TAR DNA-binding protein 43

Overview
NameTAR DNA-binding protein 43
Smed IDSMED30015674
Length (bp)4210
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of TAR DNA-binding protein 43 (SMED30015674) t-SNE clustered cells

Violin plots show distribution of expression levels for TAR DNA-binding protein 43 (SMED30015674) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of TAR DNA-binding protein 43 (SMED30015674) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for TAR DNA-binding protein 43 (SMED30015674) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30015674

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 1

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
X2 cellSMED30015674h1SMcG0016521 SmedASXL_014553SmedAsxl_ww_GCZZ01PMID:26114597
Zhu et al., 2015
FACS sorted cell population asexual adult RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of TAR DNA-binding protein 43 vs. Ensembl Human
Match: TARDBP (TAR DNA binding protein [Source:HGNC Symbol;Acc:HGNC:11571])

HSP 1 Score: 251.521 bits (641), Expect = 6.278e-73
Identity = 121/249 (48.59%), Postives = 167/249 (67.07%), Query Frame = 3
Query:  144 DDTVLLTTLGGIFPNVCGLKYRAPETNTFRALKLSDGKFYKPVEGWEDLKFYCVFPKDNNKRKIDEEIEKPLQKSKRLEGRKCTDLIVLNLGWKVDEETLRKYFSKFGELVLVQVKKDRETSHSKGYAFIRFADYAAQVLCLAEKHLIDGRWCAVKVPFSKNEADKQEISKKIHVGYASEEISMEDLRIAFEQYGYVTDIFIPKPFRNFAFVTFDSSDTAQSLIGQSININGITLTIGSAVPKINSNRK 890
            D TVLL+T+   FP  CGL+YR P +   R ++L +G  + P  GW +L +   +PKDN KRK+DE       K KR   +K +DLIVL L WK  E+ L++YFS FGE+++VQVKKD +T HSKG+ F+RF +Y  QV  ++++H+IDGRWC  K+P SK   D+   S+K+ VG  +E+++ ++LR  F QYG V D+FIPKPFR FAFVTF     AQSL G+ + I GI++ I +A PK NSNR+
Sbjct:   23 DGTVLLSTVTAQFPGACGLRYRNPVSQCMRGVRLVEGILHAPDAGWGNLVYVVNYPKDN-KRKMDETDASSAVKVKRAV-QKTSDLIVLGLPWKTTEQDLKEYFSTFGEVLMVQVKKDLKTGHSKGFGFVRFTEYETQVKVMSQRHMIDGRWCDCKLPNSKQSQDEPLRSRKVFVGRCTEDMTEDELREFFSQYGDVMDVFIPKPFRAFAFVTFADDQIAQSLCGEDLIIKGISVHISNAEPKHNSNRQ 269          

HSP 2 Score: 80.1073 bits (196), Expect = 7.960e-15
Identity = 35/81 (43.21%), Postives = 55/81 (67.90%), Query Frame = -2
Query: 3904 TKKIHVSYSAEELEMEDLRKAFEEYGYVVDIFIPKPFRNFAFVTFELSEVAQQLIGRCVTVKGHTLTIGSAVPKITGNKKL 4146
            ++K+ V    E++  ++LR+ F +YG V+D+FIPKPFR FAFVTF   ++AQ L G  + +KG ++ I +A PK   N++L
Sbjct:  190 SRKVFVGRCTEDMTEDELREFFSQYGDVMDVFIPKPFRAFAFVTFADDQIAQSLCGEDLIIKGISVHISNAEPKHNSNRQL 270          
BLAST of TAR DNA-binding protein 43 vs. Ensembl Human
Match: TARDBP (TAR DNA binding protein [Source:HGNC Symbol;Acc:HGNC:11571])

HSP 1 Score: 251.521 bits (641), Expect = 6.278e-73
Identity = 121/249 (48.59%), Postives = 167/249 (67.07%), Query Frame = 3
Query:  144 DDTVLLTTLGGIFPNVCGLKYRAPETNTFRALKLSDGKFYKPVEGWEDLKFYCVFPKDNNKRKIDEEIEKPLQKSKRLEGRKCTDLIVLNLGWKVDEETLRKYFSKFGELVLVQVKKDRETSHSKGYAFIRFADYAAQVLCLAEKHLIDGRWCAVKVPFSKNEADKQEISKKIHVGYASEEISMEDLRIAFEQYGYVTDIFIPKPFRNFAFVTFDSSDTAQSLIGQSININGITLTIGSAVPKINSNRK 890
            D TVLL+T+   FP  CGL+YR P +   R ++L +G  + P  GW +L +   +PKDN KRK+DE       K KR   +K +DLIVL L WK  E+ L++YFS FGE+++VQVKKD +T HSKG+ F+RF +Y  QV  ++++H+IDGRWC  K+P SK   D+   S+K+ VG  +E+++ ++LR  F QYG V D+FIPKPFR FAFVTF     AQSL G+ + I GI++ I +A PK NSNR+
Sbjct:   23 DGTVLLSTVTAQFPGACGLRYRNPVSQCMRGVRLVEGILHAPDAGWGNLVYVVNYPKDN-KRKMDETDASSAVKVKRAV-QKTSDLIVLGLPWKTTEQDLKEYFSTFGEVLMVQVKKDLKTGHSKGFGFVRFTEYETQVKVMSQRHMIDGRWCDCKLPNSKQSQDEPLRSRKVFVGRCTEDMTEDELREFFSQYGDVMDVFIPKPFRAFAFVTFADDQIAQSLCGEDLIIKGISVHISNAEPKHNSNRQ 269          

HSP 2 Score: 80.1073 bits (196), Expect = 7.960e-15
Identity = 35/81 (43.21%), Postives = 55/81 (67.90%), Query Frame = -2
Query: 3904 TKKIHVSYSAEELEMEDLRKAFEEYGYVVDIFIPKPFRNFAFVTFELSEVAQQLIGRCVTVKGHTLTIGSAVPKITGNKKL 4146
            ++K+ V    E++  ++LR+ F +YG V+D+FIPKPFR FAFVTF   ++AQ L G  + +KG ++ I +A PK   N++L
Sbjct:  190 SRKVFVGRCTEDMTEDELREFFSQYGDVMDVFIPKPFRAFAFVTFADDQIAQSLCGEDLIIKGISVHISNAEPKHNSNRQL 270          
BLAST of TAR DNA-binding protein 43 vs. Ensembl Human
Match: TARDBP (TAR DNA binding protein [Source:HGNC Symbol;Acc:HGNC:11571])

HSP 1 Score: 246.899 bits (629), Expect = 7.571e-73
Identity = 121/249 (48.59%), Postives = 167/249 (67.07%), Query Frame = 3
Query:  144 DDTVLLTTLGGIFPNVCGLKYRAPETNTFRALKLSDGKFYKPVEGWEDLKFYCVFPKDNNKRKIDEEIEKPLQKSKRLEGRKCTDLIVLNLGWKVDEETLRKYFSKFGELVLVQVKKDRETSHSKGYAFIRFADYAAQVLCLAEKHLIDGRWCAVKVPFSKNEADKQEISKKIHVGYASEEISMEDLRIAFEQYGYVTDIFIPKPFRNFAFVTFDSSDTAQSLIGQSININGITLTIGSAVPKINSNRK 890
            D TVLL+T+   FP  CGL+YR P +   R ++L +G  + P  GW +L +   +PKDN KRK+DE       K KR   +K +DLIVL L WK  E+ L++YFS FGE+++VQVKKD +T HSKG+ F+RF +Y  QV  ++++H+IDGRWC  K+P SK   D+   S+K+ VG  +E+++ ++LR  F QYG V D+FIPKPFR FAFVTF     AQSL G+ + I GI++ I +A PK NSNR+
Sbjct:   23 DGTVLLSTVTAQFPGACGLRYRNPVSQCMRGVRLVEGILHAPDAGWGNLVYVVNYPKDN-KRKMDETDASSAVKVKRAV-QKTSDLIVLGLPWKTTEQDLKEYFSTFGEVLMVQVKKDLKTGHSKGFGFVRFTEYETQVKVMSQRHMIDGRWCDCKLPNSKQSQDEPLRSRKVFVGRCTEDMTEDELREFFSQYGDVMDVFIPKPFRAFAFVTFADDQIAQSLCGEDLIIKGISVHISNAEPKHNSNRQ 269          

HSP 2 Score: 78.9518 bits (193), Expect = 4.894e-15
Identity = 36/87 (41.38%), Postives = 57/87 (65.52%), Query Frame = -2
Query: 3886 TKKIHVSYSAEELEMEDLRKAFEEYGYVVDIFIPKPFRNFAFVTFELSEVAQQLIGRCVTVKGHTLTIGSAVPKITGNKKLPIPAQF 4146
            ++K+ V    E++  ++LR+ F +YG V+D+FIPKPFR FAFVTF   ++AQ L G  + +KG ++ I +A PK   N++L    +F
Sbjct:  190 SRKVFVGRCTEDMTEDELREFFSQYGDVMDVFIPKPFRAFAFVTFADDQIAQSLCGEDLIIKGISVHISNAEPKHNSNRQLERSGRF 276          
BLAST of TAR DNA-binding protein 43 vs. Ensembl Human
Match: TARDBP (TAR DNA binding protein [Source:HGNC Symbol;Acc:HGNC:11571])

HSP 1 Score: 246.899 bits (629), Expect = 7.571e-73
Identity = 121/249 (48.59%), Postives = 167/249 (67.07%), Query Frame = 3
Query:  144 DDTVLLTTLGGIFPNVCGLKYRAPETNTFRALKLSDGKFYKPVEGWEDLKFYCVFPKDNNKRKIDEEIEKPLQKSKRLEGRKCTDLIVLNLGWKVDEETLRKYFSKFGELVLVQVKKDRETSHSKGYAFIRFADYAAQVLCLAEKHLIDGRWCAVKVPFSKNEADKQEISKKIHVGYASEEISMEDLRIAFEQYGYVTDIFIPKPFRNFAFVTFDSSDTAQSLIGQSININGITLTIGSAVPKINSNRK 890
            D TVLL+T+   FP  CGL+YR P +   R ++L +G  + P  GW +L +   +PKDN KRK+DE       K KR   +K +DLIVL L WK  E+ L++YFS FGE+++VQVKKD +T HSKG+ F+RF +Y  QV  ++++H+IDGRWC  K+P SK   D+   S+K+ VG  +E+++ ++LR  F QYG V D+FIPKPFR FAFVTF     AQSL G+ + I GI++ I +A PK NSNR+
Sbjct:   23 DGTVLLSTVTAQFPGACGLRYRNPVSQCMRGVRLVEGILHAPDAGWGNLVYVVNYPKDN-KRKMDETDASSAVKVKRAV-QKTSDLIVLGLPWKTTEQDLKEYFSTFGEVLMVQVKKDLKTGHSKGFGFVRFTEYETQVKVMSQRHMIDGRWCDCKLPNSKQSQDEPLRSRKVFVGRCTEDMTEDELREFFSQYGDVMDVFIPKPFRAFAFVTFADDQIAQSLCGEDLIIKGISVHISNAEPKHNSNRQ 269          

HSP 2 Score: 78.9518 bits (193), Expect = 4.894e-15
Identity = 36/87 (41.38%), Postives = 57/87 (65.52%), Query Frame = -2
Query: 3886 TKKIHVSYSAEELEMEDLRKAFEEYGYVVDIFIPKPFRNFAFVTFELSEVAQQLIGRCVTVKGHTLTIGSAVPKITGNKKLPIPAQF 4146
            ++K+ V    E++  ++LR+ F +YG V+D+FIPKPFR FAFVTF   ++AQ L G  + +KG ++ I +A PK   N++L    +F
Sbjct:  190 SRKVFVGRCTEDMTEDELREFFSQYGDVMDVFIPKPFRAFAFVTFADDQIAQSLCGEDLIIKGISVHISNAEPKHNSNRQLERSGRF 276          
BLAST of TAR DNA-binding protein 43 vs. Ensembl Human
Match: AL109811.3 (novel protein)

HSP 1 Score: 246.899 bits (629), Expect = 7.571e-73
Identity = 121/249 (48.59%), Postives = 167/249 (67.07%), Query Frame = 3
Query:  144 DDTVLLTTLGGIFPNVCGLKYRAPETNTFRALKLSDGKFYKPVEGWEDLKFYCVFPKDNNKRKIDEEIEKPLQKSKRLEGRKCTDLIVLNLGWKVDEETLRKYFSKFGELVLVQVKKDRETSHSKGYAFIRFADYAAQVLCLAEKHLIDGRWCAVKVPFSKNEADKQEISKKIHVGYASEEISMEDLRIAFEQYGYVTDIFIPKPFRNFAFVTFDSSDTAQSLIGQSININGITLTIGSAVPKINSNRK 890
            D TVLL+T+   FP  CGL+YR P +   R ++L +G  + P  GW +L +   +PKDN KRK+DE       K KR   +K +DLIVL L WK  E+ L++YFS FGE+++VQVKKD +T HSKG+ F+RF +Y  QV  ++++H+IDGRWC  K+P SK   D+   S+K+ VG  +E+++ ++LR  F QYG V D+FIPKPFR FAFVTF     AQSL G+ + I GI++ I +A PK NSNR+
Sbjct:   23 DGTVLLSTVTAQFPGACGLRYRNPVSQCMRGVRLVEGILHAPDAGWGNLVYVVNYPKDN-KRKMDETDASSAVKVKRAV-QKTSDLIVLGLPWKTTEQDLKEYFSTFGEVLMVQVKKDLKTGHSKGFGFVRFTEYETQVKVMSQRHMIDGRWCDCKLPNSKQSQDEPLRSRKVFVGRCTEDMTEDELREFFSQYGDVMDVFIPKPFRAFAFVTFADDQIAQSLCGEDLIIKGISVHISNAEPKHNSNRQ 269          

HSP 2 Score: 78.9518 bits (193), Expect = 4.894e-15
Identity = 36/87 (41.38%), Postives = 57/87 (65.52%), Query Frame = -2
Query: 3886 TKKIHVSYSAEELEMEDLRKAFEEYGYVVDIFIPKPFRNFAFVTFELSEVAQQLIGRCVTVKGHTLTIGSAVPKITGNKKLPIPAQF 4146
            ++K+ V    E++  ++LR+ F +YG V+D+FIPKPFR FAFVTF   ++AQ L G  + +KG ++ I +A PK   N++L    +F
Sbjct:  190 SRKVFVGRCTEDMTEDELREFFSQYGDVMDVFIPKPFRAFAFVTFADDQIAQSLCGEDLIIKGISVHISNAEPKHNSNRQLERSGRF 276          
BLAST of TAR DNA-binding protein 43 vs. Ensembl Celegans
Match: tdp-1 (Tar DNA-binding protein homolog 1 [Source:UniProtKB/Swiss-Prot;Acc:D0VWM8])

HSP 1 Score: 143.28 bits (360), Expect = 2.881e-36
Identity = 86/282 (30.50%), Postives = 145/282 (51.42%), Query Frame = 3
Query:  144 DDTVLLTTLGGIFPNVCGLKYRAPETNTFRALKL--SDGKFYKPVEGWEDLKFYCVFPKDNNKRKIDEEIEKPLQKSKRL-----------------------EGRKCTDLIVLNLGWKVDEETLRKYFSKFGELVLVQVKKDRETSHSKGYAFIRFADYAAQVLCLA-EKHLIDGRWCAVKVPFSKNEADKQEISKKIHVGYASEEISMEDLRIAFE-------QYGYVTDIFIPKPFRNFAFVTFDSSDTAQSLIGQ-SININGITLTIGSAVPKINSNR 887
            D  VL+TTL   FP   GLKY+ P+T   RA+++  S  K   P +GWE+  F+ +    + + +     +    K +++                          +  DLIVL + +K  +E  +KYF   G +V  ++K+ +   +SKG+ F+R +    Q   LA  +H+IDGR C VKVP  +++  +  IS+ I VG  ++++    LR  F        +   VTD+FIPKPFR FAFVT  S++ A+ ++ + S+ +NG+++ +  A P+  +N+
Sbjct:   65 DGVVLMTTLQASFPGATGLKYKNPKTGANRAVQVDPSGLKLIAPADGWENKTFFVIVAPQSERVRALSSADATSAKRRKVGSSDDSDSDDGRDGRSGRKRAVERDSQPVDLIVLGVDFKTTDECFQKYFEDIGTVVFCEIKR-KSDGNSKGFGFVRMSSVGEQNKVLAIPQHMIDGRRCDVKVPDGRDKQGRPSISR-IFVGRLTDKVDEHQLRKVFGDEAKSYIETAVVTDVFIPKPFRGFAFVTLSSAEAAERIVSKGSLTVNGLSVGLSIAQPREENNQ 344          

HSP 2 Score: 52.7582 bits (125), Expect = 1.361e-6
Identity = 29/87 (33.33%), Postives = 48/87 (55.17%), Query Frame = -2
Query: 3904 KIHVSYSAEELEMEDLRKAFE-------EYGYVVDIFIPKPFRNFAFVTFELSEVAQQLIGR-CVTVKGHTLTIGSAVPKITGNKKL 4140
            +I V    ++++   LRK F        E   V D+FIPKPFR FAFVT   +E A++++ +  +TV G ++ +  A P+   N+ +
Sbjct:  260 RIFVGRLTDKVDEHQLRKVFGDEAKSYIETAVVTDVFIPKPFRGFAFVTLSSAEAAERIVSKGSLTVNGLSVGLSIAQPREENNQSV 346          
BLAST of TAR DNA-binding protein 43 vs. Ensembl Celegans
Match: tdp-1 (Tar DNA-binding protein homolog 1 [Source:UniProtKB/Swiss-Prot;Acc:D0VWM8])

HSP 1 Score: 142.895 bits (359), Expect = 4.701e-36
Identity = 89/285 (31.23%), Postives = 146/285 (51.23%), Query Frame = 3
Query:  144 DDTVLLTTLGGIFPNVCGLKYRAPETNTFRALKL--SDGKFYKPVEGWEDLKFYCVFPKDNNKRKIDEEIEKPLQKSKRL-----------------------EGRKCTDLIVLNLGWKVDEETLRKYFSKFGELVLVQVKKDRETSHSKGYAFIRFADYAAQVLCLA-EKHLIDGRWCAVKVPFSKNEADKQ---EISKKIHVGYASEEISMEDLRIAFE-------QYGYVTDIFIPKPFRNFAFVTFDSSDTAQSLIGQ-SININGITLTIGSAVPKINSNR 887
            D  VL+TTL   FP   GLKY+ P+T   RA+++  S  K   P +GWE+  F+ +    + + +     +    K +++                          +  DLIVL + +K  +E  +KYF   G +V  ++K+ +   +SKG+ F+R +    Q   LA  +H+IDGR C VKVP  ++  DKQ    IS+ I VG  ++++    LR  F        +   VTD+FIPKPFR FAFVT  S++ A+ ++ + S+ +NG+++ +  A P+  +N+
Sbjct:   65 DGVVLMTTLQASFPGATGLKYKNPKTGANRAVQVDPSGLKLIAPADGWENKTFFVIVAPQSERVRALSSADATSAKRRKVGSSDDSDSDDGRDGRSGRKRAVERDSQPVDLIVLGVDFKTTDECFQKYFEDIGTVVFCEIKR-KSDGNSKGFGFVRMSSVGEQNKVLAIPQHMIDGRRCDVKVPDGRSLQDKQGRPSISR-IFVGRLTDKVDEHQLRKVFGDEAKSYIETAVVTDVFIPKPFRGFAFVTLSSAEAAERIVSKGSLTVNGLSVGLSIAQPREENNQ 347          

HSP 2 Score: 52.7582 bits (125), Expect = 1.347e-6
Identity = 29/87 (33.33%), Postives = 48/87 (55.17%), Query Frame = -2
Query: 3904 KIHVSYSAEELEMEDLRKAFE-------EYGYVVDIFIPKPFRNFAFVTFELSEVAQQLIGR-CVTVKGHTLTIGSAVPKITGNKKL 4140
            +I V    ++++   LRK F        E   V D+FIPKPFR FAFVT   +E A++++ +  +TV G ++ +  A P+   N+ +
Sbjct:  263 RIFVGRLTDKVDEHQLRKVFGDEAKSYIETAVVTDVFIPKPFRGFAFVTLSSAEAAERIVSKGSLTVNGLSVGLSIAQPREENNQSV 349          
BLAST of TAR DNA-binding protein 43 vs. Ensembl Celegans
Match: msi-1 (MuSashI (Fly neural) family; Neural RNA-binding protein MSI-1 [Source:UniProtKB/TrEMBL;Acc:G5EFS2])

HSP 1 Score: 84.3445 bits (207), Expect = 4.699e-17
Identity = 54/166 (32.53%), Postives = 82/166 (49.40%), Query Frame = 3
Query:  399 LIVLNLGWKVDEETLRKYFSKFGELVLVQVKKDRETSHSKGYAFIRFADYAAQVLCLAEK-HLIDGRWCAVKVPFSK-NEADKQEISKKIHVGYASEEISMEDLRIAFEQYGYVTDIFI-----PKPFRNFAFVTFDSSDTAQSLIGQSIN-INGITLTIGSAVPK 872
            + +  L W+   E LR YF +FGE+    V +D  T  ++G+ FI F D ++    L  + H +DG+    KV F K  +A     +KK+ +G  S   ++ED++  FE YG V D  +      +  R F FVTFDS + A  +     + ING  +    A PK
Sbjct:   47 MFIGGLSWQTTAENLRDYFGRFGEVNECMVMRDPATKRARGFGFITFVDPSSVDKVLNNREHELDGKKIDPKVAFPKRTQAKLVTKTKKVFIGGLSATSTLEDMKQYFETYGKVEDAMLMFDKATQRHRGFGFVTFDSDEVADKVCEIHFHEINGKMVECKKAQPK 212          
BLAST of TAR DNA-binding protein 43 vs. Ensembl Celegans
Match: sqd-1 (Homologous to Drosophila SQD (Squid) protein [Source:UniProtKB/TrEMBL;Acc:Q8MXR6])

HSP 1 Score: 81.2629 bits (199), Expect = 3.638e-16
Identity = 55/173 (31.79%), Postives = 84/173 (48.55%), Query Frame = 3
Query:  375 LEGRKCTDLIVLNLGWKVDEETLRKYFSKFGELVLVQVKKDRETSHSKGYAFIRFADYAAQVLCLAEK-HLIDGRWCAVKVPFSKNEADKQEISKKIHVGYASEEISMEDLRIAFEQYGYVTDIFIP-----KPFRNFAFVTFDSSDTAQSLIGQSININGI-TLTIGSAVPK 872
             +G +   + V  +  +V+ E L  +F+++GE+   QVK DR    S+G+AF+ F       L LA +   I G+   VK   S+        +KK+ VG    + S +DLR  FEQ+G V DI  P     K  RNFAF+ F+  ++A     Q+    G     +  AVP+
Sbjct:   23 TKGNEDKKIFVGGISPEVNNEDLSSHFTQYGEVAQAQVKYDRTNGRSRGFAFVEFTTGEGCKLALAAREQTIKGKSVEVKPAKSRE-------NKKVFVGGLPSDYSEQDLRSHFEQFGKVDDIEWPFDKQTKARRNFAFIVFEEEESADKASSQTKQTFGTRECDVKKAVPQ 188          
BLAST of TAR DNA-binding protein 43 vs. Ensembl Celegans
Match: sqd-1 (Homologous to Drosophila SQD (Squid) protein [Source:UniProtKB/TrEMBL;Acc:Q8MXR6])

