Gelsolin-like protein

Overview
NameGelsolin-like protein
Smed IDSMED30015672
Length (bp)1435
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Gelsolin-like protein (SMED30015672) t-SNE clustered cells

Violin plots show distribution of expression levels for Gelsolin-like protein (SMED30015672) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Gelsolin-like protein (SMED30015672) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Gelsolin-like protein (SMED30015672) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30015672

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 8

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
neuronSMED30015672SMESG000015928.1 dd_Smed_v4_1215_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
neuronSMED30015672SMESG000015928.1 dd_Smed_v4_1215_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult colorimetric in situ hybridization evidence
parenchymal cellSMED30015672SMESG000015928.1 dd_Smed_v4_1215_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
epidermal cellSMED30015672SMESG000015928.1 dd_Smed_v4_1215_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
Category 2 cellSMED30015672SMESG000015928.1 dd_Smed_v6_1215_0dd_Smed_v6PMID:29674432
Plass et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
epidermisSMED30015672SMESG000015928.1 dd_Smed_v6_1215_0dd_Smed_v6PMID:29674432
Plass et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Category 3 cellSMED30015672SMESG000015928.1 dd_Smed_v6_1215_0dd_Smed_v6PMID:29674432
Plass et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
epidermisSMED30015672SMESG000015928.1 dd_Smed_v4_1215_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Gelsolin-like protein vs. Ensembl Human
Match: VIL1 (villin 1 [Source:HGNC Symbol;Acc:HGNC:12690])

HSP 1 Score: 206.068 bits (523), Expect = 7.951e-61
Identity = 123/341 (36.07%), Postives = 193/341 (56.60%), Query Frame = 3
Query:  366 LFIWRIEKFKVVEWPQKQHGEFYEGDSYIVLNIYQRENELLYDVHFWIGKYSTQDEYGTAAYKTVELDNLLDDKPVQHREVQHYESELFKSYFK-NLIYLKGGCESGFRHVKTVEY-TPRLLHVRGEKRNIIVSEVTATKHNLNSNDVFIYDTGTHIFEWIGKGANKDEKFKGQEFAQAL-NSDRNGKAKVEVVDEAN------ISE--NHEFYKH--LSDLQPDEDDKWQNKLSVKDKKLFRISDASGSLKFENIAIGKFAKKDINEDDIFIVD-NGLEVYVYIGENASPNERQNALIYAHNYLKQTEYPQVPVTVMKKDVKGKNAENFNKVIEG*TLAN 1346
            L IWRIE  ++V  P    G F++GD YI+L I++  + L YD+H+WIG+ S+ DE G AA  T ++D+ L  + VQHREVQ  ESE F+ YFK  L+  KGG  SG +HV+T  Y   RLLHV+G KRN++  EV  +  + N  DVF+ D G  I +W G  + + E+ +G   A+ + + +R G+  V VVD  N      + E  NH   K   L    PD   +   K ++   KL+ +SD+ G+L    +A     +  ++ +D +I+D  GL++YV+ G+ A+  E++ A+ +A N++K  +YP  P T ++    G  +  F ++ +  T +N
Sbjct:   19 LQIWRIEAMQMVPVPSSTFGSFFDGDCYIILAIHKTASSLSYDIHYWIGQDSSLDEQGAAAIYTTQMDDFLKGRAVQHREVQGNESEAFRGYFKQGLVIRKGGVASGMKHVETNSYDVQRLLHVKG-KRNVVAGEVEMSWKSFNRGDVFLLDLGKLIIQWNGPESTRMERLRGMTLAKEIRDQERGGRTYVGVVDGENELASPKLMEVMNHVLGKRRELKAAVPDTVVEPALKAAL---KLYHVSDSEGNLVVREVATRPLTQDLLSHEDCYILDQGGLKIYVWKGKKANEQEKKGAMSHALNFIKAKQYP--PSTQVEVQNDGAESAVFQQLFQKWTASN 353          
BLAST of Gelsolin-like protein vs. Ensembl Human
Match: AVIL (advillin [Source:HGNC Symbol;Acc:HGNC:14188])

HSP 1 Score: 212.231 bits (539), Expect = 5.652e-60
Identity = 117/308 (37.99%), Postives = 179/308 (58.12%), Query Frame = 3
Query:  366 LFIWRIEKFKVVEWPQKQHGEFYEGDSYIVLNIYQRENELLYDVHFWIGKYSTQDEYGTAAYKTVELDNLLDDKPVQHREVQHYESELFKSYFK-NLIYLKGGCESGFRHVKTVEY-TPRLLHVRGEKRNIIVSEVTATKHNLNSNDVFIYDTGTHIFEWIGKGANKDEKFKGQEFAQAL-NSDRNGKAKVEVVDEANISENHEFYKHLSD-------LQPDEDDKWQNKLSVKDKKLFRISDASGSLKFENIAIGKFAKKDINEDDIFIVD-NGLEVYVYIGENASPNERQNALIYAHNYLKQTEYP 1256
            + +WRIEK ++   P   HG FYEGD Y++L+  +  + L  D+HFWIGK S+QDE   AA  T +LD+ L   PVQHREVQ++ES+ F+ YFK  +IY +GG  SG +HV+T  Y   RLLHV+G KRNI  +EV  +  + N  DVF+ D G  I +W G  +N  E+ K    A+ + + +R G+AK+ V++    + + E  K L D       ++P   D+  ++       L+ ISD++G L    +A     +  +N DD +I+D +G ++YV+ G+ A+  E+Q A+  A  ++K   YP
Sbjct:   16 IIVWRIEKMELALVPVSAHGNFYEGDCYVILSTRRVASLLSQDIHFWIGKDSSQDEQSCAAIYTTQLDDYLGGSPVQHREVQYHESDTFRGYFKQGIIYKQGGVASGMKHVETNTYDVKRLLHVKG-KRNIRATEVEMSWDSFNRGDVFLLDLGKVIIQWNGPESNSGERLKAMLLAKDIRDRERGGRAKIGVIEGDKEAASPELMKVLQDTLGRRSIIKPTVPDEIIDQKQKSTIMLYHISDSAGQLAVTEVATRPLVQDLLNHDDCYILDQSGTKIYVWKGKGATKAEKQAAMSKALGFIKMKSYP 322          

HSP 2 Score: 137.502 bits (345), Expect = 5.259e-34
Identity = 95/317 (29.97%), Postives = 153/317 (48.26%), Query Frame = 3
Query:  354 GHSELFIWRIEKFKVVEWPQKQHGEFYEGDSYIVLNIYQRENELLYDVHFWIGKYSTQDEYGTAAYKTVELDNLLDDKPVQHREVQHYESELFKSYFKNLIYLKGGCESGFRHVKTVEYTP--RLLHVRG-EKRNIIVSEVTATKHNLNSNDVFIYDTGTHIFEWIGKGANKDEKFKGQEFAQALNSDRNGKAKVEVVDEANISENHEFYKHLSDLQPDEDDK-WQNKLSVKDKKLFRISDASGSLKFENIAIGKFAKKDINEDDIFIVDNGLEVYVYIGENASPNERQNALIYAHNYL---KQTEYPQVPVTVMKK 1283
            G+ ++ +WRIE  ++V    + +G FY GD Y+VL  Y+   +  + ++ W G++++QDE   +AY+ VE+D   D   VQ R     E   F + FK  + +    E G       E  P  RL  + G +K N    EV A   +LNSNDVF+  T    + W GKG++ DE+   +E A  L               A   E  EF+  L    P  +DK  Q ++     +LF  S+ +G  +F    I  F + D+N  D+ ++D   +V+++IG  A+  E+++AL  A  YL        P  P+ ++K+
Sbjct:  393 GNGKVEVWRIENLELVPVEYQWYGFFYGGDCYLVLYTYEVNGKPHHILYIWQGRHASQDELAASAYQAVEVDRQFDGAAVQVRVRMGTEPRHFMAIFKGKLVI---FEGGTSRKGNAEPDPPVRLFQIHGNDKSNTKAVEVPAFASSLNSNDVFLLRTQAEHYLWYGKGSSGDERAMAKELASLLCDGSENTV-------AEGQEPAEFWDLLGGKTPYANDKRLQQEILDVQSRLFECSNKTG--QFVVTEITDFTQDDLNPTDVMLLDTWDQVFLWIGAEANATEKESALATAQQYLHTHPSGRDPDTPILIIKQ 697          
BLAST of Gelsolin-like protein vs. Ensembl Human
Match: SCIN (scinderin [Source:HGNC Symbol;Acc:HGNC:21695])

HSP 1 Score: 202.216 bits (513), Expect = 8.169e-58
Identity = 122/316 (38.61%), Postives = 186/316 (58.86%), Query Frame = 3
Query:  342 AKACGHSELFIWRIEKFKVVEWPQKQHGEFYEGDSYIVLNIYQRENELLYDVHFWIGKYSTQDEYGTAAYKTVELDNLLDDKPVQHREVQHYESELFKSYFK-NLIYLKGGCESGFRHVKTVEYTP-RLLHVRGEKRNIIVSEVTATKHNLNSNDVFIYDTGTHIFEWIGKGANKDEKFKGQEFAQALN-SDRNGKAKVEVVDEANISENHEFYKHLSDLQPDEDDKWQNKLSV------KDKKLFRISDASGSLKFENIA-IGKFAKKDINEDDIFIVDNGL--EVYVYIGENASPNERQNALIYAHNYLKQTEY 1253
            A+A   + L +WRIEK ++V  PQ  HG+FY GD+Y+VL+  +      Y +HFW+GK  +QDE   AA  TV++D+ L  KPVQ+RE+Q YES  F SYFK  L Y  GG  SG  HV T + T  RLLHV+G +R +  +EV  +  + N  D FI D GT I++W G   NK E+ K  + A  +  ++R G++++ VV+E   SE  E  K L + +P+  D   +   +      K  KL+ +SDASGS++   +A    F+   +  ++ FI+D+G   +++V+ G++A+P ER+ A+  A  +L+Q  Y
Sbjct:   11 ARAGKQAGLQVWRIEKLELVPVPQSAHGDFYVGDAYLVLHTAKTSRGFTYHLHFWLGKECSQDESTAAAIFTVQMDDYLGGKPVQNRELQGYESNDFVSYFKGGLKYKAGGVASGLNHVLTNDLTAKRLLHVKG-RRVVRATEVPLSWDSFNKGDCFIIDLGTEIYQWCGSSCNKYERLKANQVATGIRYNERKGRSELIVVEEG--SEPSELIKVLGE-KPELPDGGDDDDIIADISNRKMAKLYMVSDASGSMRVTVVAEENPFSMAMLLSEECFILDHGAAKQIFVWKGKDANPQERKAAMKTAEEFLQQMNY 322          

HSP 2 Score: 67.0106 bits (162), Expect = 3.668e-11
Identity = 42/113 (37.17%), Postives = 61/113 (53.98%), Query Frame = 3
Query:  354 GHSELFIWRIEKFKVVEWPQKQHGEFYEGDSYIVLNIYQRENELLYDVHFWIGKYSTQDEYGTAAYKTVELDNLLDDKPVQHREVQHYESELFKSYFKN---LIYLKGGCESG 683
            G  ++ IWR+E    ++  Q  +GEFY GD YI+L  Y R  +++Y    W G  +T+DE  T+A+ TV+LD  L  + VQ R  Q  E     S FK+   +IY  G  + G
Sbjct:  394 GSGKVEIWRVENNGRIQVDQNSYGEFYGGDCYIILYTYPR-GQIIYT---WQGANATRDELTTSAFLTVQLDRSLGGQAVQIRVSQGKEPVHLLSLFKDKPLIIYKNGTSKKG 502          
BLAST of Gelsolin-like protein vs. Ensembl Human
Match: VIL1 (villin 1 [Source:HGNC Symbol;Acc:HGNC:12690])

HSP 1 Score: 204.912 bits (520), Expect = 2.568e-57
Identity = 123/341 (36.07%), Postives = 193/341 (56.60%), Query Frame = 3
Query:  366 LFIWRIEKFKVVEWPQKQHGEFYEGDSYIVLNIYQRENELLYDVHFWIGKYSTQDEYGTAAYKTVELDNLLDDKPVQHREVQHYESELFKSYFK-NLIYLKGGCESGFRHVKTVEY-TPRLLHVRGEKRNIIVSEVTATKHNLNSNDVFIYDTGTHIFEWIGKGANKDEKFKGQEFAQAL-NSDRNGKAKVEVVDEAN------ISE--NHEFYKH--LSDLQPDEDDKWQNKLSVKDKKLFRISDASGSLKFENIAIGKFAKKDINEDDIFIVD-NGLEVYVYIGENASPNERQNALIYAHNYLKQTEYPQVPVTVMKKDVKGKNAENFNKVIEG*TLAN 1346
            L IWRIE  ++V  P    G F++GD YI+L I++  + L YD+H+WIG+ S+ DE G AA  T ++D+ L  + VQHREVQ  ESE F+ YFK  L+  KGG  SG +HV+T  Y   RLLHV+G KRN++  EV  +  + N  DVF+ D G  I +W G  + + E+ +G   A+ + + +R G+  V VVD  N      + E  NH   K   L    PD   +   K ++   KL+ +SD+ G+L    +A     +  ++ +D +I+D  GL++YV+ G+ A+  E++ A+ +A N++K  +YP  P T ++    G  +  F ++ +  T +N
Sbjct:   19 LQIWRIEAMQMVPVPSSTFGSFFDGDCYIILAIHKTASSLSYDIHYWIGQDSSLDEQGAAAIYTTQMDDFLKGRAVQHREVQGNESEAFRGYFKQGLVIRKGGVASGMKHVETNSYDVQRLLHVKG-KRNVVAGEVEMSWKSFNRGDVFLLDLGKLIIQWNGPESTRMERLRGMTLAKEIRDQERGGRTYVGVVDGENELASPKLMEVMNHVLGKRRELKAAVPDTVVEPALKAAL---KLYHVSDSEGNLVVREVATRPLTQDLLSHEDCYILDQGGLKIYVWKGKKANEQEKKGAMSHALNFIKAKQYP--PSTQVEVQNDGAESAVFQQLFQKWTASN 353          

HSP 2 Score: 135.576 bits (340), Expect = 2.303e-33
Identity = 101/315 (32.06%), Postives = 158/315 (50.16%), Query Frame = 3
Query:  354 GHSELFIWRIEKFKVVEWPQKQHGEFYEGDSYIVLNIYQRENELLYDVHFWIGKYSTQDEYGTAAYKTVELDNLLDDKPVQHREVQHYESELFKSYFKNLIYLKGGCESGFRHVKTVEYTPRLLHVRGE-KRNIIVSEVTATKHNLNSNDVFIYDTGTHIFEWIGKGANKDEKFKGQEFAQALNSDRNGKAKVEVVDEANISENHEFYKHLSDLQPDEDDK-WQNKLSVKDKKLFRISDASGSLKFENIAIGKFAKKDINEDDIFIVDNGLEVYVYIGENASPNERQNALIYAHNYLKQTEY---PQVPVTVMKK 1283
            G  E+ +WRIE  ++V    K  G FY GD Y++L  Y    +  Y ++ W G  ++QDE   +AY+ V LD   + +PVQ R     E     S FK  + +  G  S   +++T   T RL  V+G    N    EV A  + LNSNDVF+  T +  + W GKG + DE+    E A+ + +D   + + +VV E    E   F+  L    P  + K  Q +  V   +LF  S+ +G  +F    I  F + D+ EDD+F++D   +V+ +IG++A+  E++ A   A  YLK       P+ P+ V+K+
Sbjct:  396 GSGEVQVWRIENLELVPVDSKWLGHFYGGDCYLLLYTYLIGEKQHYLLYVWQGSQASQDEITASAYQAVILDQKYNGEPVQIRVPMGKEPPHLMSIFKGRMVVYQGGTSRTNNLETGPST-RLFQVQGTGANNTKAFEVPARANFLNSNDVFVLKTQSCCYLWCGKGCSGDER----EMAKMV-ADTISRTEKQVVVEGQ--EPANFWMALGGKAPYANTKRLQEENLVITPRLFECSNKTG--RFLATEIPDFNQDDLEEDDVFLLDVWDQVFFWIGKHANEEEKKAAATTAQEYLKTHPSGRDPETPIIVVKQ 700          
BLAST of Gelsolin-like protein vs. Ensembl Human
Match: SCIN (scinderin [Source:HGNC Symbol;Acc:HGNC:21695])

HSP 1 Score: 201.83 bits (512), Expect = 9.065e-57
Identity = 122/316 (38.61%), Postives = 186/316 (58.86%), Query Frame = 3
Query:  342 AKACGHSELFIWRIEKFKVVEWPQKQHGEFYEGDSYIVLNIYQRENELLYDVHFWIGKYSTQDEYGTAAYKTVELDNLLDDKPVQHREVQHYESELFKSYFK-NLIYLKGGCESGFRHVKTVEYTP-RLLHVRGEKRNIIVSEVTATKHNLNSNDVFIYDTGTHIFEWIGKGANKDEKFKGQEFAQALN-SDRNGKAKVEVVDEANISENHEFYKHLSDLQPDEDDKWQNKLSV------KDKKLFRISDASGSLKFENIA-IGKFAKKDINEDDIFIVDNGL--EVYVYIGENASPNERQNALIYAHNYLKQTEY 1253
            A+A   + L +WRIEK ++V  PQ  HG+FY GD+Y+VL+  +      Y +HFW+GK  +QDE   AA  TV++D+ L  KPVQ+RE+Q YES  F SYFK  L Y  GG  SG  HV T + T  RLLHV+G +R +  +EV  +  + N  D FI D GT I++W G   NK E+ K  + A  +  ++R G++++ VV+E   SE  E  K L + +P+  D   +   +      K  KL+ +SDASGS++   +A    F+   +  ++ FI+D+G   +++V+ G++A+P ER+ A+  A  +L+Q  Y
Sbjct:   11 ARAGKQAGLQVWRIEKLELVPVPQSAHGDFYVGDAYLVLHTAKTSRGFTYHLHFWLGKECSQDESTAAAIFTVQMDDYLGGKPVQNRELQGYESNDFVSYFKGGLKYKAGGVASGLNHVLTNDLTAKRLLHVKG-RRVVRATEVPLSWDSFNKGDCFIIDLGTEIYQWCGSSCNKYERLKANQVATGIRYNERKGRSELIVVEEG--SEPSELIKVLGE-KPELPDGGDDDDIIADISNRKMAKLYMVSDASGSMRVTVVAEENPFSMAMLLSEECFILDHGAAKQIFVWKGKDANPQERKAAMKTAEEFLQQMNY 322          

HSP 2 Score: 117.857 bits (294), Expect = 1.629e-27
Identity = 94/319 (29.47%), Postives = 162/319 (50.78%), Query Frame = 3
Query:  354 GHSELFIWRIEKFKVVEWPQKQHGEFYEGDSYIVLNIYQRENELLYDVHFWIGKYSTQDEYGTAAYKTVELDNLLDDKPVQHREVQHYESELFKSYFKN---LIYLKGGCESGFRHVKTVEYTPRLLHVRGEKRNII-VSEVTATKHNLNSNDVFIYDTGTHI-FEWIGKGANKDEKFKGQEFAQALNSDRNGKAKVEVVDEANISENHEFYKHLSDLQPDEDDK-WQNKLSVKDKKLFRISDASGSLKFENIAIGKFAKKDINEDDIFIVDNGLEVYVYIGENASPNERQNALIYAHNYLKQTEY---PQVPVTVMKK 1283
            G  ++ IWR+E    ++  Q  +GEFY GD YI+L  Y R  +++Y    W G  +T+DE  T+A+ TV+LD  L  + VQ R  Q  E     S FK+   +IY  G  + G +         RL  VR    +I  + EV    ++LNSNDVF+     +  + W+GKGA+++E+ KG E+  ++      K K   + E    E  EF+  L   +  +     + +      +L+  S+ +G    E I  G+F + D+ EDD+ ++D   +++++IG++A+  E++ +L  A  YL+        + P+ ++K+
Sbjct:  394 GSGKVEIWRVENNGRIQVDQNSYGEFYGGDCYIILYTYPR-GQIIYT---WQGANATRDELTTSAFLTVQLDRSLGGQAVQIRVSQGKEPVHLLSLFKDKPLIIYKNGTSKKGGQAPAP---PTRLFQVRRNLASITRIVEVDVDANSLNSNDVFVLKLPQNSGYIWVGKGASQEEE-KGAEYVASVL-----KCKTLRIQEGE--EPEEFWNSLGGKKDYQTSPLLETQAEDHPPRLYGCSNKTGRFVIEEIP-GEFTQDDLAEDDVMLLDAWEQIFIWIGKDANEVEKKESLKSAKMYLETDPSGRDKRTPIVIIKQ 696          
BLAST of Gelsolin-like protein vs. Ensembl Celegans
Match: gsnl-1 (Gelsolin-like protein 1 [Source:UniProtKB/Swiss-Prot;Acc:Q21253])

