GYP IK+M   FKY   LS+YDSLGN+G F V+SNLDCA+
Sbjct:    4 LFKNEIYLLVIILKIITAQGNEIYFKETIYSLSFVLDLILSRGRPTFGT-IIAGYSVWEPQKAVDGNYDGNQFNGSCFHSEGPNVNKWWLVILDSLSVVTKVVIYSRTDCCTNRTSFISFYVSYKNSTSLTNNMNDFFNISYYAGPPPPGEIITTLNFKRLYARTLAISKPLAADHINLCELEVYGYPLIKSMFTLFKYFGTLSLYDSLGNVGIFTVVSNLDCAL 227          
The following BLAST results are available for this feature:
BLAST of fucolectin vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of fucolectin vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of fucolectin vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of fucolectin vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
si:ch73-359m17.22.105e-1029.01si:ch73-359m17.2 [Source:ZFIN;Acc:ZDB-GENE-141222-... [more]
si:ch73-359m17.22.961e-1029.10si:ch73-359m17.2 [Source:ZFIN;Acc:ZDB-GENE-141222-... [more]
si:ch73-359m17.21.047e-929.01si:ch73-359m17.2 [Source:ZFIN;Acc:ZDB-GENE-141222-... [more]
si:ch211-215k15.47.767e-728.65si:ch211-215k15.4 [Source:ZFIN;Acc:ZDB-GENE-131127... [more]
si:ch211-215k15.41.923e-627.95si:ch211-215k15.4 [Source:ZFIN;Acc:ZDB-GENE-131127... [more]
back to top
BLAST of fucolectin vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ncapg29.656e-1029.66non-SMC condensin II complex subunit G2 [Source:Xe... [more]
ncapg21.093e-931.91non-SMC condensin II complex subunit G2 [Source:Xe... [more]
ncapg23.652e-931.29non-SMC condensin II complex subunit G2 [Source:Xe... [more]
ncapg23.855e-931.29non-SMC condensin II complex subunit G2 [Source:Xe... [more]
fucolectin1.282e-828.24x-epilectin [Source:NCBI gene;Acc:100144955][more]
back to top
BLAST of fucolectin vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of fucolectin vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 3
Match NameE-valueIdentityDescription
sp|Q9I929|FUCL3_ANGJA1.979e-735.37Fucolectin-3 OS=Anguilla japonica OX=7937 PE=2 SV=... [more]
sp|Q9I925|FUCL7_ANGJA2.379e-729.33Fucolectin-7 OS=Anguilla japonica OX=7937 PE=2 SV=... [more]
sp|Q7SIC1|FUCL_ANGAN3.789e-634.15Fucolectin OS=Anguilla anguilla OX=7936 PE=1 SV=1[more]
back to top
BLAST of fucolectin vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A1S3KEU65.644e-1530.32fucolectin OS=Lingula unguis OX=7574 GN=LOC1061813... [more]
A0A3Q4HN981.251e-1331.06Si:ch211-215k15.4 OS=Neolamprologus brichardi OX=3... [more]
A0A1S3HEB91.045e-1230.73fucolectin-like OS=Lingula unguis OX=7574 GN=LOC10... [more]
A0A3P8NS801.479e-1231.06Si:ch211-215k15.4 OS=Astatotilapia calliptera OX=8... [more]
A0A3P9BXB61.479e-1231.06Si:ch211-215k15.4 OS=Maylandia zebra OX=106582 PE=... [more]
back to top
BLAST of fucolectin vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ENSAMXT00000008051.23.278e-926.63pep primary_assembly:Astyanax_mexicanus-2.0:APWO02... [more]
ENSAMXT00000056118.12.184e-828.57fucolectin-4-like [Source:NCBI gene;Acc:103037148][more]
ENSAMXT00000052670.11.077e-729.13fucolectin-4-like [Source:NCBI gene;Acc:103030634][more]
ENSAMXT00000042585.11.118e-729.13fucolectin-4-like [Source:NCBI gene;Acc:103030634][more]