HSP 1 Score: 81.2629 bits (199), Expect = 3.638e-16
Identity = 55/173 (31.79%), Postives = 84/173 (48.55%), Query Frame = 3
Query:  375 LEGRKCTDLIVLNLGWKVDEETLRKYFSKFGELVLVQVKKDRETSHSKGYAFIRFADYAAQVLCLAEK-HLIDGRWCAVKVPFSKNEADKQEISKKIHVGYASEEISMEDLRIAFEQYGYVTDIFIP-----KPFRNFAFVTFDSSDTAQSLIGQSININGI-TLTIGSAVPK 872
             +G +   + V  +  +V+ E L  +F+++GE+   QVK DR    S+G+AF+ F       L LA +   I G+   VK   S+        +KK+ VG    + S +DLR  FEQ+G V DI  P     K  RNFAF+ F+  ++A     Q+    G     +  AVP+
Sbjct:   23 TKGNEDKKIFVGGISPEVNNEDLSSHFTQYGEVAQAQVKYDRTNGRSRGFAFVEFTTGEGCKLALAAREQTIKGKSVEVKPAKSRE-------NKKVFVGGLPSDYSEQDLRSHFEQFGKVDDIEWPFDKQTKARRNFAFIVFEEEESADKASSQTKQTFGTRECDVKKAVPQ 188          
BLAST of TAR DNA-binding protein 43 vs. Ensembl Fly
Match: TBPH (gene:FBgn0025790 transcript:FBtr0089626)

HSP 1 Score: 250.366 bits (638), Expect = 5.843e-74
Identity = 121/251 (48.21%), Postives = 170/251 (67.73%), Query Frame = 3
Query:  144 DDTVLLTTLGGIFPNVCGLKYRAPETNTFRALKLSDGKFYKP-VE-GWEDLKFYCVFPKDNNKRKIDEEIEKPLQKSKRLEGR-KCTDLIVLNLGWKVDEETLRKYFSKFGELVLVQVKKDRETSHSKGYAFIRFADYAAQVLCLAEKHLIDGRWCAVKVPFSKNEADKQEISKKIHVGYASEEISMEDLRIAFEQYGYVTDIFIPKPFRNFAFVTFDSSDTAQSLIGQSININGITLTIGSAVPKINSNR 887
            D T+LL+TL   FP  CGLKYR  +T   R ++ ++G+ + P VE GW +  ++CVFPK+N KRK D+ +E    K+KR+E R +CTDLIVL L WK  EE+LR+YF  +GE+++ Q+KKD ++  SKG+ F+RF  Y AQ+  L  +HLIDGRWC VKVP SK      ++  K+ VG  +E+I+ +DLR  F ++G VTD+FIP+PFR F+FVTF   D AQSL G+   I G+++ + +A PK   NR
Sbjct:   22 DGTLLLSTLQAQFPGSCGLKYRNLDTKAVRGVRSNEGRLFPPSVESGWGEYAYFCVFPKEN-KRKSDDNLENSTAKTKRIETRLRCTDLIVLGLPWKTTEESLREYFETYGEVLMAQIKKDTKSGQSKGFGFVRFGSYDAQMRVLTNRHLIDGRWCEVKVPNSKGMG--HQVPCKVFVGRCTEDINSDDLREYFSKFGEVTDVFIPRPFRAFSFVTFLDPDVAQSLCGEDHIIKGVSVHVSNAAPKAEQNR 269          

HSP 2 Score: 76.6406 bits (187), Expect = 2.449e-14
Identity = 43/131 (32.82%), Postives = 70/131 (53.44%), Query Frame = -2
Query: 3778 QEITKKIHVSYSAEELEMEDLRKAFEEYGYVVDIFIPKPFRNFAFVTFELSEVAQQLIGRCVTVKGHTLTIGSAVPKITGNKKLPIPAQFPICPYNEQGPMTAGRYGWSSYEPA-----PMQSSRYKARQF 4155
             ++  K+ V    E++  +DLR+ F ++G V D+FIP+PFR F+FVTF   +VAQ L G    +KG ++ + +A PK   N+   + +      YN     +A  +G  SY P      P ++  ++ RQF
Sbjct:  188 HQVPCKVFVGRCTEDINSDDLREYFSKFGEVTDVFIPRPFRAFSFVTFLDPDVAQSLCGEDHIIKGVSVHVSNAAPKAEQNRNQQVQS------YNYN---SANSFGMHSYHPQGNHMNPGRNGHHRGRQF 309          
BLAST of TAR DNA-binding protein 43 vs. Ensembl Fly
Match: TBPH (gene:FBgn0025790 transcript:FBtr0089625)

HSP 1 Score: 254.988 bits (650), Expect = 4.365e-73
Identity = 121/252 (48.02%), Postives = 170/252 (67.46%), Query Frame = 3
Query:  144 DDTVLLTTLGGIFPNVCGLKYRAPETNTFRALKLSDGKFYKP-VE-GWEDLKFYCVFPKDNNKRKIDEEIEKPLQKSKRLEGR-KCTDLIVLNLGWKVDEETLRKYFSKFGELVLVQVKKDRETSHSKGYAFIRFADYAAQVLCLAEKHLIDGRWCAVKVPFSKNEADKQEISKKIHVGYASEEISMEDLRIAFEQYGYVTDIFIPKPFRNFAFVTFDSSDTAQSLIGQSININGITLTIGSAVPKINSNRK 890
            D T+LL+TL   FP  CGLKYR  +T   R ++ ++G+ + P VE GW +  ++CVFPK+N KRK D+ +E    K+KR+E R +CTDLIVL L WK  EE+LR+YF  +GE+++ Q+KKD ++  SKG+ F+RF  Y AQ+  L  +HLIDGRWC VKVP SK      ++  K+ VG  +E+I+ +DLR  F ++G VTD+FIP+PFR F+FVTF   D AQSL G+   I G+++ + +A PK   NR 
Sbjct:   22 DGTLLLSTLQAQFPGSCGLKYRNLDTKAVRGVRSNEGRLFPPSVESGWGEYAYFCVFPKEN-KRKSDDNLENSTAKTKRIETRLRCTDLIVLGLPWKTTEESLREYFETYGEVLMAQIKKDTKSGQSKGFGFVRFGSYDAQMRVLTNRHLIDGRWCEVKVPNSKGMG--HQVPCKVFVGRCTEDINSDDLREYFSKFGEVTDVFIPRPFRAFSFVTFLDPDVAQSLCGEDHIIKGVSVHVSNAAPKAEQNRN 270          

HSP 2 Score: 75.485 bits (184), Expect = 2.055e-13
Identity = 41/120 (34.17%), Postives = 65/120 (54.17%), Query Frame = -2
Query: 3835 SEADKQEITKKIHVSYSAEELEMEDLRKAFEEYGYVVDIFIPKPFRNFAFVTFELSEVAQQLIGRCVTVKGHTLTIGSAVPKITGNKKLPIPA-------QFPICPYNEQGP-MTAGRYG 4170
            S+    ++  K+ V    E++  +DLR+ F ++G V D+FIP+PFR F+FVTF   +VAQ L G    +KG ++ + +A PK   N+   + +        F +  Y+ QG  M  GR G
Sbjct:  183 SKGMGHQVPCKVFVGRCTEDINSDDLREYFSKFGEVTDVFIPRPFRAFSFVTFLDPDVAQSLCGEDHIIKGVSVHVSNAAPKAEQNRNQQVQSYNYNSANSFGMHSYHPQGNHMNPGRNG 302          
BLAST of TAR DNA-binding protein 43 vs. Ensembl Fly
Match: TBPH (gene:FBgn0025790 transcript:FBtr0089624)

HSP 1 Score: 254.988 bits (650), Expect = 4.365e-73
Identity = 121/252 (48.02%), Postives = 170/252 (67.46%), Query Frame = 3
Query:  144 DDTVLLTTLGGIFPNVCGLKYRAPETNTFRALKLSDGKFYKP-VE-GWEDLKFYCVFPKDNNKRKIDEEIEKPLQKSKRLEGR-KCTDLIVLNLGWKVDEETLRKYFSKFGELVLVQVKKDRETSHSKGYAFIRFADYAAQVLCLAEKHLIDGRWCAVKVPFSKNEADKQEISKKIHVGYASEEISMEDLRIAFEQYGYVTDIFIPKPFRNFAFVTFDSSDTAQSLIGQSININGITLTIGSAVPKINSNRK 890
            D T+LL+TL   FP  CGLKYR  +T   R ++ ++G+ + P VE GW +  ++CVFPK+N KRK D+ +E    K+KR+E R +CTDLIVL L WK  EE+LR+YF  +GE+++ Q+KKD ++  SKG+ F+RF  Y AQ+  L  +HLIDGRWC VKVP SK      ++  K+ VG  +E+I+ +DLR  F ++G VTD+FIP+PFR F+FVTF   D AQSL G+   I G+++ + +A PK   NR 
Sbjct:   22 DGTLLLSTLQAQFPGSCGLKYRNLDTKAVRGVRSNEGRLFPPSVESGWGEYAYFCVFPKEN-KRKSDDNLENSTAKTKRIETRLRCTDLIVLGLPWKTTEESLREYFETYGEVLMAQIKKDTKSGQSKGFGFVRFGSYDAQMRVLTNRHLIDGRWCEVKVPNSKGMG--HQVPCKVFVGRCTEDINSDDLREYFSKFGEVTDVFIPRPFRAFSFVTFLDPDVAQSLCGEDHIIKGVSVHVSNAAPKAEQNRN 270          

HSP 2 Score: 75.485 bits (184), Expect = 2.055e-13
Identity = 41/120 (34.17%), Postives = 65/120 (54.17%), Query Frame = -2
Query: 3835 SEADKQEITKKIHVSYSAEELEMEDLRKAFEEYGYVVDIFIPKPFRNFAFVTFELSEVAQQLIGRCVTVKGHTLTIGSAVPKITGNKKLPIPA-------QFPICPYNEQGP-MTAGRYG 4170
            S+    ++  K+ V    E++  +DLR+ F ++G V D+FIP+PFR F+FVTF   +VAQ L G    +KG ++ + +A PK   N+   + +        F +  Y+ QG  M  GR G
Sbjct:  183 SKGMGHQVPCKVFVGRCTEDINSDDLREYFSKFGEVTDVFIPRPFRAFSFVTFLDPDVAQSLCGEDHIIKGVSVHVSNAAPKAEQNRNQQVQSYNYNSANSFGMHSYHPQGNHMNPGRNG 302          
BLAST of TAR DNA-binding protein 43 vs. Ensembl Fly
Match: TBPH (gene:FBgn0025790 transcript:FBtr0089627)

HSP 1 Score: 254.988 bits (650), Expect = 4.365e-73
Identity = 121/252 (48.02%), Postives = 170/252 (67.46%), Query Frame = 3
Query:  144 DDTVLLTTLGGIFPNVCGLKYRAPETNTFRALKLSDGKFYKP-VE-GWEDLKFYCVFPKDNNKRKIDEEIEKPLQKSKRLEGR-KCTDLIVLNLGWKVDEETLRKYFSKFGELVLVQVKKDRETSHSKGYAFIRFADYAAQVLCLAEKHLIDGRWCAVKVPFSKNEADKQEISKKIHVGYASEEISMEDLRIAFEQYGYVTDIFIPKPFRNFAFVTFDSSDTAQSLIGQSININGITLTIGSAVPKINSNRK 890
            D T+LL+TL   FP  CGLKYR  +T   R ++ ++G+ + P VE GW +  ++CVFPK+N KRK D+ +E    K+KR+E R +CTDLIVL L WK  EE+LR+YF  +GE+++ Q+KKD ++  SKG+ F+RF  Y AQ+  L  +HLIDGRWC VKVP SK      ++  K+ VG  +E+I+ +DLR  F ++G VTD+FIP+PFR F+FVTF   D AQSL G+   I G+++ + +A PK   NR 
Sbjct:   22 DGTLLLSTLQAQFPGSCGLKYRNLDTKAVRGVRSNEGRLFPPSVESGWGEYAYFCVFPKEN-KRKSDDNLENSTAKTKRIETRLRCTDLIVLGLPWKTTEESLREYFETYGEVLMAQIKKDTKSGQSKGFGFVRFGSYDAQMRVLTNRHLIDGRWCEVKVPNSKGMG--HQVPCKVFVGRCTEDINSDDLREYFSKFGEVTDVFIPRPFRAFSFVTFLDPDVAQSLCGEDHIIKGVSVHVSNAAPKAEQNRN 270          

HSP 2 Score: 75.485 bits (184), Expect = 2.055e-13
Identity = 41/120 (34.17%), Postives = 65/120 (54.17%), Query Frame = -2
Query: 3835 SEADKQEITKKIHVSYSAEELEMEDLRKAFEEYGYVVDIFIPKPFRNFAFVTFELSEVAQQLIGRCVTVKGHTLTIGSAVPKITGNKKLPIPA-------QFPICPYNEQGP-MTAGRYG 4170
            S+    ++  K+ V    E++  +DLR+ F ++G V D+FIP+PFR F+FVTF   +VAQ L G    +KG ++ + +A PK   N+   + +        F +  Y+ QG  M  GR G
Sbjct:  183 SKGMGHQVPCKVFVGRCTEDINSDDLREYFSKFGEVTDVFIPRPFRAFSFVTFLDPDVAQSLCGEDHIIKGVSVHVSNAAPKAEQNRNQQVQSYNYNSANSFGMHSYHPQGNHMNPGRNG 302          
BLAST of TAR DNA-binding protein 43 vs. Ensembl Fly
Match: TBPH (gene:FBgn0025790 transcript:FBtr0301643)

HSP 1 Score: 254.988 bits (650), Expect = 4.365e-73
Identity = 121/252 (48.02%), Postives = 170/252 (67.46%), Query Frame = 3
Query:  144 DDTVLLTTLGGIFPNVCGLKYRAPETNTFRALKLSDGKFYKP-VE-GWEDLKFYCVFPKDNNKRKIDEEIEKPLQKSKRLEGR-KCTDLIVLNLGWKVDEETLRKYFSKFGELVLVQVKKDRETSHSKGYAFIRFADYAAQVLCLAEKHLIDGRWCAVKVPFSKNEADKQEISKKIHVGYASEEISMEDLRIAFEQYGYVTDIFIPKPFRNFAFVTFDSSDTAQSLIGQSININGITLTIGSAVPKINSNRK 890
            D T+LL+TL   FP  CGLKYR  +T   R ++ ++G+ + P VE GW +  ++CVFPK+N KRK D+ +E    K+KR+E R +CTDLIVL L WK  EE+LR+YF  +GE+++ Q+KKD ++  SKG+ F+RF  Y AQ+  L  +HLIDGRWC VKVP SK      ++  K+ VG  +E+I+ +DLR  F ++G VTD+FIP+PFR F+FVTF   D AQSL G+   I G+++ + +A PK   NR 
Sbjct:   22 DGTLLLSTLQAQFPGSCGLKYRNLDTKAVRGVRSNEGRLFPPSVESGWGEYAYFCVFPKEN-KRKSDDNLENSTAKTKRIETRLRCTDLIVLGLPWKTTEESLREYFETYGEVLMAQIKKDTKSGQSKGFGFVRFGSYDAQMRVLTNRHLIDGRWCEVKVPNSKGMG--HQVPCKVFVGRCTEDINSDDLREYFSKFGEVTDVFIPRPFRAFSFVTFLDPDVAQSLCGEDHIIKGVSVHVSNAAPKAEQNRN 270          

HSP 2 Score: 75.485 bits (184), Expect = 2.055e-13
Identity = 41/120 (34.17%), Postives = 65/120 (54.17%), Query Frame = -2
Query: 3835 SEADKQEITKKIHVSYSAEELEMEDLRKAFEEYGYVVDIFIPKPFRNFAFVTFELSEVAQQLIGRCVTVKGHTLTIGSAVPKITGNKKLPIPA-------QFPICPYNEQGP-MTAGRYG 4170
            S+    ++  K+ V    E++  +DLR+ F ++G V D+FIP+PFR F+FVTF   +VAQ L G    +KG ++ + +A PK   N+   + +        F +  Y+ QG  M  GR G
Sbjct:  183 SKGMGHQVPCKVFVGRCTEDINSDDLREYFSKFGEVTDVFIPRPFRAFSFVTFLDPDVAQSLCGEDHIIKGVSVHVSNAAPKAEQNRNQQVQSYNYNSANSFGMHSYHPQGNHMNPGRNG 302          
BLAST of TAR DNA-binding protein 43 vs. Ensembl Zebrafish
Match: tardbp (TAR DNA binding protein [Source:ZFIN;Acc:ZDB-GENE-030131-3777])

HSP 1 Score: 238.039 bits (606), Expect = 1.748e-68
Identity = 112/253 (44.27%), Postives = 165/253 (65.22%), Query Frame = 3
Query:  144 DDTVLLTTLGGIFPNVCGLKYRAPETNTFRALKLSDGKFYKPVEGWEDLKFYCVFPKD----NNKRKIDEEIEKPLQKSKRLEGRKCTDLIVLNLGWKVDEETLRKYFSKFGELVLVQVKKDRETSHSKGYAFIRFADYAAQVLCLAEKHLIDGRWCAVKVPFSKNEADKQEISKKIHVGYASEEISMEDLRIAFEQYGYVTDIFIPKPFRNFAFVTFDSSDTAQSLIGQSININGITLTIGSAVPKINSNRK 890
            D TVLL+T+   FP  CGL++R+P +   R ++L DG  + P  GW +L +   +PK+    +NKRK+DE       K KR + +K +DLIVL L WK  E+ L+ YF  FGE+++VQVK+D +T +SKG+ F+RF D+  Q   + ++H+IDGRWC  K+P SK   D+   S+K+ VG  +E+++ ++LR  F QYG VTD+FIPKPFR FAFVTF     A +L G+ + I G+++ I +A PK N+ R+
Sbjct:   24 DGTVLLSTVSAQFPGACGLRFRSPVSQCMRGVRLVDGILHAPENGWGNLVYVVNYPKETVLPDNKRKMDEIDASSATKIKRGD-QKTSDLIVLGLPWKTSEQDLKDYFGTFGEVIMVQVKRDVKTGNSKGFGFVRFGDWETQSKVMTQRHMIDGRWCDCKLPNSKQGIDEPMRSRKVFVGRCTEDMTADELRQFFMQYGEVTDVFIPKPFRAFAFVTFADDQVAAALCGEDLIIKGVSVHISNAEPKHNNTRQ 275          

HSP 2 Score: 73.9442 bits (180), Expect = 4.128e-13
Identity = 33/81 (40.74%), Postives = 52/81 (64.20%), Query Frame = -2
Query: 3904 TKKIHVSYSAEELEMEDLRKAFEEYGYVVDIFIPKPFRNFAFVTFELSEVAQQLIGRCVTVKGHTLTIGSAVPKITGNKKL 4146
            ++K+ V    E++  ++LR+ F +YG V D+FIPKPFR FAFVTF   +VA  L G  + +KG ++ I +A PK    +++
Sbjct:  196 SRKVFVGRCTEDMTADELRQFFMQYGEVTDVFIPKPFRAFAFVTFADDQVAAALCGEDLIIKGVSVHISNAEPKHNNTRQM 276          
BLAST of TAR DNA-binding protein 43 vs. Ensembl Zebrafish
Match: tardbpl (TAR DNA binding protein, like [Source:ZFIN;Acc:ZDB-GENE-031030-1])

HSP 1 Score: 233.417 bits (594), Expect = 2.678e-68
Identity = 113/246 (45.93%), Postives = 162/246 (65.85%), Query Frame = 3
Query:  144 DDTVLLTTLGGIFPNVCGLKYRAPETNTFRALKLSDGKFYKPVEGWEDLKFYCVFPKDNNKRKIDEEIEKPLQKSKRLEGRKCTDLIVLNLGWKVDEETLRKYFSKFGELVLVQVKKDRETSHSKGYAFIRFADYAAQVLCLAEKHLIDGRWCAVKVPFSKNEADKQEISKKIHVGYASEEISMEDLRIAFEQYGYVTDIFIPKPFRNFAFVTFDSSDTAQSLIGQSININGITLTIGSAVPKINS 881
            D TVLL+T+   FP  CGL+YR+P +   R ++L +G  + P   W +L +   +PKDN KRK+DE       K KR   +K +DLIVL L WK  E+ L+ YF  FGE+++VQVK+D ++ +SKG+ F+RF DY  Q+  ++++H+IDGRWC  K+P SK   D+   S+K+ VG  +E+++ ++LR  F QYG VTD+FIPKPFR FAFVTF     AQSL G+ + I G ++ I +A PK N+
Sbjct:   24 DGTVLLSTVAAQFPGACGLRYRSPVSQCMRGVRLVEGVLHAPEADWGNLVYVVNYPKDN-KRKMDEMDAASAVKIKR-GIQKTSDLIVLGLPWKTTEQDLKDYFGTFGEVIMVQVKRDAKSGNSKGFGFVRFTDYETQIKVMSQRHMIDGRWCDCKLPNSKAGPDEPMRSRKVFVGRCTEDMTADELRQFFMQYGEVTDVFIPKPFRAFAFVTFADDQVAQSLCGEDLIIKGTSVHISNAEPKHNN 267          

HSP 2 Score: 75.0998 bits (183), Expect = 6.071e-14
Identity = 34/74 (45.95%), Postives = 50/74 (67.57%), Query Frame = -2
Query: 3925 TKKIHVSYSAEELEMEDLRKAFEEYGYVVDIFIPKPFRNFAFVTFELSEVAQQLIGRCVTVKGHTLTIGSAVPK 4146
            ++K+ V    E++  ++LR+ F +YG V D+FIPKPFR FAFVTF   +VAQ L G  + +KG ++ I +A PK
Sbjct:  191 SRKVFVGRCTEDMTADELRQFFMQYGEVTDVFIPKPFRAFAFVTFADDQVAQSLCGEDLIIKGTSVHISNAEPK 264          
BLAST of TAR DNA-binding protein 43 vs. Ensembl Zebrafish
Match: tardbpl (TAR DNA binding protein, like [Source:ZFIN;Acc:ZDB-GENE-031030-1])

HSP 1 Score: 233.417 bits (594), Expect = 2.678e-68
Identity = 113/246 (45.93%), Postives = 162/246 (65.85%), Query Frame = 3
Query:  144 DDTVLLTTLGGIFPNVCGLKYRAPETNTFRALKLSDGKFYKPVEGWEDLKFYCVFPKDNNKRKIDEEIEKPLQKSKRLEGRKCTDLIVLNLGWKVDEETLRKYFSKFGELVLVQVKKDRETSHSKGYAFIRFADYAAQVLCLAEKHLIDGRWCAVKVPFSKNEADKQEISKKIHVGYASEEISMEDLRIAFEQYGYVTDIFIPKPFRNFAFVTFDSSDTAQSLIGQSININGITLTIGSAVPKINS 881
            D TVLL+T+   FP  CGL+YR+P +   R ++L +G  + P   W +L +   +PKDN KRK+DE       K KR   +K +DLIVL L WK  E+ L+ YF  FGE+++VQVK+D ++ +SKG+ F+RF DY  Q+  ++++H+IDGRWC  K+P SK   D+   S+K+ VG  +E+++ ++LR  F QYG VTD+FIPKPFR FAFVTF     AQSL G+ + I G ++ I +A PK N+
Sbjct:   24 DGTVLLSTVAAQFPGACGLRYRSPVSQCMRGVRLVEGVLHAPEADWGNLVYVVNYPKDN-KRKMDEMDAASAVKIKR-GIQKTSDLIVLGLPWKTTEQDLKDYFGTFGEVIMVQVKRDAKSGNSKGFGFVRFTDYETQIKVMSQRHMIDGRWCDCKLPNSKAGPDEPMRSRKVFVGRCTEDMTADELRQFFMQYGEVTDVFIPKPFRAFAFVTFADDQVAQSLCGEDLIIKGTSVHISNAEPKHNN 267          

HSP 2 Score: 75.0998 bits (183), Expect = 6.071e-14
Identity = 34/74 (45.95%), Postives = 50/74 (67.57%), Query Frame = -2
Query: 3925 TKKIHVSYSAEELEMEDLRKAFEEYGYVVDIFIPKPFRNFAFVTFELSEVAQQLIGRCVTVKGHTLTIGSAVPK 4146
            ++K+ V    E++  ++LR+ F +YG V D+FIPKPFR FAFVTF   +VAQ L G  + +KG ++ I +A PK
Sbjct:  191 SRKVFVGRCTEDMTADELRQFFMQYGEVTDVFIPKPFRAFAFVTFADDQVAQSLCGEDLIIKGTSVHISNAEPK 264          
BLAST of TAR DNA-binding protein 43 vs. Ensembl Zebrafish
Match: tardbpl (TAR DNA binding protein, like [Source:ZFIN;Acc:ZDB-GENE-031030-1])