HSP 1 Score: 201.83 bits (512), Expect = 5.677e-59
Identity = 121/313 (38.66%), Postives = 185/313 (59.11%), Query Frame = 3
Query:  366 LFIWRIEKFKVVEWPQKQHGEFYEGDSYIVLNIYQRENELLYDVHFWIGKYSTQDEYGTAAYKTVELDNLLDDKPVQHREVQHYESELFKSYFKNLI-YLKGGCESGFRHV--KTVEYTPRLLHVRGEKRNIIVSEVTATKHNLNSNDVFIYDTGTHIFEWIGKGANKDEKFKGQEFAQAL-NSDRNGKAKVEVVDEANISENHEFYKHLSDLQP--------DEDDKWQNKLSVKDKKLFRISDASGSLKFENIAIGKFAKKD-INEDDIFIVD--NGLEVYVYIGENASPNERQNALIYAHNYLKQTEYPQ 1259
            L +WRI KF +   P+  HG FY GD+YI L  YQ+ +   +DVHFW+GK ++ DE G AA KTVE+D+ L   P QHRE+Q+YES LF SYF + I Y+ GG ESG+RHV  +   + P L H +G KRN+  +EV    ++LN  DVFI D G  ++ W+   + + E+ KG   A+ + + +R G  KV ++D+     +  F+ +   +          D+DD +  +L+ +   L+++SDASG+ K   ++ G+  +K+ ++  D FI+D  NG  ++V+IG   +  ER  ALI+  NYLKQ   P+
Sbjct:   19 LLVWRINKFVLEPVPEVDHGVFYIGDAYIAL--YQKYDGC-WDVHFWLGKNASTDEIGVAAIKTVEIDDSLGGIPTQHREIQNYESPLFLSYFPDGIRYVSGGYESGYRHVDDQFKNWKPHLFHCKG-KRNVRCTEVECEVNSLNLGDVFILDLGKDLYVWMPPESGRLERIKGMARAKNIADHERMGIPKVHILDDVEWDNDSTFWSYFGGVSSVRKVSKGKDDDDNYWKRLT-EQITLWKVSDASGAAKVSMVSQGENIRKEQLDPKDAFILDAING-GIFVWIGHECTLEERSKALIWGQNYLKQHHLPR 325          

HSP 2 Score: 72.0182 bits (175), Expect = 3.191e-13
Identity = 55/182 (30.22%), Postives = 88/182 (48.35%), Query Frame = 3
Query:  777 KHNLNSNDVFIYDT-GTHIFEWIGKGANKDEKFKGQEFAQALNSDRNGKAKVEVVDEANISENHEFYKHLSDLQPDEDDKWQNKLSVKDKKLFRISDASGSLKFENIAIGKFAKKDINEDDIFIVDNGLEVYVYIGENASPNERQNALIYAHNYLKQTEYPQVPVTVMKKDVKGKNAENFNK 1319
            K  L+  D FI D     IF WIG     +E+ K   + Q      +     +V      +E+ +F +   D     D+K +N  +     LF++SD SG L  E IA   F ++D++ DD+ I+D    +YV++G NA+ NE++ AL  A  YL++ + P+   T +    +GK    F K
Sbjct:  276 KEQLDPKDAFILDAINGGIFVWIGHECTLEERSKALIWGQNYLKQHHLPRWTQVTRVLESAESTQFTQWFRDWV---DEKKKNTFT---PLLFQVSDESGLLHVEEIA--NFTQEDLDGDDVMILDALNSIYVWVGANANANEKKEALNTAKLYLEKDKLPRHKKTAIDTIFQGKEPPTFKK 449          
BLAST of Gelsolin-like protein vs. Ensembl Celegans
Match: fli-1 (pep chromosome:WBcel235:III:8675297:8683732:-1 gene:WBGene00001443.1 transcript:B0523.5.1 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:fli-1)

HSP 1 Score: 100.523 bits (249), Expect = 4.305e-22
Identity = 78/313 (24.92%), Postives = 156/313 (49.84%), Query Frame = 3
Query:  366 LFIWRIEKFKVVEWPQKQHGEFYEGDSYIVLNIYQREN-ELLYDVHFWIGKYSTQDEYGTAAYKTVELDNLLDDKPVQHREVQHYESELFKSYF-KNLIYLKGG-CESGFRHVKTVEYTPRLLHVRGEKRNIIVSEVTATKHNLNSNDVFIYDTGTHIFEWIGKGANKDEKFKGQEFAQALN-SDRNGKAKVEVVDEANISENHEFYKHLSDLQPDED-----DKWQNKLSVKDKKLFRISDASGSLKFENIAIGK-FAKKD-INEDDIFIVDNGLEVYVYIGENASPNER---QNALIYAHNYLKQTEYPQV 1262
            +++W IE F      +  HG+FY+ D+Y+VL   +  + +L + + +W+G++++ D+   +A   V L N L+      RE  + E+E F + F + ++Y++GG   SGF   +   +  RL         + +  V  +  +L+    F+ D G  I+ W G  +      K + FA+ LN  DR GK+++E   +A      EF++ L+   PD+      +        + KKL++++   G L+   + + K  AK+D +    +F++D+  +++++IG+ A+   +   Q  ++  H  + + +Y QV
Sbjct:  510 MWVWEIENFYPSIMDEAFHGQFYDADAYLVLKTTREASGQLRHAIFYWLGEHASLDKGMCSAVHAVGLRNHLNATCRTQREEMNDETEEFLTLFGEEIVYIEGGRTISGFYTTEKPAHLTRLYRAGVNGTAVEMEPVPLSVESLDPRFCFLLDAGETIWIWSGYKSRITVSNKARLFAERLNKRDRKGKSEIETCRQARCPP--EFWQALTG-NPDKPQGAIVEHVPEGFVAERKKLYKVNIGMGFLELPQVELPKGIAKQDMLGSKGVFVLDSNSDIFLWIGKKANRLLKMAGQKLVVELHQMIDRPDYAQV 819          
BLAST of Gelsolin-like protein vs. Ensembl Fly
Match: Gel (gene:FBgn0010225 transcript:FBtr0336707)

HSP 1 Score: 217.238 bits (552), Expect = 1.321e-62
Identity = 128/340 (37.65%), Postives = 203/340 (59.71%), Query Frame = 3
Query:  342 AKACGHSELFIWRIEKFKVVEWPQKQHGEFYEGDSYIVLNIYQ--RENELLYDVHFWIGKYSTQDEYGTAAYKTVELDNLLDDKPVQHREVQHYESELFKSYFKNLI-YLKGGCESGFRHVKT-VEYTPRLLHVRGEKRNIIVSEVTATKHNLNSNDVFIYDTGTHIFEWIGKGANKDEKFKGQEFA-QALNSDRNGKAKVEVVDEANI-SENHEFYKHL----SDLQPDE----DDKWQNKLSVKDKKLFRISDASGSLKFENIAIGKFAKKDINEDDIFIVDNGLEVYVYIGENASPNERQNALIYAHNYLKQTEYPQVPVTVMKKDVKGKNAENFNK 1319
            A A     L IWRIE F+ V +P+  +G+FY GDS+IVLN  +  ++ +L +DVHFW+G  ++ DE G AA  TV+LD+LL+  PVQHREVQ +ES+LF SYFKN I Y +GG  +GF+HV+T  +   RL  V+G KRN+ V +V  +  ++N+ D FI D G+ I+ ++G  A + EK K    A Q  + D NG+A+V++VD+ +  ++   F+  L    +D  PDE    +D    +       L+++SDASG LK + I      +  ++  + FI+D G  ++V++G+ A+  E+ +A+  A  +L+  +YP    T + + V+G  +  F +
Sbjct:    6 ANAGRTPGLEIWRIENFEPVIYPKTNYGKFYTGDSFIVLNTIENKKDKKLSWDVHFWLGLETSTDEAGAAAILTVQLDDLLNGGPVQHREVQDHESQLFLSYFKNGIRYEQGGVGTGFKHVETNAQGETRLFQVKG-KRNVRVRQVNLSVSSMNTGDCFILDAGSDIYVYVGSQAKRVEKLKAISAANQIRDQDHNGRARVQIVDDFSTDADKQHFFDVLGSGSADQVPDESTADEDSAFERTDAAAVSLYKVSDASGKLKVDIIGQKPLTQAMLDTRECFILDTGSGIFVWVGKGATQKEKTDAMAKAQEFLRTKKYP--AWTQIHRIVEGSESAPFKQ 342          
BLAST of Gelsolin-like protein vs. Ensembl Fly
Match: Gel (gene:FBgn0010225 transcript:FBtr0078971)

HSP 1 Score: 217.238 bits (552), Expect = 1.321e-62
Identity = 128/340 (37.65%), Postives = 203/340 (59.71%), Query Frame = 3
Query:  342 AKACGHSELFIWRIEKFKVVEWPQKQHGEFYEGDSYIVLNIYQ--RENELLYDVHFWIGKYSTQDEYGTAAYKTVELDNLLDDKPVQHREVQHYESELFKSYFKNLI-YLKGGCESGFRHVKT-VEYTPRLLHVRGEKRNIIVSEVTATKHNLNSNDVFIYDTGTHIFEWIGKGANKDEKFKGQEFA-QALNSDRNGKAKVEVVDEANI-SENHEFYKHL----SDLQPDE----DDKWQNKLSVKDKKLFRISDASGSLKFENIAIGKFAKKDINEDDIFIVDNGLEVYVYIGENASPNERQNALIYAHNYLKQTEYPQVPVTVMKKDVKGKNAENFNK 1319
            A A     L IWRIE F+ V +P+  +G+FY GDS+IVLN  +  ++ +L +DVHFW+G  ++ DE G AA  TV+LD+LL+  PVQHREVQ +ES+LF SYFKN I Y +GG  +GF+HV+T  +   RL  V+G KRN+ V +V  +  ++N+ D FI D G+ I+ ++G  A + EK K    A Q  + D NG+A+V++VD+ +  ++   F+  L    +D  PDE    +D    +       L+++SDASG LK + I      +  ++  + FI+D G  ++V++G+ A+  E+ +A+  A  +L+  +YP    T + + V+G  +  F +
Sbjct:    6 ANAGRTPGLEIWRIENFEPVIYPKTNYGKFYTGDSFIVLNTIENKKDKKLSWDVHFWLGLETSTDEAGAAAILTVQLDDLLNGGPVQHREVQDHESQLFLSYFKNGIRYEQGGVGTGFKHVETNAQGETRLFQVKG-KRNVRVRQVNLSVSSMNTGDCFILDAGSDIYVYVGSQAKRVEKLKAISAANQIRDQDHNGRARVQIVDDFSTDADKQHFFDVLGSGSADQVPDESTADEDSAFERTDAAAVSLYKVSDASGKLKVDIIGQKPLTQAMLDTRECFILDTGSGIFVWVGKGATQKEKTDAMAKAQEFLRTKKYP--AWTQIHRIVEGSESAPFKQ 342          
BLAST of Gelsolin-like protein vs. Ensembl Fly
Match: Gel (gene:FBgn0010225 transcript:FBtr0078973)

HSP 1 Score: 218.009 bits (554), Expect = 1.564e-62
Identity = 128/340 (37.65%), Postives = 203/340 (59.71%), Query Frame = 3
Query:  342 AKACGHSELFIWRIEKFKVVEWPQKQHGEFYEGDSYIVLNIYQ--RENELLYDVHFWIGKYSTQDEYGTAAYKTVELDNLLDDKPVQHREVQHYESELFKSYFKNLI-YLKGGCESGFRHVKT-VEYTPRLLHVRGEKRNIIVSEVTATKHNLNSNDVFIYDTGTHIFEWIGKGANKDEKFKGQEFA-QALNSDRNGKAKVEVVDEANI-SENHEFYKHL----SDLQPDE----DDKWQNKLSVKDKKLFRISDASGSLKFENIAIGKFAKKDINEDDIFIVDNGLEVYVYIGENASPNERQNALIYAHNYLKQTEYPQVPVTVMKKDVKGKNAENFNK 1319
            A A     L IWRIE F+ V +P+  +G+FY GDS+IVLN  +  ++ +L +DVHFW+G  ++ DE G AA  TV+LD+LL+  PVQHREVQ +ES+LF SYFKN I Y +GG  +GF+HV+T  +   RL  V+G KRN+ V +V  +  ++N+ D FI D G+ I+ ++G  A + EK K    A Q  + D NG+A+V++VD+ +  ++   F+  L    +D  PDE    +D    +       L+++SDASG LK + I      +  ++  + FI+D G  ++V++G+ A+  E+ +A+  A  +L+  +YP    T + + V+G  +  F +
Sbjct:   64 ANAGRTPGLEIWRIENFEPVIYPKTNYGKFYTGDSFIVLNTIENKKDKKLSWDVHFWLGLETSTDEAGAAAILTVQLDDLLNGGPVQHREVQDHESQLFLSYFKNGIRYEQGGVGTGFKHVETNAQGETRLFQVKG-KRNVRVRQVNLSVSSMNTGDCFILDAGSDIYVYVGSQAKRVEKLKAISAANQIRDQDHNGRARVQIVDDFSTDADKQHFFDVLGSGSADQVPDESTADEDSAFERTDAAAVSLYKVSDASGKLKVDIIGQKPLTQAMLDTRECFILDTGSGIFVWVGKGATQKEKTDAMAKAQEFLRTKKYP--AWTQIHRIVEGSESAPFKQ 400          
BLAST of Gelsolin-like protein vs. Ensembl Fly
Match: Gel (gene:FBgn0010225 transcript:FBtr0309256)

HSP 1 Score: 218.009 bits (554), Expect = 1.564e-62
Identity = 128/340 (37.65%), Postives = 203/340 (59.71%), Query Frame = 3
Query:  342 AKACGHSELFIWRIEKFKVVEWPQKQHGEFYEGDSYIVLNIYQ--RENELLYDVHFWIGKYSTQDEYGTAAYKTVELDNLLDDKPVQHREVQHYESELFKSYFKNLI-YLKGGCESGFRHVKT-VEYTPRLLHVRGEKRNIIVSEVTATKHNLNSNDVFIYDTGTHIFEWIGKGANKDEKFKGQEFA-QALNSDRNGKAKVEVVDEANI-SENHEFYKHL----SDLQPDE----DDKWQNKLSVKDKKLFRISDASGSLKFENIAIGKFAKKDINEDDIFIVDNGLEVYVYIGENASPNERQNALIYAHNYLKQTEYPQVPVTVMKKDVKGKNAENFNK 1319
            A A     L IWRIE F+ V +P+  +G+FY GDS+IVLN  +  ++ +L +DVHFW+G  ++ DE G AA  TV+LD+LL+  PVQHREVQ +ES+LF SYFKN I Y +GG  +GF+HV+T  +   RL  V+G KRN+ V +V  +  ++N+ D FI D G+ I+ ++G  A + EK K    A Q  + D NG+A+V++VD+ +  ++   F+  L    +D  PDE    +D    +       L+++SDASG LK + I      +  ++  + FI+D G  ++V++G+ A+  E+ +A+  A  +L+  +YP    T + + V+G  +  F +
Sbjct:   64 ANAGRTPGLEIWRIENFEPVIYPKTNYGKFYTGDSFIVLNTIENKKDKKLSWDVHFWLGLETSTDEAGAAAILTVQLDDLLNGGPVQHREVQDHESQLFLSYFKNGIRYEQGGVGTGFKHVETNAQGETRLFQVKG-KRNVRVRQVNLSVSSMNTGDCFILDAGSDIYVYVGSQAKRVEKLKAISAANQIRDQDHNGRARVQIVDDFSTDADKQHFFDVLGSGSADQVPDESTADEDSAFERTDAAAVSLYKVSDASGKLKVDIIGQKPLTQAMLDTRECFILDTGSGIFVWVGKGATQKEKTDAMAKAQEFLRTKKYP--AWTQIHRIVEGSESAPFKQ 400          
BLAST of Gelsolin-like protein vs. Ensembl Fly
Match: Gel (gene:FBgn0010225 transcript:FBtr0078969)

HSP 1 Score: 218.009 bits (554), Expect = 1.564e-62
Identity = 128/340 (37.65%), Postives = 203/340 (59.71%), Query Frame = 3
Query:  342 AKACGHSELFIWRIEKFKVVEWPQKQHGEFYEGDSYIVLNIYQ--RENELLYDVHFWIGKYSTQDEYGTAAYKTVELDNLLDDKPVQHREVQHYESELFKSYFKNLI-YLKGGCESGFRHVKT-VEYTPRLLHVRGEKRNIIVSEVTATKHNLNSNDVFIYDTGTHIFEWIGKGANKDEKFKGQEFA-QALNSDRNGKAKVEVVDEANI-SENHEFYKHL----SDLQPDE----DDKWQNKLSVKDKKLFRISDASGSLKFENIAIGKFAKKDINEDDIFIVDNGLEVYVYIGENASPNERQNALIYAHNYLKQTEYPQVPVTVMKKDVKGKNAENFNK 1319
            A A     L IWRIE F+ V +P+  +G+FY GDS+IVLN  +  ++ +L +DVHFW+G  ++ DE G AA  TV+LD+LL+  PVQHREVQ +ES+LF SYFKN I Y +GG  +GF+HV+T  +   RL  V+G KRN+ V +V  +  ++N+ D FI D G+ I+ ++G  A + EK K    A Q  + D NG+A+V++VD+ +  ++   F+  L    +D  PDE    +D    +       L+++SDASG LK + I      +  ++  + FI+D G  ++V++G+ A+  E+ +A+  A  +L+  +YP    T + + V+G  +  F +
Sbjct:   64 ANAGRTPGLEIWRIENFEPVIYPKTNYGKFYTGDSFIVLNTIENKKDKKLSWDVHFWLGLETSTDEAGAAAILTVQLDDLLNGGPVQHREVQDHESQLFLSYFKNGIRYEQGGVGTGFKHVETNAQGETRLFQVKG-KRNVRVRQVNLSVSSMNTGDCFILDAGSDIYVYVGSQAKRVEKLKAISAANQIRDQDHNGRARVQIVDDFSTDADKQHFFDVLGSGSADQVPDESTADEDSAFERTDAAAVSLYKVSDASGKLKVDIIGQKPLTQAMLDTRECFILDTGSGIFVWVGKGATQKEKTDAMAKAQEFLRTKKYP--AWTQIHRIVEGSESAPFKQ 400          
BLAST of Gelsolin-like protein vs. Ensembl Zebrafish
Match: scin (scinderin [Source:ZFIN;Acc:ZDB-GENE-060503-6])

HSP 1 Score: 209.534 bits (532), Expect = 1.190e-59
Identity = 115/314 (36.62%), Postives = 188/314 (59.87%), Query Frame = 3
Query:  345 KACGHSELFIWRIEKFKVVEWPQKQHGEFYEGDSYIVLNIYQRENELLYDVHFWIGKYSTQDEYGTAAYKTVELDNLLDDKPVQHREVQHYESELFKSYFKNLI-YLKGGCESGFRHVKTVEYTP-RLLHVRGEKRNIIVSEVTATKHNLNSNDVFIYDTGTHIFEWIGKGANKDEKFKGQEFAQAL-NSDRNGKAKVEVVDEANISENHEFYKHLSDLQPDEDDKWQNKLSVKDKK---LFRISDASGSLKFENIAI-GKFAKKDINEDDIFIVDNGLE--VYVYIGENASPNERQNALIYAHNYLKQTEYPQ 1259
            KA  +S L IWRIEK ++V  P+  +G FY GD+Y+VL+  ++++   YD+HFW+GK  +QDE   AA  + ++D+ L  KPVQ+RE+Q +ES +F SYFK  I Y  GG  SGF+HV T + T  RL H++G +R +  +EV  +  + N+ D FI D G  I++W G   NK E+ K  +    + +++R+G+AK+ V++E            +    P+ DD       V ++K   L+ +SDA+G ++   ++    F + ++  D+ FI+D+G    ++V+ G NA+P+ER+ A+  A +++KQ  YPQ
Sbjct:   10 KAGKYSGLQIWRIEKMEIVPVPESFYGSFYTGDAYLVLHTVKQKDSSFYDLHFWLGKECSQDESTAAAIFSTQMDDYLGGKPVQYREIQGFESTVFTSYFKGGIKYKSGGVASGFQHVITNDLTARRLFHIKG-RRTVRATEVPLSWASFNNGDCFIVDLGPVIYQWCGSKCNKFERIKAAQVGTGIRDNERSGRAKLVVIEEGQEPAEMTEVLGVKPEIPEGDDSEDAVADVSNRKMASLYMVSDATGKMQVSLVSKDNPFDQSNLLSDECFILDHGKNKMIFVWKGHNANPSERKEAMKTAESFIKQMGYPQ 322          