ENSAMXT00000054425.11.121e-729.13fucolectin-4-like [Source:NCBI gene;Acc:103030634][more]
back to top
BLAST of fucolectin vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of fucolectin vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of fucolectin vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
EDO299941.296e-830.16Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO258711.351e-831.54Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO344623.965e-827.48Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO331945.103e-831.20Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO407503.242e-631.82Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of fucolectin vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of fucolectin vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000046841.12.211e-13695.19SMESG000046841.1[more]
SMESG000046835.13.313e-10080.00SMESG000046835.1[more]
SMESG000024705.14.655e-9872.12SMESG000024705.1[more]
SMESG000024705.12.986e-9573.37SMESG000024705.1[more]
SMESG000024886.11.833e-8359.56SMESG000024886.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30015677 ID=SMED30015677|Name=fucolectin|organism=Schmidtea mediterranea sexual|type=transcript|length=624bp
GTCTTCATTAATTCAAGCAAATTTTTGCTTTTTGTTTTTCAAATAACTAC
GGCACAAAATGCCCTTTTATCAAGAGGCCGACCGACCTTTGCGGCTAACG
TTATTGATAACCAACCGTATTGGTCAAGTGATAAAGCGGTGGATGGGAAT
TATGATAGCAAGATGGTTGACGGACATTGCTATCATAGCAAAGAATTAAA
TTCCACAAAATGGTGGCTCATCATTCTTGATTCTTTGTCCGTTGTTACAA
GGGTTGTCATTTACAGTCGGGTTGACTGCTGTACCTATAGAACAAGTCTC
CTCTCGTTCTATGTCAGCTATACAAACTCAACGTCCCTCTCTACAAATTC
TAATGATTTCGCTAATGTTTCATATTACCCGGGACCTCCACCACCGGGTG
AATTCATTACCACTCTGAATTTTACGAGATTATATGCAAGAACTCTAGCT
ATATCCAAACCTTTTGCGGAGCAACCTCTCAACCTCTGTGAACTAGAGGT
GTTTGGCTATCCGTTCATTAAAACAATGCCCATGACATTCAAATATTTAA
GGGCTCTGTCAATCTACGATAGCCTAGGAAATATCGGAACATTTCCGGTC
CTGTCAAATCTTGATTGCGCAATG
back to top

protein sequence of SMED30015677-orf-1

>SMED30015677-orf-1 ID=SMED30015677-orf-1|Name=SMED30015677-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=208bp
VFINSSKFLLFVFQITTAQNALLSRGRPTFAANVIDNQPYWSSDKAVDGN
YDSKMVDGHCYHSKELNSTKWWLIILDSLSVVTRVVIYSRVDCCTYRTSL
LSFYVSYTNSTSLSTNSNDFANVSYYPGPPPPGEFITTLNFTRLYARTLA
ISKPFAEQPLNLCELEVFGYPFIKTMPMTFKYLRALSIYDSLGNIGTFPV
LSNLDCAM
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000025nervous system
PLANA:0000099neuron
PLANA:0000418head
PLANA:0000464GABAergic neuron
Vocabulary: INTERPRO
TermDefinition
IPR008979Galactose-bd-like_sf
Vocabulary: molecular function
TermDefinition
GO:0046872metal ion binding
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR008979Galactose-binding-like domain superfamilyGENE3DG3DSA:2.60.120.260coord: 14..171
e-value: 2.5E-24
score: 87.8
IPR008979Galactose-binding-like domain superfamilySUPERFAMILYSSF49785Galactose-binding domain-likecoord: 17..171
NoneNo IPR availablePANTHERPTHR45713:SF6SI:CABZ01040626.2-RELATEDcoord: 26..170
NoneNo IPR availablePANTHERPTHR45713FAMILY NOT NAMEDcoord: 26..170
NoneNo IPR availableSIGNALP_EUKSignalP-noTMSignalP-noTMcoord: 1..18
score: 0.547