HSP 1 Score: 233.417 bits (594), Expect = 2.678e-68
Identity = 113/246 (45.93%), Postives = 162/246 (65.85%), Query Frame = 3
Query:  144 DDTVLLTTLGGIFPNVCGLKYRAPETNTFRALKLSDGKFYKPVEGWEDLKFYCVFPKDNNKRKIDEEIEKPLQKSKRLEGRKCTDLIVLNLGWKVDEETLRKYFSKFGELVLVQVKKDRETSHSKGYAFIRFADYAAQVLCLAEKHLIDGRWCAVKVPFSKNEADKQEISKKIHVGYASEEISMEDLRIAFEQYGYVTDIFIPKPFRNFAFVTFDSSDTAQSLIGQSININGITLTIGSAVPKINS 881
            D TVLL+T+   FP  CGL+YR+P +   R ++L +G  + P   W +L +   +PKDN KRK+DE       K KR   +K +DLIVL L WK  E+ L+ YF  FGE+++VQVK+D ++ +SKG+ F+RF DY  Q+  ++++H+IDGRWC  K+P SK   D+   S+K+ VG  +E+++ ++LR  F QYG VTD+FIPKPFR FAFVTF     AQSL G+ + I G ++ I +A PK N+
Sbjct:   24 DGTVLLSTVAAQFPGACGLRYRSPVSQCMRGVRLVEGVLHAPEADWGNLVYVVNYPKDN-KRKMDEMDAASAVKIKR-GIQKTSDLIVLGLPWKTTEQDLKDYFGTFGEVIMVQVKRDAKSGNSKGFGFVRFTDYETQIKVMSQRHMIDGRWCDCKLPNSKAGPDEPMRSRKVFVGRCTEDMTADELRQFFMQYGEVTDVFIPKPFRAFAFVTFADDQVAQSLCGEDLIIKGTSVHISNAEPKHNN 267          

HSP 2 Score: 75.0998 bits (183), Expect = 6.071e-14
Identity = 34/74 (45.95%), Postives = 50/74 (67.57%), Query Frame = -2
Query: 3925 TKKIHVSYSAEELEMEDLRKAFEEYGYVVDIFIPKPFRNFAFVTFELSEVAQQLIGRCVTVKGHTLTIGSAVPK 4146
            ++K+ V    E++  ++LR+ F +YG V D+FIPKPFR FAFVTF   +VAQ L G  + +KG ++ I +A PK
Sbjct:  191 SRKVFVGRCTEDMTADELRQFFMQYGEVTDVFIPKPFRAFAFVTFADDQVAQSLCGEDLIIKGTSVHISNAEPK 264          
BLAST of TAR DNA-binding protein 43 vs. Ensembl Zebrafish
Match: tardbp (TAR DNA binding protein [Source:ZFIN;Acc:ZDB-GENE-030131-3777])

HSP 1 Score: 235.343 bits (599), Expect = 1.410e-67
Identity = 113/256 (44.14%), Postives = 167/256 (65.23%), Query Frame = 3
Query:  144 DDTVLLTTLGGIFPNVCGLKYRAPETNTFRALKLSDGKFYKPVEGWEDLKFYCVFPKD----NNKRKIDEEIEKPLQKSKRLEGRKCTDLIVLNLGWKVDEETLRKYFSKFGELVLVQVKKDRETSHSKGYAFIRFADYAAQVLCLAEKHLIDGRWCAVKVPFSKNEADKQEISKKIHVGYASEEISMEDLRIAFEQYGYVTDIFIPKPFRNFAFVTF---DSSDTAQSLIGQSININGITLTIGSAVPKINSNRK 890
            D TVLL+T+   FP  CGL++R+P +   R ++L DG  + P  GW +L +   +PK+    +NKRK+DE       K KR + +K +DLIVL L WK  E+ L+ YF  FGE+++VQVK+D +T +SKG+ F+RF D+  Q   + ++H+IDGRWC  K+P SK   D+   S+K+ VG  +E+++ ++LR  F QYG VTD+FIPKPFR FAFVTF    +S  A +L G+ + I G+++ I +A PK N+ R+
Sbjct:   24 DGTVLLSTVSAQFPGACGLRFRSPVSQCMRGVRLVDGILHAPENGWGNLVYVVNYPKETVLPDNKRKMDEIDASSATKIKRGD-QKTSDLIVLGLPWKTSEQDLKDYFGTFGEVIMVQVKRDVKTGNSKGFGFVRFGDWETQSKVMTQRHMIDGRWCDCKLPNSKQGIDEPMRSRKVFVGRCTEDMTADELRQFFMQYGEVTDVFIPKPFRAFAFVTFADDQASHVAAALCGEDLIIKGVSVHISNAEPKHNNTRQ 278          

HSP 2 Score: 71.2478 bits (173), Expect = 3.670e-12
Identity = 34/84 (40.48%), Postives = 53/84 (63.10%), Query Frame = -2
Query: 3904 TKKIHVSYSAEELEMEDLRKAFEEYGYVVDIFIPKPFRNFAFVTF---ELSEVAQQLIGRCVTVKGHTLTIGSAVPKITGNKKL 4146
            ++K+ V    E++  ++LR+ F +YG V D+FIPKPFR FAFVTF   + S VA  L G  + +KG ++ I +A PK    +++
Sbjct:  196 SRKVFVGRCTEDMTADELRQFFMQYGEVTDVFIPKPFRAFAFVTFADDQASHVAAALCGEDLIIKGVSVHISNAEPKHNNTRQM 279          
BLAST of TAR DNA-binding protein 43 vs. Ensembl Xenopus
Match: jarid2 (jumonji and AT-rich interaction domain containing 2 [Source:Xenbase;Acc:XB-GENE-982166])

HSP 1 Score: 253.062 bits (645), Expect = 1.516e-73
Identity = 133/270 (49.26%), Postives = 179/270 (66.30%), Query Frame = 3
Query:   81 MYYIAVCXXXXXXXXXXXXXXDDTVLLTTLGGIFPNVCGLKYRAPETNTFRALKLSDGKFYKPVEGWEDLKFYCVFPKDNNKRKIDEEIEKPLQKSKRLEGRKCTDLIVLNLGWKVDEETLRKYFSKFGELVLVQVKKDRETSHSKGYAFIRFADYAAQVLCLAEKHLIDGRWCAVKVPFSKNEADKQEISKKIHVGYASEEISMEDLRIAFEQYGYVTDIFIPKPFRNFAFVTFDSSDTAQSLIGQSININGITLTIGSAVPKINSNRK 890
            M YI V E E  E +EIP E+D TVLL+T+   FP  CGL+YR P     R ++L +G  + P  GW +L +   +PKDN KRK+DE       K KR    K +DLIVL L WK  E+ L+ YFS FGE+++VQVKKD +T HSKG+ F+RFADY  QV  ++++H+IDGRWC  K+P SK+  D+   S+K+ VG  +E++S E+LR  F QYG V D+FIPKPFR FAFVTF     AQSL G+ + I G+++ + +A PK N+NR+
Sbjct:   12 MEYIRVAEDENEEPMEIPSEDDGTVLLSTVTAQFPGACGLRYRNPVNQCMRGVRLVEGILHAPENGWGNLVYVVNYPKDN-KRKMDETDASSAVKIKRAV-TKTSDLIVLGLPWKTTEQDLKDYFSTFGEVIMVQVKKDAKTGHSKGFGFVRFADYETQVKVMSQRHMIDGRWCDCKLPNSKS-PDEPMRSRKVFVGRCTEDMSAEELRQFFSQYGEVVDVFIPKPFRAFAFVTFADDQVAQSLCGEDLIIKGVSVHVSTAEPKHNNNRQ 278          

HSP 2 Score: 88.9669 bits (219), Expect = 9.418e-18
Identity = 41/96 (42.71%), Postives = 61/96 (63.54%), Query Frame = -2
Query: 3859 TKKIHVSYSAEELEMEDLRKAFEEYGYVVDIFIPKPFRNFAFVTFELSEVAQQLIGRCVTVKGHTLTIGSAVPKITGNKKLPIPAQFPICPYNEQG 4146
            ++K+ V    E++  E+LR+ F +YG VVD+FIPKPFR FAFVTF   +VAQ L G  + +KG ++ + +A PK   N++L    +FP   +  QG
Sbjct:  199 SRKVFVGRCTEDMSAEELRQFFSQYGEVVDVFIPKPFRAFAFVTFADDQVAQSLCGEDLIIKGVSVHVSTAEPKHNNNRQLERGGRFPGPSFGNQG 294          
BLAST of TAR DNA-binding protein 43 vs. Ensembl Xenopus
Match: jarid2 (jumonji and AT-rich interaction domain containing 2 [Source:Xenbase;Acc:XB-GENE-982166])

HSP 1 Score: 172.555 bits (436), Expect = 1.928e-46
Identity = 91/182 (50.00%), Postives = 119/182 (65.38%), Query Frame = 3
Query:   81 MYYIAVCXXXXXXXXXXXXXXDDTVLLTTLGGIFPNVCGLKYRAPETNTFRALKLSDGKFYKPVEGWEDLKFYCVFPKDNNKRKIDEEIEKPLQKSKRLEGRKCTDLIVLNLGWKVDEETLRKYFSKFGELVLVQVKKDRETSHSKGYAFIRFADYAAQVLCLAEKHLIDGRWCAVKVPFSK 626
            M YI V E E  E +EIP E+D TVLL+T+   FP  CGL+YR P     R ++L +G  + P  GW +L +   +PKDN KRK+DE       K KR    K +DLIVL L WK  E+ L+ YFS FGE+++VQVKKD +T HSKG+ F+RFADY  QV  ++++H+IDGRWC  K+P SK
Sbjct:    3 MEYIRVAEDENEEPMEIPSEDDGTVLLSTVTAQFPGACGLRYRNPVNQCMRGVRLVEGILHAPENGWGNLVYVVNYPKDN-KRKMDETDASSAVKIKRAV-TKTSDLIVLGLPWKTTEQDLKDYFSTFGEVIMVQVKKDAKTGHSKGFGFVRFADYETQVKVMSQRHMIDGRWCDCKLPNSK 182          
BLAST of TAR DNA-binding protein 43 vs. Ensembl Xenopus
Match: kcnj4 (potassium inwardly rectifying channel subfamily J member 4 [Source:Xenbase;Acc:XB-GENE-493748])

HSP 1 Score: 83.5741 bits (205), Expect = 2.074e-16
Identity = 49/145 (33.79%), Postives = 74/145 (51.03%), Query Frame = 3
Query:  399 LIVLNLGWKVDEETLRKYFSKFGELVLVQVKKDRETSHSKGYAFIRFADYAAQVLCLAEKHL-IDGRWCAVKVPFSKNEADKQEI-SKKIHVGYASEEISMEDLRIAFEQYGYVTDIFI-----PKPFRNFAFVTFDSSDTAQSL 812
            + +  L W+   ++LR YF+KFGE+    V +D  T  S+G+ F+ FAD A+    LA+ H  +D +    KV F +    K    +KKI VG  S    +ED++  FEQ+G V D  +         R F FVTF+  D  + +
Sbjct:   23 MFIGGLSWQTSPDSLRDYFNKFGEIRECMVMRDPTTKRSRGFGFVTFADPASVDKVLAQPHHELDSKTIDPKVAFPRRAQPKMVTRTKKIFVGGLSANTVVEDVKQYFEQFGKVEDAMLMFDKTTNRHRGFGFVTFEIEDVVEKV 167          
BLAST of TAR DNA-binding protein 43 vs. Ensembl Xenopus
Match: kcnj4 (potassium inwardly rectifying channel subfamily J member 4 [Source:Xenbase;Acc:XB-GENE-493748])

HSP 1 Score: 83.5741 bits (205), Expect = 2.569e-16
Identity = 49/145 (33.79%), Postives = 74/145 (51.03%), Query Frame = 3
Query:  399 LIVLNLGWKVDEETLRKYFSKFGELVLVQVKKDRETSHSKGYAFIRFADYAAQVLCLAEKHL-IDGRWCAVKVPFSKNEADKQEI-SKKIHVGYASEEISMEDLRIAFEQYGYVTDIFI-----PKPFRNFAFVTFDSSDTAQSL 812
            + +  L W+   ++LR YF+KFGE+    V +D  T  S+G+ F+ FAD A+    LA+ H  +D +    KV F +    K    +KKI VG  S    +ED++  FEQ+G V D  +         R F FVTF+  D  + +
Sbjct:   23 MFIGGLSWQTSPDSLRDYFNKFGEIRECMVMRDPTTKRSRGFGFVTFADPASVDKVLAQPHHELDSKTIDPKVAFPRRAQPKMVTRTKKIFVGGLSANTVVEDVKQYFEQFGKVEDAMLMFDKTTNRHRGFGFVTFEIEDVVEKV 167          
BLAST of TAR DNA-binding protein 43 vs. Ensembl Xenopus
Match: kcnj4 (potassium inwardly rectifying channel subfamily J member 4 [Source:Xenbase;Acc:XB-GENE-493748])

HSP 1 Score: 83.9593 bits (206), Expect = 2.781e-16
Identity = 49/145 (33.79%), Postives = 74/145 (51.03%), Query Frame = 3
Query:  399 LIVLNLGWKVDEETLRKYFSKFGELVLVQVKKDRETSHSKGYAFIRFADYAAQVLCLAEKHL-IDGRWCAVKVPFSKNEADKQEI-SKKIHVGYASEEISMEDLRIAFEQYGYVTDIFI-----PKPFRNFAFVTFDSSDTAQSL 812
            + +  L W+   ++LR YF+KFGE+    V +D  T  S+G+ F+ FAD A+    LA+ H  +D +    KV F +    K    +KKI VG  S    +ED++  FEQ+G V D  +         R F FVTF+  D  + +
Sbjct:   23 MFIGGLSWQTSPDSLRDYFNKFGEIRECMVMRDPTTKRSRGFGFVTFADPASVDKVLAQPHHELDSKTIDPKVAFPRRAQPKMVTRTKKIFVGGLSANTVVEDVKQYFEQFGKVEDAMLMFDKTTNRHRGFGFVTFEIEDVVEKV 167          
BLAST of TAR DNA-binding protein 43 vs. Ensembl Mouse
Match: Tardbp (TAR DNA binding protein [Source:MGI Symbol;Acc:MGI:2387629])

HSP 1 Score: 245.743 bits (626), Expect = 7.918e-73
Identity = 121/249 (48.59%), Postives = 166/249 (66.67%), Query Frame = 3
Query:  144 DDTVLLTTLGGIFPNVCGLKYRAPETNTFRALKLSDGKFYKPVEGWEDLKFYCVFPKDNNKRKIDEEIEKPLQKSKRLEGRKCTDLIVLNLGWKVDEETLRKYFSKFGELVLVQVKKDRETSHSKGYAFIRFADYAAQVLCLAEKHLIDGRWCAVKVPFSKNEADKQEISKKIHVGYASEEISMEDLRIAFEQYGYVTDIFIPKPFRNFAFVTFDSSDTAQSLIGQSININGITLTIGSAVPKINSNRK 890
            D TVLL+T+   FP  CGL+YR P +   R ++L +G  + P  GW +L +   +PKDN KRK+DE       K KR   +K +DLIVL L WK  E+ L+ YFS FGE+++VQVKKD +T HSKG+ F+RF +Y  QV  ++++H+IDGRWC  K+P SK   D+   S+K+ VG  +E+++ E+L+  F QYG V D+FIPKPFR FAFVTF     AQSL G+ + I GI++ I +A PK NSNR+
Sbjct:   23 DGTVLLSTVTAQFPGACGLRYRNPVSQCMRGVRLVEGILHAPDAGWGNLVYVVNYPKDN-KRKMDETDASSAVKVKRAV-QKTSDLIVLGLPWKTTEQDLKDYFSTFGEVLMVQVKKDLKTGHSKGFGFVRFTEYETQVKVMSQRHMIDGRWCDCKLPNSKQSPDEPLRSRKVFVGRCTEDMTAEELQQFFCQYGEVVDVFIPKPFRAFAFVTFADDKVAQSLCGEDLIIKGISVHISNAEPKHNSNRQ 269          

HSP 2 Score: 79.337 bits (194), Expect = 2.196e-15
Identity = 38/87 (43.68%), Postives = 57/87 (65.52%), Query Frame = -2
Query: 3886 TKKIHVSYSAEELEMEDLRKAFEEYGYVVDIFIPKPFRNFAFVTFELSEVAQQLIGRCVTVKGHTLTIGSAVPKITGNKKLPIPAQF 4146
            ++K+ V    E++  E+L++ F +YG VVD+FIPKPFR FAFVTF   +VAQ L G  + +KG ++ I +A PK   N++L    +F
Sbjct:  190 SRKVFVGRCTEDMTAEELQQFFCQYGEVVDVFIPKPFRAFAFVTFADDKVAQSLCGEDLIIKGISVHISNAEPKHNSNRQLERSGRF 276          
BLAST of TAR DNA-binding protein 43 vs. Ensembl Mouse
Match: Tardbp (TAR DNA binding protein [Source:MGI Symbol;Acc:MGI:2387629])

HSP 1 Score: 245.743 bits (626), Expect = 1.184e-72
Identity = 121/249 (48.59%), Postives = 166/249 (66.67%), Query Frame = 3
Query:  144 DDTVLLTTLGGIFPNVCGLKYRAPETNTFRALKLSDGKFYKPVEGWEDLKFYCVFPKDNNKRKIDEEIEKPLQKSKRLEGRKCTDLIVLNLGWKVDEETLRKYFSKFGELVLVQVKKDRETSHSKGYAFIRFADYAAQVLCLAEKHLIDGRWCAVKVPFSKNEADKQEISKKIHVGYASEEISMEDLRIAFEQYGYVTDIFIPKPFRNFAFVTFDSSDTAQSLIGQSININGITLTIGSAVPKINSNRK 890
            D TVLL+T+   FP  CGL+YR P +   R ++L +G  + P  GW +L +   +PKDN KRK+DE       K KR   +K +DLIVL L WK  E+ L+ YFS FGE+++VQVKKD +T HSKG+ F+RF +Y  QV  ++++H+IDGRWC  K+P SK   D+   S+K+ VG  +E+++ E+L+  F QYG V D+FIPKPFR FAFVTF     AQSL G+ + I GI++ I +A PK NSNR+
Sbjct:   23 DGTVLLSTVTAQFPGACGLRYRNPVSQCMRGVRLVEGILHAPDAGWGNLVYVVNYPKDN-KRKMDETDASSAVKVKRAV-QKTSDLIVLGLPWKTTEQDLKDYFSTFGEVLMVQVKKDLKTGHSKGFGFVRFTEYETQVKVMSQRHMIDGRWCDCKLPNSKQSPDEPLRSRKVFVGRCTEDMTAEELQQFFCQYGEVVDVFIPKPFRAFAFVTFADDKVAQSLCGEDLIIKGISVHISNAEPKHNSNRQ 269          

HSP 2 Score: 79.337 bits (194), Expect = 2.765e-15
Identity = 38/87 (43.68%), Postives = 57/87 (65.52%), Query Frame = -2
Query: 3886 TKKIHVSYSAEELEMEDLRKAFEEYGYVVDIFIPKPFRNFAFVTFELSEVAQQLIGRCVTVKGHTLTIGSAVPKITGNKKLPIPAQF 4146
            ++K+ V    E++  E+L++ F +YG VVD+FIPKPFR FAFVTF   +VAQ L G  + +KG ++ I +A PK   N++L    +F
Sbjct:  190 SRKVFVGRCTEDMTAEELQQFFCQYGEVVDVFIPKPFRAFAFVTFADDKVAQSLCGEDLIIKGISVHISNAEPKHNSNRQLERSGRF 276          
BLAST of TAR DNA-binding protein 43 vs. Ensembl Mouse
Match: Tardbp (TAR DNA binding protein [Source:MGI Symbol;Acc:MGI:2387629])

HSP 1 Score: 245.743 bits (626), Expect = 1.184e-72
Identity = 121/249 (48.59%), Postives = 166/249 (66.67%), Query Frame = 3
Query:  144 DDTVLLTTLGGIFPNVCGLKYRAPETNTFRALKLSDGKFYKPVEGWEDLKFYCVFPKDNNKRKIDEEIEKPLQKSKRLEGRKCTDLIVLNLGWKVDEETLRKYFSKFGELVLVQVKKDRETSHSKGYAFIRFADYAAQVLCLAEKHLIDGRWCAVKVPFSKNEADKQEISKKIHVGYASEEISMEDLRIAFEQYGYVTDIFIPKPFRNFAFVTFDSSDTAQSLIGQSININGITLTIGSAVPKINSNRK 890
            D TVLL+T+   FP  CGL+YR P +   R ++L +G  + P  GW +L +   +PKDN KRK+DE       K KR   +K +DLIVL L WK  E+ L+ YFS FGE+++VQVKKD +T HSKG+ F+RF +Y  QV  ++++H+IDGRWC  K+P SK   D+   S+K+ VG  +E+++ E+L+  F QYG V D+FIPKPFR FAFVTF     AQSL G+ + I GI++ I +A PK NSNR+
Sbjct:   23 DGTVLLSTVTAQFPGACGLRYRNPVSQCMRGVRLVEGILHAPDAGWGNLVYVVNYPKDN-KRKMDETDASSAVKVKRAV-QKTSDLIVLGLPWKTTEQDLKDYFSTFGEVLMVQVKKDLKTGHSKGFGFVRFTEYETQVKVMSQRHMIDGRWCDCKLPNSKQSPDEPLRSRKVFVGRCTEDMTAEELQQFFCQYGEVVDVFIPKPFRAFAFVTFADDKVAQSLCGEDLIIKGISVHISNAEPKHNSNRQ 269          

HSP 2 Score: 79.337 bits (194), Expect = 2.765e-15
Identity = 38/87 (43.68%), Postives = 57/87 (65.52%), Query Frame = -2
Query: 3886 TKKIHVSYSAEELEMEDLRKAFEEYGYVVDIFIPKPFRNFAFVTFELSEVAQQLIGRCVTVKGHTLTIGSAVPKITGNKKLPIPAQF 4146
            ++K+ V    E++  E+L++ F +YG VVD+FIPKPFR FAFVTF   +VAQ L G  + +KG ++ I +A PK   N++L    +F
Sbjct:  190 SRKVFVGRCTEDMTAEELQQFFCQYGEVVDVFIPKPFRAFAFVTFADDKVAQSLCGEDLIIKGISVHISNAEPKHNSNRQLERSGRF 276          
BLAST of TAR DNA-binding protein 43 vs. Ensembl Mouse
Match: Tardbp (TAR DNA binding protein [Source:MGI Symbol;Acc:MGI:2387629])

HSP 1 Score: 245.743 bits (626), Expect = 1.184e-72
Identity = 121/249 (48.59%), Postives = 166/249 (66.67%), Query Frame = 3
Query:  144 DDTVLLTTLGGIFPNVCGLKYRAPETNTFRALKLSDGKFYKPVEGWEDLKFYCVFPKDNNKRKIDEEIEKPLQKSKRLEGRKCTDLIVLNLGWKVDEETLRKYFSKFGELVLVQVKKDRETSHSKGYAFIRFADYAAQVLCLAEKHLIDGRWCAVKVPFSKNEADKQEISKKIHVGYASEEISMEDLRIAFEQYGYVTDIFIPKPFRNFAFVTFDSSDTAQSLIGQSININGITLTIGSAVPKINSNRK 890
            D TVLL+T+   FP  CGL+YR P +   R ++L +G  + P  GW +L +   +PKDN KRK+DE       K KR   +K +DLIVL L WK  E+ L+ YFS FGE+++VQVKKD +T HSKG+ F+RF +Y  QV  ++++H+IDGRWC  K+P SK   D+   S+K+ VG  +E+++ E+L+  F QYG V D+FIPKPFR FAFVTF     AQSL G+ + I GI++ I +A PK NSNR+
Sbjct:   23 DGTVLLSTVTAQFPGACGLRYRNPVSQCMRGVRLVEGILHAPDAGWGNLVYVVNYPKDN-KRKMDETDASSAVKVKRAV-QKTSDLIVLGLPWKTTEQDLKDYFSTFGEVLMVQVKKDLKTGHSKGFGFVRFTEYETQVKVMSQRHMIDGRWCDCKLPNSKQSPDEPLRSRKVFVGRCTEDMTAEELQQFFCQYGEVVDVFIPKPFRAFAFVTFADDKVAQSLCGEDLIIKGISVHISNAEPKHNSNRQ 269          