HSP 2 Score: 102.064 bits (253), Expect = 1.816e-22
Identity = 97/324 (29.94%), Postives = 151/324 (46.60%), Query Frame = 3
Query:  354 GHSELFIWRIEKFKV-----VEWPQKQHGEFYEGDSYIVLNIYQRENELLYDVHFWIGKYSTQDEYGTAAYKTVELDNLLDDKPVQHREVQHYESELFKSYFKN--LIYLKGGCESGFRHVKTVEYTP-RLLHVRGEKRNII-VSEVTATKHNLNSNDVFIYDTGTH-IFEWIGKGANKDEKFKGQEFAQALNSDRNGKAKVEVVDEANISENHEFYKHLSD-LQPDEDDKWQNKLSVKDKKLFRISDASGSLKFENIAIGKFAKKDINEDDIFIVDNGLEVYVYIGENASPNERQNALIYAHNYLKQTEYPQ---VPVTVMKK 1283
            G  +  IWR+E         V    + +G+FY GD YI+L  Y +  E++Y    W G  ST DE   +A+ TVELD  L    VQ R  Q  E     S FK+  LI  K G     R        P RL  VR     I  +SEV A   +LNSNDV++        + W GKGA+++E+   +  ++ LN       K ++V E    E   F+  L    +       +++      +LF  S+ +G    E +  G+F + D+ EDD+ ++D    V+V+IG++A+  ER  ++  A  Y++     +    P+ V+K+
Sbjct:  392 GAGKTEIWRVECGATKGDTKVPVDPETYGQFYGGDCYIILYRYSK-GEIIYT---WQGSRSTIDELTASAFLTVELDRSLGGNAVQVRVTQGKEPPHLLSLFKDKPLIVYKDGTS---RKGGQAPAAPTRLFQVRKNLGTITRISEVDAKASSLNSNDVYLLKLPQGDGYIWKGKGASEEEEKAAKYMSEKLN------CKTKMVVEGK--EPDVFWMALGGKTEYQTSGLLESRTIAHPPRLFACSNKTGKFIIEEVP-GEFNQDDLAEDDVMLLDVWDSVFVWIGKDANEVERTESVKSAKIYIETDPSGRDKGTPLVVVKQ 699          
BLAST of Gelsolin-like protein vs. Ensembl Zebrafish
Match: scin (scinderin [Source:ZFIN;Acc:ZDB-GENE-060503-6])

HSP 1 Score: 209.149 bits (531), Expect = 1.487e-59
Identity = 115/314 (36.62%), Postives = 188/314 (59.87%), Query Frame = 3
Query:  345 KACGHSELFIWRIEKFKVVEWPQKQHGEFYEGDSYIVLNIYQRENELLYDVHFWIGKYSTQDEYGTAAYKTVELDNLLDDKPVQHREVQHYESELFKSYFKNLI-YLKGGCESGFRHVKTVEYTP-RLLHVRGEKRNIIVSEVTATKHNLNSNDVFIYDTGTHIFEWIGKGANKDEKFKGQEFAQAL-NSDRNGKAKVEVVDEANISENHEFYKHLSDLQPDEDDKWQNKLSVKDKK---LFRISDASGSLKFENIAI-GKFAKKDINEDDIFIVDNGLE--VYVYIGENASPNERQNALIYAHNYLKQTEYPQ 1259
            KA  +S L IWRIEK ++V  P+  +G FY GD+Y+VL+  ++++   YD+HFW+GK  +QDE   AA  + ++D+ L  KPVQ+RE+Q +ES +F SYFK  I Y  GG  SGF+HV T + T  RL H++G +R +  +EV  +  + N+ D FI D G  I++W G   NK E+ K  +    + +++R+G+AK+ V++E            +    P+ DD       V ++K   L+ +SDA+G ++   ++    F + ++  D+ FI+D+G    ++V+ G NA+P+ER+ A+  A +++KQ  YPQ
Sbjct:   10 KAGKYSGLQIWRIEKMEIVPVPESFYGSFYTGDAYLVLHTVKQKDSSFYDLHFWLGKECSQDESTAAAIFSTQMDDYLGGKPVQYREIQGFESTVFTSYFKGGIKYKSGGVASGFQHVITNDLTARRLFHIKG-RRTVRATEVPLSWASFNNGDCFIVDLGPVIYQWCGSKCNKFERIKAAQVGTGIRDNERSGRAKLVVIEEGQEPAEMTEVLGVKPEIPEGDDSEDAVADVSNRKMASLYMVSDATGKMQVSLVSKDNPFDQSNLLSDECFILDHGKNKMIFVWKGHNANPSERKEAMKTAESFIKQMGYPQ 322          

HSP 2 Score: 97.8265 bits (242), Expect = 3.443e-21
Identity = 95/324 (29.32%), Postives = 148/324 (45.68%), Query Frame = 3
Query:  354 GHSELFIWRIEKFKV-----VEWPQKQHGEFYEGDSYIVLNIYQRENELLYDVHFWIGKYSTQDEYGTAAYKTVELDNLLDDKPVQHREVQHYESELFKSYFKN--LIYLKGGCESGFRHVKTVEYTP-RLLHVRGEKRNII-VSEVTATKHNLNSNDVFIYDTGTH-IFEWIGKGANKDEKFKGQEFAQALNSDRNGKAKVEVVDEANISENHEFYKHLSD-LQPDEDDKWQNKLSVKDKKLFRISDASGSLKFENIAIGKFAKKDINEDDIFIVDNGLEVYVYIGENASPNERQNALIYAHNYLKQTEYPQ---VPVTVMKK 1283
            G  +  IWR+E         V    + +G+FY GD YI+L  Y +  E++Y    W G  ST DE   +A+ TVELD  L    VQ R  Q  E     S FK+  LI  K G     R        P RL  V      I  +SEV A   +LNSND ++        + W GKGA+++E+   +   + LN       K ++V E    E   F+  L    +       +++      +LF  S+ +G    E +  G+F + D+ EDD+ ++D    V+V+IG++A+  ER  ++  A  Y++     +    P+ V+K+
Sbjct:  392 GAGKTEIWRVECGATKGDTKVPVDPETYGQFYGGDCYIILYRYSK-GEIIYT---WQGSRSTIDELTASAFLTVELDRSLGGNAVQVRVTQGKEPPHLLSLFKDKPLIVYKDGTS---RKGGQAPAAPTRLFQVHKNLGTITRISEVDAKASSLNSNDAYLLKLPQGDGYIWKGKGASEEEEKAAKYMTEKLN------CKTKMVVEGK--EPEAFWMALGGKTEYQTSGLLESRTIAHPPRLFACSNKTGKFIIEEVP-GEFNQDDLAEDDVMLLDVWDSVFVWIGKDANEVERTESVKSAKIYIETDPSGRDKGTPLVVVKQ 699          
BLAST of Gelsolin-like protein vs. Ensembl Zebrafish
Match: gsna (gelsolin a [Source:ZFIN;Acc:ZDB-GENE-030131-9653])

HSP 1 Score: 208.764 bits (530), Expect = 2.065e-59
Identity = 120/310 (38.71%), Postives = 187/310 (60.32%), Query Frame = 3
Query:  366 LFIWRIEKFKVVEWPQKQHGEFYEGDSYIVLNIY-QRENELLYDVHFWIGKYSTQDEYGTAAYKTVELDNLLDDKPVQHREVQHYESELFKSYF-KNLIYLKGGCESGFRHVKTVEYT-PRLLHVRGEKRNIIVSEVTATKHNLNSNDVFIYDTGTHIFEWIGKGANKDEKFKGQEFAQAL-NSDRNGKAKVEVVDEANISENHEFYKHLSDLQPD-----EDDKWQNKLSVKDKKLFRISDASGSLKFENIAI-GKFAKKDINEDDIFIVDNGLE--VYVYIGENASPNERQNALIYAHNYLKQTEYPQ 1259
            L +WRIEKF +V  P+  +G FY GD+Y+VL    Q    L YD+HFW+G Y TQDE G+AA  TV++D+ L  KP+Q+REVQ +ES+ F  YF K L Y++GG  SGF+HV T E    R+L V+G +R +  +EV  +  + N  D FI D G  I++W G  +N+ EK K  + A+ + +++R+G+A+V V DE    E  +  + L + +PD      DD   +  + K  KL+++SDASG +    +A    F +  +   D FI+D+G +  ++V+ G++A+  ER+ A+  A  ++K+  YP+
Sbjct:   16 LQVWRIEKFDLVAVPENLYGGFYTGDAYLVLKTTKQTSGNLQYDLHFWLGDYCTQDESGSAAIFTVQMDDYLGGKPIQYREVQGHESKAFLGYFKKGLQYMQGGVASGFKHVVTNEVVMQRVLQVKG-RRVVRATEVPVSWDSFNQGDCFILDLGNEIYQWCGSKSNRFEKLKATQLAKGIRDNERSGRARVYVCDEG--VEREKMLEVLGE-KPDLPEGASDDVKADASNRKMAKLYKVSDASGDMAIALVAAENPFTQSALESSDCFILDHGSDGKIFVWKGKDANMEERKAAMKAADEFIKKMGYPK 321          

HSP 2 Score: 128.642 bits (322), Expect = 3.180e-31
Identity = 100/339 (29.50%), Postives = 150/339 (44.25%), Query Frame = 3
Query:  354 GHSELFIWRIEKFKVVEWPQKQHGEFYEGDSYIVLNIYQRENELLYDVHFWIGKYSTQDEYGTAAYKTVELDNLLDDKPVQH---------REVQHYESELFKSYF--KNLIYLKGGC--ESGFRHVKTVEYTPRLLHVRGEKRNIIVS-EVTATKHNLNSNDVFIYDTGTHIFEWIGKGANKDEKFKGQEFAQALNSDRNGKAKVEVVDEANISENHE---FYKHLSDLQP-DEDDKWQNKLSVKDKKLFRISDASGSLKFENIAIGKFAKKDINEDDIFIVDNGLEVYVYIGENASPNERQNALIYAHNYLKQTEYPQVPVTVMKKDVKGKNAENFN 1316
            G+ E  IWRIE    V      +G+FY GDSYI+L  Y+      + ++ W G  STQDE G +A    +LD+ L   PVQ          R VQ  E     S F  + ++  KGG   E G    +T     RL  VR        + E+ A   NLNSND F+  T    F W+G+GA+  EK   Q+    L            V  + +SE  E   F+  L          + ++K++    +LF  S+ +G    E +  G+  ++D+  DD+ I+D   +V+V+IG  A   E+  A+  A  Y++     + P T + K  +G     F 
Sbjct:  391 GNGEKQIWRIEGSDKVPVDPSTYGQFYGGDSYIILYSYRHGGRQGHIIYIWQGADSTQDEIGASAILGAQLDDELGGGPVQMAGAPLTTQVRVVQGKEPAHLMSLFGGQPMVVHKGGTSREGG----QTAPAETRLFQVRSNSAGCTRAVEIDAVSSNLNSNDAFVLVTPAASFIWVGQGASDIEKRGAQQLCGILG-----------VSPSELSEGGEDGGFWDALGGKAAYRTSSRLKDKMNAHPPRLFACSNKTGRFIIEEVP-GEMTQEDLATDDVMILDTWDQVFVWIGNEAHDEEKMEAMTSAAQYIQTDPANRDPRTAIVKIKQGFEPPTFT 713          
BLAST of Gelsolin-like protein vs. Ensembl Zebrafish
Match: gsna (gelsolin a [Source:ZFIN;Acc:ZDB-GENE-030131-9653])

HSP 1 Score: 208.764 bits (530), Expect = 2.182e-59
Identity = 120/310 (38.71%), Postives = 187/310 (60.32%), Query Frame = 3
Query:  366 LFIWRIEKFKVVEWPQKQHGEFYEGDSYIVLNIY-QRENELLYDVHFWIGKYSTQDEYGTAAYKTVELDNLLDDKPVQHREVQHYESELFKSYF-KNLIYLKGGCESGFRHVKTVEYT-PRLLHVRGEKRNIIVSEVTATKHNLNSNDVFIYDTGTHIFEWIGKGANKDEKFKGQEFAQAL-NSDRNGKAKVEVVDEANISENHEFYKHLSDLQPD-----EDDKWQNKLSVKDKKLFRISDASGSLKFENIAI-GKFAKKDINEDDIFIVDNGLE--VYVYIGENASPNERQNALIYAHNYLKQTEYPQ 1259
            L +WRIEKF +V  P+  +G FY GD+Y+VL    Q    L YD+HFW+G Y TQDE G+AA  TV++D+ L  KP+Q+REVQ +ES+ F  YF K L Y++GG  SGF+HV T E    R+L V+G +R +  +EV  +  + N  D FI D G  I++W G  +N+ EK K  + A+ + +++R+G+A+V V DE    E  +  + L + +PD      DD   +  + K  KL+++SDASG +    +A    F +  +   D FI+D+G +  ++V+ G++A+  ER+ A+  A  ++K+  YP+
Sbjct:   16 LQVWRIEKFDLVAVPENLYGGFYTGDAYLVLKTTKQTSGNLQYDLHFWLGDYCTQDESGSAAIFTVQMDDYLGGKPIQYREVQGHESKAFLGYFKKGLQYMQGGVASGFKHVVTNEVVMQRVLQVKG-RRVVRATEVPVSWDSFNQGDCFILDLGNEIYQWCGSKSNRFEKLKATQLAKGIRDNERSGRARVYVCDEG--VEREKMLEVLGE-KPDLPEGASDDVKADASNRKMAKLYKVSDASGDMAIALVAAENPFTQSALESSDCFILDHGSDGKIFVWKGKDANMEERKAAMKAADEFIKKMGYPK 321          

HSP 2 Score: 135.191 bits (339), Expect = 1.819e-33
Identity = 100/330 (30.30%), Postives = 150/330 (45.45%), Query Frame = 3
Query:  354 GHSELFIWRIEKFKVVEWPQKQHGEFYEGDSYIVLNIYQRENELLYDVHFWIGKYSTQDEYGTAAYKTVELDNLLDDKPVQHREVQHYESELFKSYF--KNLIYLKGGC--ESGFRHVKTVEYTPRLLHVRGEKRNIIVS-EVTATKHNLNSNDVFIYDTGTHIFEWIGKGANKDEKFKGQEFAQALNSDRNGKAKVEVVDEANISENHE---FYKHLSDLQP-DEDDKWQNKLSVKDKKLFRISDASGSLKFENIAIGKFAKKDINEDDIFIVDNGLEVYVYIGENASPNERQNALIYAHNYLKQTEYPQVPVTVMKKDVKGKNAENFN 1316
            G+ E  IWRIE    V      +G+FY GDSYI+L  Y+      + ++ W G  STQDE G +A    +LD+ L   PVQ R VQ  E     S F  + ++  KGG   E G    +T     RL  VR        + E+ A   NLNSND F+  T    F W+G+GA+  EK   Q+    L            V  + +SE  E   F+  L          + ++K++    +LF  S+ +G    E +  G+  ++D+  DD+ I+D   +V+V+IG  A   E+  A+  A  Y++     + P T + K  +G     F 
Sbjct:  391 GNGEKQIWRIEGSDKVPVDPSTYGQFYGGDSYIILYSYRHGGRQGHIIYIWQGADSTQDEIGASAILGAQLDDELGGGPVQVRVVQGKEPAHLMSLFGGQPMVVHKGGTSREGG----QTAPAETRLFQVRSNSAGCTRAVEIDAVSSNLNSNDAFVLVTPAASFIWVGQGASDIEKRGAQQLCGILG-----------VSPSELSEGGEDGGFWDALGGKAAYRTSSRLKDKMNAHPPRLFACSNKTGRFIIEEVP-GEMTQEDLATDDVMILDTWDQVFVWIGNEAHDEEKMEAMTSAAQYIQTDPANRDPRTAIVKIKQGFEPPTFT 704          
BLAST of Gelsolin-like protein vs. Ensembl Zebrafish
Match: gsna (gelsolin a [Source:ZFIN;Acc:ZDB-GENE-030131-9653])

HSP 1 Score: 208.764 bits (530), Expect = 2.182e-59
Identity = 120/310 (38.71%), Postives = 187/310 (60.32%), Query Frame = 3
Query:  366 LFIWRIEKFKVVEWPQKQHGEFYEGDSYIVLNIY-QRENELLYDVHFWIGKYSTQDEYGTAAYKTVELDNLLDDKPVQHREVQHYESELFKSYF-KNLIYLKGGCESGFRHVKTVEYT-PRLLHVRGEKRNIIVSEVTATKHNLNSNDVFIYDTGTHIFEWIGKGANKDEKFKGQEFAQAL-NSDRNGKAKVEVVDEANISENHEFYKHLSDLQPD-----EDDKWQNKLSVKDKKLFRISDASGSLKFENIAI-GKFAKKDINEDDIFIVDNGLE--VYVYIGENASPNERQNALIYAHNYLKQTEYPQ 1259
            L +WRIEKF +V  P+  +G FY GD+Y+VL    Q    L YD+HFW+G Y TQDE G+AA  TV++D+ L  KP+Q+REVQ +ES+ F  YF K L Y++GG  SGF+HV T E    R+L V+G +R +  +EV  +  + N  D FI D G  I++W G  +N+ EK K  + A+ + +++R+G+A+V V DE    E  +  + L + +PD      DD   +  + K  KL+++SDASG +    +A    F +  +   D FI+D+G +  ++V+ G++A+  ER+ A+  A  ++K+  YP+
Sbjct:   16 LQVWRIEKFDLVAVPENLYGGFYTGDAYLVLKTTKQTSGNLQYDLHFWLGDYCTQDESGSAAIFTVQMDDYLGGKPIQYREVQGHESKAFLGYFKKGLQYMQGGVASGFKHVVTNEVVMQRVLQVKG-RRVVRATEVPVSWDSFNQGDCFILDLGNEIYQWCGSKSNRFEKLKATQLAKGIRDNERSGRARVYVCDEG--VEREKMLEVLGE-KPDLPEGASDDVKADASNRKMAKLYKVSDASGDMAIALVAAENPFTQSALESSDCFILDHGSDGKIFVWKGKDANMEERKAAMKAADEFIKKMGYPK 321          

HSP 2 Score: 135.191 bits (339), Expect = 1.819e-33
Identity = 100/330 (30.30%), Postives = 150/330 (45.45%), Query Frame = 3
Query:  354 GHSELFIWRIEKFKVVEWPQKQHGEFYEGDSYIVLNIYQRENELLYDVHFWIGKYSTQDEYGTAAYKTVELDNLLDDKPVQHREVQHYESELFKSYF--KNLIYLKGGC--ESGFRHVKTVEYTPRLLHVRGEKRNIIVS-EVTATKHNLNSNDVFIYDTGTHIFEWIGKGANKDEKFKGQEFAQALNSDRNGKAKVEVVDEANISENHE---FYKHLSDLQP-DEDDKWQNKLSVKDKKLFRISDASGSLKFENIAIGKFAKKDINEDDIFIVDNGLEVYVYIGENASPNERQNALIYAHNYLKQTEYPQVPVTVMKKDVKGKNAENFN 1316
            G+ E  IWRIE    V      +G+FY GDSYI+L  Y+      + ++ W G  STQDE G +A    +LD+ L   PVQ R VQ  E     S F  + ++  KGG   E G    +T     RL  VR        + E+ A   NLNSND F+  T    F W+G+GA+  EK   Q+    L            V  + +SE  E   F+  L          + ++K++    +LF  S+ +G    E +  G+  ++D+  DD+ I+D   +V+V+IG  A   E+  A+  A  Y++     + P T + K  +G     F 
Sbjct:  391 GNGEKQIWRIEGSDKVPVDPSTYGQFYGGDSYIILYSYRHGGRQGHIIYIWQGADSTQDEIGASAILGAQLDDELGGGPVQVRVVQGKEPAHLMSLFGGQPMVVHKGGTSREGG----QTAPAETRLFQVRSNSAGCTRAVEIDAVSSNLNSNDAFVLVTPAASFIWVGQGASDIEKRGAQQLCGILG-----------VSPSELSEGGEDGGFWDALGGKAAYRTSSRLKDKMNAHPPRLFACSNKTGRFIIEEVP-GEMTQEDLATDDVMILDTWDQVFVWIGNEAHDEEKMEAMTSAAQYIQTDPANRDPRTAIVKIKQGFEPPTFT 704          
BLAST of Gelsolin-like protein vs. Ensembl Xenopus
Match: jazf1 (JAZF zinc finger 1 [Source:Xenbase;Acc:XB-GENE-950886])

HSP 1 Score: 215.312 bits (547), Expect = 5.688e-61
Identity = 125/339 (36.87%), Postives = 192/339 (56.64%), Query Frame = 3
Query:  351 CGHSELFIWRIEKFKVVEWPQKQHGEFYEGDSYIVLNIYQRENELLYDVHFWIGKYSTQDEYGTAAYKTVELDNLLDDKPVQHREVQHYESELFKSYFKN-LIYLKGGCESGFRHVKTVEY-TPRLLHVRGEKRNIIVSEVTATKHNLNSNDVFIYDTGTHIFEWIGKGANKDEKFKGQEFAQALNSD-RNGKAKVEVVDEANISEN---------HEFYKHLSDLQPDEDDKWQNKLSVKDKKLFRISDASGSLKFENIAIGKFAKKDINEDDIFIVD-NGLEVYVYIGENASPNERQNALIYAHNYLKQTEYPQVPVTVMKKDVKGKNAENFNKVIE 1328
            C    L IW +EK K+V  P+K +G F+EGD YI+L   Q  N L+ D+H+WIGK S+QDE G+AA+   ++D LL   P+QHREVQ +ES  FKSYFKN +IY KGG  SGF+HV+T  Y   RLLHV+G K+++  +EV  + ++ N  DVF+ D G  I +W G  +NK E+ +    AQ++  D R G+A++ V+D    S +               L D  PDE    Q K +V   +L+ + +   +L  + +A     +  +  +D  I+D  G+++YV+ G+N+SP E+  A   A  +++   YP  P T ++    G  +  F ++ +
Sbjct:    9 CRKPGLQIWSMEKMKMVPIPEKAYGSFFEGDCYILLYNKQTPNGLISDIHYWIGKDSSQDEQGSAAFYATQIDGLLGGGPIQHREVQGHESATFKSYFKNGVIYKKGGVSSGFKHVETNMYNIRRLLHVKG-KKHVTATEVAMSWNSFNKGDVFLLDLGKVIIQWNGPESNKSERIRACSLAQSIRDDERGGRAQIGVIDNEQDSPDLMQIMVAVLGARAGELKDSVPDEKADEQQKANV---RLYHVFEKDANLVVQELATKPLTQDLLQHEDCHILDQGGVKIYVWRGKNSSPEEKSAAFSRAVGFIQAKGYP--PTTNVEVVNDGAESAMFKQLFQ 341          

HSP 2 Score: 141.739 bits (356), Expect = 2.143e-35
Identity = 90/302 (29.80%), Postives = 158/302 (52.32%), Query Frame = 3
Query:  348 ACGHSELFIWRIEKFKVVEWPQKQHGEFYEGDSYIVLNIYQRENELLYDVHFWIGKYSTQDEYGTAAYKTVELDNLLDDKPVQHREVQHYESELFKSYFKN--LIYLKGGCESGFRHVKTVEYTPRLLHVRGEKR-NIIVSEVTATKHNLNSNDVFIYDTGTHIFEWIGKGANKDEKFKGQEFAQALNSDRNGKAKVEVVDEANISENHEFYKHLSDLQPDEDDK-WQNKLSVKDKKLFRISDASGSLKFENIAIGKFAKKDINEDDIFIVDNGLEVYVYIGENASPNERQNALIYAHNYLK 1241
            A G+ E  +WRIEK ++ E   + +G+FY GD Y++L  Y +     Y ++ W+G++++QDE    A++ V+LD    D+PVQ R     E    ++ FK   +IY  G    G   V   E   +L  V+G    N   +EV A   +LNSNDVF+  T +  + W GKG + DE+    E A+ + +  + + K  +++     E  EF+  L    P   DK +Q +      +LF  S+ +G  +F    +  F + D++EDD+ ++D   E+++++G++A+  E+  ++  +  YL+
Sbjct:  390 ASGNVE--VWRIEKLELAEVEPRTYGQFYGGDCYLILYTYMKSGRPNYLLYMWLGRHASQDEITACAFQAVQLDKKYHDQPVQIRVTMGKEPRHLQAMFKGKMIIYEGGTSRLG---VHEPEAPIKLFQVKGTNEYNTKATEVPARASSLNSNDVFVLKTESMCYLWCGKGCSGDER----EMAKTVANIISKQDKQTILEG---QEPAEFWVALGGKAPYASDKRFQEQAVQYSPRLFECSNQTG--RFVMTEVVDFCQSDLDEDDVMLLDTWEEIFLWVGKSANDYEKTESVKASQEYLR 677          
BLAST of Gelsolin-like protein vs. Ensembl Xenopus
Match: jazf1 (JAZF zinc finger 1 [Source:Xenbase;Acc:XB-GENE-950886])

HSP 1 Score: 214.927 bits (546), Expect = 7.771e-61
Identity = 125/339 (36.87%), Postives = 192/339 (56.64%), Query Frame = 3
Query:  351 CGHSELFIWRIEKFKVVEWPQKQHGEFYEGDSYIVLNIYQRENELLYDVHFWIGKYSTQDEYGTAAYKTVELDNLLDDKPVQHREVQHYESELFKSYFKN-LIYLKGGCESGFRHVKTVEY-TPRLLHVRGEKRNIIVSEVTATKHNLNSNDVFIYDTGTHIFEWIGKGANKDEKFKGQEFAQALNSD-RNGKAKVEVVDEANISEN---------HEFYKHLSDLQPDEDDKWQNKLSVKDKKLFRISDASGSLKFENIAIGKFAKKDINEDDIFIVD-NGLEVYVYIGENASPNERQNALIYAHNYLKQTEYPQVPVTVMKKDVKGKNAENFNKVIE 1328
            C    L IW +EK K+V  P+K +G F+EGD YI+L   Q  N L+ D+H+WIGK S+QDE G+AA+   ++D LL   P+QHREVQ +ES  FKSYFKN +IY KGG  SGF+HV+T  Y   RLLHV+G K+++  +EV  + ++ N  DVF+ D G  I +W G  +NK E+ +    AQ++  D R G+A++ V+D    S +               L D  PDE    Q K +V   +L+ + +   +L  + +A     +  +  +D  I+D  G+++YV+ G+N+SP E+  A   A  +++   YP  P T ++    G  +  F ++ +
Sbjct:    9 CRKPGLQIWSMEKMKMVPIPEKAYGSFFEGDCYILLYNKQTPNGLISDIHYWIGKDSSQDEQGSAAFYATQIDGLLGGGPIQHREVQGHESATFKSYFKNGVIYKKGGVSSGFKHVETNMYNIRRLLHVKG-KKHVTATEVAMSWNSFNKGDVFLLDLGKVIIQWNGPESNKSERIRACSLAQSIRDDERGGRAQIGVIDNEQDSPDLMQIMVAVLGARAGELKDSVPDEKADEQQKANV---RLYHVFEKDANLVVQELATKPLTQDLLQHEDCHILDQGGVKIYVWRGKNSSPEEKSAAFSRAVGFIQAKGYP--PTTNVEVVNDGAESAMFKQLFQ 341          

HSP 2 Score: 141.354 bits (355), Expect = 2.706e-35
Identity = 90/302 (29.80%), Postives = 158/302 (52.32%), Query Frame = 3
Query:  348 ACGHSELFIWRIEKFKVVEWPQKQHGEFYEGDSYIVLNIYQRENELLYDVHFWIGKYSTQDEYGTAAYKTVELDNLLDDKPVQHREVQHYESELFKSYFKN--LIYLKGGCESGFRHVKTVEYTPRLLHVRGEKR-NIIVSEVTATKHNLNSNDVFIYDTGTHIFEWIGKGANKDEKFKGQEFAQALNSDRNGKAKVEVVDEANISENHEFYKHLSDLQPDEDDK-WQNKLSVKDKKLFRISDASGSLKFENIAIGKFAKKDINEDDIFIVDNGLEVYVYIGENASPNERQNALIYAHNYLK 1241
            A G+ E  +WRIEK ++ E   + +G+FY GD Y++L  Y +     Y ++ W+G++++QDE    A++ V+LD    D+PVQ R     E    ++ FK   +IY  G    G   V   E   +L  V+G    N   +EV A   +LNSNDVF+  T +  + W GKG + DE+    E A+ + +  + + K  +++     E  EF+  L    P   DK +Q +      +LF  S+ +G  +F    +  F + D++EDD+ ++D   E+++++G++A+  E+  ++  +  YL+
Sbjct:  390 ASGNVE--VWRIEKLELAEVEPRTYGQFYGGDCYLILYTYMKSGRPNYLLYMWLGRHASQDEITACAFQAVQLDKKYHDQPVQIRVTMGKEPRHLQAMFKGKMIIYEGGTSRLG---VHEPEAPIKLFQVKGTNEYNTKATEVPARASSLNSNDVFVLKTESMCYLWCGKGCSGDER----EMAKTVANIISKQDKQTILEG---QEPAEFWVALGGKAPYASDKRFQEQAVQYSPRLFECSNQTG--RFVMTEVVDFCQSDLDEDDVMLLDTWEEIFLWVGKSANDYEKTESVKASQEYLR 677          
BLAST of Gelsolin-like protein vs. Ensembl Xenopus
Match: jazf1 (JAZF zinc finger 1 [Source:Xenbase;Acc:XB-GENE-950886])

HSP 1 Score: 209.92 bits (533), Expect = 4.036e-59
Identity = 124/339 (36.58%), Postives = 191/339 (56.34%), Query Frame = 3
Query:  351 CGHSELFIWRIEKFKVVEWPQKQHGEFYEGDSYIVLNIYQRENELLYDVHFWIGKYSTQDEYGTAAYKTVELDNLLDDKPVQHREVQHYESELFKSYFKN-LIYLKGGCESGFRHVKTVEY-TPRLLHVRGEKRNIIVSEVTATKHNLNSNDVFIYDTGTHIFEWIGKGANKDEKFKGQEFAQALNSD-RNGKAKVEVVDEANISEN---------HEFYKHLSDLQPDEDDKWQNKLSVKDKKLFRISDASGSLKFENIAIGKFAKKDINEDDIFIVD-NGLEVYVYIGENASPNERQNALIYAHNYLKQTEYPQVPVTVMKKDVKGKNAENFNKVIE 1328
            C    L IW +EK K+V  P+K +G F+EGD YI+L      N L+ D+H+WIGK S+QDE G+AA+   ++D LL   P+QHREVQ +ES  FKSYFKN +IY KGG  SGF+HV+T  Y   RLLHV+G K+++  +EV  + ++ N  DVF+ D G  I +W G  +NK E+ +    AQ++  D R G+A++ V+D    S +               L D  PDE    Q K +V   +L+ + +   +L  + +A     +  +  +D  I+D  G+++YV+ G+N+SP E+  A   A  +++   YP  P T ++    G  +  F ++ +
Sbjct:   35 CRKPGLQIWSMEKMKMVPIPEKAYGSFFEGDCYILLYT---PNGLISDIHYWIGKDSSQDEQGSAAFYATQIDGLLGGGPIQHREVQGHESATFKSYFKNGVIYKKGGVSSGFKHVETNMYNIRRLLHVKG-KKHVTATEVAMSWNSFNKGDVFLLDLGKVIIQWNGPESNKSERIRACSLAQSIRDDERGGRAQIGVIDNEQDSPDLMQIMVAVLGARAGELKDSVPDEKADEQQKANV---RLYHVFEKDANLVVQELATKPLTQDLLQHEDCHILDQGGVKIYVWRGKNSSPEEKSAAFSRAVGFIQAKGYP--PTTNVEVVNDGAESAMFKQLFQ 364          

HSP 2 Score: 141.354 bits (355), Expect = 2.771e-35
Identity = 87/294 (29.59%), Postives = 154/294 (52.38%), Query Frame = 3
Query:  372 IWRIEKFKVVEWPQKQHGEFYEGDSYIVLNIYQRENELLYDVHFWIGKYSTQDEYGTAAYKTVELDNLLDDKPVQHREVQHYESELFKSYFKN--LIYLKGGCESGFRHVKTVEYTPRLLHVRGEKR-NIIVSEVTATKHNLNSNDVFIYDTGTHIFEWIGKGANKDEKFKGQEFAQALNSDRNGKAKVEVVDEANISENHEFYKHLSDLQPDEDDK-WQNKLSVKDKKLFRISDASGSLKFENIAIGKFAKKDINEDDIFIVDNGLEVYVYIGENASPNERQNALIYAHNYLK 1241
            +WRIEK ++ E   + +G+FY GD Y++L  Y +     Y ++ W+G++++QDE    A++ V+LD    D+PVQ R     E    ++ FK   +IY  G    G   V   E   +L  V+G    N   +EV A   +LNSNDVF+  T +  + W GKG + DE+    E A+ + +  + + K  +++     E  EF+  L    P   DK +Q +      +LF  S+ +G  +F    +  F + D++EDD+ ++D   E+++++G++A+  E+  ++  +  YL+
Sbjct:  419 VWRIEKLELAEVEPRTYGQFYGGDCYLILYTYMKSGRPNYLLYMWLGRHASQDEITACAFQAVQLDKKYHDQPVQIRVTMGKEPRHLQAMFKGKMIIYEGGTSRLG---VHEPEAPIKLFQVKGTNEYNTKATEVPARASSLNSNDVFVLKTESMCYLWCGKGCSGDER----EMAKTVANIISKQDKQTILEG---QEPAEFWVALGGKAPYASDKRFQEQAVQYSPRLFECSNQTG--RFVMTEVVDFCQSDLDEDDVMLLDTWEEIFLWVGKSANDYEKTESVKASQEYLR 700          
BLAST of Gelsolin-like protein vs. Ensembl Xenopus
Match: ndc80 (NDC80 kinetochore complex component [Source:Xenbase;Acc:XB-GENE-997352])

HSP 1 Score: 202.986 bits (515), Expect = 2.629e-57
Identity = 122/308 (39.61%), Postives = 183/308 (59.42%), Query Frame = 3
Query:  366 LFIWRIEKFKVVEWPQKQHGEFYEGDSYIVLNIYQRENELLYDVHFWIGKYSTQDEYGTAAYKTVELDNLLDDKPVQHREVQHYESELFKSYFKNLI-YLKGGCESGFRHVKTVEY-TPRLLHVRGEKRNIIVSEVTATKHNLNSNDVFIYDTGTHIFEWIGKGANKDEKFKGQEFAQAL-NSDRNGKAKVEVVDEANISENHEFYKHLSDLQPD-----EDDKWQNKLSVKDKKLFRISDASGSLKFENIA-IGKFAKKDINEDDIFIVDNGLE--VYVYIGENASPNERQNALIYAHNYLKQTEYP 1256
            L IWRIE   +V  P+  +G FY GD+Y+VLN   + N   YD+H+W+GK  +QDE   AA  TV+LD  L  KPVQ+RE+Q +ES  F  YFK  I Y  GG  SGF+HV T E    RLLH++G +R +  +EV  +  N NS D FI D G  I++W G   NK E+ K  + A  + ++++NG+A++ VV+E   SE +E  K L   +P      + D   +  + K+ KL+ +SDASGS+K   +A    F+K  +  ++ FI+D+  +  ++V+ G+NA+  ER+ A+  A  +++Q  YP
Sbjct:   17 LQIWRIENMDLVPVPKTLYGNFYVGDAYLVLNTIAKNNSKYYDLHYWLGKECSQDESTAAAIYTVQLDEFLGGKPVQYREIQGHESSAFVGYFKGGIKYKAGGVASGFQHVVTNELGAQRLLHIKG-RRVVRATEVPLSWSNFNSGDCFIVDLGAVIYQWCGSECNKYERLKAAQVAHGIRDNEKNGRAQIIVVEEG--SEPNELTKVLG-AKPQLPAGDDADDVADDTNRKNVKLYMVSDASGSMKVSVVAEQSPFSKAMLLSEECFILDHSGDKKIFVWKGKNANTEERKAAMKTAEQFIQQMNYP 320          

HSP 2 Score: 112.849 bits (281), Expect = 5.582e-26
Identity = 88/294 (29.93%), Postives = 144/294 (48.98%), Query Frame = 3
Query:  354 GHSELFIWRIEKFKVVEWPQKQHGEFYEGDSYIVLNIYQRENELLYDVHFWIGKYSTQDEYGTAAYKTVELDNLLDDKPVQHREVQHYESELFKSYFKN---LIYLKGGCESGFRHVKTVEYTPRLLHVRGEKRNII-VSEVTATKHNLNSNDVFIYDTGTHI-FEWIGKGANKDEKFKGQEFAQALNSDRNGKAKVEVVDEANISENHEFYKHLSDLQPDEDDK-WQNKLSVKDKKLFRISDASGSLKFENIAIGKFAKKDINEDDIFIVDNGLEVYVYIGENASPNERQNAL 1217
            G  ++ I+R+E    V       G+FY GD YI+L  Y +       ++ W G  +T+DE   +A+ TV+LD  L D+ VQ R  Q  E     S FK+   +IY  G    G    +T     RL  +R     I  + EV      LNSNDVF+     +  ++WIGKGA+ +E+   +  A  L      + KV  + E    E  EF+  L+  +  +     ++K  V   +LF  S+ +G    E +  G+F + D+ EDD+ ++D   +V+++IG++A+  E++ +L
Sbjct:  391 GSGKVEIFRVESCGRVPIEPNTFGQFYGGDCYIILYTYAKG----LIIYTWQGAKATRDELTASAFLTVQLDRSLGDQAVQVRVTQGKEPPHLLSLFKDKPLIIYKDGTSRKGG---QTPPSAVRLFQIRKNLSTITRIIEVDTDASLLNSNDVFVLKLKNNSGYKWIGKGASGEEEKAAEYIANVL------RCKVSKIAEGQ--EPDEFWSALNGKKKYQTSALLESKSIVNPPRLFGCSNKTGRFLIEEVP-GEFTQDDLAEDDVMLLDTHEQVFLWIGKDANEQEKKESL 668          
BLAST of Gelsolin-like protein vs. Ensembl Xenopus
Match: ndc80 (NDC80 kinetochore complex component [Source:Xenbase;Acc:XB-GENE-997352])

HSP 1 Score: 202.601 bits (514), Expect = 3.021e-57
Identity = 122/308 (39.61%), Postives = 183/308 (59.42%), Query Frame = 3
Query:  366 LFIWRIEKFKVVEWPQKQHGEFYEGDSYIVLNIYQRENELLYDVHFWIGKYSTQDEYGTAAYKTVELDNLLDDKPVQHREVQHYESELFKSYFKNLI-YLKGGCESGFRHVKTVEY-TPRLLHVRGEKRNIIVSEVTATKHNLNSNDVFIYDTGTHIFEWIGKGANKDEKFKGQEFAQAL-NSDRNGKAKVEVVDEANISENHEFYKHLSDLQPD-----EDDKWQNKLSVKDKKLFRISDASGSLKFENIA-IGKFAKKDINEDDIFIVDNGLE--VYVYIGENASPNERQNALIYAHNYLKQTEYP 1256
            L IWRIE   +V  P+  +G FY GD+Y+VLN   + N   YD+H+W+GK  +QDE   AA  TV+LD  L  KPVQ+RE+Q +ES  F  YFK  I Y  GG  SGF+HV T E    RLLH++G +R +  +EV  +  N NS D FI D G  I++W G   NK E+ K  + A  + ++++NG+A++ VV+E   SE +E  K L   +P      + D   +  + K+ KL+ +SDASGS+K   +A    F+K  +  ++ FI+D+  +  ++V+ G+NA+  ER+ A+  A  +++Q  YP
Sbjct:   17 LQIWRIENMDLVPVPKTLYGNFYVGDAYLVLNTIAKNNSKYYDLHYWLGKECSQDESTAAAIYTVQLDEFLGGKPVQYREIQGHESSAFVGYFKGGIKYKAGGVASGFQHVVTNELGAQRLLHIKG-RRVVRATEVPLSWSNFNSGDCFIVDLGAVIYQWCGSECNKYERLKAAQVAHGIRDNEKNGRAQIIVVEEG--SEPNELTKVLG-AKPQLPAGDDADDVADDTNRKNVKLYMVSDASGSMKVSVVAEQSPFSKAMLLSEECFILDHSGDKKIFVWKGKNANTEERKAAMKTAEQFIQQMNYP 320          