HSP 2 Score: 79.337 bits (194), Expect = 2.765e-15
Identity = 38/87 (43.68%), Postives = 57/87 (65.52%), Query Frame = -2
Query: 3886 TKKIHVSYSAEELEMEDLRKAFEEYGYVVDIFIPKPFRNFAFVTFELSEVAQQLIGRCVTVKGHTLTIGSAVPKITGNKKLPIPAQF 4146
            ++K+ V    E++  E+L++ F +YG VVD+FIPKPFR FAFVTF   +VAQ L G  + +KG ++ I +A PK   N++L    +F
Sbjct:  190 SRKVFVGRCTEDMTAEELQQFFCQYGEVVDVFIPKPFRAFAFVTFADDKVAQSLCGEDLIIKGISVHISNAEPKHNSNRQLERSGRF 276          
BLAST of TAR DNA-binding protein 43 vs. Ensembl Mouse
Match: Tardbp (TAR DNA binding protein [Source:MGI Symbol;Acc:MGI:2387629])

HSP 1 Score: 245.743 bits (626), Expect = 1.184e-72
Identity = 121/249 (48.59%), Postives = 166/249 (66.67%), Query Frame = 3
Query:  144 DDTVLLTTLGGIFPNVCGLKYRAPETNTFRALKLSDGKFYKPVEGWEDLKFYCVFPKDNNKRKIDEEIEKPLQKSKRLEGRKCTDLIVLNLGWKVDEETLRKYFSKFGELVLVQVKKDRETSHSKGYAFIRFADYAAQVLCLAEKHLIDGRWCAVKVPFSKNEADKQEISKKIHVGYASEEISMEDLRIAFEQYGYVTDIFIPKPFRNFAFVTFDSSDTAQSLIGQSININGITLTIGSAVPKINSNRK 890
            D TVLL+T+   FP  CGL+YR P +   R ++L +G  + P  GW +L +   +PKDN KRK+DE       K KR   +K +DLIVL L WK  E+ L+ YFS FGE+++VQVKKD +T HSKG+ F+RF +Y  QV  ++++H+IDGRWC  K+P SK   D+   S+K+ VG  +E+++ E+L+  F QYG V D+FIPKPFR FAFVTF     AQSL G+ + I GI++ I +A PK NSNR+
Sbjct:   23 DGTVLLSTVTAQFPGACGLRYRNPVSQCMRGVRLVEGILHAPDAGWGNLVYVVNYPKDN-KRKMDETDASSAVKVKRAV-QKTSDLIVLGLPWKTTEQDLKDYFSTFGEVLMVQVKKDLKTGHSKGFGFVRFTEYETQVKVMSQRHMIDGRWCDCKLPNSKQSPDEPLRSRKVFVGRCTEDMTAEELQQFFCQYGEVVDVFIPKPFRAFAFVTFADDKVAQSLCGEDLIIKGISVHISNAEPKHNSNRQ 269          

HSP 2 Score: 79.337 bits (194), Expect = 2.765e-15
Identity = 38/87 (43.68%), Postives = 57/87 (65.52%), Query Frame = -2
Query: 3886 TKKIHVSYSAEELEMEDLRKAFEEYGYVVDIFIPKPFRNFAFVTFELSEVAQQLIGRCVTVKGHTLTIGSAVPKITGNKKLPIPAQF 4146
            ++K+ V    E++  E+L++ F +YG VVD+FIPKPFR FAFVTF   +VAQ L G  + +KG ++ I +A PK   N++L    +F
Sbjct:  190 SRKVFVGRCTEDMTAEELQQFFCQYGEVVDVFIPKPFRAFAFVTFADDKVAQSLCGEDLIIKGISVHISNAEPKHNSNRQLERSGRF 276          
BLAST of TAR DNA-binding protein 43 vs. UniProt/SwissProt
Match: sp|Q28F51|TADBP_XENTR (TAR DNA-binding protein 43 OS=Xenopus tropicalis OX=8364 GN=tardbp PE=2 SV=1)

HSP 1 Score: 253.062 bits (645), Expect = 7.247e-73
Identity = 133/270 (49.26%), Postives = 179/270 (66.30%), Query Frame = 3
Query:   81 MYYIAVCXXXXXXXXXXXXXXDDTVLLTTLGGIFPNVCGLKYRAPETNTFRALKLSDGKFYKPVEGWEDLKFYCVFPKDNNKRKIDEEIEKPLQKSKRLEGRKCTDLIVLNLGWKVDEETLRKYFSKFGELVLVQVKKDRETSHSKGYAFIRFADYAAQVLCLAEKHLIDGRWCAVKVPFSKNEADKQEISKKIHVGYASEEISMEDLRIAFEQYGYVTDIFIPKPFRNFAFVTFDSSDTAQSLIGQSININGITLTIGSAVPKINSNRK 890
            M YI V E E  E +EIP E+D TVLL+T+   FP  CGL+YR P     R ++L +G  + P  GW +L +   +PKDN KRK+DE       K KR    K +DLIVL L WK  E+ L+ YFS FGE+++VQVKKD +T HSKG+ F+RFADY  QV  ++++H+IDGRWC  K+P SK+  D+   S+K+ VG  +E++S E+LR  F QYG V D+FIPKPFR FAFVTF     AQSL G+ + I G+++ + +A PK N+NR+
Sbjct:    3 MEYIRVAEDENEEPMEIPSEDDGTVLLSTVTAQFPGACGLRYRNPVNQCMRGVRLVEGILHAPENGWGNLVYVVNYPKDN-KRKMDETDASSAVKIKRAV-TKTSDLIVLGLPWKTTEQDLKDYFSTFGEVIMVQVKKDAKTGHSKGFGFVRFADYETQVKVMSQRHMIDGRWCDCKLPNSKS-PDEPMRSRKVFVGRCTEDMSAEELRQFFSQYGEVVDVFIPKPFRAFAFVTFADDQVAQSLCGEDLIIKGVSVHVSTAEPKHNNNRQ 269          

HSP 2 Score: 88.9669 bits (219), Expect = 4.510e-17
Identity = 41/96 (42.71%), Postives = 61/96 (63.54%), Query Frame = -2
Query: 3859 TKKIHVSYSAEELEMEDLRKAFEEYGYVVDIFIPKPFRNFAFVTFELSEVAQQLIGRCVTVKGHTLTIGSAVPKITGNKKLPIPAQFPICPYNEQG 4146
            ++K+ V    E++  E+LR+ F +YG VVD+FIPKPFR FAFVTF   +VAQ L G  + +KG ++ + +A PK   N++L    +FP   +  QG
Sbjct:  190 SRKVFVGRCTEDMSAEELRQFFSQYGEVVDVFIPKPFRAFAFVTFADDQVAQSLCGEDLIIKGVSVHVSTAEPKHNNNRQLERGGRFPGPSFGNQG 285          
BLAST of TAR DNA-binding protein 43 vs. UniProt/SwissProt
Match: sp|Q5R5W2|TADBP_PONAB (TAR DNA-binding protein 43 OS=Pongo abelii OX=9601 GN=TARDBP PE=2 SV=1)

HSP 1 Score: 251.521 bits (641), Expect = 2.901e-72
Identity = 121/249 (48.59%), Postives = 167/249 (67.07%), Query Frame = 3
Query:  144 DDTVLLTTLGGIFPNVCGLKYRAPETNTFRALKLSDGKFYKPVEGWEDLKFYCVFPKDNNKRKIDEEIEKPLQKSKRLEGRKCTDLIVLNLGWKVDEETLRKYFSKFGELVLVQVKKDRETSHSKGYAFIRFADYAAQVLCLAEKHLIDGRWCAVKVPFSKNEADKQEISKKIHVGYASEEISMEDLRIAFEQYGYVTDIFIPKPFRNFAFVTFDSSDTAQSLIGQSININGITLTIGSAVPKINSNRK 890
            D TVLL+T+   FP  CGL+YR P +   R ++L +G  + P  GW +L +   +PKDN KRK+DE       K KR   +K +DLIVL L WK  E+ L++YFS FGE+++VQVKKD +T HSKG+ F+RF +Y  QV  ++++H+IDGRWC  K+P SK   D+   S+K+ VG  +E+++ ++LR  F QYG V D+FIPKPFR FAFVTF     AQSL G+ + I GI++ I +A PK NSNR+
Sbjct:   23 DGTVLLSTVTAQFPGACGLRYRNPVSQCMRGVRLVEGILHAPDAGWGNLVYVVNYPKDN-KRKMDETDASSAVKVKRAV-QKTSDLIVLGLPWKTTEQDLKEYFSTFGEVLMVQVKKDLKTGHSKGFGFVRFTEYETQVKVMSQRHMIDGRWCDCKLPNSKQSQDEPLRSRKVFVGRCTEDMTEDELREFFSQYGDVMDVFIPKPFRAFAFVTFADDQIAQSLCGEDLIIKGISVHISNAEPKHNSNRQ 269          

HSP 2 Score: 80.1073 bits (196), Expect = 3.857e-14
Identity = 35/81 (43.21%), Postives = 55/81 (67.90%), Query Frame = -2
Query: 3904 TKKIHVSYSAEELEMEDLRKAFEEYGYVVDIFIPKPFRNFAFVTFELSEVAQQLIGRCVTVKGHTLTIGSAVPKITGNKKL 4146
            ++K+ V    E++  ++LR+ F +YG V+D+FIPKPFR FAFVTF   ++AQ L G  + +KG ++ I +A PK   N++L
Sbjct:  190 SRKVFVGRCTEDMTEDELREFFSQYGDVMDVFIPKPFRAFAFVTFADDQIAQSLCGEDLIIKGISVHISNAEPKHNSNRQL 270          
BLAST of TAR DNA-binding protein 43 vs. UniProt/SwissProt
Match: sp|Q13148|TADBP_HUMAN (TAR DNA-binding protein 43 OS=Homo sapiens OX=9606 GN=TARDBP PE=1 SV=1)

HSP 1 Score: 251.521 bits (641), Expect = 3.015e-72
Identity = 121/249 (48.59%), Postives = 167/249 (67.07%), Query Frame = 3
Query:  144 DDTVLLTTLGGIFPNVCGLKYRAPETNTFRALKLSDGKFYKPVEGWEDLKFYCVFPKDNNKRKIDEEIEKPLQKSKRLEGRKCTDLIVLNLGWKVDEETLRKYFSKFGELVLVQVKKDRETSHSKGYAFIRFADYAAQVLCLAEKHLIDGRWCAVKVPFSKNEADKQEISKKIHVGYASEEISMEDLRIAFEQYGYVTDIFIPKPFRNFAFVTFDSSDTAQSLIGQSININGITLTIGSAVPKINSNRK 890
            D TVLL+T+   FP  CGL+YR P +   R ++L +G  + P  GW +L +   +PKDN KRK+DE       K KR   +K +DLIVL L WK  E+ L++YFS FGE+++VQVKKD +T HSKG+ F+RF +Y  QV  ++++H+IDGRWC  K+P SK   D+   S+K+ VG  +E+++ ++LR  F QYG V D+FIPKPFR FAFVTF     AQSL G+ + I GI++ I +A PK NSNR+
Sbjct:   23 DGTVLLSTVTAQFPGACGLRYRNPVSQCMRGVRLVEGILHAPDAGWGNLVYVVNYPKDN-KRKMDETDASSAVKVKRAV-QKTSDLIVLGLPWKTTEQDLKEYFSTFGEVLMVQVKKDLKTGHSKGFGFVRFTEYETQVKVMSQRHMIDGRWCDCKLPNSKQSQDEPLRSRKVFVGRCTEDMTEDELREFFSQYGDVMDVFIPKPFRAFAFVTFADDQIAQSLCGEDLIIKGISVHISNAEPKHNSNRQ 269          

HSP 2 Score: 80.1073 bits (196), Expect = 3.823e-14
Identity = 35/81 (43.21%), Postives = 55/81 (67.90%), Query Frame = -2
Query: 3904 TKKIHVSYSAEELEMEDLRKAFEEYGYVVDIFIPKPFRNFAFVTFELSEVAQQLIGRCVTVKGHTLTIGSAVPKITGNKKL 4146
            ++K+ V    E++  ++LR+ F +YG V+D+FIPKPFR FAFVTF   ++AQ L G  + +KG ++ I +A PK   N++L
Sbjct:  190 SRKVFVGRCTEDMTEDELREFFSQYGDVMDVFIPKPFRAFAFVTFADDQIAQSLCGEDLIIKGISVHISNAEPKHNSNRQL 270          
BLAST of TAR DNA-binding protein 43 vs. UniProt/SwissProt
Match: sp|Q921F2|TADBP_MOUSE (TAR DNA-binding protein 43 OS=Mus musculus OX=10090 GN=Tardbp PE=1 SV=1)

HSP 1 Score: 249.595 bits (636), Expect = 1.292e-71
Identity = 121/249 (48.59%), Postives = 166/249 (66.67%), Query Frame = 3
Query:  144 DDTVLLTTLGGIFPNVCGLKYRAPETNTFRALKLSDGKFYKPVEGWEDLKFYCVFPKDNNKRKIDEEIEKPLQKSKRLEGRKCTDLIVLNLGWKVDEETLRKYFSKFGELVLVQVKKDRETSHSKGYAFIRFADYAAQVLCLAEKHLIDGRWCAVKVPFSKNEADKQEISKKIHVGYASEEISMEDLRIAFEQYGYVTDIFIPKPFRNFAFVTFDSSDTAQSLIGQSININGITLTIGSAVPKINSNRK 890
            D TVLL+T+   FP  CGL+YR P +   R ++L +G  + P  GW +L +   +PKDN KRK+DE       K KR   +K +DLIVL L WK  E+ L+ YFS FGE+++VQVKKD +T HSKG+ F+RF +Y  QV  ++++H+IDGRWC  K+P SK   D+   S+K+ VG  +E+++ E+L+  F QYG V D+FIPKPFR FAFVTF     AQSL G+ + I GI++ I +A PK NSNR+
Sbjct:   23 DGTVLLSTVTAQFPGACGLRYRNPVSQCMRGVRLVEGILHAPDAGWGNLVYVVNYPKDN-KRKMDETDASSAVKVKRAV-QKTSDLIVLGLPWKTTEQDLKDYFSTFGEVLMVQVKKDLKTGHSKGFGFVRFTEYETQVKVMSQRHMIDGRWCDCKLPNSKQSPDEPLRSRKVFVGRCTEDMTAEELQQFFCQYGEVVDVFIPKPFRAFAFVTFADDKVAQSLCGEDLIIKGISVHISNAEPKHNSNRQ 269          

HSP 2 Score: 80.1073 bits (196), Expect = 3.373e-14
Identity = 37/81 (45.68%), Postives = 55/81 (67.90%), Query Frame = -2
Query: 3904 TKKIHVSYSAEELEMEDLRKAFEEYGYVVDIFIPKPFRNFAFVTFELSEVAQQLIGRCVTVKGHTLTIGSAVPKITGNKKL 4146
            ++K+ V    E++  E+L++ F +YG VVD+FIPKPFR FAFVTF   +VAQ L G  + +KG ++ I +A PK   N++L
Sbjct:  190 SRKVFVGRCTEDMTAEELQQFFCQYGEVVDVFIPKPFRAFAFVTFADDKVAQSLCGEDLIIKGISVHISNAEPKHNSNRQL 270          
BLAST of TAR DNA-binding protein 43 vs. UniProt/SwissProt
Match: sp|Q5ZLN5|TADBP_CHICK (TAR DNA-binding protein 43 OS=Gallus gallus OX=9031 GN=TARDBP PE=2 SV=1)

HSP 1 Score: 248.44 bits (633), Expect = 3.517e-71
Identity = 120/249 (48.19%), Postives = 166/249 (66.67%), Query Frame = 3
Query:  144 DDTVLLTTLGGIFPNVCGLKYRAPETNTFRALKLSDGKFYKPVEGWEDLKFYCVFPKDNNKRKIDEEIEKPLQKSKRLEGRKCTDLIVLNLGWKVDEETLRKYFSKFGELVLVQVKKDRETSHSKGYAFIRFADYAAQVLCLAEKHLIDGRWCAVKVPFSKNEADKQEISKKIHVGYASEEISMEDLRIAFEQYGYVTDIFIPKPFRNFAFVTFDSSDTAQSLIGQSININGITLTIGSAVPKINSNRK 890
            D TVLL+T+   FP  CGL+YR P +     ++L +G  + P  GW +L +   +PKDN KRK+DE       K KR   +K +DLIVL L WK  E+ L++YFS FGE+++VQVKKD +T HSKG+ F+RF DY  QV  ++++H+IDGRWC  K+P SK   D+   S+K+ VG  +E+++ ++L+  F QYG V D+FIPKPFR FAFVTF     AQSL G+ + I GI++ I +A PK NSNR+
Sbjct:   23 DGTVLLSTVTAQFPGACGLRYRNPVSQCMWGVRLVEGILHAPEAGWGNLVYVVNYPKDN-KRKMDETDASSAVKVKRAV-QKTSDLIVLGLPWKTTEQDLKEYFSTFGEVLMVQVKKDIKTGHSKGFGFVRFTDYETQVKVMSQRHMIDGRWCDCKLPNSKQSPDEPLRSRKVFVGRCTEDMTADELQQFFAQYGEVVDVFIPKPFRAFAFVTFADDQVAQSLCGEDLIIKGISVHISNAEPKHNSNRQ 269          

HSP 2 Score: 79.7221 bits (195), Expect = 4.449e-14
Identity = 36/81 (44.44%), Postives = 55/81 (67.90%), Query Frame = -2
Query: 3904 TKKIHVSYSAEELEMEDLRKAFEEYGYVVDIFIPKPFRNFAFVTFELSEVAQQLIGRCVTVKGHTLTIGSAVPKITGNKKL 4146
            ++K+ V    E++  ++L++ F +YG VVD+FIPKPFR FAFVTF   +VAQ L G  + +KG ++ I +A PK   N++L
Sbjct:  190 SRKVFVGRCTEDMTADELQQFFAQYGEVVDVFIPKPFRAFAFVTFADDQVAQSLCGEDLIIKGISVHISNAEPKHNSNRQL 270          
BLAST of TAR DNA-binding protein 43 vs. TrEMBL
Match: A0A4E0RSY0 (TAR DNA-binding protein 43 OS=Fasciola hepatica OX=6192 GN=D915_009315 PE=4 SV=1)

HSP 1 Score: 311.997 bits (798), Expect = 3.090e-91
Identity = 148/269 (55.02%), Postives = 197/269 (73.23%), Query Frame = 3
Query:   87 YIAVCXXXXXXXXXXXXXXDDTVLLTTLGGIFPNVCGLKYRAPETNTFRALKLSDGKFYKPV-EGWEDLKFYCVFPKDNNKRKIDEEIEKPLQKSKRLEGRKCTDLIVLNLGWKVDEETLRKYFSKFGELVLVQVKKDRETSHSKGYAFIRFADYAAQVLCLAEKHLIDGRWCAVKVPFSKNEADKQEISKKIHVGYASEEISMEDLRIAFEQYGYVTDIFIPKPFRNFAFVTFDSSDTAQSLIGQSININGITLTIGSAVPKINSNRK 890
            YI VCE +    +E+P+E+D T+LL TL   FP   GLKY+APE+  FR L+L+D   Y P   GW D  F+CVFPK  +KRK +   +   QK KRLEGRKCTDLIVLNL W  DE+TLR+YFS FGE+V+VQ+K+D +T+ S+GY F+RF+DYAAQV+CLAE+H+ID R C V++P SK E D+QE+ +KIHVG  +E++  + LR  F +YG V D+FIP+PFR+FAFVTFD  D A  L+G+ + I+G  +TIGSAVPK+  N++
Sbjct:    6 YIRVCEDDGEIPVELPLEQDGTLLLATLTAQFPRCTGLKYKAPESGCFRGLRLADDHIYPPSGSGWSDTDFFCVFPKAESKRKAEGSEDDSTQKVKRLEGRKCTDLIVLNLSWNTDEDTLREYFSGFGEVVMVQLKRDLKTNKSRGYGFVRFSDYAAQVMCLAERHMIDNRLCDVRIPNSKVEGDRQEVGRKIHVGNLTEDVGSDVLRQFFSEYGRVIDVFIPRPFRSFAFVTFDDPDVASGLMGKDLVIHGCRVTIGSAVPKLPQNKQ 274          

HSP 2 Score: 101.679 bits (252), Expect = 8.876e-19
Identity = 45/88 (51.14%), Postives = 65/88 (73.86%), Query Frame = -2
Query: 3904 EADKQEITKKIHVSYSAEELEMEDLRKAFEEYGYVVDIFIPKPFRNFAFVTFELSEVAQQLIGRCVTVKGHTLTIGSAVPKITGNKKL 4167
            E D+QE+ +KIHV    E++  + LR+ F EYG V+D+FIP+PFR+FAFVTF+  +VA  L+G+ + + G  +TIGSAVPK+  NK+L
Sbjct:  188 EGDRQEVGRKIHVGNLTEDVGSDVLRQFFSEYGRVIDVFIPRPFRSFAFVTFDDPDVASGLMGKDLVIHGCRVTIGSAVPKLPQNKQL 275          
BLAST of TAR DNA-binding protein 43 vs. TrEMBL
Match: A0A504Z4S8 (TAR DNA-binding protein 43 OS=Fasciola gigantica OX=46835 GN=FGIG_02376 PE=4 SV=1)

HSP 1 Score: 310.071 bits (793), Expect = 3.472e-91
Identity = 149/263 (56.65%), Postives = 198/263 (75.29%), Query Frame = 3
Query:   87 YIAVCXXXXXXXXXXXXXXDDTVLLTTLGGIFPNVCGLKYRAPETNTFRALKLSDGKFYKPVEGWEDLKFYCVFPKDNNKRKIDEEIEKPLQKSKRLEGRKCTDLIVLNLGWKVDEETLRKYFSKFGELVLVQVKKDRETSHSKGYAFIRFADYAAQVLCLAEKHLIDGRWCAVKVPFSKNEADKQEISKKIHVGYASEEISMEDLRIAFEQYGYVTDIFIPKPFRNFAFVTFDSSDTAQSLIGQSININGITLTIGSAVPKI 875
            YI V E +E   IE+P+E D +VLLTTL G+FP   GLKY AP++  +R ++L+DGK Y P EGW    + CVFPK + KRK DE+ +    KSK+LEG+KCTDLIVLNL WK DE  LR YFS++GELV+VQVK+   T  SKGY FIRF++Y +Q +CLAE+H IDGRWC V+VP SK E DKQE+S+K+HVG  +E+++ + LR  F Q+G V D+F+PKPFR+FAFVTF+ ++TA  L+G+ ++I+G  +TIGSAVPK+
Sbjct:    6 YIRVSEDDEESPIEVPIETDGSVLLTTLNGVFPKATGLKYMAPDSGCYRGVRLNDGKLYAPDEGWVH-TYVCVFPKSDKKRKGDEDQDSLSAKSKKLEGKKCTDLIVLNLAWKTDEAALRDYFSRYGELVMVQVKRHPGTQQSKGYGFIRFSEYESQPMCLAERHYIDGRWCDVRVPMSKLEGDKQEVSRKVHVGGVTEKMTADTLREYFLQFGQVLDVFVPKPFRSFAFVTFEDAETAAGLLGKELSIDGSKVTIGSAVPKL 267          