HSP 2 Score: 90.8929 bits (224), Expect = 8.441e-19
Identity = 89/324 (27.47%), Postives = 146/324 (45.06%), Query Frame = 3
Query:  372 IWRIEKFKVVEWPQKQHGEFYEGDSYIVLNIYQRENELLYDVHFWIGKYSTQDEYGTAAYKTVELDNLLDDKPVQHREVQHYESELFKSYFKN---LIYLKGGCESGFRHVKTVEYTPRLLHVRGEKRNII-VSEVTATKHNLNSNDVFIYDTGTHI-FEWIGKGANKDEKFKGQEFAQALNSDRNGKAKVEVVDEANISENHEFYKHLSDLQPDEDDK-WQNKLSVKDKKLFRISDASGSLKFENIAIGKFAKKDINEDDIFIVDNGLEVYVYIGENASPNERQNALIYAHNYLKQTEYPQ---VPVTVMKKDVKGKNAENFN 1316
            I+R+E    V       G+FY GD YI+L  Y +       ++ W G  +T+DE   +A+ TV+LD  L D+ VQ R  Q  E     S FK+   +IY  G    G    +T     RL  +R     I  + EV      LNSNDVF+     +  ++WIGKGA+ +E+   +  A  L      + KV  + E    E  EF+  L+  +  +     ++K  V   +LF  S+ +G    + + I             F+    L+V+++IG++A+  E++ +L  A  Y++     +   +P+  +K   +G    NF 
Sbjct:  398 IFRVESCGRVPIEPNTFGQFYGGDCYIILYTYAKG----LIIYTWQGAKATRDELTASAFLTVQLDRSLGDQAVQVRVTQGKEPPHLLSLFKDKPLIIYKDGTSRKGG---QTPPSAVRLFQIRKNLSTITRIIEVDTDASLLNSNDVFVLKLKNNSGYKWIGKGASGEEEKAAEYIANVL------RCKVSKIAEGQ--EPDEFWSALNGKKKYQTSALLESKSIVNPPRLFGCSNKTGRFLVQVLMIR------------FLFH--LKVFLWIGKDANEQEKKESLKSAKQYIETDPSGRDKGIPIVSVK---QGHEPPNFT 689          
BLAST of Gelsolin-like protein vs. Ensembl Mouse
Match: Vil1 (villin 1 [Source:MGI Symbol;Acc:MGI:98930])

HSP 1 Score: 209.534 bits (532), Expect = 3.838e-59
Identity = 123/338 (36.39%), Postives = 191/338 (56.51%), Query Frame = 3
Query:  372 IWRIEKFKVVEWPQKQHGEFYEGDSYIVLNIYQRENELLYDVHFWIGKYSTQDEYGTAAYKTVELDNLLDDKPVQHREVQHYESELFKSYFK-NLIYLKGGCESGFRHVKTVEY-TPRLLHVRGEKRNIIVSEVTATKHNLNSNDVFIYDTGTHIFEWIGKGANKDEKFKGQEFAQAL-NSDRNGKAKVEVVD---EANISENHEFYKHLSDLQPDEDDKWQNKLSVKDK------KLFRISDASGSLKFENIAIGKFAKKDINEDDIFIVD-NGLEVYVYIGENASPNERQNALIYAHNYLKQTEYPQVPVTVMKKDVKGKNAENFNKVIEG*TLAN 1346
            IWRIE  ++V  P    G F++GD Y+VL I++  + L YD+H+WIG+ S+QDE G AA  T ++D+ L  + VQHREVQ  ESE F+SYFK  L+  KGG  SG +HV+T      RLLHV+G KRN++  EV  +  + N  DVF+ D G  I +W G  +N+ E+ +G   A+ + + +R G+  V VVD   E +  +      H+  L P ++ K     SV +       KL+ +SD+ G L    +A     +  +  +D +I+D  GL+++V+ G+NA+  ER  A+  A N++K  +YP  P T ++    G  +  F ++ +  T+ N
Sbjct:   21 IWRIEAMQMVPVPSSTFGSFFDGDCYVVLAIHKTSSTLSYDIHYWIGQDSSQDEQGAAAIYTTQMDDYLKGRAVQHREVQGNESETFRSYFKQGLVIRKGGVASGMKHVETNSCDVQRLLHVKG-KRNVLAGEVEMSWKSFNRGDVFLLDLGKLIIQWNGPESNRMERLRGMALAKEIRDQERGGRTYVGVVDGEKEGDSPQLMAIMNHV--LGPRKELKAAISDSVVEPAAKAALKLYHVSDSEGKLVVREVATRPLTQDLLKHEDCYILDQGGLKIFVWKGKNANAQERSGAMSQALNFIKAKQYP--PSTQVEVQNDGAESPIFQQLFQKWTVPN 353          

HSP 2 Score: 139.043 bits (349), Expect = 1.155e-34
Identity = 103/317 (32.49%), Postives = 160/317 (50.47%), Query Frame = 3
Query:  354 GHSELFIWRIEKFKVVEWPQKQHGEFYEGDSYIVLNIYQRENELLYDVHFWIGKYSTQDEYGTAAYKTVELDNLLDDKPVQHREVQHYESELFKSYFKNLIYLKGGCESGFRHVKTVEYTPRLLHVRGEKR-NIIVSEVTATKHNLNSNDVFIYDTGTHIFEWIGKGANKDEKFKGQEFAQALNSDRNGKAKVEVVDEANISENHEFYKHLSDLQPDEDDK-WQNKLSVKDKKLFRISDASGSLKFENIAIGKFAKKDINEDDIFIVDNGLEVYVYIGENASPNERQNALIYAHNYLKQTEYP-----QVPVTVMKK 1283
            G  E+ +WRIE  ++V    K  G FY GD Y++L  Y    +  Y ++ W G  ++QDE   +AY+ V LD   +D+PVQ R     E     S FK  + +  G  S   +++ V  T RL  VRG    N    EVTA   +LNSNDVFI  T +  + W GKG + DE+    E A+ + +D   + + +VV E    E   F+  L    P  + K  Q +  V   +LF  S+ +G  +F    I  F + D+ E+D+F++D   +V+ +IG++A+  E++ A      YLK   +P     + P+ V+K+
Sbjct:  396 GSGEVQVWRIEDLELVPVESKWLGHFYGGDCYLLLYTYLIGEKQHYLLYIWQGSQASQDEIAASAYQAVLLDQKYNDEPVQIRVTMGKEPPHLMSIFKGRMVVYQGGTSRKNNLEPVPST-RLFQVRGTNADNTKAFEVTARATSLNSNDVFILKTPSCCYLWCGKGCSGDER----EMAKMV-ADTISRTEKQVVVEGQ--EPANFWMALGGKAPYANTKRLQEENQVITPRLFECSNQTG--RFLATEIFDFNQDDLEEEDVFLLDVWDQVFFWIGKHANEEEKKAAATTVQEYLK--THPGNRDLETPIIVVKQ 700          
BLAST of Gelsolin-like protein vs. Ensembl Mouse
Match: Scin (scinderin [Source:MGI Symbol;Acc:MGI:1306794])

HSP 1 Score: 203.756 bits (517), Expect = 2.924e-58
Identity = 122/315 (38.73%), Postives = 186/315 (59.05%), Query Frame = 3
Query:  342 AKACGHSELFIWRIEKFKVVEWPQKQHGEFYEGDSYIVLNIYQRENELLYDVHFWIGKYSTQDEYGTAAYKTVELDNLLDDKPVQHREVQHYESELFKSYFK-NLIYLKGGCESGFRHVKTVEYTP-RLLHVRGEKRNIIVSEVTATKHNLNSNDVFIYDTGTHIFEWIGKGANKDEKFKGQEFAQAL-NSDRNGKAKVEVVDEANISENHEFYKHLSDLQ--PD---EDDKWQNKLSVKDKKLFRISDASGSLKFENIA-IGKFAKKDINEDDIFIVDNGL--EVYVYIGENASPNERQNALIYAHNYLKQTEY 1253
            A+A   + L +WR+EK ++V  PQ  +G+FY GD+Y+VL+  +      Y +HFW+GK  +QDE   AA  TV++D+ L  KPVQ RE+Q YES  F  YFK  L Y  GG  SG  HV T + T  RLLHV+G +R +  +EV  +  + N  D FI D GT I++W G   NK E+ K  + A  + +++R G++++ VV+E   SE  E  K L      PD   +DD   +  + K  KL+ +SDASGS+K   +A    F+   +  ++ FI+D+G   +++V+ G+NA+P ER+ A+  A  +L++ +Y
Sbjct:   11 ARAGQQAGLQVWRVEKLELVPVPQGAYGDFYVGDAYLVLHTTKSSRGFSYRLHFWLGKECSQDESTAAAIFTVQMDDYLGGKPVQSRELQGYESTDFVGYFKGGLKYKAGGVASGLNHVLTNDLTAKRLLHVKG-RRVVRATEVPLSWESFNKGDCFIIDLGTEIYQWCGSSCNKYERLKASQVAIGIRDNERKGRSQLIVVEEG--SEPSELMKVLGRKPELPDGDNDDDVVADISNRKMAKLYMVSDASGSMKVTLVAEENPFSMGMLLSEECFILDHGAAKQIFVWKGKNANPQERKTAMKTAEEFLQKMKY 322          

HSP 2 Score: 85.5001 bits (210), Expect = 3.043e-17
Identity = 71/214 (33.18%), Postives = 103/214 (48.13%), Query Frame = 3
Query:  354 GHSELFIWRIEKFKVVEWPQKQHGEFYEGDSYIVLNIYQRENELLYDVHFWIGKYSTQDEYGTAAYKTVELDNLLDDKPVQHREVQHYESELFKSYFKN--LIYLKGGCESGFRHVKTVEYTPRLLHVRGEKRNII----VSEVTA--TKHNLNSNDVFIYDTGTHIFEWIGKGANKDEKFKGQEFAQA-LNSDRNGKAKVEVVDEANISENHE 968
            G   + IWR+E    V+     +GEFY GD YI+L  Y R  +++Y    W G  +T+DE   +A+ TV+LD  L  + VQ R  Q  E     S FK+  LI  K G     +  +      RL  VR    +I     + EV    T+ +L  +DV + D    IF WIGK AN+ EK +  + A+  L +D +G+ K   +    I + HE
Sbjct:  394 GSGGVEIWRVENSGRVQIDPSSYGEFYGGDCYIILYTYPR-GQIIYT---WQGANATRDELTMSAFLTVQLDRSLGGQAVQVRVSQGKEPAHLLSLFKDKPLIIYKNGTSK--KEGQAPAPPTRLFQVRRNLASITRIVEIEEVPGEFTQDDLAEDDVMLLDAWEQIFIWIGKDANEVEKKESVKSAKMYLETDPSGRDKRTPI--VIIKQGHE 599          
BLAST of Gelsolin-like protein vs. Ensembl Mouse
Match: Gsn (gelsolin [Source:MGI Symbol;Acc:MGI:95851])

HSP 1 Score: 201.83 bits (512), Expect = 5.415e-58
Identity = 117/321 (36.45%), Postives = 190/321 (59.19%), Query Frame = 3
Query:  345 KACGHSELFIWRIEKFKVVEWPQKQHGEFYEGDSYIVLNIYQ-RENELLYDVHFWIGKYSTQDEYGTAAYKTVELDNLLDDKPVQHREVQHYESELFKSYFKN-LIYLKGGCESGFRHVKTVE-YTPRLLHVRGEKRNIIVSEVTATKHNLNSNDVFIYDTGTHIFEWIGKGANKDEKFKGQEFAQAL-NSDRNGKAKVEVVDEANISENHEFYKHLSDLQPD--EDDKWQNKLSVKDKKLFRISDASGSLKFENIAI-GKFAKKDINEDDIFIVDNGLE--VYVYIGENASPNERQNALIYAHNYLKQTEYP-QVPVTVM 1277
            KA     L IWR+EKF +V  P   +G+F+ GD+Y++L   Q R   L YD+H+W+G   +QDE G AA  TV+LD+ L+ + VQHREVQ +ES  F  YFK+ L Y KGG  SGF+HV   E    RL  V+G +R +  +EV  +  + N+ D FI D G +I++W G G+NK E+ K  + ++ + +++R+G+A+V V +E    E            P+  ED   ++  + +  KL+++S+ +GS+    +A    FA+  +  +D FI+D+G +  ++V+ G+ A+  ER+ AL  A +++ + +YP Q  V+V+
Sbjct:   21 KAGKEPGLQIWRVEKFDLVPVPPNLYGDFFTGDAYVILKTVQLRNGNLQYDLHYWLGNECSQDESGAAAIFTVQLDDYLNGRAVQHREVQGFESSTFSGYFKSGLKYKKGGVASGFKHVVPNEVVVQRLFQVKG-RRVVRATEVPVSWDSFNNGDCFILDLGNNIYQWCGSGSNKFERLKATQVSKGIRDNERSGRAQVHVSEEGGEPEAMLQVLGPKPALPEGTEDTAKEDAANRRLAKLYKVSNGAGSMSVSLVADENPFAQGALRSEDCFILDHGRDGKIFVWKGKQANMEERKAALKTASDFISKMQYPRQTQVSVL 340          

HSP 2 Score: 90.8929 bits (224), Expect = 5.534e-19
Identity = 61/170 (35.88%), Postives = 81/170 (47.65%), Query Frame = 3
Query:  354 GHSELFIWRIEKFKVVEWPQKQHGEFYEGDSYIVLNIYQ---RENELLYDVHFWIGKYSTQDEYGTAAYKTVELDNLLDDKPVQHREVQHYESELFKSYF--KNLIYLKGGCESGFRHVKTVEYTPRLLHVRGEKRNIIVS-EVTATKHNLNSNDVFIYDTGTHIFEWIG 845
            G  +  IWRIE    V      +G+FY GDSYI+L  Y+   R+ +++Y+   W G  STQDE   +A  T +LD  L   PVQ R VQ  E     S F  K +I  KGG        +T   + RL  VR        + EV      LNSND F+  T +  + W+G
Sbjct:  403 GTGQKQIWRIEGSNKVPVDPATYGQFYGGDSYIILYNYRHGGRQGQIIYN---WQGAQSTQDEVAASAILTAQLDEELGGTPVQSRVVQGKEPAHLMSLFGGKPMIIYKGGTSR--DGGQTAPASIRLFQVRASSSGATRAVEVMPKSGALNSNDAFVLKTPSAAYLWVG 567          
BLAST of Gelsolin-like protein vs. Ensembl Mouse
Match: Gsn (gelsolin [Source:MGI Symbol;Acc:MGI:95851])

HSP 1 Score: 204.527 bits (519), Expect = 1.283e-57
Identity = 122/349 (34.96%), Postives = 201/349 (57.59%), Query Frame = 3
Query:  279 GSSEDRAVKKSSAENEPAWKKA------KACGHSELFIWRIEKFKVVEWPQKQHGEFYEGDSYIVLNIYQ-RENELLYDVHFWIGKYSTQDEYGTAAYKTVELDNLLDDKPVQHREVQHYESELFKSYFKN-LIYLKGGCESGFRHVKTVE-YTPRLLHVRGEKRNIIVSEVTATKHNLNSNDVFIYDTGTHIFEWIGKGANKDEKFKGQEFAQAL-NSDRNGKAKVEVVDEANISENHEFYKHLSDLQPD--EDDKWQNKLSVKDKKLFRISDASGSLKFENIAI-GKFAKKDINEDDIFIVDNGLE--VYVYIGENASPNERQNALIYAHNYLKQTEYP-QVPVTVM 1277
            G +++RA +   +E  P+          KA     L IWR+EKF +V  P   +G+F+ GD+Y++L   Q R   L YD+H+W+G   +QDE G AA  TV+LD+ L+ + VQHREVQ +ES  F  YFK+ L Y KGG  SGF+HV   E    RL  V+G +R +  +EV  +  + N+ D FI D G +I++W G G+NK E+ K  + ++ + +++R+G+A+V V +E    E            P+  ED   ++  + +  KL+++S+ +GS+    +A    FA+  +  +D FI+D+G +  ++V+ G+ A+  ER+ AL  A +++ + +YP Q  V+V+
Sbjct:   31 GRAQERAPQSRVSEARPSTMVVEHPEFLKAGKEPGLQIWRVEKFDLVPVPPNLYGDFFTGDAYVILKTVQLRNGNLQYDLHYWLGNECSQDESGAAAIFTVQLDDYLNGRAVQHREVQGFESSTFSGYFKSGLKYKKGGVASGFKHVVPNEVVVQRLFQVKG-RRVVRATEVPVSWDSFNNGDCFILDLGNNIYQWCGSGSNKFERLKATQVSKGIRDNERSGRAQVHVSEEGGEPEAMLQVLGPKPALPEGTEDTAKEDAANRRLAKLYKVSNGAGSMSVSLVADENPFAQGALRSEDCFILDHGRDGKIFVWKGKQANMEERKAALKTASDFISKMQYPRQTQVSVL 378          

HSP 2 Score: 131.724 bits (330), Expect = 2.701e-32
Identity = 99/324 (30.56%), Postives = 150/324 (46.30%), Query Frame = 3
Query:  354 GHSELFIWRIEKFKVVEWPQKQHGEFYEGDSYIVLNIYQ---RENELLYDVHFWIGKYSTQDEYGTAAYKTVELDNLLDDKPVQHREVQHYESELFKSYF--KNLIYLKGGCESGFRHVKTVEYTPRLLHVRGEKRNIIVS-EVTATKHNLNSNDVFIYDTGTHIFEWIGKGANKDEKFKGQEFAQALNSDRNGKAKVEVVDEANISENHEFYKHLSD-----LQPDEDDKWQNKLSVKDKKLFRISDASGSLKFENIAIGKFAKKDINEDDIFIVDNGLEVYVYIGENASPNERQNALIYAHNYLKQTEY---PQVPVTVMKK 1283
            G  +  IWRIE    V      +G+FY GDSYI+L  Y+   R+ +++Y+   W G  STQDE   +A  T +LD  L   PVQ R VQ  E     S F  K +I  KGG        +T   + RL  VR        + EV      LNSND F+  T +  + W+G GA++ EK   QE  + L S          V     SE   F++ L         P   DK   K+     +LF  S+  G    E +  G+  ++D+  DD+ ++D   +V+V++G+++   E+  AL  A  Y++        + P+TV+++
Sbjct:  441 GTGQKQIWRIEGSNKVPVDPATYGQFYGGDSYIILYNYRHGGRQGQIIYN---WQGAQSTQDEVAASAILTAQLDEELGGTPVQSRVVQGKEPAHLMSLFGGKPMIIYKGGTSR--DGGQTAPASIRLFQVRASSSGATRAVEVMPKSGALNSNDAFVLKTPSAAYLWVGAGASEAEKTGAQELLKVLRSQH--------VQVEEGSEPDAFWEALGGKTAYRTSPRLKDK---KMDAHPPRLFACSNRIGRFVIEEVP-GELMQEDLATDDVMLLDTWDQVFVWVGKDSQEEEKTEALTSAKRYIETDPANRDRRTPITVVRQ 747          
BLAST of Gelsolin-like protein vs. Ensembl Mouse
Match: Scin (scinderin [Source:MGI Symbol;Acc:MGI:1306794])