HSP 2 Score: 97.4413 bits (241), Expect = 1.193e-17
Identity = 41/82 (50.00%), Postives = 63/82 (76.83%), Query Frame = -2
Query: 3922 EADKQEITKKIHVSYSAEELEMEDLRKAFEEYGYVVDIFIPKPFRNFAFVTFELSEVAQQLIGRCVTVKGHTLTIGSAVPKI 4167
            E DKQE+++K+HV    E++  + LR+ F ++G V+D+F+PKPFR+FAFVTFE +E A  L+G+ +++ G  +TIGSAVPK+
Sbjct:  186 EGDKQEVSRKVHVGGVTEKMTADTLREYFLQFGQVLDVFVPKPFRSFAFVTFEDAETAAGLLGKELSIDGSKVTIGSAVPKL 267          
BLAST of TAR DNA-binding protein 43 vs. TrEMBL
Match: A0A2H1BSY3 (Uncharacterized protein OS=Fasciola hepatica OX=6192 GN=D915_15054 PE=4 SV=1)

HSP 1 Score: 309.301 bits (791), Expect = 6.321e-91
Identity = 150/263 (57.03%), Postives = 197/263 (74.90%), Query Frame = 3
Query:   87 YIAVCXXXXXXXXXXXXXXDDTVLLTTLGGIFPNVCGLKYRAPETNTFRALKLSDGKFYKPVEGWEDLKFYCVFPKDNNKRKIDEEIEKPLQKSKRLEGRKCTDLIVLNLGWKVDEETLRKYFSKFGELVLVQVKKDRETSHSKGYAFIRFADYAAQVLCLAEKHLIDGRWCAVKVPFSKNEADKQEISKKIHVGYASEEISMEDLRIAFEQYGYVTDIFIPKPFRNFAFVTFDSSDTAQSLIGQSININGITLTIGSAVPKI 875
            YI V E +E   IEIP+E D +VLLTTL G+FP   GLKY AP++  +R ++L+DGK Y P EGW    + CVFPK + KRK DE+ +    KSK+LEG+KCTDLIVLNL WK DE  LR YFS++GELV+VQVK+   T  SKGY FIRF++Y +Q +CLAE+H IDGRWC V+VP SK E DKQE+S+K+HVG  +E+++ + LR  F Q+G V D+F+PKPFR+FAFVTF+ ++TA  L+G+ + I+G  +TIGSAVPK+
Sbjct:    6 YIRVSEDDEESPIEIPIETDGSVLLTTLNGVFPKATGLKYMAPDSGCYRGVRLNDGKLYAPDEGWVH-TYVCVFPKSDKKRKGDEDQDSLSAKSKKLEGKKCTDLIVLNLAWKTDEAALRDYFSRYGELVMVQVKRHPGTQQSKGYGFIRFSEYESQPMCLAERHYIDGRWCDVRVPMSKLEGDKQEVSRKVHVGGVTEKMTADALREYFLQFGQVLDVFVPKPFRSFAFVTFEDAETAAGLLGKELTIDGSKVTIGSAVPKL 267          

HSP 2 Score: 98.5969 bits (244), Expect = 5.459e-18
Identity = 42/82 (51.22%), Postives = 63/82 (76.83%), Query Frame = -2
Query: 3922 EADKQEITKKIHVSYSAEELEMEDLRKAFEEYGYVVDIFIPKPFRNFAFVTFELSEVAQQLIGRCVTVKGHTLTIGSAVPKI 4167
            E DKQE+++K+HV    E++  + LR+ F ++G V+D+F+PKPFR+FAFVTFE +E A  L+G+ +T+ G  +TIGSAVPK+
Sbjct:  186 EGDKQEVSRKVHVGGVTEKMTADALREYFLQFGQVLDVFVPKPFRSFAFVTFEDAETAAGLLGKELTIDGSKVTIGSAVPKL 267          
BLAST of TAR DNA-binding protein 43 vs. TrEMBL
Match: A0A504YT28 (TAR DNA-binding protein 43 OS=Fasciola gigantica OX=46835 GN=FGIG_10236 PE=4 SV=1)

HSP 1 Score: 308.531 bits (789), Expect = 5.612e-90
Identity = 140/250 (56.00%), Postives = 184/250 (73.60%), Query Frame = 3
Query:  144 DDTVLLTTLGGIFPNVCGLKYRAPETNTFRALKLSDGKFYKPV-EGWEDLKFYCVFPKDNNKRKIDEEIEKPLQKSKRLEGRKCTDLIVLNLGWKVDEETLRKYFSKFGELVLVQVKKDRETSHSKGYAFIRFADYAAQVLCLAEKHLIDGRWCAVKVPFSKNEADKQEISKKIHVGYASEEISMEDLRIAFEQYGYVTDIFIPKPFRNFAFVTFDSSDTAQSLIGQSININGITLTIGSAVPKINSNRK 890
            D T+LL TL   FP   GLKY+APE+  FR L+L+D   Y P   GW D  F+CVFPK  +KRK +   +   QK KRLEGRKCTDLIVLNL W  DE+TLR+YFS FGE+V+VQ+K+D +T+ S+GY F+RF+DYAAQV+CLAE+H+ID R C V++P SK E D+QE+ +KIHVG  +E++  + LR  F +YG V D+FIP+PFR+FAFVTFD  D A  L+G+ + I+G  +TIGSAVPK+  N++
Sbjct:   25 DGTLLLATLTAQFPRCTGLKYKAPESGCFRGLRLADDHIYPPSGSGWSDTDFFCVFPKAESKRKAEGSEDDSTQKVKRLEGRKCTDLIVLNLSWNTDEDTLREYFSGFGEVVMVQLKRDLKTNKSRGYGFVRFSDYAAQVMCLAERHMIDNRLCDVRIPNSKVEGDRQEVGRKIHVGNLTEDVGSDVLRQFFSEYGRVIDVFIPRPFRSFAFVTFDDPDVASGLMGKDLVIHGCRVTIGSAVPKLPQNKQ 274          

HSP 2 Score: 101.679 bits (252), Expect = 9.463e-19
Identity = 45/88 (51.14%), Postives = 65/88 (73.86%), Query Frame = -2
Query: 3904 EADKQEITKKIHVSYSAEELEMEDLRKAFEEYGYVVDIFIPKPFRNFAFVTFELSEVAQQLIGRCVTVKGHTLTIGSAVPKITGNKKL 4167
            E D+QE+ +KIHV    E++  + LR+ F EYG V+D+FIP+PFR+FAFVTF+  +VA  L+G+ + + G  +TIGSAVPK+  NK+L
Sbjct:  188 EGDRQEVGRKIHVGNLTEDVGSDVLRQFFSEYGRVIDVFIPRPFRSFAFVTFDDPDVASGLMGKDLVIHGCRVTIGSAVPKLPQNKQL 275          
BLAST of TAR DNA-binding protein 43 vs. TrEMBL
Match: A0A1S8WSG9 (Uncharacterized protein (Fragment) OS=Opisthorchis viverrini OX=6198 GN=X801_06808 PE=4 SV=1)

HSP 1 Score: 306.605 bits (784), Expect = 3.273e-89
Identity = 163/315 (51.75%), Postives = 207/315 (65.71%), Query Frame = 3
Query:   81 MYYIAVCXXXXXXXXXXXXXXDDTVLLTTLGGIFPNVCGLKYRAPETNTFRALKLSDGKFYKPVEGWEDLKFYCVFPKDNNKRKIDEEIEKPLQKSKRLEGRKCTDLIVLNLGWKVDEETLRKYFSKFGELVLVQVKKDRETSHSKGYAFIRFADYAAQVLCLAEKHLIDGRWCAVKVPFSKNEADKQEISKKIHVGYASEEISMEDLRIAFEQYGYVTDIFIPKPFRNFAFVTFDSSDTAQSLIGQSININGITLTIGSAVPKINSNRKXXXXXXXXXXXXXXHYPMYGDNMQSAQGYQTRYAP--GMIPTYGA 1019
            + Y  +CE E +E +E+PVE D T+LL TL   FP   GLKY++ ++  FR L+L     Y PVE   D  FYCVFPKD  KRK DE+ E   QK K LEGRKCTDLIVLNL W+ DE  LR YFS+FG+LV+VQ+KKD +T  S+GY F+RF+DY+ Q +CLAE+H+IDGR C V++P SK E D+QE+S+KIHVG   E I  + LR  F QYG V D+FIPKPFR+FAFVTFD  D A SL+G+ + I G  +TIGSAVPK+ S+ +         G     YP  G  M     + + ++P  GM P  GA
Sbjct:    4 VVYARICEEEGTEPVELPVEADGTLLLPTLTAQFPKCTGLKYKSEDSGCFRGLRLVGDHIYPPVETDWDNVFYCVFPKDK-KRKGDEDTEDTKQKVKCLEGRKCTDLIVLNLAWQTDETKLRNYFSQFGDLVMVQIKKDPDTGKSRGYGFVRFSDYSGQAMCLAERHMIDGRLCDVRIPLSKQEGDRQEVSRKIHVGNLPESIGADALRQHFLQYGLVIDVFIPKPFRSFAFVTFDDPDVAASLLGKDLTIQGHKVTIGSAVPKLPSHVRQNPAFENAGGNLRSPYP--GSPMAHGPLWNSPWSPALGMFPGGGA 315          

HSP 2 Score: 105.145 bits (261), Expect = 7.872e-20
Identity = 45/86 (52.33%), Postives = 66/86 (76.74%), Query Frame = -2
Query: 3922 LMQSEADKQEITKKIHVSYSAEELEMEDLRKAFEEYGYVVDIFIPKPFRNFAFVTFELSEVAQQLIGRCVTVKGHTLTIGSAVPKI 4179
            L + E D+QE+++KIHV    E +  + LR+ F +YG V+D+FIPKPFR+FAFVTF+  +VA  L+G+ +T++GH +TIGSAVPK+
Sbjct:  182 LSKQEGDRQEVSRKIHVGNLPESIGADALRQHFLQYGLVIDVFIPKPFRSFAFVTFDDPDVAASLLGKDLTIQGHKVTIGSAVPKL 267          
BLAST of TAR DNA-binding protein 43 vs. Ensembl Cavefish
Match: tardbp (TAR DNA-binding protein 43-like [Source:NCBI gene;Acc:103044966])

HSP 1 Score: 240.736 bits (613), Expect = 1.218e-69
Identity = 116/252 (46.03%), Postives = 168/252 (66.67%), Query Frame = 3
Query:  144 DDTVLLTTLGGIFPNVCGLKYRAPETNTFRALKLSDGKFYKPVEGWEDLKFYCVFPKD----NNKRKIDEEIEKPLQKSKRLEGRKCTDLIVLNLGWKVDEETLRKYFSKFGELVLVQVKKDRETSHSKGYAFIRFADYAAQVLCLAEKHLIDGRWCAVKVPFSKNEADKQEISKKIHVGYASEEISMEDLRIAFEQYGYVTDIFIPKPFRNFAFVTFDSSDTAQSLIGQSININGITLTIGSAVPKINSNR 887
            D TVLL+T+   FP  CGL+YR+P +   R ++L +G  + P  GW +L +   +PK+    +NKRK+DE IE    K KR +  K +DLIVL L WK  E+ L+ YFS FGE+++VQVK+D +T +SKG+ F+RF ++  Q   +A++H+IDGRWC  K+P SK   D+   S+K+ VG  +E+++ +DLR  F QYG VTD+FIPKPFR FAFVTF     A SL G+ + + G+++ I +A PK N++R
Sbjct:   24 DGTVLLSTVSAQFPGACGLRYRSPISQCMRGVRLVEGVLHAPENGWGNLVYVVNYPKEPALPDNKRKMDE-IEASSAKMKRGD-HKTSDLIVLGLPWKTSEQDLKDYFSTFGEVIMVQVKRDVKTGNSKGFGFVRFGEWETQSKVIAQRHMIDGRWCDCKLPNSKQGPDEPMRSRKVFVGRCTEDMTADDLRQFFMQYGEVTDVFIPKPFRAFAFVTFADDQVASSLCGEDLIVKGVSVHISNAEPKHNNSR 273          

HSP 2 Score: 76.6406 bits (187), Expect = 5.596e-14
Identity = 35/74 (47.30%), Postives = 49/74 (66.22%), Query Frame = -2
Query: 3925 TKKIHVSYSAEELEMEDLRKAFEEYGYVVDIFIPKPFRNFAFVTFELSEVAQQLIGRCVTVKGHTLTIGSAVPK 4146
            ++K+ V    E++  +DLR+ F +YG V D+FIPKPFR FAFVTF   +VA  L G  + VKG ++ I +A PK
Sbjct:  195 SRKVFVGRCTEDMTADDLRQFFMQYGEVTDVFIPKPFRAFAFVTFADDQVASSLCGEDLIVKGVSVHISNAEPK 268          
BLAST of TAR DNA-binding protein 43 vs. Ensembl Cavefish
Match: tardbpl (TAR DNA binding protein [Source:NCBI gene;Acc:103025275])

HSP 1 Score: 238.81 bits (608), Expect = 5.150e-69
Identity = 117/254 (46.06%), Postives = 166/254 (65.35%), Query Frame = 3
Query:  144 DDTVLLTTLGGIFPNVCGLKYRAPETNTFRALKLSDGKFYKPVEGWEDLKFYCVFPKDNNKRKIDEEIEKPLQKSKRLEGRKCTDLIVLNLGWKVDEETLRKYFSKFGELVLVQVKKDRETSHSKGYAFIRFADYAAQVLCLAEKHLIDGRWCAVKVPFSK-----NEADKQEISKKIHVGYASEEISMEDLRIAFEQYGYVTDIFIPKPFRNFAFVTFDSSDTAQSLIGQSININGITLTIGSAVPKINSNRK 890
            D TVLL+T+   FP  CGL+YR+P +   R ++L +G  + P   W +L +   +PKDN KRK+DE       K KR   +K +DLIVL L WK  E+ L+ YFS FGE+++VQVK+D +T +SKG+ F+RF DY  Q+  ++++H+IDGRWC  K+P SK        D+   S+K+ VG  +E+++ +DLR  F QYG VTD+FIPKPFR FAFVTF     AQSL G+ + I G ++ I +A PK N++R+
Sbjct:   24 DGTVLLSTVAAQFPGACGLRYRSPVSQCMRGVRLVEGVLHAPDADWGNLVYVVNYPKDN-KRKMDEMDAASAVKIKR-GIQKTSDLIVLGLPWKTSEQDLKDYFSTFGEVIMVQVKRDVKTGNSKGFGFVRFTDYETQIKVMSQRHMIDGRWCDCKLPNSKYFLEQAGPDEPMRSRKVFVGRCTEDMTADDLRQFFMQYGEVTDVFIPKPFRAFAFVTFADDQVAQSLCGEDLIIKGTSVHISNAEPKHNNSRQ 275          

HSP 2 Score: 83.9593 bits (206), Expect = 2.138e-16
Identity = 39/93 (41.94%), Postives = 60/93 (64.52%), Query Frame = -2
Query: 3904 FLMQSEADKQEITKKIHVSYSAEELEMEDLRKAFEEYGYVVDIFIPKPFRNFAFVTFELSEVAQQLIGRCVTVKGHTLTIGSAVPKITGNKKL 4182
            FL Q+  D+   ++K+ V    E++  +DLR+ F +YG V D+FIPKPFR FAFVTF   +VAQ L G  + +KG ++ I +A PK   ++++
Sbjct:  184 FLEQAGPDEPMRSRKVFVGRCTEDMTADDLRQFFMQYGEVTDVFIPKPFRAFAFVTFADDQVAQSLCGEDLIIKGTSVHISNAEPKHNNSRQM 276          
BLAST of TAR DNA-binding protein 43 vs. Ensembl Cavefish
Match: tardbpl (TAR DNA binding protein [Source:NCBI gene;Acc:103025275])

HSP 1 Score: 231.491 bits (589), Expect = 1.103e-67
Identity = 116/251 (46.22%), Postives = 163/251 (64.94%), Query Frame = 3
Query:  144 DDTVLLTTLGGIFPNVCGLKYRAPETNTFRALKLSDGKFYKPVEGWEDLKFYCVFPKDNNKRKIDEEIEKPLQKSKRLEGRKCTDLIVLNLGWKVDEETLRKYFSKFGELVLVQVKKDRETSHSKGYAFIRFADYAAQVLCLAEKHLIDGRWCAVKVPFSK-----NEADKQEISKKIHVGYASEEISMEDLRIAFEQYGYVTDIFIPKPFRNFAFVTFDSSDTAQSLIGQSININGITLTIGSAVPKINS 881
            D TVLL+T+   FP  CGL+YR+P +   R ++L +G  + P   W +L +   +PKDN KRK+DE       K KR   +K +DLIVL L WK  E+ L+ YFS FGE+++VQVK+D +T +SKG+ F+RF DY  Q+  ++++H+IDGRWC  K+P SK        D+   S+K+ VG  +E+++ +DLR  F QYG VTD+FIPKPFR FAFVTF     AQSL G+ + I G ++ I +A PK N+
Sbjct:   24 DGTVLLSTVAAQFPGACGLRYRSPVSQCMRGVRLVEGVLHAPDADWGNLVYVVNYPKDN-KRKMDEMDAASAVKIKR-GIQKTSDLIVLGLPWKTSEQDLKDYFSTFGEVIMVQVKRDVKTGNSKGFGFVRFTDYETQIKVMSQRHMIDGRWCDCKLPNSKYFLEQAGPDEPMRSRKVFVGRCTEDMTADDLRQFFMQYGEVTDVFIPKPFRAFAFVTFADDQVAQSLCGEDLIIKGTSVHISNAEPKHNN 272          

HSP 2 Score: 81.2629 bits (199), Expect = 5.670e-16
Identity = 39/86 (45.35%), Postives = 56/86 (65.12%), Query Frame = -2
Query: 3925 FLMQSEADKQEITKKIHVSYSAEELEMEDLRKAFEEYGYVVDIFIPKPFRNFAFVTFELSEVAQQLIGRCVTVKGHTLTIGSAVPK 4182
            FL Q+  D+   ++K+ V    E++  +DLR+ F +YG V D+FIPKPFR FAFVTF   +VAQ L G  + +KG ++ I +A PK
Sbjct:  184 FLEQAGPDEPMRSRKVFVGRCTEDMTADDLRQFFMQYGEVTDVFIPKPFRAFAFVTFADDQVAQSLCGEDLIIKGTSVHISNAEPK 269          
BLAST of TAR DNA-binding protein 43 vs. Ensembl Cavefish
Match: msi2b (RNA-binding protein Musashi homolog 2 [Source:NCBI gene;Acc:103023867])

HSP 1 Score: 87.8113 bits (216), Expect = 3.026e-18
Identity = 50/148 (33.78%), Postives = 76/148 (51.35%), Query Frame = 3
Query:  390 CTDLIVLNLGWKVDEETLRKYFSKFGELVLVQVKKDRETSHSKGYAFIRFADYAAQVLCLAEKHL-IDGRWCAVKVPFSKNEADKQEI-SKKIHVGYASEEISMEDLRIAFEQYGYVTDIFI-----PKPFRNFAFVTFDSSDTAQSL 812
            C+ + +  L W+   ++LR YFSKFGE+    V +D  T  S+G+ F+ FAD A+    L + H  +D +    KV F +    K    +KKI VG  S    +ED++  FEQ+G V D  +         R F FVTF++ D  + +
Sbjct:   16 CSKMFIGGLSWQTSPDSLRDYFSKFGEIRECMVMRDPTTKRSRGFGFVTFADAASVDKVLGQPHHELDSKTIDPKVAFPRRAQPKMVTRTKKIFVGGLSANTVVEDVKQYFEQFGKVEDAMLMFDKTTNRHRGFGFVTFENEDVVEKV 163          
BLAST of TAR DNA-binding protein 43 vs. Ensembl Cavefish
Match: msi2b (RNA-binding protein Musashi homolog 2 [Source:NCBI gene;Acc:103023867])

HSP 1 Score: 88.1965 bits (217), Expect = 3.880e-18
Identity = 50/148 (33.78%), Postives = 76/148 (51.35%), Query Frame = 3
Query:  390 CTDLIVLNLGWKVDEETLRKYFSKFGELVLVQVKKDRETSHSKGYAFIRFADYAAQVLCLAEKHL-IDGRWCAVKVPFSKNEADKQEI-SKKIHVGYASEEISMEDLRIAFEQYGYVTDIFI-----PKPFRNFAFVTFDSSDTAQSL 812
            C+ + +  L W+   ++LR YFSKFGE+    V +D  T  S+G+ F+ FAD A+    L + H  +D +    KV F +    K    +KKI VG  S    +ED++  FEQ+G V D  +         R F FVTF++ D  + +
Sbjct:   16 CSKMFIGGLSWQTSPDSLRDYFSKFGEIRECMVMRDPTTKRSRGFGFVTFADAASVDKVLGQPHHELDSKTIDPKVAFPRRAQPKMVTRTKKIFVGGLSANTVVEDVKQYFEQFGKVEDAMLMFDKTTNRHRGFGFVTFENEDVVEKV 163          
BLAST of TAR DNA-binding protein 43 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000009806.1 (pep scaffold:Pmarinus_7.0:GL479354:9188:12030:-1 gene:ENSPMAG00000008859.1 transcript:ENSPMAT00000009806.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 218.009 bits (554), Expect = 3.147e-63
Identity = 111/252 (44.05%), Postives = 151/252 (59.92%), Query Frame = 3
Query:  144 DDTVLLTTLGGIFPNVCGLKYRAPETNTFRALKLSDGKFYKPVEGWEDLKFYCVFPKD------NNKRKIDEEIEKPLQKSKRLEGRKCTDLIVLNLGWKVDEETLRKYFSKFGELVLVQVKKDRETSHSKGYAFIRFADYAAQVLCLAEKHLIDGRWCAVKVPFSK---NEADKQEISKKIHVGYASEEISMEDLRIAFEQYGYVTDIFIPKPFRNFAFVTFDSSDTAQSLIGQSININGITLTIGSAVPK 872
            D T+L++ +   FP   GL+YR P+  +FR ++L DG  + P  GW    FY  FPKD       NKRK++E       K  R E R  +DL+VL L W   E+ L+ YFS FG +VL Q+K D  T  SKGY F+RFAD+ +Q+  +  +H+I GRWC  K+P SK    + D+     +I VG   E+I+ EDLR  F Q+G VTD++IPKPFR+F FVTF +   AQSL GQ + + G ++ I SA PK
Sbjct:   23 DGTLLVSNVAAQFPGAVGLRYRPPDAQSFRGVRLVDGVLHPPENGWASYTFYVNFPKDPCVLGLENKRKMEEVDMASASKMLRSEPR-VSDLVVLGLPWTTTEDELKDYFSAFGSVVLSQIKTDPATGKSKGYGFVRFADHESQLKAMGMRHMIGGRWCDAKLPQSKMYPTDPDRN----RIFVGRCPEDITPEDLRSFFGQFGDVTDVYIPKPFRSFGFVTFANEHVAQSLCGQDVIVKGASVHIASAEPK 269          

HSP 2 Score: 74.7146 bits (182), Expect = 2.396e-14
Identity = 36/72 (50.00%), Postives = 47/72 (65.28%), Query Frame = -2
Query: 3925 KIHVSYSAEELEMEDLRKAFEEYGYVVDIFIPKPFRNFAFVTFELSEVAQQLIGRCVTVKGHTLTIGSAVPK 4140
            +I V    E++  EDLR  F ++G V D++IPKPFR+F FVTF    VAQ L G+ V VKG ++ I SA PK
Sbjct:  198 RIFVGRCPEDITPEDLRSFFGQFGDVTDVYIPKPFRSFGFVTFANEHVAQSLCGQDVIVKGASVHIASAEPK 269          
BLAST of TAR DNA-binding protein 43 vs. Ensembl Sea Lamprey
Match: TARDBP (TAR DNA binding protein [Source:HGNC Symbol;Acc:HGNC:11571])