HSP 1 Score: 203.371 bits (516), Expect = 1.480e-57
Identity = 122/315 (38.73%), Postives = 186/315 (59.05%), Query Frame = 3
Query:  342 AKACGHSELFIWRIEKFKVVEWPQKQHGEFYEGDSYIVLNIYQRENELLYDVHFWIGKYSTQDEYGTAAYKTVELDNLLDDKPVQHREVQHYESELFKSYFK-NLIYLKGGCESGFRHVKTVEYTP-RLLHVRGEKRNIIVSEVTATKHNLNSNDVFIYDTGTHIFEWIGKGANKDEKFKGQEFAQAL-NSDRNGKAKVEVVDEANISENHEFYKHLSDLQ--PD---EDDKWQNKLSVKDKKLFRISDASGSLKFENIA-IGKFAKKDINEDDIFIVDNGL--EVYVYIGENASPNERQNALIYAHNYLKQTEY 1253
            A+A   + L +WR+EK ++V  PQ  +G+FY GD+Y+VL+  +      Y +HFW+GK  +QDE   AA  TV++D+ L  KPVQ RE+Q YES  F  YFK  L Y  GG  SG  HV T + T  RLLHV+G +R +  +EV  +  + N  D FI D GT I++W G   NK E+ K  + A  + +++R G++++ VV+E   SE  E  K L      PD   +DD   +  + K  KL+ +SDASGS+K   +A    F+   +  ++ FI+D+G   +++V+ G+NA+P ER+ A+  A  +L++ +Y
Sbjct:   11 ARAGQQAGLQVWRVEKLELVPVPQGAYGDFYVGDAYLVLHTTKSSRGFSYRLHFWLGKECSQDESTAAAIFTVQMDDYLGGKPVQSRELQGYESTDFVGYFKGGLKYKAGGVASGLNHVLTNDLTAKRLLHVKG-RRVVRATEVPLSWESFNKGDCFIIDLGTEIYQWCGSSCNKYERLKASQVAIGIRDNERKGRSQLIVVEEG--SEPSELMKVLGRKPELPDGDNDDDVVADISNRKMAKLYMVSDASGSMKVTLVAEENPFSMGMLLSEECFILDHGAAKQIFVWKGKNANPQERKTAMKTAEEFLQKMKY 322          

HSP 2 Score: 112.849 bits (281), Expect = 5.338e-26
Identity = 93/320 (29.06%), Postives = 154/320 (48.12%), Query Frame = 3
Query:  354 GHSELFIWRIEKFKVVEWPQKQHGEFYEGDSYIVLNIYQRENELLYDVHFWIGKYSTQDEYGTAAYKTVELDNLLDDKPVQHREVQHYESELFKSYFKN--LIYLKGGCESGFRHVKTVEYTPRLLHVRGEKRNII-VSEVTATKHNLNSNDVFIYDTG-THIFEWIGKGANKDEKFKGQEFAQALNSDRNGKAKVEVVDEANISENHEFYKHLS---DLQPDEDDKWQNKLSVKDKKLFRISDASGSLKFENIAIGKFAKKDINEDDIFIVDNGLEVYVYIGENASPNERQNALIYAHNYLKQTEY---PQVPVTVMKK 1283
            G   + IWR+E    V+     +GEFY GD YI+L  Y R  +++Y    W G  +T+DE   +A+ TV+LD  L  + VQ R  Q  E     S FK+  LI  K G     +  +      RL  VR    +I  + EV    ++LNSND F+      + F WIGKGA+++E+   +  A  L      K K   + E    E  EF+  L    D Q       + +      +L+  S+ +G    E +  G+F + D+ EDD+ ++D   +++++IG++A+  E++ ++  A  YL+        + P+ ++K+
Sbjct:  394 GSGGVEIWRVENSGRVQIDPSSYGEFYGGDCYIILYTYPR-GQIIYT---WQGANATRDELTMSAFLTVQLDRSLGGQAVQVRVSQGKEPAHLLSLFKDKPLIIYKNGTSK--KEGQAPAPPTRLFQVRRNLASITRIVEVDVDANSLNSNDTFVLKLPRNNGFIWIGKGASQEEEKGAEYVADVL------KCKASRIQEGK--EPEEFWNSLGGRGDYQ--TSPLLETRAEDHPPRLYGCSNKTGRFIIEEVP-GEFTQDDLAEDDVMLLDAWEQIFIWIGKDANEVEKKESVKSAKMYLETDPSGRDKRTPIVIIKQ 696          
BLAST of Gelsolin-like protein vs. UniProt/SwissProt
Match: sp|Q7JQD3|GELS1_LUMTE (Gelsolin-like protein 1 OS=Lumbricus terrestris OX=6398 GN=AM PE=1 SV=1)

HSP 1 Score: 328.946 bits (842), Expect = 2.838e-108
Identity = 175/375 (46.67%), Postives = 238/375 (63.47%), Query Frame = 3
Query:  216 VKSTMQKTKKYDWKDSNVELIGSSEDRAVKKSSAENEPAWKKAKACGHSE-LFIWRIEKFKVVEWPQKQHGEFYEGDSYIVLNIYQ---RENELLYDVHFWIGKYSTQDEYGTAAYKTVELDNLLDDKPVQHREVQHYESELFKSYFK-NLIYLKGGCESGFRHVKTVEYTPRLLHVRGEKRNIIVSEVTATKHNLNSNDVFIYDTGTHIFEWIGKGANKDEKFKGQEFAQALNSDRNGKAKVEVVDEANISENHEFYKHLSDLQPDEDDKWQNKLSVKDKKLFRISDASGSLKFENIAIGKFAKKDINEDDIFIVDNGLEVYVYIGENASPNERQNALIYAHNYLKQTEYPQVPVTVMKKDVKGKNAENFNKVI 1325
            + + + K K+YDWKDSN+ L GS  ++ VKK SA  EPAWK A   G  E L IWRI  FKV EWPQ QHG+FY GDSYI+LN Y+   + NEL YDVHFWIG  S+QDEYGTAAYKTVELD  LDDKPVQHREVQ YESELF++YFK  L  L+GG E+GF HVK  EY PRLLH  G+K+ I V EV   K  L+  DVFI D G  +++W GK ++K+E FK  ++   + S+R  KA+ E +++ +  E+H+FY  L+     ++      L  ++ +L ++SDA G LK   +  G    KD + +D+FI+D G + +V++G+             +H +L +T +P  P+ V+K   +G+  + FN  I
Sbjct:    1 MATGLIKAKEYDWKDSNLALFGSDTEKQVKKDSAATEPAWKGA---GQKEGLKIWRIVNFKVTEWPQNQHGKFYNGDSYIILNTYKPDPKSNELAYDVHFWIGSQSSQDEYGTAAYKTVELDTFLDDKPVQHREVQGYESELFRNYFKQGLTILEGGAETGFHHVKPTEYKPRLLHFSGQKQQIYVHEVPLVKERLDHKDVFILDLGLTLYQWNGKESSKEEGFKAMQYLGLMRSERP-KAEAETLEDESTPESHKFYTSLTG---TDEPNLVKPLVKEENQLLKVSDAGGHLKTTEVKRGAVNSKDFSSNDVFILDTGDQCFVWVGKGRFAVGEAEWTRISHAHLMKTCHPLAPIHVIK---EGQLCKAFNVAI 365          
BLAST of Gelsolin-like protein vs. UniProt/SwissProt
Match: sp|Q8MPM1|GELS2_LUMTE (Gelsolin-like protein 2 OS=Lumbricus terrestris OX=6398 GN=gelsolin PE=1 SV=1)

HSP 1 Score: 327.02 bits (837), Expect = 1.472e-107
Identity = 173/378 (45.77%), Postives = 239/378 (63.23%), Query Frame = 3
Query:  222 STMQKTKKYDWKDSNVELIGSSEDRAVKKSSAENEPAWKKAKACGHSE---LFIWRIEKFKVVEWPQKQHGEFYEGDSYIVLNIYQREN--ELLYDVHFWIGKYSTQDEYGTAAYKTVELDNLLDDKPVQHREVQHYESELFKSYFKN-LIYLKGGCESGFRHVKTVEYTPRLLHVRGEKRNIIVSEVTATKHNLNSNDVFIYDTGTHIFEWIGKGANKDEKFKGQEFAQALNSDRNGKAKVEVVDEANISENHEFYKHLS----DLQPDEDDKWQNKLSVKDKKLFRISDASGSLKFENIAIGKFAKKDINEDDIFIVDNGLEVYVYIGENASPNERQNALIYAHNYLKQTEYPQVPVTVMKKDVKGKNAENFNKVI 1325
            S + K K+YDWKDSN+ + GS+ D++VKK SA  E AWK     G  E   L IWRI  FKV EWP+K +G F+ GDSYI+LN Y+ +   EL YDVHFWIG  STQDEY  AAYKTVELD  LDD  +QHR+ +  ES+LF SYF+N L  ++GG E GF +VK  EY  RLLH  G K++I+V EV      L S+DVFI D G  +++W G G+NKDE+FK  ++ Q L ++R G A  + ++E +I ++HEFY  L+    DL  D+ D      S   K L R+SDA+G  K   +  G  A  D++  D+FI+DNG   +V++G  AS  E++N L YAH++L +T +P +P+    +  +G+ ++ FN  +
Sbjct:    2 SGLVKAKRYDWKDSNLAMFGSALDKSVKKESALKEAAWK-----GVGEKVGLKIWRIVNFKVTEWPEKDYGSFFSGDSYIILNTYKLKGREELAYDVHFWIGSKSTQDEYCVAAYKTVELDAYLDDAAIQHRDAEGNESDLFLSYFENGLTIMEGGAEMGFNNVKPEEYKARLLHFSGLKKHIVVKEVPLCPQRLKSDDVFILDLGRTLYQWNGTGSNKDERFKAMQYLQNLKAER-GAATSKTLEEEHIDKSHEFYTSLTGEDEDLPEDQTD------SAAVKTLLRVSDAAGHFKSTVVKTGHIAASDLDSKDVFILDNGSTCFVWVGNGASAQEKRNGLGYAHSHLMKTPHPLIPIL---RHQRGQASKCFNAAL 364          
BLAST of Gelsolin-like protein vs. UniProt/SwissProt
Match: sp|Q24800|SEVE_ECHGR (Severin OS=Echinococcus granulosus OX=6210 GN=AG8 PE=2 SV=3)

HSP 1 Score: 298.516 bits (763), Expect = 2.830e-96
Identity = 163/376 (43.35%), Postives = 227/376 (60.37%), Query Frame = 3
Query:  228 MQKTKKYDWKDSNVELIGSSEDRAVKKSSAENEPAWKKAKACGHSELFIWRIEKFKVVEWPQKQHGEFYEGDSYIVLNIYQRE--NELLYDVHFWIGKYSTQDEYGTAAYKTVELDNLLDDKPVQHREVQHYESELFKSYFKNL----IYLKGGCESGFRHVKTVEYTPRLLHVRGEKRNIIVSEVTATKHNLNSNDVFIYDTGTHIFEWIGKGANKDEKFKGQEFAQALNSDRNGKAKVEVVDEANISEN----HEFYKHLSDLQPDEDDKWQNKLSVKDKKLFRISDASGSLKFENIAIGKFAKKDINEDDIFIVDNGLEVYVYIGENASPNERQNALIYAHNYLKQTEYPQVPVTVMKKDVKGKNAENFNKVI 1325
            + K K YDWKDSN+EL GSS+DR VKK SA  E  W+         L +WR+ +F +   P  + G FY GDSY++    +    ++LLY+VHFWIGK+ST DEYGTAAYKTVELD  LDD  VQHREV+ YES+LFKSYF  L    + LKGG  SGFRHVK  EY PRLL    E +   + +V  +K +++S DVFI D G+  +++ G   +  EK     F Q L S RNG+    V+DEA+  ++    HEF+  L D+   E +  +  +    K L+++SD+SG L+   ++ G  +K DI  DD++I+     ++VYIG++ S  E++NAL  AH +L+    P +P+TV    V  + AE+F K I
Sbjct:    4 LVKAKDYDWKDSNMELFGSSKDRQVKKESAMTEKCWEPVGRATSPFLMVWRVNQFTLEPVPSDEIGNFYNGDSYVICKATRSPGGDKLLYNVHFWIGKHSTADEYGTAAYKTVELDTFLDDAAVQHREVEGYESQLFKSYFDKLVILKVILKGGYASGFRHVKPDEYRPRLLRFCKEGKTTYMRQVAFSKQSVHSGDVFILDLGSRAYQFNGSKCSAFEKSSAAAFLQDLESKRNGRCNTSVLDEADTPQDVGVLHEFWTALPDVPVKELEPPKEVI----KSLYKLSDSSGKLELTIVSEGSASKHDIKPDDVYIILTKEGLFVYIGKDCSVLEKRNALSNAHKFLQTCPNPFLPITV----VTDEQAESFLKGI 371          
BLAST of Gelsolin-like protein vs. UniProt/SwissProt
Match: sp|P10733|SEVE_DICDI (Severin OS=Dictyostelium discoideum OX=44689 GN=sevA PE=1 SV=1)

HSP 1 Score: 281.182 bits (718), Expect = 1.116e-89
Identity = 151/349 (43.27%), Postives = 214/349 (61.32%), Query Frame = 3
Query:  228 MQKTKKYDWKDSNVELIGSSEDRAVKKSSAENEPAWKK-AKACGHSELFIWRIEKFKVVEWPQKQHGEFYEGDSYIVLNIYQRENELLYDVHFWIGKYSTQDEYGTAAYKTVELDNLLDDKPVQHREVQHYESELFKSYFKNLIYLKGGCESGFRHVKTVEYTPRLLHVRGEKRNIIVSEVTATKHNLNSNDVFIYDTGTHIFEWIGKGANKDEKFKGQEFAQALNSDRNGKAKVEVVDEANISENHEFYKHLSDLQPDEDDKWQNKLSVKDKKLFRISDASGSLKFENIAIGKFAKKDINEDDIFIVDNGLEVYVYIGENASPNERQNALIYAHNYL---KQTEYPQV 1262
            M K +K D   +NV  IG+  D+  +  +A  E  WK   +A G   L IWRIE FKVV  P+  +G+FY+GDSYI+L+ ++  N L +D+HF++G ++TQDE GTAAYKTVELD+ L   P+Q+R+ Q YES  F S F     L GG ESGF HVK  EY PRLLH+ G+K N  V+EV     +LNS D F+ D G  I+++ G  ++  EK K  E A+A++++R G  KVEV  E +     EF+K L   +     K +   +  +K L+++SDASGSLKF  ++ GK  K  +  +D+FI+D G E+Y +IG  +SPNE++ A  +A  YL   K+ EY  +
Sbjct:    1 MIKNRKLDITSTNVAGIGTDLDKKCRLDAASTEAQWKGVGQAPG---LKIWRIENFKVVPVPESSYGKFYDGDSYIILHTFKEGNSLKHDIHFFLGTFTTQDEAGTAAYKTVELDDFLGGAPIQYRQCQSYESPSFLSLFPKYFILSGGVESGFNHVKPTEYKPRLLHISGDK-NAKVAEVPLATSSLNSGDCFLLDAGLTIYQFNGSKSSPQEKNKAAEVARAIDAERKGLPKVEVFCETDSDIPAEFWKLLGG-KGAIAAKHETAPTKSEKVLYKLSDASGSLKFSEVSRGKINKSSLKSEDVFIIDLGNEIYTWIGSKSSPNEKKTAFSHATQYLVNNKRCEYTPI 344          
BLAST of Gelsolin-like protein vs. UniProt/SwissProt
Match: sp|Q07171|GELS_DROME (Gelsolin OS=Drosophila melanogaster OX=7227 GN=Gel PE=1 SV=2)

HSP 1 Score: 218.009 bits (554), Expect = 1.568e-61
Identity = 128/340 (37.65%), Postives = 203/340 (59.71%), Query Frame = 3
Query:  342 AKACGHSELFIWRIEKFKVVEWPQKQHGEFYEGDSYIVLNIYQ--RENELLYDVHFWIGKYSTQDEYGTAAYKTVELDNLLDDKPVQHREVQHYESELFKSYFKNLI-YLKGGCESGFRHVKT-VEYTPRLLHVRGEKRNIIVSEVTATKHNLNSNDVFIYDTGTHIFEWIGKGANKDEKFKGQEFA-QALNSDRNGKAKVEVVDEANI-SENHEFYKHL----SDLQPDE----DDKWQNKLSVKDKKLFRISDASGSLKFENIAIGKFAKKDINEDDIFIVDNGLEVYVYIGENASPNERQNALIYAHNYLKQTEYPQVPVTVMKKDVKGKNAENFNK 1319
            A A     L IWRIE F+ V +P+  +G+FY GDS+IVLN  +  ++ +L +DVHFW+G  ++ DE G AA  TV+LD+LL+  PVQHREVQ +ES+LF SYFKN I Y +GG  +GF+HV+T  +   RL  V+G KRN+ V +V  +  ++N+ D FI D G+ I+ ++G  A + EK K    A Q  + D NG+A+V++VD+ +  ++   F+  L    +D  PDE    +D    +       L+++SDASG LK + I      +  ++  + FI+D G  ++V++G+ A+  E+ +A+  A  +L+  +YP    T + + V+G  +  F +
Sbjct:   64 ANAGRTPGLEIWRIENFEPVIYPKTNYGKFYTGDSFIVLNTIENKKDKKLSWDVHFWLGLETSTDEAGAAAILTVQLDDLLNGGPVQHREVQDHESQLFLSYFKNGIRYEQGGVGTGFKHVETNAQGETRLFQVKG-KRNVRVRQVNLSVSSMNTGDCFILDAGSDIYVYVGSQAKRVEKLKAISAANQIRDQDHNGRARVQIVDDFSTDADKQHFFDVLGSGSADQVPDESTADEDSAFERTDAAAVSLYKVSDASGKLKVDIIGQKPLTQAMLDTRECFILDTGSGIFVWVGKGATQKEKTDAMAKAQEFLRTKKYP--AWTQIHRIVEGSESAPFKQ 400          
BLAST of Gelsolin-like protein vs. TrEMBL
Match: A0A1I8FYV1 (Uncharacterized protein OS=Macrostomum lignano OX=282301 PE=4 SV=1)

HSP 1 Score: 415.616 bits (1067), Expect = 8.547e-140
Identity = 195/366 (53.28%), Postives = 249/366 (68.03%), Query Frame = 3
Query:  228 MQKTKKYDWKDSNVELIGSSEDRAVKKSSAENEPAWKKAKACGHSELFIWRIEKFKVVEWPQKQHGEFYEGDSYIVLNIYQRENELLYDVHFWIGKYSTQDEYGTAAYKTVELDNLLDDKPVQHREVQHYESELFKSYFKNLIYLKGGCESGFRHVKTVEYTPRLLHVRGEKRNIIVSEVTATKHNLNSNDVFIYDTGTHIFEWIGKGANKDEKFKGQEFAQALNSDRNGKAKVEVVDEANISENHEFYKHLSDLQPDEDDKWQNKLSVKDKKLFRISDASGSLKFENIAIGKFAKKDINEDDIFIVDNGLEVYVYIGENASPNERQNALIYAHNYLKQTEYPQVPVTVMKKDVKGKNAENFNKVI 1325
            M K K+YDWKDSN+ L GS  +R VKK SAE EPAWK        +L++WRIE FKVVEWP+  +G+FY GDSYI+LN Y   ++L YDVHFWIGK ST DEYGTAAYKTVELD LLDD PVQHREVQ +ES L +SYF  + YL GGC SGFR+V T EY PRLLHVRGE++NI+V+EV  ++  L++ DV+I D G    +W G GANK+EKFK  ++   L S+RNG+     ++E      HEFY  L+D + + D         + K++ ++SDA+G L F+ ++    +K +I EDD+FI+DNG EVYVY+GENAS  ER NAL YAHNYL+ +  P +PVTV+      K    FN V 
Sbjct:    1 MNKPKQYDWKDSNLALFGSDTERQVKKESAEKEPAWKPVLEAQKPQLYVWRIENFKVVEWPRDLYGKFYSGDSYIILNAYMEADKLCYDVHFWIGKESTADEYGTAAYKTVELDTLLDDLPVQHREVQGHESALMRSYFPEITYLAGGCPSGFRNVTTREYKPRLLHVRGERQNIVVTEVPRSRKALDNTDVYILDLGDRAIQWNGSGANKNEKFKAAQYLSNLKSERNGRLAASTLEEDGTPTEHEFYTSLTDEEVERDSASGGSPGAQ-KRMMKLSDATGKLNFDLVSTDSLSKSNITEDDVFIIDNGFEVYVYVGENASMTERHNALAYAHNYLRDSVNPLLPVTVVTPQAPAKTKAAFNAVF 365          
BLAST of Gelsolin-like protein vs. TrEMBL
Match: A0A1I8GIF7 (Uncharacterized protein OS=Macrostomum lignano OX=282301 PE=4 SV=1)