HSP 1 Score: 186.037 bits (471), Expect = 9.252e-54
Identity = 94/191 (49.21%), Postives = 126/191 (65.97%), Query Frame = 3
Query:  318 NNKRKIDEEIEKPLQKSKRLEGRKCTDLIVLNLGWKVDEETLRKYFSKFGELVLVQVKKDRETSHSKGYAFIRFADYAAQVLCLAEKHLIDGRWCAVKVPFSKNEADKQEI-SKKIHVGYASEEISMEDLRIAFEQYGYVTDIFIPKPFRNFAFVTFDSSDTAQSLIGQSININGITLTIGSAVPKINSNR 887
            +NKRK+DE     + K KR   +K +DLIVL L WK  E+ +R YFS FGE+++ QVK+D +T +SKG+ F+RF DY  Q+  LA++H+IDGRWC  K+P SK +       S+KI VG  +E+I+ +DLR  F Q+G VTD+FIPKPFR FAFVTF     AQ L G+ + I G ++ I SA PK    R
Sbjct:    1 DNKRKMDEAEMSNVAKVKR-SVQKTSDLIVLGLPWKASEQDIRDYFSTFGEVLMAQVKRDIKTGNSKGFGFVRFRDYETQLKVLAQRHMIDGRWCDCKLPNSKEQQVGDAFRSRKIFVGRCTEDITADDLRQFFSQFGEVTDVFIPKPFRAFAFVTFSDDQIAQGLCGEDLIIKGTSVHISSAEPKFGYAR 190          

HSP 2 Score: 77.7962 bits (190), Expect = 3.825e-16
Identity = 35/75 (46.67%), Postives = 50/75 (66.67%), Query Frame = -2
Query: 3922 TKKIHVSYSAEELEMEDLRKAFEEYGYVVDIFIPKPFRNFAFVTFELSEVAQQLIGRCVTVKGHTLTIGSAVPKI 4146
            ++KI V    E++  +DLR+ F ++G V D+FIPKPFR FAFVTF   ++AQ L G  + +KG ++ I SA PK 
Sbjct:  112 SRKIFVGRCTEDITADDLRQFFSQFGEVTDVFIPKPFRAFAFVTFSDDQIAQGLCGEDLIIKGTSVHISSAEPKF 186          
BLAST of TAR DNA-binding protein 43 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000007723.1 (pep scaffold:Pmarinus_7.0:GL496487:1152:2091:-1 gene:ENSPMAG00000006977.1 transcript:ENSPMAT00000007723.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 104.375 bits (259), Expect = 9.459e-27
Identity = 47/103 (45.63%), Postives = 76/103 (73.79%), Query Frame = 3
Query:  318 NNKRKIDEEIEKPLQKSKRLEGRKCTDLIVLNLGWKVDEETLRKYFSKFGELVLVQVKKDRETSHSKGYAFIRFADYAAQVLCLAEKHLIDGRWCAVKVPFSK 626
            +NKRK+DE     + K KR   +K +DLIVL L WK +E+ LR YF++ G++++VQVK+D ++  SKG+ F+RF+++ +Q+  ++++HLI GRWC VK+P +K
Sbjct:    1 DNKRKMDESDAWNVAKIKR-SVQKTSDLIVLGLPWKCNEQDLRDYFTEVGDVLMVQVKRDAKSGTSKGFGFVRFSEFESQLKAISQRHLIGGRWCDVKLPNTK 102          
BLAST of TAR DNA-binding protein 43 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000004893.1 (pep scaffold:Pmarinus_7.0:GL479484:4:2056:-1 gene:ENSPMAG00000004449.1 transcript:ENSPMAT00000004893.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 76.6406 bits (187), Expect = 1.364e-15
Identity = 55/168 (32.74%), Postives = 84/168 (50.00%), Query Frame = 3
Query:  399 LIVLNLGWKVDEETLRKYFSKFGELVLVQVKKDRETSHSKGYAFIRFADYAAQVLCL-AEKHLIDGRWCAVKVPFSKNEADK--QEIS-KKIHVGYASEEISMEDLRIAFEQYGYVTDIFI-----PKPFRNFAFVTFDSSDTAQSLIGQSIN-INGITLTIGSAVPK 872
            L V  L ++  EE LR+YF ++G L    V KD ++  S+G+ F+ F+  +     + A  H IDGR    K   S+ ++ +    +S KKI VG   ++   E LR  FE+YG +  + +         R FAFVTF+  D    ++ Q  + ING    I  A+PK
Sbjct:   13 LFVGGLSFETTEEGLRQYFEQWGSLTDCVVMKDTQSKRSRGFGFVTFSSMSEVDAAMSARPHKIDGRMVEPKRAVSREDSMRPGAHLSVKKIFVGGIKDDTDEEHLRDYFEKYGRIEIVEVMTERESGKKRGFAFVTFNDHDPVDKIVVQKYHTINGHNCEIRKALPK 180          

HSP 2 Score: 53.1434 bits (126), Expect = 9.336e-8
Identity = 24/70 (34.29%), Postives = 40/70 (57.14%), Query Frame = 3
Query:  426 VDEETLRKYFSKFGELVLVQVKKDRETSHSKGYAFIRFADY-AAQVLCLAEKHLIDGRWCAVKVPFSKNE 632
             DEE LR YF K+G + +V+V  +RE+   +G+AF+ F D+     + + + H I+G  C ++    K E
Sbjct:  113 TDEEHLRDYFEKYGRIEIVEVMTERESGKKRGFAFVTFNDHDPVDKIVVQKYHTINGHNCEIRKALPKQE 182          
BLAST of TAR DNA-binding protein 43 vs. Ensembl Sea Lamprey
Match: HNRNPA2B1 (heterogeneous nuclear ribonucleoprotein A2/B1 [Source:HGNC Symbol;Acc:HGNC:5033])

HSP 1 Score: 64.3142 bits (155), Expect = 2.133e-11
Identity = 50/167 (29.94%), Postives = 78/167 (46.71%), Query Frame = 3
Query:  399 LIVLNLGWKVDEETLRKYFSKFGELVLVQVKKDRETSHSKGYAFIRFADYAAQVLCL-AEKHLIDGRWCAVK--VPFSKNEADKQEISKKIHVGYASEEISMEDLRIAFEQYGYV--TDIFIPKPF---RNFAFVTFDSSDTAQSLIGQSIN-INGITLTIGSAVPK 872
            L +  L ++  EE+LR+Y+ ++G +V   V KD  +  S+G+ FI ++        + A  H +DGR    K  VP   +    Q   KK+ VG   +      LR  F ++G V   D+   K     R FAFVTFD  D    ++ Q  + IN   L +  A+ +
Sbjct:   16 LFIGGLSFETTEESLREYYEQWGTIVDCVVMKDPSSKRSRGFGFITYSVMEEVNSAMQARPHTVDGRVVEAKRAVPRDDSRPGIQVTVKKLFVGGIKDNTDESHLRDYFSKFGRVESVDMVTDKQTGKKRGFAFVTFDDYDPVDQIVFQKFHTINCHKLEVRKALSR 182          

HSP 2 Score: 48.1358 bits (113), Expect = 5.381e-6
Identity = 26/87 (29.89%), Postives = 45/87 (51.72%), Query Frame = 3
Query:  399 LIVLNLGWKVDEETLRKYFSKFGELVLVQVKKDRETSHSKGYAFIRFADY-AAQVLCLAEKHLIDGRWCAVKVPFSKNEADKQEISK 656
            L V  +    DE  LR YFSKFG +  V +  D++T   +G+AF+ F DY     +   + H I+     V+   S++E +  ++++
Sbjct:  106 LFVGGIKDNTDESHLRDYFSKFGRVESVDMVTDKQTGKKRGFAFVTFDDYDPVDQIVFQKFHTINCHKLEVRKALSRHEMETMQMNQ 192          
BLAST of TAR DNA-binding protein 43 vs. Ensembl Yeast
Match: HRP1 (Subunit of cleavage factor I; cleavage factor I is a five-subunit complex required for the cleavage and polyadenylation of pre-mRNA 3' ends; RRM-containing heteronuclear RNA binding protein and hnRNPA/B family member that binds to poly (A) signal sequences; required for genome stability [Source:SGD;Acc:S000005483])

HSP 1 Score: 77.0258 bits (188), Expect = 8.360e-15
Identity = 46/177 (25.99%), Postives = 87/177 (49.15%), Query Frame = 3
Query:  360 QKSKRLEGRKCTDLIVLNLGWKVDEETLRKYFSKFGELVLVQVKKDRETSHSKGYAFIRFADYAAQVLCLAEKHLIDGRWCAVKVPFSKNEADKQEISKKIHVGYASEEISMEDLRIAFEQYGYVTD--IFIPKPF---RNFAFVTFDSSDTAQSLI-GQSININGITLTIGSAVPK 872
            ++SK    ++   + +  L W   E+ LR+YF K+G +  +++ KD  T  S+G+ F+ F   ++    +  +H++DG+    K    ++E DK   + KI VG    ++  ++    F Q+G + D  + + K     R F FVT+DS+D    +   + I+     + I  A P+
Sbjct:  148 ERSKADLSKESCKMFIGGLNWDTTEDNLREYFGKYGTVTDLKIMKDPATGRSRGFGFLSFEKPSSVDEVVKTQHILDGKVIDPKRAIPRDEQDK---TGKIFVGGIGPDVRPKEFEEFFSQWGTIIDAQLMLDKDTGQSRGFGFVTYDSADAVDRVCQNKFIDFKDRKIEIKRAEPR 321          
BLAST of TAR DNA-binding protein 43 vs. Ensembl Yeast
Match: NSR1 (Nucleolar protein that binds nuclear localization sequences; required for pre-rRNA processing and ribosome biogenesis; binds to single stranded telomeric DNA and mRNA; methylated by Hmt1p; interaction with Top1p and nucleolar localization are negatively regulated by polyphosphorylation [Source:SGD;Acc:S000003391])

HSP 1 Score: 53.5286 bits (127), Expect = 1.367e-7
Identity = 51/205 (24.88%), Postives = 90/205 (43.90%), Query Frame = 3
Query:  321 NKRKIDEEIEKPLQKSKRLEGRKCTDLIVLNLGWKVDEETLRKYFSKFGELVLVQVKKDRETSHSKGYAFIRFAD--YAAQVLCLAEKHLIDGRWC----AVKVPFSKNEADKQ------EISKKIHVGYASEEISMEDLRIAFEQYGYVTDIFIP------KPFRNFAFVTFDSSDTAQ----SLIGQSININGITLTIGSAVP 869
            NK++ +EE E+P              + V  L W +D+E L+K F   G ++  +V  +R T  S+GY ++ F +  YA + +   +   IDGR      +   P   N+  K+      E S  + +G  S     + +   F ++G V  + IP      +P + F +V F + + A+    +L G+ I+   + L   S  P
Sbjct:  156 NKKQKNEETEEPAT------------IFVGRLSWSIDDEWLKKEFEHIGGVIGARVIYERGTDRSRGYGYVDFENKSYAEKAIQEMQGKEIDGRPINCDMSTSKPAGNNDRAKKFGDTPSEPSDTLFLGNLSFNADRDAIFELFAKHGEVVSVRIPTHPETEQP-KGFGYVQFSNMEDAKKALDALQGEYIDNRPVRLDFSSPRP 347          
BLAST of TAR DNA-binding protein 43 vs. Ensembl Yeast
Match: SNP1 (Component of U1 snRNP required for mRNA splicing via spliceosome; substrate of the arginine methyltransferase Hmt1p; may interact with poly(A) polymerase to regulate polyadenylation; homolog of human U1 70K protein; protein abundance increases in response to DNA replication stress [Source:SGD;Acc:S000001323])

HSP 1 Score: 51.9878 bits (123), Expect = 3.172e-7
Identity = 28/77 (36.36%), Postives = 42/77 (54.55%), Query Frame = 3
Query:  399 LIVLNLGWKVDEETLRKYFSKFGELVLVQVKKDRETSHSKGYAFIRFADYAAQVLCLAEKHL-----IDGRWCAVKV 614
            + +  L + +DE  L+KYF KFGE+  +++ KD+ T  SKGYAFI F D  +  +   E  +     I  R C V +
Sbjct:  109 IFIGRLPYDLDEIELQKYFVKFGEIEKIRIVKDKITQKSKGYAFIVFKDPISSKMAFKEIGVHRGIQIKDRICIVDI 185          
BLAST of TAR DNA-binding protein 43 vs. Ensembl Nematostella
Match: EDO44940 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RU25])

HSP 1 Score: 178.333 bits (451), Expect = 7.562e-50
Identity = 100/249 (40.16%), Postives = 142/249 (57.03%), Query Frame = 3
Query:  144 DDTVLLTTLGGIFPNVCGLKYRAPETNTFRALKLSDGKFYKPVE-GWEDLKFYCVFPK---DNNKRKIDEEI--EKPLQKSKRLEGRKCTDLIVLNLGWKVDEETLRKYFSKFGELVLVQVKKDRETSHSKGYAFIRFADYAAQVLCLAEKHLIDGRWCAVKVPFSKNEADKQEISKKIHVGYASEEISMEDLRIAFEQYGYVTDIFIPKPFRNFAFVTFDSSDTAQSLIGQSININGITLTIGSAVPK 872
            D T+LL+ + G FP  CGL+YR PET  FR ++L +   Y P E GW D  F  V  K     +KRKI+E    ++P  K  ++EG    DLIVL L +   E  +++YF++FGE+   +VK D  T  S+G+ F+RF         L+  H I GR C V++P  K E +   + KK+ VG   E  + + L   F Q+G VTD++IPKPFR+F FVTF S + A+ ++ Q+  I+G  L I  A PK
Sbjct:   26 DGTLLLSNVNGQFPGACGLRYRNPETQAFRGVRLVEDVLYPPFEDGWGDTLFLVVPSKAADSASKRKIEESPIGKEPETKITKVEGVDVGDLIVLGLPYATTESEMKEYFTRFGEIDFCEVKLDPNTRRSRGFGFVRFKKDEDAKNVLSTSHRIQGRLCEVRLPRPKEELN---VPKKLFVGRLPESTTEKTLMEYFAQFGEVTDVYIPKPFRHFGFVTFASGELAKKVLSQNHRISGSLLNITFAEPK 271          

HSP 2 Score: 56.225 bits (134), Expect = 2.828e-8
Identity = 29/77 (37.66%), Postives = 45/77 (58.44%), Query Frame = -2
Query: 3919 ITKKIHVSYSAEELEMEDLRKAFEEYGYVVDIFIPKPFRNFAFVTFELSEVAQQLIGRCVTVKGHTLTIGSAVPKIT 4149
            + KK+ V    E    + L + F ++G V D++IPKPFR+F FVTF   E+A++++ +   + G  L I  A PK T
Sbjct:  197 VPKKLFVGRLPESTTEKTLMEYFAQFGEVTDVYIPKPFRHFGFVTFASGELAKKVLSQNHRISGSLLNITFAEPKST 273          
BLAST of TAR DNA-binding protein 43 vs. Ensembl Nematostella
Match: EDO36522 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SIF0])

HSP 1 Score: 78.1814 bits (191), Expect = 2.605e-16
Identity = 58/174 (33.33%), Postives = 83/174 (47.70%), Query Frame = 3
Query:  399 LIVLNLGWKVDEETLRKYFSKFGELVLVQVKKDRETSHSKGYAFIRFADYAAQVLCLAEK-----HLIDGRWCAVK--VPFSKNEADKQEISKKIHVGYASEEISMEDLRIA----FEQYGYVTDIFIPKP----FRNFAFVTFDSSDTAQSLIG-QSININGITLTIGSAVPK 872
            L V  L  +   ETLR+YF  +GEL  V V  D  T  S+G+ ++ FADY      L +K     H IDG+   VK  +P   N A   E +KKI VG   E+ + ED++ A     E+     D+ + K      R FAFV  ++ D A  L   + I++ G  +    A P+
Sbjct:   16 LFVGGLNRETTNETLREYFEAYGELTDVVVICDSATKKSRGFGYVTFADYKVTRNVLKDKVENGAHRIDGKEVEVKRAIPRDDNSATSHEKTKKIFVGGLPEDATKEDIQEAIESLLEEKVDKVDLIMKKEDETKHRGFAFVELNNEDQADELCCVKKIHVKGKMVEAKKATPR 189          
BLAST of TAR DNA-binding protein 43 vs. Ensembl Nematostella
Match: EDO38417 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SCX6])

HSP 1 Score: 76.2554 bits (186), Expect = 8.563e-15
Identity = 60/167 (35.93%), Postives = 86/167 (51.50%), Query Frame = 3
Query:  399 LIVLNLGWKVDEETLRKYFSKFGELVLVQVKKDRETSHSKGYAFIRFA--DYAAQVLCLAEKHLIDGRWCAVKVPFSKNEADKQEISKKIHVGYASEEISMEDLRIAF-EQYGYVTDI-FIPKPF----RNFAFVTFDSSDTAQSLI-GQSININGITLTIGSAVPK 872
            L V  L ++  +E+L++YFSK+GELV V +K D  T   +G+AF++F     A  VL   + H++DGR    K P +          KKI VG    E S E +R  F + Y  V +I +I +      R F FV+FDS DT   +   Q  NI G  + +  A+PK
Sbjct:   31 LFVGGLSYETTKESLKEYFSKYGELVGVDIKMDALTGRPRGFAFVQFKHQSEADAVLNQVDPHVLDGRTIDPK-PAAPIGKPPHLRVKKIFVGGLKPETSDEKIREYFGKAYAPVKEIEYITEHSSNRRRGFCFVSFDSEDTVDKICETQFHNIEGNKVEVKRALPK 196          
BLAST of TAR DNA-binding protein 43 vs. Ensembl Nematostella
Match: EDO39879 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S8S5])

HSP 1 Score: 73.1738 bits (178), Expect = 1.183e-14
Identity = 51/166 (30.72%), Postives = 80/166 (48.19%), Query Frame = 3
Query:  399 LIVLNLGWKVDEETLRKYFSKFGELVLVQVKKDRETSHSKGYAFIRFAD-YAAQVLCLAEKHLIDGRWCAVKVPFSKNEADKQ-EISKKIHVGYASEEISMEDLRIAFEQYGYVTDIFI-----PKPFRNFAFVTFDSSDTAQSLIGQSIN-INGITLTIGSAVPK 872
            + +  L W+   E LR++F KFGEL    V +D  T  S+G+ F+ F D  A  V+  +    +DG+    K+   K    K    +KKI +G  S   S ED++  F Q+G +T+  +      +  R F FVTF+S ++A        + IN   + +  A PK
Sbjct:    2 MFIGGLSWQTTAEGLRQHFEKFGELKECVVMRDPVTKRSRGFGFLTFKDPKAVDVVLNSGAQELDGKKIDPKLAVPKRAPAKMVTTTKKIFIGGLSTNTSEEDMKKYFSQFGKITETMLMFDKATQRHRGFGFVTFESENSADKACDTQYHLINNKKVEVKKAQPK 167          
BLAST of TAR DNA-binding protein 43 vs. Ensembl Nematostella
Match: EDO40104 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S851])

HSP 1 Score: 55.4546 bits (132), Expect = 2.394e-9
Identity = 30/84 (35.71%), Postives = 49/84 (58.33%), Query Frame = 3
Query:  372 RLEGRKCTDLIVLNLGWKVDEETLRKYFSKFGELVLVQVKKDRETSHSKGYAFIRFADY-AAQVLCLAEKHLIDGRWCAVKVPF 620
            R +  K T L V  + ++  ++ LRK+F++FGE+    V KDR T  SKGY F+  A   AA++ C  ++ +I+GR   V + +
Sbjct:    3 RNQDTKFTKLFVGGIPYESGDDALRKFFAQFGEIREAVVIKDRVTKKSKGYGFVTMATSDAAELACKNKRPMIEGRQANVNLAY 86          
BLAST of TAR DNA-binding protein 43 vs. Ensembl Medaka
Match: tardbp (TAR DNA-binding protein 43-like [Source:NCBI gene;Acc:101167445])

HSP 1 Score: 239.965 bits (611), Expect = 2.660e-69
Identity = 116/249 (46.59%), Postives = 167/249 (67.07%), Query Frame = 3
Query:  144 DDTVLLTTLGGIFPNVCGLKYRAPETNTFRALKLSDGKFYKPVEGWEDLKFYCVFPKDNNKRKIDEEIEKPLQKSKRLEGRKCTDLIVLNLGWKVDEETLRKYFSKFGELVLVQVKKDRETSHSKGYAFIRFADYAAQVLCLAEKHLIDGRWCAVKVPFSKNEADKQEISKKIHVGYASEEISMEDLRIAFEQYGYVTDIFIPKPFRNFAFVTFDSSDTAQSLIGQSININGITLTIGSAVPKINSNRK 890
            D TVLL+T+   FP  CGL++R+P +   R ++L +G  + P  GW ++ +   +PKDN KRK+DE       K KR +  K +DLIVL L WK  E+ L+ YFS FGE+++VQVK+D +T +SKG+ F+RF +Y AQ   ++++H+IDGRWC  K+P SK   D+   S+K+ VG  +E+++ +DLR  F QYG VTD+FIPKPFR FAFVTF     AQSL G+ + I G+++ I +A PK + NR+
Sbjct:   24 DGTVLLSTVAAQFPGACGLRFRSPVSQCMRGVRLVEGVLHAPETGWGNVVYVVNYPKDN-KRKMDEIDASSAVKMKRGD-MKTSDLIVLGLPWKTTEQDLKDYFSTFGEVIMVQVKRDAKTGNSKGFGFVRFTEYEAQEKVISQRHMIDGRWCDCKLPNSKQGPDEPLRSRKVFVGRCTEDMTTDDLRQFFMQYGEVTDVFIPKPFRAFAFVTFADDQVAQSLCGEDLIIKGVSVHISNAEPK-HGNRQ 269          

HSP 2 Score: 81.2629 bits (199), Expect = 1.694e-15
Identity = 39/87 (44.83%), Postives = 57/87 (65.52%), Query Frame = -2
Query: 3886 TKKIHVSYSAEELEMEDLRKAFEEYGYVVDIFIPKPFRNFAFVTFELSEVAQQLIGRCVTVKGHTLTIGSAVPKITGNKKLPIPAQF 4146
            ++K+ V    E++  +DLR+ F +YG V D+FIPKPFR FAFVTF   +VAQ L G  + +KG ++ I +A PK  GN++    A+F
Sbjct:  191 SRKVFVGRCTEDMTTDDLRQFFMQYGEVTDVFIPKPFRAFAFVTFADDQVAQSLCGEDLIIKGVSVHISNAEPK-HGNRQYDRTARF 276          
BLAST of TAR DNA-binding protein 43 vs. Ensembl Medaka
Match: tardbpl (TAR DNA binding protein [Source:NCBI gene;Acc:101173545])

HSP 1 Score: 234.187 bits (596), Expect = 1.024e-68
Identity = 115/246 (46.75%), Postives = 163/246 (66.26%), Query Frame = 3
Query:  144 DDTVLLTTLGGIFPNVCGLKYRAPETNTFRALKLSDGKFYKPVEGWEDLKFYCVFPKDNNKRKIDEEIEKPLQKSKRLEGRKCTDLIVLNLGWKVDEETLRKYFSKFGELVLVQVKKDRETSHSKGYAFIRFADYAAQVLCLAEKHLIDGRWCAVKVPFSKNEADKQEISKKIHVGYASEEISMEDLRIAFEQYGYVTDIFIPKPFRNFAFVTFDSSDTAQSLIGQSININGITLTIGSAVPKINS 881
            D TVLL+++   FP  CGL+YR PE+   R ++L +G  + P   W +L +   +PKDN KRK++E       K KR   +K +DLIVL L WK  E+ L+ YFS FGE+++VQVK+D +T +SKG+ F+RFADY  Q   + ++H+IDGRWC  K+P SK   D+   S+KI VG  +E+++ ++LR  F QYG VTD+FIPKPFR FAFVTF     AQ+L G+ + I G+++ I +A PK N+
Sbjct:   24 DGTVLLSSVAAQFPGACGLRYRNPESQCMRGVRLVEGVLHAPENEWGNLVYVVNYPKDN-KRKMEEIDAASAVKVKR-GFQKTSDLIVLGLPWKTTEQDLKDYFSTFGEVIMVQVKRDAKTGNSKGFGFVRFADYETQTKVITQRHMIDGRWCDCKLPNSKVCPDEPMRSRKIFVGRCTEDMTPDELRQYFMQYGEVTDVFIPKPFRAFAFVTFADDQVAQALCGEDLIIKGVSVHISNAEPKHNN 267          