HSP 1 Score: 415.231 bits (1066), Expect = 1.147e-139
Identity = 195/366 (53.28%), Postives = 249/366 (68.03%), Query Frame = 3
Query:  228 MQKTKKYDWKDSNVELIGSSEDRAVKKSSAENEPAWKKAKACGHSELFIWRIEKFKVVEWPQKQHGEFYEGDSYIVLNIYQRENELLYDVHFWIGKYSTQDEYGTAAYKTVELDNLLDDKPVQHREVQHYESELFKSYFKNLIYLKGGCESGFRHVKTVEYTPRLLHVRGEKRNIIVSEVTATKHNLNSNDVFIYDTGTHIFEWIGKGANKDEKFKGQEFAQALNSDRNGKAKVEVVDEANISENHEFYKHLSDLQPDEDDKWQNKLSVKDKKLFRISDASGSLKFENIAIGKFAKKDINEDDIFIVDNGLEVYVYIGENASPNERQNALIYAHNYLKQTEYPQVPVTVMKKDVKGKNAENFNKVI 1325
            M K K+YDWKDSN+ L GS  +R VKK SAE EPAWK        +L++WRIE FKVVEWP+  +G+FY GDSYI+LN Y   ++L YDVHFWIGK ST DEYGTAAYKTVELD LLDD PVQHREVQ +ES L +SYF  + YL GGC SGFR+V T EY PRLLHVRGE++NI+V+EV  ++  L++ DV+I D G    +W G GANK+EKFK  ++   L S+RNG+     ++E      HEFY  L+D + + D         + K++ ++SDA+G L F+ ++    +K +I EDD+FI+DNG EVYVY+GENAS  ER NAL YAHNYL+ +  P +PVTV+      K    FN V 
Sbjct:    1 MNKPKQYDWKDSNLALFGSDTERQVKKESAEKEPAWKPVLEAQKPQLYVWRIENFKVVEWPRDLYGKFYSGDSYIILNAYMEADKLCYDVHFWIGKESTADEYGTAAYKTVELDTLLDDLPVQHREVQGHESALMRSYFPEITYLAGGCPSGFRNVTTREYKPRLLHVRGERQNIVVTEVPRSRKALDNTDVYILDLGDRAIQWNGSGANKNEKFKAAQYLSNLKSERNGRLAASTLEEDGTPTEHEFYTSLTDEEVERDSASGGSPGAQ-KRMMKLSDATGKLNFDLVSTDSLSKSNITEDDVFIIDNGFEVYVYVGENASLTERHNALAYAHNYLRDSVNPLLPVTVVTPQAPAKTKAAFNAVF 365          
BLAST of Gelsolin-like protein vs. TrEMBL
Match: A0A1W6I1A3 (Gelsolin-like protein OS=Schmidtea mediterranea OX=79327 PE=2 SV=1)

HSP 1 Score: 407.912 bits (1047), Expect = 2.223e-138
Identity = 188/243 (77.37%), Postives = 217/243 (89.30%), Query Frame = 3
Query:  228 MQKTKKYDWKDSNVELIGSSEDRAVKKSSAENEPAWKKAKACGHSELFIWRIEKFKVVEWPQKQHGEFYEGDSYIVLNIYQRENELLYDVHFWIGKYSTQDEYGTAAYKTVELDNLLDDKPVQHREVQHYESELFKSYFKNLIYLKGGCESGFRHVKTVEYTPRLLHVRGEKRNIIVSEVTATKHNLNSNDVFIYDTGTHIFEWIGKGANKDEKFKGQEFAQALNSDRNGKAKVEVVDEANIS 956
            M+K +KYDWKDSNVELIGSSEDR+VKKSSA+ E AW  AK C  + LFIWRIEKFKVVEWP+++ GEF+EGDSYIVLNIYQ+E ELLYD+HFWIGKYSTQDEYGTAAYKTVELD LLDDKP+QHREVQ YES++FKSYF N+IYLKGGCESGFRHV T EY PRLLHVRGEK NII+SEV++TK NLNS+DVFI+D+G+ I++WIGKGANKDE+ K Q+FAQ LNSDRNGK K+EV+DE  +S
Sbjct:    1 MKKAEKYDWKDSNVELIGSSEDRSVKKSSADTEKAWNAAKTCKTTALFIWRIEKFKVVEWPKQRFGEFFEGDSYIVLNIYQKEKELLYDIHFWIGKYSTQDEYGTAAYKTVELDTLLDDKPIQHREVQDYESDMFKSYFPNIIYLKGGCESGFRHVNTREYNPRLLHVRGEKNNIIISEVSSTKKNLNSDDVFIFDSGSCIYQWIGKGANKDERXKAQQFAQQLNSDRNGKLKIEVLDEGQMS 243          
BLAST of Gelsolin-like protein vs. TrEMBL
Match: A0A1I8GFK5 (Uncharacterized protein OS=Macrostomum lignano OX=282301 GN=BOX15_Mlig019412g3 PE=4 SV=1)

HSP 1 Score: 404.06 bits (1037), Expect = 3.042e-135
Identity = 196/364 (53.85%), Postives = 256/364 (70.33%), Query Frame = 3
Query:  228 MQKTKKYDWKDSNVELIGSSEDRAVKKSSAENEPAWKKAKACGHSELFIWRIEKFKVVEWPQKQHGEFYEGDSYIVLNIYQREN--ELLYDVHFWIGKYSTQDEYGTAAYKTVELDNLLDDKPVQHREVQHYESELFKSYFKNLIYLKGGCESGFRHVKTVEYTPRLLHVRGEKRNIIVSEVTATKHNLNSNDVFIYDTGTHIFEWIGKGANKDEKFKGQEFAQALNSDRNGKAKVEVVDEANISENHEFYKHLSDLQPDEDDKWQNKLSVKD--KKLFRISDASGSLKFENIAIGKFAKKDINEDDIFIVDNGLEVYVYIGENASPNERQNALIYAHNYLKQTEYPQVPVTVMKKDVKGKNAE 1307
            MQK +KYDWKDSN+ L GS  ++ VKK+++E E AW+  K C   ELF+WRIEKFKV  WP++ +G+F+ GDSYIVLN+Y+  +  ELLYDVHFWIGK+STQDEYGTAAYKTVELD  LDDK VQHREVQ +ES +FKSYFK + YLKGGC +GFR VK  EY PRLLH  G +RNI V EV  T+  LNSNDVFI D G   ++W GK  NKDE+ K   F Q L ++R+GK +   +DE +I   H+FY+ L D+ P      + K  V+   K +FR+SD SG L++  ++ G   +  INEDD++I+D G+E++VY+G  AS  E+ NAL YAH+YLK T++P +PVT  + ++K    E
Sbjct:    1 MQKPQKYDWKDSNLALFGSKTEKDVKKAASEVETAWQPVKECTSDELFVWRIEKFKVKAWPKEDYGKFFSGDSYIVLNVYKDPDGDELLYDVHFWIGKHSTQDEYGTAAYKTVELDTFLDDKAVQHREVQEHESSMFKSYFKTITYLKGGCATGFRQVKPEEYKPRLLHFCGVRRNIEVKEVKLTRKALNSNDVFILDLGRTAYQWNGKTCNKDERIKAAAFLQQLENERHGKTQTFTLDENSIGSEHKFYQSLPDV-PYAKKSSEVKSDVRSGKKAMFRLSDESGKLQYSLVSEGNCPRSMINEDDVYIIDTGVEIFVYVGARASDAEKMNALQYAHDYLKTTQHPLIPVTACRGNMKNPQME 363          
BLAST of Gelsolin-like protein vs. TrEMBL
Match: A0A267FTU3 (Uncharacterized protein OS=Macrostomum lignano OX=282301 GN=BOX15_Mlig033145g1 PE=4 SV=1)

HSP 1 Score: 403.675 bits (1036), Expect = 6.051e-135
Identity = 191/375 (50.93%), Postives = 256/375 (68.27%), Query Frame = 3
Query:  228 MQKTKKYDWKDSNVELIGSSEDRAVKKSSAENEPAWKKAKACGHSELFIWRIEKFKVVEWPQKQHGEFYEGDSYIVLNIYQRENE--LLYDVHFWIGKYSTQDEYGTAAYKTVELDNLLDDKPVQHREVQHYESELFKSYFKNLIYLKGGCESGFRHVKTVEYTPRLLHVRGEKRNIIVSEVTATKHNLNSNDVFIYDTGTHIFEWIGKGANKDEKFKGQEFAQALNSDRNGKAKVEVVDEANISENHEFYKHLSD--LQPDED---DKWQNKLSVKDKKLFRISDASGSLKFENIAIGKFAKKD-INEDDIFIVDNGLEVYVYIGENASPNERQNALIYAHNYLKQTEYPQVPVTVMKKDVKGKNAENFNKVIE 1328
            MQK ++Y WKD+N+ L GS E+R VKK +AE EPAW +   C   +LF+WRIE+FKV +W    +G+F++GDSYIVLN+YQ E+E  L YD+HFWIG +ST DEYGTAAYKTVELD LLDD+PVQHREVQ +ES+LFKSYF  + Y+ GGC SGF  V T EYTPRL H +GE+RNIIV EVT ++  L+  DV+I D G   ++W  +G NKDE+FK  ++ + L  +RNG+   EV+D+ +  E HEFY  L+D  L+P  D     +    S  DK ++R+S  SGSL+F  ++ G  A +  + E+D+FI+DNG E+YVY+GENASP+E  NAL YAH Y  +   P +P+TV+      +    F  V +
Sbjct:    1 MQKPQQYSWKDTNLALFGSDEERKVKKEAAELEPAWAEVLECSEPKLFVWRIEQFKVAKWESDLYGKFFDGDSYIVLNVYQEEDEDKLCYDIHFWIGVHSTADEYGTAAYKTVELDTLLDDRPVQHREVQGHESDLFKSYFPEITYMSGGCPSGFNKVHTREYTPRLFHFKGERRNIIVKEVTMSRKALDETDVYILDLGDRAYQWNSRGCNKDERFKAAQYLRKLCEERNGRLDTEVLDQDDAEEEHEFYNSLTDEELEPISDLEQASFSMAFSQPDKSVYRLSGESGSLEFSEVSRGPAASRGAVTEEDVFIIDNGHEIYVYVGENASPDEIHNALTYAHKYANELSNPLLPLTVVNSKAPARTRRAFESVFD 375          
BLAST of Gelsolin-like protein vs. Ensembl Cavefish
Match: gsna (gelsolin-like [Source:NCBI gene;Acc:103033745])

HSP 1 Score: 217.238 bits (552), Expect = 1.360e-62
Identity = 125/317 (39.43%), Postives = 196/317 (61.83%), Query Frame = 3
Query:  345 KACGHSELFIWRIEKFKVVEWPQKQHGEFYEGDSYIVLN-IYQRENELLYDVHFWIGKYSTQDEYGTAAYKTVELDNLLDDKPVQHREVQHYESELFKSYF-KNLIYLKGGCESGFRHVKTVE-YTPRLLHVRGEKRNIIVSEVTATKHNLNSNDVFIYDTGTHIFEWIGKGANKDEKFKGQEFAQAL-NSDRNGKAKVEVVDEANISENHEFYKHLSDLQPD-----EDDKWQNKLSVKDKKLFRISDASGSLKFENIAI-GKFAKKDINEDDIFIVDNGL--EVYVYIGENASPNERQNALIYAHNYLKQTEYPQ 1259
            +A     L +WRIEKF +V  P+  +G FY GD+Y++LN I QR   L YD+HFW+G + TQDE G+AA  TV++D+ L  KP+Q+REVQ +ES+ F  YF K L Y+KGG  SGF+HV T E    R+L V+G +R +  +EV  +  + N+ D FI D G  I++W G  +N+ EK K  + A+A+ +++R+G+A+V V DE    E  +  + L + +PD      DD   +  + K  KL+++SDASGS+    +A    F++  +   D FI+D+G   +++V+ G++A+  ER+ A+  A  ++K+  YP+
Sbjct:    9 RAGKQPGLQVWRIEKFDLVAVPENLYGGFYTGDAYVILNTIKQRSGNLQYDLHFWLGDHCTQDESGSAAIFTVQMDDYLGGKPIQYREVQGFESKTFLGYFKKGLQYMKGGVASGFKHVVTNEVVVQRVLQVKG-RRVVRATEVPVSWDSFNTGDCFILDLGNEIYQWCGSKSNRFEKLKSTQLAKAIRDNERSGRARVYVCDEG--VEREKILEVLGE-KPDLPEGAGDDLKADASNRKLAKLYKVSDASGSMTMALVADENPFSQSALESTDCFILDHGSNGKIFVWKGKDANVEERKAAMKAADEFIKKMGYPK 321          

HSP 2 Score: 129.798 bits (325), Expect = 1.009e-31
Identity = 102/334 (30.54%), Postives = 149/334 (44.61%), Query Frame = 3
Query:  354 GHSELFIWRIEKFKVVEWPQKQHGEFYEGDSYIVLNIYQRENELLYDVHFWIGKYSTQDEYGTAAYKTVELDNLLDDKPV---------QHREVQHYESELFKSYF--KNLIYLKGGCESGFRHVKTVEYTPRLLHVRGEKRNIIVS-EVTATKHNLNSNDVFIYDTGTHIFEWIGKGANKDEKFKGQEFAQALNSDRNGKAKVEVVDEANISENHEFYKHLSDLQP-DEDDKWQNKLSVKDKKLFRISDASGSLKFENIAIGKFAKKDINEDDIFIVDNGLEVYVYIGENASPNERQNALIYAHNYLKQTEYPQVPVTVMKKDVKGKNAENFN 1316
            G  +  IWRIE    V      HG+FY GDSYI+L  Y+      + ++ W G  STQDE G +A    +LD+ L   PV         Q R VQ  E     S F  K ++  KGG           E   RL  VR        + EV A   NLNSND FI  T    F W+G GA+  EK    + AQ L  D  G +  E+ +     E+ +F+  L          + ++K+ V   +LF  S+ +G    E +  G+  ++D+  DD+ I+D   +V+V++G  A   E+  A+  A  Y++     + P T + K  +G     F 
Sbjct:  391 GRGDKQIWRIEGADKVPVDPSTHGQFYGGDSYIILYNYRHGGRQGHIIYIWQGVDSTQDEIGASAILAAQLDDELGGGPVQVAGVPITTQVRVVQGKEPAHLMSLFGGKPMVVYKGGTSREGGQSALAET--RLFQVRSNSAGCTRAVEVDAVSSNLNSNDAFILVTPAGSFMWVGVGASDSEK----QGAQGL-CDILGVSASEITEGG---ESDDFWAALGGKAAYRTSTRLKDKMDVHPPRLFACSNKTGRFIIEEVP-GEMTQEDLATDDVMILDTWDQVFVWVGNEAQEEEKTEAVASAARYIETDPAKRDPRTPIVKIKQGSEPPTFT 713          
BLAST of Gelsolin-like protein vs. Ensembl Cavefish
Match: gsna (gelsolin-like [Source:NCBI gene;Acc:103033745])

HSP 1 Score: 217.238 bits (552), Expect = 1.514e-62
Identity = 125/317 (39.43%), Postives = 196/317 (61.83%), Query Frame = 3
Query:  345 KACGHSELFIWRIEKFKVVEWPQKQHGEFYEGDSYIVLN-IYQRENELLYDVHFWIGKYSTQDEYGTAAYKTVELDNLLDDKPVQHREVQHYESELFKSYF-KNLIYLKGGCESGFRHVKTVE-YTPRLLHVRGEKRNIIVSEVTATKHNLNSNDVFIYDTGTHIFEWIGKGANKDEKFKGQEFAQAL-NSDRNGKAKVEVVDEANISENHEFYKHLSDLQPD-----EDDKWQNKLSVKDKKLFRISDASGSLKFENIAI-GKFAKKDINEDDIFIVDNGL--EVYVYIGENASPNERQNALIYAHNYLKQTEYPQ 1259
            +A     L +WRIEKF +V  P+  +G FY GD+Y++LN I QR   L YD+HFW+G + TQDE G+AA  TV++D+ L  KP+Q+REVQ +ES+ F  YF K L Y+KGG  SGF+HV T E    R+L V+G +R +  +EV  +  + N+ D FI D G  I++W G  +N+ EK K  + A+A+ +++R+G+A+V V DE    E  +  + L + +PD      DD   +  + K  KL+++SDASGS+    +A    F++  +   D FI+D+G   +++V+ G++A+  ER+ A+  A  ++K+  YP+
Sbjct:    9 RAGKQPGLQVWRIEKFDLVAVPENLYGGFYTGDAYVILNTIKQRSGNLQYDLHFWLGDHCTQDESGSAAIFTVQMDDYLGGKPIQYREVQGFESKTFLGYFKKGLQYMKGGVASGFKHVVTNEVVVQRVLQVKG-RRVVRATEVPVSWDSFNTGDCFILDLGNEIYQWCGSKSNRFEKLKSTQLAKAIRDNERSGRARVYVCDEG--VEREKILEVLGE-KPDLPEGAGDDLKADASNRKLAKLYKVSDASGSMTMALVADENPFSQSALESTDCFILDHGSNGKIFVWKGKDANVEERKAAMKAADEFIKKMGYPK 321          

HSP 2 Score: 137.502 bits (345), Expect = 2.607e-34
Identity = 102/325 (31.38%), Postives = 149/325 (45.85%), Query Frame = 3
Query:  354 GHSELFIWRIEKFKVVEWPQKQHGEFYEGDSYIVLNIYQRENELLYDVHFWIGKYSTQDEYGTAAYKTVELDNLLDDKPVQHREVQHYESELFKSYF--KNLIYLKGGCESGFRHVKTVEYTPRLLHVRGEKRNIIVS-EVTATKHNLNSNDVFIYDTGTHIFEWIGKGANKDEKFKGQEFAQALNSDRNGKAKVEVVDEANISENHEFYKHLSDLQP-DEDDKWQNKLSVKDKKLFRISDASGSLKFENIAIGKFAKKDINEDDIFIVDNGLEVYVYIGENASPNERQNALIYAHNYLKQTEYPQVPVTVMKKDVKGKNAENFN 1316
            G  +  IWRIE    V      HG+FY GDSYI+L  Y+      + ++ W G  STQDE G +A    +LD+ L   PVQ R VQ  E     S F  K ++  KGG           E   RL  VR        + EV A   NLNSND FI  T    F W+G GA+  EK    + AQ L  D  G +  E+ +     E+ +F+  L          + ++K+ V   +LF  S+ +G    E +  G+  ++D+  DD+ I+D   +V+V++G  A   E+  A+  A  Y++     + P T + K  +G     F 
Sbjct:  391 GRGDKQIWRIEGADKVPVDPSTHGQFYGGDSYIILYNYRHGGRQGHIIYIWQGVDSTQDEIGASAILAAQLDDELGGGPVQVRVVQGKEPAHLMSLFGGKPMVVYKGGTSREGGQSALAET--RLFQVRSNSAGCTRAVEVDAVSSNLNSNDAFILVTPAGSFMWVGVGASDSEK----QGAQGL-CDILGVSASEITEGG---ESDDFWAALGGKAAYRTSTRLKDKMDVHPPRLFACSNKTGRFIIEEVP-GEMTQEDLATDDVMILDTWDQVFVWVGNEAQEEEKTEAVASAARYIETDPAKRDPRTPIVKIKQGSEPPTFT 704          
BLAST of Gelsolin-like protein vs. Ensembl Cavefish
Match: scin (scinderin [Source:NCBI gene;Acc:103042167])