HSP 2 Score: 74.3294 bits (181), Expect = 1.007e-13
Identity = 35/74 (47.30%), Postives = 50/74 (67.57%), Query Frame = -2
Query: 3925 TKKIHVSYSAEELEMEDLRKAFEEYGYVVDIFIPKPFRNFAFVTFELSEVAQQLIGRCVTVKGHTLTIGSAVPK 4146
            ++KI V    E++  ++LR+ F +YG V D+FIPKPFR FAFVTF   +VAQ L G  + +KG ++ I +A PK
Sbjct:  191 SRKIFVGRCTEDMTPDELRQYFMQYGEVTDVFIPKPFRAFAFVTFADDQVAQALCGEDLIIKGVSVHISNAEPK 264          
BLAST of TAR DNA-binding protein 43 vs. Ensembl Medaka
Match: tardbpl (TAR DNA binding protein [Source:NCBI gene;Acc:101173545])

HSP 1 Score: 210.305 bits (534), Expect = 6.222e-61
Identity = 104/214 (48.60%), Postives = 144/214 (67.29%), Query Frame = 3
Query:  144 DDTVLLTTLGGIFPNVCGLKYRAPETNTFRALKLSDGKFYKPVEGWEDLKFYCVFPKDNNKRKIDEEIEKPLQKSKRLEGRKCTDLIVLNLGWKVDEETLRKYFSKFGELVLVQVKKDRETSHSKGYAFIRFADYAAQVLCLAEKHLIDGRWCAVKVPFSKNEADKQEISKKIHVGYASEEISMEDLRIAFEQYGYVTDIFIPKPFRNFAFVTF 785
            D TVLL+++   FP  CGL+YR PE+   R ++L +G  + P   W +L +   +PKDN KRK++E       K KR   +K +DLIVL L WK  E+ L+ YFS FGE+++VQVK+D +T +SKG+ F+RFADY  Q   + ++H+IDGRWC  K+P SK   D+   S+KI VG  +E+++ ++LR  F QYG VTD+FIPKPFR FAFVTF
Sbjct:   24 DGTVLLSSVAAQFPGACGLRYRNPESQCMRGVRLVEGVLHAPENEWGNLVYVVNYPKDN-KRKMEEIDAASAVKVKR-GFQKTSDLIVLGLPWKTTEQDLKDYFSTFGEVIMVQVKRDAKTGNSKGFGFVRFADYETQTKVITQRHMIDGRWCDCKLPNSKVCPDEPMRSRKIFVGRCTEDMTPDELRQYFMQYGEVTDVFIPKPFRAFAFVTF 235          

HSP 2 Score: 56.225 bits (134), Expect = 7.496e-8
Identity = 24/45 (53.33%), Postives = 33/45 (73.33%), Query Frame = -2
Query: 4012 TKKIHVSYSAEELEMEDLRKAFEEYGYVVDIFIPKPFRNFAFVTF 4146
            ++KI V    E++  ++LR+ F +YG V D+FIPKPFR FAFVTF
Sbjct:  191 SRKIFVGRCTEDMTPDELRQYFMQYGEVTDVFIPKPFRAFAFVTF 235          
BLAST of TAR DNA-binding protein 43 vs. Ensembl Medaka
Match: msi2a (musashi RNA binding protein 2 [Source:NCBI gene;Acc:101163923])

HSP 1 Score: 85.8853 bits (211), Expect = 1.417e-17
Identity = 49/145 (33.79%), Postives = 75/145 (51.72%), Query Frame = 3
Query:  399 LIVLNLGWKVDEETLRKYFSKFGELVLVQVKKDRETSHSKGYAFIRFADYAAQVLCLAEKHL-IDGRWCAVKVPFSKNEADKQEI-SKKIHVGYASEEISMEDLRIAFEQYGYVTDIFI-----PKPFRNFAFVTFDSSDTAQSL 812
            + +  L W+   ++LR YFSKFGE+    V +D  T  S+G+ F+ F D A+    LA++H  +D +    KV F +    K    +KKI VG  S    +ED++  FEQ+G V D  +         R F F+TF+S D  + +
Sbjct:   23 MFIGGLSWQTSPDSLRDYFSKFGEIRECMVMRDPTTKRSRGFGFVTFTDAASVDKVLAQQHHELDSKTIDPKVAFPRRAQPKMVTRTKKIFVGGLSANTVVEDVKQYFEQFGKVDDAMLMFDKTTNRHRGFGFITFESEDIVEKV 167          
BLAST of TAR DNA-binding protein 43 vs. Ensembl Medaka
Match: msi2a (musashi RNA binding protein 2 [Source:NCBI gene;Acc:101163923])

HSP 1 Score: 86.2705 bits (212), Expect = 1.738e-17
Identity = 49/145 (33.79%), Postives = 75/145 (51.72%), Query Frame = 3
Query:  399 LIVLNLGWKVDEETLRKYFSKFGELVLVQVKKDRETSHSKGYAFIRFADYAAQVLCLAEKHL-IDGRWCAVKVPFSKNEADKQEI-SKKIHVGYASEEISMEDLRIAFEQYGYVTDIFI-----PKPFRNFAFVTFDSSDTAQSL 812
            + +  L W+   ++LR YFSKFGE+    V +D  T  S+G+ F+ F D A+    LA++H  +D +    KV F +    K    +KKI VG  S    +ED++  FEQ+G V D  +         R F F+TF+S D  + +
Sbjct:   23 MFIGGLSWQTSPDSLRDYFSKFGEIRECMVMRDPTTKRSRGFGFVTFTDAASVDKVLAQQHHELDSKTIDPKVAFPRRAQPKMVTRTKKIFVGGLSANTVVEDVKQYFEQFGKVDDAMLMFDKTTNRHRGFGFITFESEDIVEKV 167          
BLAST of TAR DNA-binding protein 43 vs. Planmine SMEST
Match: SMESG000032661.1 (SMESG000032661.1)

HSP 1 Score: 766.148 bits (1977), Expect = 0.000e+0
Identity = 448/448 (100.00%), Postives = 448/448 (100.00%), Query Frame = 3
Query:   81 MYYIAVCXXXXXXXXXXXXXXDDTVLLTTLGGIFPNVCGLKYRAPETNTFRALKLSDGKFYKPVEGWEDLKFYCVFPKDNNKRKIDEEIEKPLQKSKRLEGRKCTDLIVLNLGWKVDEETLRKYFSKFGELVLVQVKKDRETSHSKGYAFIRFADYAAQVLCLAEKHLIDGRWCAVKVPFSKNEADKQEISKKIHVGYASEEISMEDLRIAFEQYGYVTDIFIPKPFRNFAFVTFDSSDTAQSLIGQSININGITLTIGSAVPKINSNRKXXXXXXXXXXXXXXHYPMYGDNMQSAQGYQTRYAPGMIPTYGAAWPPSYDMAAAQKAARMNSSNXXXXXXXXXXXXXXXXXXXXMLTGQAAYHLMSNGNRAGQEAMQQGGYASQEMMHQNYMSQYGAGDPNQHGSXXXXXXXXXXXPEXXXXXXXXXXXXXXSNSMHSGGGGGKYNMK 1424
            MYYIAVCEYEESETIEIPVEEDDTVLLTTLGGIFPNVCGLKYRAPETNTFRALKLSDGKFYKPVEGWEDLKFYCVFPKDNNKRKIDEEIEKPLQKSKRLEGRKCTDLIVLNLGWKVDEETLRKYFSKFGELVLVQVKKDRETSHSKGYAFIRFADYAAQVLCLAEKHLIDGRWCAVKVPFSKNEADKQEISKKIHVGYASEEISMEDLRIAFEQYGYVTDIFIPKPFRNFAFVTFDSSDTAQSLIGQSININGITLTIGSAVPKINSNRKGGAGGGGGSGGGGGHYPMYGDNMQSAQGYQTRYAPGMIPTYGAAWPPSYDMAAAQKAARMNSSNAYAGATAAAAAAAAGYPGGGMLTGQAAYHLMSNGNRAGQEAMQQGGYASQEMMHQNYMSQYGAGDPNQHGSAANAALNILNNPEVVAAIVAAANKAGVSNSMHSGGGGGKYNMK
Sbjct:    1 MYYIAVCEYEESETIEIPVEEDDTVLLTTLGGIFPNVCGLKYRAPETNTFRALKLSDGKFYKPVEGWEDLKFYCVFPKDNNKRKIDEEIEKPLQKSKRLEGRKCTDLIVLNLGWKVDEETLRKYFSKFGELVLVQVKKDRETSHSKGYAFIRFADYAAQVLCLAEKHLIDGRWCAVKVPFSKNEADKQEISKKIHVGYASEEISMEDLRIAFEQYGYVTDIFIPKPFRNFAFVTFDSSDTAQSLIGQSININGITLTIGSAVPKINSNRKGGAGGGGGSGGGGGHYPMYGDNMQSAQGYQTRYAPGMIPTYGAAWPPSYDMAAAQKAARMNSSNAYAGATAAAAAAAAGYPGGGMLTGQAAYHLMSNGNRAGQEAMQQGGYASQEMMHQNYMSQYGAGDPNQHGSAANAALNILNNPEVVAAIVAAANKAGVSNSMHSGGGGGKYNMK 448          

HSP 2 Score: 141.354 bits (355), Expect = 2.685e-35
Identity = 102/239 (42.68%), Postives = 127/239 (53.14%), Query Frame = -2
Query: 3547 QSEADKQEITKKIHVSYSAEELEMEDLRKAFEEYGYVVDIFIPKPFRNFAFVTFELSEVAQQLIGRCVTVKGHTLTIGSAVPKITGNKK---------LPIPAQFPICPYNEQ---------GPMTAGRYG--W-SSYEPAPMQ-SSRYKARQFRNSAIMGNYGTLMSTAAVANSSSNQSY-LMSNGR------IHPHGLISFEYNHQQSSQQAVPAATDIGQN-TAAMAALNILNNPD 4173
            ++EADKQEI+KKIHV Y++EE+ MEDLR AFE+YGYV DIFIPKPFRNFAFVTF+ S+ AQ LIG+ + + G TLTIGSAVPKI  N+K               +P+   N Q          P     YG  W  SY+ A  Q ++R  +      A                 +   +Y LMSNG       +   G  S E  HQ    Q    A D  Q+ +AA AALNILNNP+
Sbjct:  182 KNEADKQEISKKIHVGYASEEISMEDLRIAFEQYGYVTDIFIPKPFRNFAFVTFDSSDTAQSLIGQSININGITLTIGSAVPKINSNRKGGAGGGGGSGGGGGHYPMYGDNMQSAQGYQTRYAPGMIPTYGAAWPPSYDMAAAQKAARMNSSNAYAGATAAAAAAAAGYPGGGMLTGQAAYHLMSNGNRAGQEAMQQGGYASQEMMHQNYMSQY--GAGDPNQHGSAANAALNILNNPE 418          
BLAST of TAR DNA-binding protein 43 vs. Planmine SMEST
Match: SMESG000032661.1 (SMESG000032661.1)

HSP 1 Score: 710.679 bits (1833), Expect = 0.000e+0
Identity = 427/448 (95.31%), Postives = 428/448 (95.54%), Query Frame = 3
Query:   81 MYYIAVCXXXXXXXXXXXXXXDDTVLLTTLGGIFPNVCGLKYRAPETNTFRALKLSDGKFYKPVEGWEDLKFYCVFPKDNNKRKIDEEIEKPLQKSKRLEGRKCTDLIVLNLGWKVDEETLRKYFSKFGELVLVQVKKDRETSHSKGYAFIRFADYAAQVLCLAEKHLIDGRWCAVKVPFSKNEADKQEISKKIHVGYASEEISMEDLRIAFEQYGYVTDIFIPKPFRNFAFVTFDSSDTAQSLIGQSININGITLTIGSAVPKINSNRKXXXXXXXXXXXXXXHYPMYGDNMQSAQGYQTRYAPGMIPTYGAAWPPSYDMAAAQKAARMNSSNXXXXXXXXXXXXXXXXXXXXMLTGQAAYHLMSNGNRAGQEAMQQGGYASQEMMHQNYMSQYGAGDPNQHGSXXXXXXXXXXXPEXXXXXXXXXXXXXXSNSMHSGGGGGKYNMK 1424
            MYYIAVCEYEESETIEIPVEEDDTVLLTTLGGIFPNVCGLKYRAPETNTFRALKLSDGKFYKPVEGWEDLKFYCVFPKDNNKRKIDEEIEKPLQK                    +DEETLRKYFSKFGELVLVQVKKDRETSHSKGYAFIRFADYAAQVLCLAEKHLIDGRWCAVKVPFSKNEADKQEISKKIHVGYASEEISMEDLRIAFEQYGYVTDIFIPKPFRNFAFVTFDSSDTAQSLIGQSININGITLTIGSAVPKINSNRKGGAGGGGGSGGGGGHYPMYGDNMQSAQGYQTRYAPGMIPTYGAAWPPSYDMAAAQKAARMNSSNAYAGATAAAAAAAAGYPGGGMLTGQAAYHLMSNGNRAGQEAMQQGGYASQEMMHQNYMSQYGAGDPNQHGSAANAALNILNNPEVVAAIVAAANKAGVSNSMHSGGGGGKYNMK
Sbjct:    1 MYYIAVCEYEESETIEIPVEEDDTVLLTTLGGIFPNVCGLKYRAPETNTFRALKLSDGKFYKPVEGWEDLKFYCVFPKDNNKRKIDEEIEKPLQK--------------------IDEETLRKYFSKFGELVLVQVKKDRETSHSKGYAFIRFADYAAQVLCLAEKHLIDGRWCAVKVPFSKNEADKQEISKKIHVGYASEEISMEDLRIAFEQYGYVTDIFIPKPFRNFAFVTFDSSDTAQSLIGQSININGITLTIGSAVPKINSNRKGGAGGGGGSGGGGGHYPMYGDNMQSAQGYQTRYAPGMIPTYGAAWPPSYDMAAAQKAARMNSSNAYAGATAAAAAAAAGYPGGGMLTGQAAYHLMSNGNRAGQEAMQQGGYASQEMMHQNYMSQYGAGDPNQHGSAANAALNILNNPEVVAAIVAAANKAGVSNSMHSGGGGGKYNMK 428          

HSP 2 Score: 141.354 bits (355), Expect = 2.146e-35
Identity = 102/239 (42.68%), Postives = 127/239 (53.14%), Query Frame = -2
Query: 3547 QSEADKQEITKKIHVSYSAEELEMEDLRKAFEEYGYVVDIFIPKPFRNFAFVTFELSEVAQQLIGRCVTVKGHTLTIGSAVPKITGNKK---------LPIPAQFPICPYNEQ---------GPMTAGRYG--W-SSYEPAPMQ-SSRYKARQFRNSAIMGNYGTLMSTAAVANSSSNQSY-LMSNGR------IHPHGLISFEYNHQQSSQQAVPAATDIGQN-TAAMAALNILNNPD 4173
            ++EADKQEI+KKIHV Y++EE+ MEDLR AFE+YGYV DIFIPKPFRNFAFVTF+ S+ AQ LIG+ + + G TLTIGSAVPKI  N+K               +P+   N Q          P     YG  W  SY+ A  Q ++R  +      A                 +   +Y LMSNG       +   G  S E  HQ    Q    A D  Q+ +AA AALNILNNP+
Sbjct:  162 KNEADKQEISKKIHVGYASEEISMEDLRIAFEQYGYVTDIFIPKPFRNFAFVTFDSSDTAQSLIGQSININGITLTIGSAVPKINSNRKGGAGGGGGSGGGGGHYPMYGDNMQSAQGYQTRYAPGMIPTYGAAWPPSYDMAAAQKAARMNSSNAYAGATAAAAAAAAGYPGGGMLTGQAAYHLMSNGNRAGQEAMQQGGYASQEMMHQNYMSQY--GAGDPNQHGSAANAALNILNNPE 398          
BLAST of TAR DNA-binding protein 43 vs. Planmine SMEST
Match: SMESG000032660.1 (SMESG000032660.1)

HSP 1 Score: 471.085 bits (1211), Expect = 2.747e-153
Identity = 245/246 (99.59%), Postives = 246/246 (100.00%), Query Frame = -2
Query: 3436 QSEADKQEITKKIHVSYSAEELEMEDLRKAFEEYGYVVDIFIPKPFRNFAFVTFELSEVAQQLIGRCVTVKGHTLTIGSAVPKITGNKKLPIPAQFPICPYNEQGPMTAGRYGWSSYEPAPMQSSRYKARQFRNSAIMGNYGTLMSTAAVANSSSNQSYLMSNGRIHPHGLISFEYNHQQSSQQAVPAATDIGQNTAAMAALNILNNPDXXXXXXXXXXXANKSGLSHHXXXXXQNLYSHQHGAMQ 4173
            +SEADKQEITKKIHVSYSAEELEMEDLRKAFEEYGYVVDIFIPKPFRNFAFVTFELSEVAQQLIGRCVTVKGHTLTIGSAVPKITGNKKLPIPAQFPICPYNEQGPMTAGRYGWSSYEPAPMQSSRYKARQFRNSAIMGNYGTLMSTAAVANSSSNQSYLMSNGRIHPHGLISFEYNHQQSSQQAVPAATDIGQNTAAMAALNILNNPDVVAAIVAAAAAANKSGLSHHQQQQQQNLYSHQHGAMQ
Sbjct:  183 KSEADKQEITKKIHVSYSAEELEMEDLRKAFEEYGYVVDIFIPKPFRNFAFVTFELSEVAQQLIGRCVTVKGHTLTIGSAVPKITGNKKLPIPAQFPICPYNEQGPMTAGRYGWSSYEPAPMQSSRYKARQFRNSAIMGNYGTLMSTAAVANSSSNQSYLMSNGRIHPHGLISFEYNHQQSSQQAVPAATDIGQNTAAMAALNILNNPDVVAAIVAAAAAANKSGLSHHQQQQQQNLYSHQHGAMQ 428          

HSP 2 Score: 390.193 bits (1001), Expect = 4.401e-123
Identity = 182/250 (72.80%), Postives = 210/250 (84.00%), Query Frame = 3
Query:  144 DDTVLLTTLGGIFPNVCGLKYRAPETNTFRALKLSDGKFYKPVEGWEDLKFYCVFPKD-NNKRKIDEEIEKPLQKSKRLEGRKCTDLIVLNLGWKVDEETLRKYFSKFGELVLVQVKKDRETSHSKGYAFIRFADYAAQVLCLAEKHLIDGRWCAVKVPFSKNEADKQEISKKIHVGYASEEISMEDLRIAFEQYGYVTDIFIPKPFRNFAFVTFDSSDTAQSLIGQSININGITLTIGSAVPKINSNRK 890
            DDT+L TTL G FP V GLKYR   +  FRA+KLS+GK +KP+EGW  LK  CVFPK+ +NKRK  EE E P  K+KRL+ RKCTDLIVLNLGWKVDEE LR YFSKFG+LVLVQ+KKDRET+HSKGYAF+RFADY  QVLCLAE+HLIDGRWC+VKVPFSK+EADKQEI+KKIHV Y++EE+ MEDLR AFE+YGYV DIFIPKPFRNFAFVTF+ S+ AQ LIG+ + + G TLTIGSAVPKI  N+K
Sbjct:   22 DDTILFTTLSGQFPKVSGLKYRFSGSLNFRAIKLSEGKLFKPLEGWGSLKLICVFPKEIDNKRKCKEEYEIPTPKTKRLDTRKCTDLIVLNLGWKVDEEMLRNYFSKFGDLVLVQIKKDRETNHSKGYAFVRFADYDGQVLCLAEQHLIDGRWCSVKVPFSKSEADKQEITKKIHVSYSAEELEMEDLRKAFEEYGYVVDIFIPKPFRNFAFVTFELSEVAQQLIGRCVTVKGHTLTIGSAVPKITGNKK 271          
BLAST of TAR DNA-binding protein 43 vs. Planmine SMEST
Match: SMESG000032660.1 (SMESG000032660.1)

HSP 1 Score: 381.719 bits (979), Expect = 3.738e-122
Identity = 180/246 (73.17%), Postives = 207/246 (84.15%), Query Frame = 3
Query:  144 DDTVLLTTLGGIFPNVCGLKYRAPETNTFRALKLSDGKFYKPVEGWEDLKFYCVFPKD-NNKRKIDEEIEKPLQKSKRLEGRKCTDLIVLNLGWKVDEETLRKYFSKFGELVLVQVKKDRETSHSKGYAFIRFADYAAQVLCLAEKHLIDGRWCAVKVPFSKNEADKQEISKKIHVGYASEEISMEDLRIAFEQYGYVTDIFIPKPFRNFAFVTFDSSDTAQSLIGQSININGITLTIGSAVPKIN 878
            DDT+L TTL G FP V GLKYR   +  FRA+KLS+GK +KP+EGW  LK  CVFPK+ +NKRK  EE E P  K+KRL+ RKCTDLIVLNLGWKVDEE LR YFSKFG+LVLVQ+KKDRET+HSKGYAF+RFADY  QVLCLAE+HLIDGRWC+VKVPFSK+EADKQEI+KKIHV Y++EE+ MEDLR AFE+YGYV DIFIPKPFRNFAFVTF+ S+ AQ LIG+ + + G TLTIGSAVPKI 
Sbjct:   22 DDTILFTTLSGQFPKVSGLKYRFSGSLNFRAIKLSEGKLFKPLEGWGSLKLICVFPKEIDNKRKCKEEYEIPTPKTKRLDTRKCTDLIVLNLGWKVDEEMLRNYFSKFGDLVLVQIKKDRETNHSKGYAFVRFADYDGQVLCLAEQHLIDGRWCSVKVPFSKSEADKQEITKKIHVSYSAEELEMEDLRKAFEEYGYVVDIFIPKPFRNFAFVTFELSEVAQQLIGRCVTVKGHTLTIGSAVPKIT 267          

HSP 2 Score: 178.333 bits (451), Expect = 1.295e-49
Identity = 85/86 (98.84%), Postives = 86/86 (100.00%), Query Frame = -2
Query: 3916 QSEADKQEITKKIHVSYSAEELEMEDLRKAFEEYGYVVDIFIPKPFRNFAFVTFELSEVAQQLIGRCVTVKGHTLTIGSAVPKITG 4173
            +SEADKQEITKKIHVSYSAEELEMEDLRKAFEEYGYVVDIFIPKPFRNFAFVTFELSEVAQQLIGRCVTVKGHTLTIGSAVPKITG
Sbjct:  183 KSEADKQEITKKIHVSYSAEELEMEDLRKAFEEYGYVVDIFIPKPFRNFAFVTFELSEVAQQLIGRCVTVKGHTLTIGSAVPKITG 268          
BLAST of TAR DNA-binding protein 43 vs. Planmine SMEST
Match: SMESG000012144.1 (SMESG000012144.1)

HSP 1 Score: 283.493 bits (724), Expect = 2.255e-84
Identity = 145/270 (53.70%), Postives = 195/270 (72.22%), Query Frame = 3
Query:   81 MYYIAVCXXXXXXXXXXXXXXDDTVLLTTLGGIFPNVCGLKYRAPETNTFRALKLSDGKFYKPVEGWEDLKFYCVFPKDNNKRKIDEEIEKPLQKSKRLEGRKCTDLIVLNLGWKVDEETLRKYFSKFGELVLVQVKKDRETSHSKGYAFIRFADYAAQVLCLAEKHLIDGRWCAVKVPFSKNEADKQEISKKIHVGYASEEISMEDLRIAFEQYGYVTDIFIPKPFRNFAFVTFDSSDTAQSLIGQSININ-GITLTIGSAVPKINSNR 887
            M Y+ VCE EE  TIE+P+EED T+LL+TL   FP   GLKY++ +T  +R ++ +  +FY P EGWE   + CV  KDN KRK D+E +  L K+K++EG+KCTDLIVLN+ W+ D+E L+ YFSKFG++V+VQVK++ +T  SKGYAFIRFADY AQV+CLAE+H ID RWC VK+P+SK   +  E+  KIHVG  SE ++ + LR  F QYG V  I+IP+PFR+FAFV+F+   TAQSL+G+ + IN    +TI +A PK N N+
Sbjct:    1 MKYVIVCEEEEEPTIELPLEEDGTLLLSTLTCQFPKATGLKYKSKDTGIYRGVRFASDRFYPPPEGWETYTYSCVLFKDN-KRKSDDE-QYTLAKTKKMEGKKCTDLIVLNIPWRTDDEALKMYFSKFGDVVMVQVKREPDTLKSKGYAFIRFADYDAQVMCLAEQHCIDNRWCEVKIPYSKMNPEANEVRNKIHVGRLSEAVTADVLRSFFNQYGKVESIYIPRPFRSFAFVSFEDESTAQSLLGRELKINDDCVVTISAASPKSNHNQ 268          

HSP 2 Score: 87.0409 bits (214), Expect = 1.931e-17
Identity = 68/214 (31.78%), Postives = 98/214 (45.79%), Query Frame = -2
Query: 3550 MQSEADKQEITKKIHVSYSAEELEMEDLRKAFEEYGYVVDIFIPKPFRNFAFVTFELSEVAQQLIGRCVTVKGHT-LTIGSAVPKITGNKKLPIPAQFPICPYNEQGPMTAGRYGWSSYEPAPMQSSRYKARQFRNSAIMGNYGTLMSTAAVANSSSNQSYLMSNGRIHPHGLISF-EYNHQQSSQ---QAVPAATDIGQNTAAMAALNILNNP 4176
            M  EA+  E+  KIHV   +E +  + LR  F +YG V  I+IP+PFR+FAFV+FE    AQ L+GR + +     +TI +A PK   N+             N  G    G   W++Y+                  +  +         +  + S Q+ LM N    PH   ++ +  H  +SQ   Q      D+ QNT AMAALNI+NNP
Sbjct:  181 MNPEAN--EVRNKIHVGRLSEAVTADVLRSFFNQYGKVESIYIPRPFRSFAFVSFEDESTAQSLLGRELKINDDCVVTISAASPKSNHNQN------------NMNGRAQPGYGHWNTYD------------------VFSD-----GRGGMNRNRSCQNKLMPNSNQMPHEWSNYLQQQHMHASQAQAQRQFTTPDMSQNTNAMAALNIINNP 357          
The following BLAST results are available for this feature:
BLAST of TAR DNA-binding protein 43 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
TARDBP6.278e-7348.59TAR DNA binding protein [Source:HGNC Symbol;Acc:HG... [more]
TARDBP6.278e-7348.59TAR DNA binding protein [Source:HGNC Symbol;Acc:HG... [more]
TARDBP7.571e-7348.59TAR DNA binding protein [Source:HGNC Symbol;Acc:HG... [more]
TARDBP7.571e-7348.59TAR DNA binding protein [Source:HGNC Symbol;Acc:HG... [more]
AL109811.37.571e-7348.59novel protein[more]
back to top
BLAST of TAR DNA-binding protein 43 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
tdp-12.881e-3630.50Tar DNA-binding protein homolog 1 [Source:UniProt... [more]
tdp-14.701e-3631.23Tar DNA-binding protein homolog 1 [Source:UniProt... [more]
msi-14.699e-1732.53MuSashI (Fly neural) family; Neural RNA-binding pr... [more]
sqd-13.638e-1631.79Homologous to Drosophila SQD (Squid) protein [Sou... [more]
sqd-13.638e-1631.79Homologous to Drosophila SQD (Squid) protein [Sou... [more]
back to top
BLAST of TAR DNA-binding protein 43 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
TBPH5.843e-7448.21gene:FBgn0025790 transcript:FBtr0089626[more]
TBPH4.365e-7348.02gene:FBgn0025790 transcript:FBtr0089625[more]
TBPH4.365e-7348.02gene:FBgn0025790 transcript:FBtr0089624[more]
TBPH4.365e-7348.02gene:FBgn0025790 transcript:FBtr0089627[more]
TBPH4.365e-7348.02gene:FBgn0025790 transcript:FBtr0301643[more]
back to top
BLAST of TAR DNA-binding protein 43 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
tardbp1.748e-6844.27TAR DNA binding protein [Source:ZFIN;Acc:ZDB-GENE-... [more]
tardbpl2.678e-6845.93TAR DNA binding protein, like [Source:ZFIN;Acc:ZDB... [more]
tardbpl2.678e-6845.93TAR DNA binding protein, like [Source:ZFIN;Acc:ZDB... [more]
tardbpl2.678e-6845.93TAR DNA binding protein, like [Source:ZFIN;Acc:ZDB... [more]
tardbp1.410e-6744.14TAR DNA binding protein [Source:ZFIN;Acc:ZDB-GENE-... [more]
back to top
BLAST of TAR DNA-binding protein 43 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
jarid21.516e-7349.26jumonji and AT-rich interaction domain containing ... [more]
jarid21.928e-4650.00jumonji and AT-rich interaction domain containing ... [more]
kcnj42.074e-1633.79potassium inwardly rectifying channel subfamily J ... [more]
kcnj42.569e-1633.79potassium inwardly rectifying channel subfamily J ... [more]
kcnj42.781e-1633.79potassium inwardly rectifying channel subfamily J ... [more]
back to top
BLAST of TAR DNA-binding protein 43 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Tardbp7.918e-7348.59TAR DNA binding protein [Source:MGI Symbol;Acc:MGI... [more]
Tardbp1.184e-7248.59TAR DNA binding protein [Source:MGI Symbol;Acc:MGI... [more]
Tardbp1.184e-7248.59TAR DNA binding protein [Source:MGI Symbol;Acc:MGI... [more]
Tardbp1.184e-7248.59TAR DNA binding protein [Source:MGI Symbol;Acc:MGI... [more]
Tardbp1.184e-7248.59TAR DNA binding protein [Source:MGI Symbol;Acc:MGI... [more]
back to top
BLAST of TAR DNA-binding protein 43 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q28F51|TADBP_XENTR7.247e-7349.26TAR DNA-binding protein 43 OS=Xenopus tropicalis O... [more]
sp|Q5R5W2|TADBP_PONAB2.901e-7248.59TAR DNA-binding protein 43 OS=Pongo abelii OX=9601... [more]
sp|Q13148|TADBP_HUMAN3.015e-7248.59TAR DNA-binding protein 43 OS=Homo sapiens OX=9606... [more]
sp|Q921F2|TADBP_MOUSE1.292e-7148.59TAR DNA-binding protein 43 OS=Mus musculus OX=1009... [more]
sp|Q5ZLN5|TADBP_CHICK3.517e-7148.19TAR DNA-binding protein 43 OS=Gallus gallus OX=903... [more]
back to top
BLAST of TAR DNA-binding protein 43 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A4E0RSY03.090e-9155.02TAR DNA-binding protein 43 OS=Fasciola hepatica OX... [more]
A0A504Z4S83.472e-9156.65TAR DNA-binding protein 43 OS=Fasciola gigantica O... [more]
A0A2H1BSY36.321e-9157.03Uncharacterized protein OS=Fasciola hepatica OX=61... [more]
A0A504YT285.612e-9056.00TAR DNA-binding protein 43 OS=Fasciola gigantica O... [more]
A0A1S8WSG93.273e-8951.75Uncharacterized protein (Fragment) OS=Opisthorchis... [more]
back to top
BLAST of TAR DNA-binding protein 43 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
tardbp1.218e-6946.03TAR DNA-binding protein 43-like [Source:NCBI gene;... [more]
tardbpl5.150e-6946.06TAR DNA binding protein [Source:NCBI gene;Acc:1030... [more]
tardbpl1.103e-6746.22TAR DNA binding protein [Source:NCBI gene;Acc:1030... [more]
msi2b3.026e-1833.78RNA-binding protein Musashi homolog 2 [Source:NCBI... [more]
msi2b3.880e-1833.78RNA-binding protein Musashi homolog 2 [Source:NCBI... [more]
back to top
BLAST of TAR DNA-binding protein 43 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ENSPMAT00000009806.13.147e-6344.05pep scaffold:Pmarinus_7.0:GL479354:9188:12030:-1 g... [more]
TARDBP9.252e-5449.21TAR DNA binding protein [Source:HGNC Symbol;Acc:HG... [more]
ENSPMAT00000007723.19.459e-2745.63pep scaffold:Pmarinus_7.0:GL496487:1152:2091:-1 ge... [more]
ENSPMAT00000004893.11.364e-1532.74pep scaffold:Pmarinus_7.0:GL479484:4:2056:-1 gene:... [more]
HNRNPA2B12.133e-1129.94heterogeneous nuclear ribonucleoprotein A2/B1 [Sou... [more]
back to top
BLAST of TAR DNA-binding protein 43 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 3
Match NameE-valueIdentityDescription
HRP18.360e-1525.99Subunit of cleavage factor I; cleavage factor I is... [more]
NSR11.367e-724.88Nucleolar protein that binds nuclear localization ... [more]
SNP13.172e-736.36Component of U1 snRNP required for mRNA splicing v... [more]
back to top
BLAST of TAR DNA-binding protein 43 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
EDO449407.562e-5040.16Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO365222.605e-1633.33Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO384178.563e-1535.93Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO398791.183e-1430.72Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO401042.394e-935.71Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of TAR DNA-binding protein 43 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
tardbp2.660e-6946.59TAR DNA-binding protein 43-like [Source:NCBI gene;... [more]
tardbpl1.024e-6846.75TAR DNA binding protein [Source:NCBI gene;Acc:1011... [more]
tardbpl6.222e-6148.60TAR DNA binding protein [Source:NCBI gene;Acc:1011... [more]
msi2a1.417e-1733.79musashi RNA binding protein 2 [Source:NCBI gene;Ac... [more]
msi2a1.738e-1733.79musashi RNA binding protein 2 [Source:NCBI gene;Ac... [more]
back to top
BLAST of TAR DNA-binding protein 43 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000032661.12.685e-35100.00SMESG000032661.1[more]
SMESG000032661.12.146e-3595.31SMESG000032661.1[more]
SMESG000032660.12.747e-15399.59SMESG000032660.1[more]
SMESG000032660.13.738e-12273.17SMESG000032660.1[more]
SMESG000012144.12.255e-8453.70SMESG000012144.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30015674 ID=SMED30015674|Name=TAR DNA-binding protein 43|organism=Schmidtea mediterranea sexual|type=transcript|length=4210bp
ATTGACTTGTCAAATATTTGATATTTTTGTTTTGAATTTTTATCTTTGAA
TTGAATATATTTCAATTTATTAATTAGTAAATGTATTATATTGCCGTATG
TGAGTATGAGGAATCAGAAACTATTGAAATTCCTGTAGAAGAAGATGACA
CGGTCTTATTAACTACTTTAGGTGGAATATTTCCCAATGTATGTGGACTG
AAATATCGAGCTCCCGAAACTAATACATTCAGGGCATTAAAATTAAGCGA
TGGCAAGTTTTACAAACCTGTTGAAGGATGGGAAGACCTTAAATTTTATT
GTGTATTTCCGAAAGATAACAATAAACGAAAAATTGACGAGGAGATAGAA
AAACCGTTACAGAAAAGTAAGAGATTAGAAGGTAGAAAATGCACAGATTT
GATCGTGTTAAACCTTGGTTGGAAAGTTGATGAAGAAACTTTACGAAAGT
ATTTCTCCAAATTTGGTGAACTTGTATTGGTGCAAGTAAAGAAAGACCGG
GAAACTAGCCACAGTAAAGGTTACGCATTTATTCGATTTGCCGATTACGC
CGCACAAGTGCTTTGCCTAGCTGAGAAGCATTTGATTGATGGCCGCTGGT
GTGCAGTTAAAGTTCCTTTTTCTAAGAACGAGGCTGACAAGCAGGAGATC
TCAAAGAAAATCCATGTCGGATACGCGTCGGAGGAGATCTCAATGGAGGA
TTTGCGCATCGCATTCGAGCAGTACGGATATGTCACCGATATTTTCATTC
CGAAACCTTTCCGTAATTTCGCATTCGTGACGTTTGACTCGAGTGACACG
GCGCAATCACTGATTGGACAGTCGATCAATATTAACGGTATCACGCTGAC
TATCGGGAGCGCGGTGCCCAAAATCAACAGCAACAGGAAAGGCGGAGCAG
GAGGAGGAGGCGGCAGTGGCGGCGGAGGGGGGCATTACCCCATGTATGGG
GACAACATGCAATCGGCACAAGGATATCAGACCAGGTACGCACCGGGAAT
GATACCGACATATGGCGCTGCTTGGCCACCCAGTTATGACATGGCAGCGG
CACAGAAGGCCGCCAGGATGAATTCCAGCAATGCTTATGCAGGGGCAACG
GCGGCAGCGGCTGCGGCTGCTGCTGGGTATCCGGGCGGCGGCATGCTCAC
TGGGCAAGCCGCATATCATCTCATGTCCAATGGCAACCGCGCCGGGCAAG
AGGCAATGCAGCAAGGCGGCTATGCCAGTCAGGAGATGATGCACCAGAAC
TACATGAGCCAATACGGTGCCGGGGATCCTAATCAGCACGGCAGCGCTGC
CAATGCCGCTCTCAACATCCTCAATAATCCAGAGGTGGTAGCTGCTATCG
TTGCGGCCGCAAACAAAGCCGGCGTCAGCAACTCGATGCATTCGGGTGGT
GGCGGTGGCAAGTACAACATGAAAAATGAGAGCTTCCAATGAGCAGGCAA
TTAGCTGCCGCCGGTTGGTCAAGTGGAGTGATCTGGTCTGGTGGTGCAGT
GCAGTGTGTAATGCTTGACTGTGTTGCTATGGGAATCGTTGTCAGTAGTC
GATGATCGATCGGGTTTATGTGAGTGCCGCAGCATTGTTGCTTGTGTAAT
AATTGTTGGTGTGCGCGCACACATTTGTTCTGAATGTAACTGCAATCGTG
CGCGTGTGTGTCGCCCTGTTGGTGTGTTCCTTCTGTGTTTGTGTGTCTGT
GTAAATATATGTAAATTGATTACACCAATAGTTTGATTTGCTGCTGTGAT
AAATTGTGTCGTGTTCACAGATTGTTTTGTGAGATTGGATTTATTTGTCA
ATATCGATTACTTCTTGCATTTGCTAATTAATAAATTAATTTCGTGAAAC
ATGAAGGCATTTTGATTGGTGGCCTCAATCAAGTAATTATTATTGATTTC
GGCGCTAATGCTCGGCACCTGACTACAACGGGCTGTCGTTGCCGGGTAAA
TGCGATTGATGATAGACTGATTGATGGGATCGTCGATTACTAACGGAGTT
GATGGGCTTGTCTTGACTGGTTATATGGACATTGAGGTATTGTCGGTATT
TAGTGAGGGATTGAGATATTAATTGGGGACCGTTCCACACCTTTGTGGTG
CATTTAGGTAACTGTCATGGCAAGGGATAAGGCAGGGCTGATAAAATTAG
CTAATCATGCCTATCAGGTTTATACAAAACTTTAAAGATTTTTTTTATTT
TGTTTTCGATAATAATAAATTGTTGGGATTGTGTAACTTGCTGTGAAACG
GAATATTTAGCAACTTGCATTGCAAGTGAAATGATAAATAGGATCAATTG
ATACGGTTATCTATAACTAGAGCAAATGATAATTCCTAATTTAGTGCAGA
ATTAAATGTAGAAATTTTTATTGATATCTATTTTATTACGATTTTCCTAC
TACCGGCTCCGATATTGCAGTGTAAGCGCCGCTTGCCAACGTTTTATTTG
CGTGAAATATTAAAACCGCACGATTTTTTTGTGTGCATGAAACGGATTAT
TAAATTCATATATGCACGAGTAAACTCGTAGTTGGCAGAGAATGGGGTAA
ATTTGTAACGGTTCAGCCGGCATCAATGGAAGCCCTCAATGGATATTCTC
AAATTCATGATTGTATTTATTTTATAAATTTTTATTAGGGCAATTGTGAC
CATATCTGATACATTTATAGCATAATCAGAATTCCAGCACGTTTCCTCGT
GATAATTGGGGTAACCTCAGAATTATTACCCAATTTGTGGATCATTCAAT
ATAAATATGAAATGCTCATAAAATCAAACTGAATTGACTTTAAAAATGGC
ATCGCATGAAATGTCGATTACTTTGCAGACATTCATAATAAAAAAGCTTT
TCTACAAGCCCAATCAACATCACACGTGTAAAATCGATAATGCAATGAAA
TGTTAAATATTATATTAAATTGCCAACTACATAATGATTCAAATGACAGA
ATGCGCACTGGGAACAATCAGCAATCATCAAGTGGAAACATATTTACAGC
CAATACAATGGACACCAAACCAGGAACGCAATTGGCACCGCATTTAGATC
ACTTGTAAAGCATCTCTAGCTCACCTCCAGACATCATTAACCAGCCAGAC
GACTAAAAATGGAAAATCACATCAAATTAATCAATAGAATTCACCATAAA
AAAGTTATTTTATCCAATCAAATAATGCCACAACAATCGATTCCAACACA
GGACAATGATAAAGGGCCGAGCAATTCATTGAAACGCCCCAATTTGCTGG
AGGAACCGCATCGATTTCCCCTGCAAAATCATATTACACAAGTGAGACAC
GCCAGTGACCAGATGACAACGCTATAAAGGTAGCGCAATTGGTAACAACC
CAAGGGTAGCCCTGTCCCCGGTACTCCTACAGCCCCCTCAAGCAACACAT
CATAATTGATTCGTCCCACACAAGGCACTCACCTACTGCATGGCACCGTG
CTGATGGCTGTATAAATTCTGCTGTTGCTGTTGCTGGTGGTGAGACAGAC
CGGATTTATTGGCAGCAGCCGCTGCCGCAACAATTGCCGCTACCACATCG
GGATTGTTGAGGATATTCAGTGCAGCCATGGCAGCAGTATTCTGTCCGAT
ATCTGTGGCAGCAGGGACGGCTTGCTGTGATGACTGCTGATGGTTGTACT
CGAATGAAATCAGGCCATGCGGATGGATTCGGCCGTTACTCATCAGATAC
GACTGATTGGATGAGGAGTTAGCAACGGCAGCAGTGGACATCAATGTCCC
GTAATTGCCCATAATTGCCGAGTTGCGGAATTGCCTGGCCTTGTACCGCG
ATGATTGCATCGGTGCCGGCTCGTAACTAGACCAGCCGTAGCGACCGGCT
GTCATTGGGCCCTGCTCATTATAAGGACAAATGGGAAATTGTGCTGGAAT
CGGTAATTTCTTGTTACCGGTAATTTTCGGCACAGCGCTGCCGATAGTGA
GCGTGTGGCCTTTCACCGTCACGCATCTGCCAATCAGCTGCTGGGCCACT
TCGCTCAATTCAAATGTTACGAAGGCGAAATTCCGGAACGGTTTCGGTAT
AAAAATGTCCACAACATAGCCATACTCCTCAAACGCTTTCCTCAGATCTT
CCATTTCCAGCTCCTCCGCACTGTAGCTAACGTGGATTTTCTTGGTAATT
TCCTGCTTGTCAGCCTCGCTCTGCATTAGAAACCGTAGGGTAACAATCGG
AGATCGGAAG
back to top

protein sequence of SMED30015674-orf-1

>SMED30015674-orf-1 ID=SMED30015674-orf-1|Name=SMED30015674-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=259bp
FRSPIVTLRFLMQSEADKQEITKKIHVSYSAEELEMEDLRKAFEEYGYVV
DIFIPKPFRNFAFVTFELSEVAQQLIGRCVTVKGHTLTIGSAVPKITGNK
KLPIPAQFPICPYNEQGPMTAGRYGWSSYEPAPMQSSRYKARQFRNSAIM
GNYGTLMSTAAVANSSSNQSYLMSNGRIHPHGLISFEYNHQQSSQQAVPA
ATDIGQNTAAMAALNILNNPDVVAAIVAAAAAANKSGLSHHQQQQQQNLY
SHQHGAMQ*
back to top

protein sequence of SMED30015674-orf-2

>SMED30015674-orf-2 ID=SMED30015674-orf-2|Name=SMED30015674-orf-2|organism=Schmidtea mediterranea sexual|type=polypeptide|length=454bp
MYYIAVCEYEESETIEIPVEEDDTVLLTTLGGIFPNVCGLKYRAPETNTF
RALKLSDGKFYKPVEGWEDLKFYCVFPKDNNKRKIDEEIEKPLQKSKRLE
GRKCTDLIVLNLGWKVDEETLRKYFSKFGELVLVQVKKDRETSHSKGYAF
IRFADYAAQVLCLAEKHLIDGRWCAVKVPFSKNEADKQEISKKIHVGYAS
EEISMEDLRIAFEQYGYVTDIFIPKPFRNFAFVTFDSSDTAQSLIGQSIN
INGITLTIGSAVPKINSNRKGGAGGGGGSGGGGGHYPMYGDNMQSAQGYQ
TRYAPGMIPTYGAAWPPSYDMAAAQKAARMNSSNAYAGATAAAAAAAAGY
PGGGMLTGQAAYHLMSNGNRAGQEAMQQGGYASQEMMHQNYMSQYGAGDP
NQHGSAANAALNILNNPEVVAAIVAAANKAGVSNSMHSGGGGGKYNMKNE
SFQ*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: molecular function
TermDefinition
GO:0003723RNA binding
GO:0003676nucleic acid binding
GO:0000166nucleotide binding
GO:0003677DNA binding
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000099neuron
PLANA:0002089reproductive organ
PLANA:0002111X2 cell
Vocabulary: INTERPRO
TermDefinition
IPR041105TDP43_N
IPR035979RBD_domain_sf
IPR000504RRM_dom
IPR012677Nucleotide-bd_a/b_plait_sf
IPR011528NERD
IPR009465Spondin_N
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR000504RNA recognition motif domainSMARTSM00360rrm1_1coord: 193..259
e-value: 2.7E-6
score: 36.9
coord: 106..177
e-value: 1.1E-14
score: 64.8
IPR000504RNA recognition motif domainPFAMPF00076RRM_1coord: 196..245
e-value: 4.5E-7
score: 29.6
coord: 107..163
e-value: 1.1E-11
score: 44.3
IPR000504RNA recognition motif domainPROSITEPS50102RRMcoord: 105..201
score: 13.771
IPR000504RNA recognition motif domainPROSITEPS50102RRMcoord: 192..270
score: 12.185
IPR041105TAR DNA-binding protein 43, N-terminalPFAMPF18694TDP43_Ncoord: 3..76
e-value: 2.5E-26
score: 91.3
IPR012677Nucleotide-binding alpha-beta plait domain superfamilyGENE3DG3DSA:3.30.70.330coord: 188..270
e-value: 5.8E-16
score: 60.4
IPR012677Nucleotide-binding alpha-beta plait domain superfamilyGENE3DG3DSA:3.30.70.330coord: 93..187
e-value: 3.5E-20
score: 74.1
NoneNo IPR availablePANTHERPTHR23147SERINE/ARGININE RICH SPLICING FACTORcoord: 2..393
NoneNo IPR availablePANTHERPTHR23147:SF103TAR DNA-BINDING PROTEIN 43coord: 2..393
NoneNo IPR availableCDDcd12321RRM1_TDP43coord: 106..182
e-value: 1.68166E-40
score: 137.518
IPR035979RNA-binding domain superfamilySUPERFAMILYSSF54928RNA-binding domain, RBDcoord: 107..246