HSP 1 Score: 208.764 bits (530), Expect = 1.537e-59
Identity = 116/315 (36.83%), Postives = 188/315 (59.68%), Query Frame = 3
Query:  345 KACGHSELFIWRIEKFKVVEWPQKQHGEFYEGDSYIVLNIYQRENELLYDVHFWIGKYSTQDEYGTAAYKTVELDNLLDDKPVQHREVQHYESELFKSYFK-NLIYLKGGCESGFRHVKTVEYTP-RLLHVRGEKRNIIVSEVTATKHNLNSNDVFIYDTGTHIFEWIGKGANKDEKFKGQEFAQAL-NSDRNGKAKVEVVDEANISENHEFYKHLSD--LQPDEDDKWQNKLSVKDK---KLFRISDASGSLKFENIA-IGKFAKKDINEDDIFIVDNGLE--VYVYIGENASPNERQNALIYAHNYLKQTEYP 1256
            +A   + L IWRIE  ++   P+  HG FY GD+Y++L   ++++   YD+HFW+GK  TQDE   AA  TV++D+ L  KPVQ+RE+Q  ES  F SYFK  + Y  GG  SGF+HV T + +  RL H++G +R +  ++V    ++ N+ D FI D G  I++W G   N+ E+ K  + A ++ +++RNG+A+V +V++ +  E  +    L D    PDEDD       + ++   KL+ +SDASG ++   ++    F++  +  D+ FI+D+G    +YV+ G NA+PNER+ A+  A  +++Q  YP
Sbjct:   10 QAGKRTGLQIWRIENMELAPVPESLHGNFYVGDAYLILRTVKQKDVSFYDLHFWLGKECTQDESTAAAIFTVQMDDYLGGKPVQYRELQGCESTAFTSYFKGGITYKTGGVSSGFQHVVTNDLSAQRLFHIKG-RRTVRATQVPLDWNSFNTGDCFIVDLGAIIYQWCGSKCNRFERLKATQVANSIRDNERNGRAQVVIVEDGH--EPGQLTSVLGDKPTLPDEDDNDDIAADMSNRRMAKLYMVSDASGKMQVSLVSEENPFSQTHLLSDECFILDHGKSKMIYVWKGRNANPNERKEAMKTAEGFIQQMGYP 321          

HSP 2 Score: 111.309 bits (277), Expect = 1.441e-25
Identity = 94/306 (30.72%), Postives = 150/306 (49.02%), Query Frame = 3
Query:  354 GHSELFIWRIEKF-----KVVEWPQKQHGEFYEGDSYIVLNIYQRENELLYDVHFWIGKYSTQDEYGTAAYKTVELDNLLDDKPVQHREVQHYESELFKSYFKN--LIYLKGGCESGFRHVKTVEYTP-RLLHVRGEKRNII-VSEVTATKHNLNSNDVFIYDTG-THIFEWIGKGANKDEKFKGQEFAQALNSDRNGKAKVEVVDEANISENHEFYKHLSD-LQPDEDDKWQNKLSVKDKKLFRISDASGSLKFENIAIGKFAKKDINEDDIFIVDNGLEVYVYIGENASPNERQNALIYAHNYL 1238
            G  E  IWR+E       K+   P K +G+FY GD YI+L  Y+R  +++Y    W G  ST DE   +A+ TVELD  L    VQ R  Q  E     S FK   L+  K G     R        P RL  VR     I  +SEV A   +LNSND ++        + W+GKGA+++E+   +  ++ L      + K++ + E    E  +F+K L    +    ++ ++K      +LF  S+ +G    E +  G+F + D+ EDD+ ++D   +V+V+IG++A+  E+  ++  A  Y+
Sbjct:  392 GSGETKIWRVETCNKGESKIPVDP-KTYGQFYGGDCYIILYTYKR-GQIIYT---WQGSCSTIDELTASAFLTVELDRSLGGNAVQVRVTQGKEPAHLLSLFKAKPLVVYKNGTS---REGGQAPAAPTRLFQVRRNLGTITRISEVDAVASSLNSNDAYLLKVPEGEGYMWVGKGASEEEEHGVKYMSELL------QCKMKRITEGQ--EPGDFWKALGGKTEYQTSERLESKTITHAPRLFGCSNKTGRFIIEEVP-GEFNQDDLAEDDVMLLDVWDQVFVWIGKDANEVEKMESVKSAKMYI 680          
BLAST of Gelsolin-like protein vs. Ensembl Cavefish
Match: avil (advillin [Source:NCBI gene;Acc:103036458])

HSP 1 Score: 209.149 bits (531), Expect = 1.661e-59
Identity = 117/309 (37.86%), Postives = 175/309 (56.63%), Query Frame = 3
Query:  366 LFIWRIEKFKVVEWPQKQHGEFYEGDSYIVLNIYQRENELLYDVHFWIGKYSTQDEYGTAAYKTVELDNLLDDKPVQHREVQHYESELFKSYFK-NLIYLKGGCESGFRHVKT-VEYTPRLLHVRGEKRNIIVSEVTATKHNLNSNDVFIYDTGTHIFEWIGKGANKDEKFKGQEFAQAL-NSDRNGKAKVEVVDEANISENHEFYKHLSDLQPDEDDKWQNKLSVKDK--------KLFRISDASGSLKFENIAIGKFAKKDINEDDIFIVD-NGLEVYVYIGENASPNERQNALIYAHNYLKQTEYP 1256
            + IWRIEK ++V  P+K +G FYEGD Y++L   +    L YD+H+WIG  S+QDE G AA  T++LD+ L   PVQHREVQH+ES  F  YFK  +IY KGG  SG RHV+T      RLL V+G KR +   EV  + ++ N  DVF+ D G  I +W G  +NK E+ KG   A+ + + +R G+A++ V++      +    + L+ +  +   K  +  S             LF +SDA G +K   +A     +  +N DD +I+D  G++++V+ G+ A+  ERQ A+  A  ++K   YP
Sbjct:   14 ILIWRIEKMELVLVPEKSYGNFYEGDCYVLLCTKKVGGSLSYDIHYWIGSESSQDEQGAAAVYTIQLDDFLGSAPVQHREVQHHESSSFCGYFKQGIIYKKGGVASGMRHVETNSSDVQRLLQVKG-KRKVTAKEVEMSWNSFNLGDVFLLDIGKTIIQWNGPDSNKQERMKGMLLAKDIRDRERGGRAEIGVIEGDAEKNSPLLMEALTSIIGERPAKLPSGTSDDQADQQQMAQVTLFHVSDADGEMKVMEVATRPLVQDLLNHDDCYILDQGGVKLFVWKGKRANKAERQAAMSRALEFIKLKGYP 321          

HSP 2 Score: 141.354 bits (355), Expect = 1.294e-35
Identity = 92/299 (30.77%), Postives = 149/299 (49.83%), Query Frame = 3
Query:  354 GHSELFIWRIEKFKVVEWPQKQHGEFYEGDSYIVLNIYQRENELLYDVHFWIGKYSTQDEYGTAAYKTVELDNLLDDKPVQHREVQHYESELFKSYFKN-LIYLKGGCESGFRHVKTVEYTPRLLHVRG-EKRNIIVSEVTATKHNLNSNDVFIYDTGTHIFEWIGKGANKDEKFKGQEFAQALNSDRNGKAKVEVVDEANISENHEFYKHLSDLQPDEDDK-WQNKLSVKDKKLFRISDASGSLKFENIAIGKFAKKDINEDDIFIVDNGLEVYVYIGENASPNERQNALIYAHNYLK 1241
            G  +L IWRIE  ++ E   K +G FY GD YI+L  Y+   +  Y ++ W G+++TQDE   +A++ V +D     +PVQ R     E   F + FK  L+  +GG     +     E   RL  + G +  N    EV A   +LNSNDVF+      ++ W GKG++ DE+   +E +  L     G    E++ E    E  EF+  L    P  +DK  Q  +     +LF  S+ +G  +F    +  F + D+ EDD+ ++D   +V+++IG  A+  ER+ +++    YL+
Sbjct:  392 GSGQLQIWRIENLELAEVDPKTYGYFYGGDCYIILYTYEVNRKKSYILYIWQGRHATQDELAASAFQAVTVDQQYGGEPVQVRVTMGKEPRHFMAIFKGKLVIFEGGTSR--KGGLDPEPLVRLFQISGTDSTNTKAIEVPAQAASLNSNDVFLLKNQGTMYLWYGKGSSGDERAMAKEVSTVLG---RGSFSAEIMAEGQ--EPAEFWNLLGGKAPYANDKRLQQVVQDHQPRLFECSNKTG--RFIVTEVTDFTQDDLIEDDVMLLDTWDQVFLWIGNEANEVERKESVVTCQEYLR 681          
BLAST of Gelsolin-like protein vs. Ensembl Cavefish
Match: avil (advillin [Source:NCBI gene;Acc:103036458])

HSP 1 Score: 208.379 bits (529), Expect = 6.195e-59
Identity = 117/309 (37.86%), Postives = 175/309 (56.63%), Query Frame = 3
Query:  366 LFIWRIEKFKVVEWPQKQHGEFYEGDSYIVLNIYQRENELLYDVHFWIGKYSTQDEYGTAAYKTVELDNLLDDKPVQHREVQHYESELFKSYFK-NLIYLKGGCESGFRHVKTVEY-TPRLLHVRGEKRNIIVSEVTATKHNLNSNDVFIYDTGTHIFEWIGKGANKDEKFKGQEFAQAL-NSDRNGKAKVEVVDEANISENHEFYKHLSDLQPDEDDKWQNKLSVKDK--------KLFRISDASGSLKFENIAIGKFAKKDINEDDIFIVD-NGLEVYVYIGENASPNERQNALIYAHNYLKQTEYP 1256
            + IWRIEK ++V  P+K +G FYEGD Y++L   +    L YD+H+WIG  S+QDE G AA  T++LD+ L   PVQHREVQH+ES  F  YFK  +IY KGG  SG RHV+T      RLL V+G KR +   EV  + ++ N  DVF+ D G  I +W G  +NK E+ KG   A+ + + +R G+A++ V++      +    + L+ +  +   K  +  S             LF +SDA G +K   +A     +  +N DD +I+D  G++++V+ G+ A+  ERQ A+  A  ++K   YP
Sbjct:   14 ILIWRIEKMELVLVPEKSYGNFYEGDCYVLLCTKKVGGSLSYDIHYWIGSESSQDEQGAAAVYTIQLDDFLGSAPVQHREVQHHESSSFCGYFKQGIIYKKGGVASGMRHVETNSSDVQRLLQVKG-KRKVTAKEVEMSWNSFNLGDVFLLDIGKTIIQWNGPDSNKQERMKGMLLAKDIRDRERGGRAEIGVIEGDAEKNSPLLMEALTSIIGERPAKLPSGTSDDQADQQQMAQVTLFHVSDADGEMKVMEVATRPLVQDLLNHDDCYILDQGGVKLFVWKGKRANKAERQAAMSRALEFIKLKGYP 321          

HSP 2 Score: 140.969 bits (354), Expect = 1.995e-35
Identity = 92/299 (30.77%), Postives = 149/299 (49.83%), Query Frame = 3
Query:  354 GHSELFIWRIEKFKVVEWPQKQHGEFYEGDSYIVLNIYQRENELLYDVHFWIGKYSTQDEYGTAAYKTVELDNLLDDKPVQHREVQHYESELFKSYFKN-LIYLKGGCESGFRHVKTVEYTPRLLHVRG-EKRNIIVSEVTATKHNLNSNDVFIYDTGTHIFEWIGKGANKDEKFKGQEFAQALNSDRNGKAKVEVVDEANISENHEFYKHLSDLQPDEDDK-WQNKLSVKDKKLFRISDASGSLKFENIAIGKFAKKDINEDDIFIVDNGLEVYVYIGENASPNERQNALIYAHNYLK 1241
            G  +L IWRIE  ++ E   K +G FY GD YI+L  Y+   +  Y ++ W G+++TQDE   +A++ V +D     +PVQ R     E   F + FK  L+  +GG     +     E   RL  + G +  N    EV A   +LNSNDVF+      ++ W GKG++ DE+   +E +  L     G    E++ E    E  EF+  L    P  +DK  Q  +     +LF  S+ +G  +F    +  F + D+ EDD+ ++D   +V+++IG  A+  ER+ +++    YL+
Sbjct:  392 GSGQLQIWRIENLELAEVDPKTYGYFYGGDCYIILYTYEVNRKKSYILYIWQGRHATQDELAASAFQAVTVDQQYGGEPVQVRVTMGKEPRHFMAIFKGKLVIFEGGTSR--KGGLDPEPLVRLFQISGTDSTNTKAIEVPAQAASLNSNDVFLLKNQGTMYLWYGKGSSGDERAMAKEVSTVLG---RGSFSAEIMAEGQ--EPAEFWNLLGGKAPYANDKRLQQVVQDHQPRLFECSNKTG--RFIVTEVTDFTQDDLIEDDVMLLDTWDQVFLWIGNEANEVERKESVVTCQEYLR 681          
BLAST of Gelsolin-like protein vs. Ensembl Sea Lamprey
Match: avil (advillin [Source:ZFIN;Acc:ZDB-GENE-060421-6683])

HSP 1 Score: 209.149 bits (531), Expect = 1.262e-59
Identity = 115/311 (36.98%), Postives = 180/311 (57.88%), Query Frame = 3
Query:  366 LFIWRIEKFKVVEWPQKQHGEFYEGDSYIVLNIYQRENELL--YDVHFWIGKYSTQDEYGTAAYKTVELDNLLDDKPVQHREVQHYESELFKSYFKN-LIYLKGGCESGFRHVKTVEY-TPRLLHVRGEKRNIIVSEVTATKHNLNSNDVFIYDTGTHIFEWIGKGANKDEKFKGQEFAQAL-NSDRNGKAKVEVVDEANISENHEFYKHLS--------DLQPDEDDKWQNKLSVKDKKLFRISDASGSLKFENIAIGKFAKKDINEDDIFIVD-NGLEVYVYIGENASPNERQNALIYAHNYLKQTEYP 1256
            L IWR+EK ++   PQK +G F+EGD YI+L+  +  +     YDVH+W+G+ S+QDE   AA  T +LD+ L   PVQHRE Q +ESE+F+ YFK+ ++Y KGG  SGF H +T  Y   RLLH++G ++ +  +EV  +  + +  DVF+ D G  I +W G  +N+ EK KG + A  + + +R G+A++ VV+  +   + E    L+        DL P   D+  +     + KL+ +S+  G+L  E +A     +  +N DD +I+D  G+++YV+ G  +S  ERQ A+  A  Y+K   YP
Sbjct:   14 LHIWRVEKMELAAVPQKAYGSFFEGDCYIILSAKKAGSSPTPTYDVHYWVGQESSQDEQAAAAMYTTQLDDALGGFPVQHREYQGHESEVFRGYFKSGVVYKKGGVASGFHHTETNSYNVQRLLHIKG-RKAVTATEVNLSWDSFSRGDVFLLDLGKVIIQWNGPDSNRVEKIKGMQLASDIRDRERGGRAQIGVVEGNDEDSSPELMAVLTAALGERHGDLSPGSPDEPTDHSRKANVKLYHVSEKGGNLMVEEVATRPLTQDLLNHDDCYILDQGGIKIYVWKGRGSSKEERQAAMKRALGYIKAKGYP 323          

HSP 2 Score: 148.288 bits (373), Expect = 1.600e-38
Identity = 103/322 (31.99%), Postives = 165/322 (51.24%), Query Frame = 3
Query:  354 GHSELFIWRIEKFKVVEWPQKQHGEFYEGDSYIVLNIYQRENELLYDVHFWIGKYSTQDEYGTAAYKTVELDNLLDDKPVQHREVQHYESELFKSYF--KNLIY---LKGGCE--SGFRHVKTVEYTPRLLHVRG-EKRNIIVSEVTATKHNLNSNDVFIYDTGTHIFEWIGKGANKDEKFKGQEFAQALNSDRNGKAKVEVVDEANISENHEFYKHLSDLQPDEDDK-WQNKLSVKDKKLFRISDASGSLKFENIAIGKFAKKDINEDDIFIVDNGLEVYVYIGENASPNERQNALIYAHNYLKQ---TEYPQVPVTVMKK 1283
            G +E+F  RIE  ++    ++ HG+FY GD Y+VL  Y   N+L Y ++ W G+++TQDE   +AY+ V LD     +PVQ R V   E + F + F  K +IY    +GG     G         T RL  VRG ++ N    EV A    LNSNDVF+ +     F W GKG + DE+    E A++L      + K  V++     E  EF+  L    P   +K  Q + +    +LF  S  +G  +F    I  F++ D++EDD+ ++D   +V++++G+ AS  E++ ++  A +YL+       P  P+ ++K+
Sbjct:  396 GTAEMF--RIEDLELKPVEKRLHGQFYGGDCYLVLYTYTSNNKLAYLLYMWQGRHATQDEVAASAYQAVALDQKYGGEPVQVRVVMGKEPKHFLAIFHGKLIIYEMVAQGGTSRAGGNDIGGAAPPTTRLFQVRGTDEFNTKAVEVPARASALNSNDVFVLNAEVACFLWCGKGCSGDER----EMARSLADGLTRRDKQTVLEG---QEPPEFWAALGGKAPYASEKRMQVEEAEVQPRLFECSTQTG--RFVVTEISDFSQDDLDEDDVMLLDTWDQVFLWVGQGASDAEKKESMTTAADYLRTHPGARDPDTPIIIVKQ 706          
BLAST of Gelsolin-like protein vs. Ensembl Sea Lamprey
Match: gsna (gelsolin a [Source:ZFIN;Acc:ZDB-GENE-030131-9653])

HSP 1 Score: 169.474 bits (428), Expect = 8.352e-50
Identity = 84/198 (42.42%), Postives = 129/198 (65.15%), Query Frame = 3
Query:  366 LFIWRIEKFKVVEWPQKQHGEFYEGDSYIVL-NIYQRENELLYDVHFWIGKYSTQDEYGTAAYKTVELDNLLDDKPVQHREVQHYESELFKSYFKNLI-YLKGGCESGFRH-VKTVEYTPRLLHVRGEKRNIIVSEVTATKHNLNSNDVFIYDTGTHIFEWIGKGANKDEKFKGQEFAQAL-NSDRNGKAKVEVVDEA 947
            L +WR+EK  +V  P++ +G FY GD+Y++L ++  R   + YD+HFW+G   +QDE G AA  TV++D+ L  +PVQHREVQ +ES  F  YFKN I Y  GG  SGFRH V  +    RLLHV+G +R +  +EV  +  + N  D FI D G +I++W G  +N+ E+ K  + A+ + +++R+G+A+V+V++E 
Sbjct:   16 LQVWRVEKLDLVAVPKELYGSFYTGDAYVLLFSVRNRAGNMQYDLHFWLGNECSQDESGAAAIFTVQMDDHLGGQPVQHREVQGFESTAFSGYFKNGIKYKPGGVASGFRHVVPNLVDVKRLLHVKG-RRTVRATEVPLSWASFNQGDCFIVDLGANIYQWCGSKSNRFERLKATQVAKGIRDNERSGRARVDVLEEG 212          
BLAST of Gelsolin-like protein vs. Ensembl Sea Lamprey
Match: ENSPMAT00000008894.1 (pep scaffold:Pmarinus_7.0:GL484493:7018:36468:1 gene:ENSPMAG00000008055.1 transcript:ENSPMAT00000008894.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 69.707 bits (169), Expect = 5.172e-13
Identity = 44/126 (34.92%), Postives = 64/126 (50.79%), Query Frame = 3
Query:  372 IWRIEKFKVVEWPQKQHGEFYEGDSYIVLNIYQREN-ELLYDVHFWIGKYSTQDEYGTAAYKTVELDNLLDDKPVQHREVQHYESELFKSYFKNLI-YLKGGCESGFRHVKTVEYTPRLLHVRGEK 743
            +W IE F      +  HG+FY+ D YIVL  +  EN  + +++++WIG  +T D+   AA   V L N L  +    RE    ESE F + F   I Y++GG  SGF  V+   +  RL    G +
Sbjct:  502 VWHIENFVPQLTEEYYHGKFYDADCYIVLRTFIDENGAIAWEIYYWIGAKATLDKKACAAIHAVNLRNFLGAEGRSQREEMDDESEEFLAVFDGSISYIEGGTSSGFFTVEENAHIIRLYRCHGTQ 627          
BLAST of Gelsolin-like protein vs. Ensembl Sea Lamprey
Match: ENSPMAT00000003626.1 (pep scaffold:Pmarinus_7.0:GL477855:13850:40700:-1 gene:ENSPMAG00000003299.1 transcript:ENSPMAT00000003626.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 55.0694 bits (131), Expect = 2.460e-8
Identity = 54/209 (25.84%), Postives = 91/209 (43.54%), Query Frame = 3
Query:  642 FKNLIYLKGGCESGFRHVKTVEYTPRLLHVRGEKRNIIVSEVTATKHNLNSNDVFIYDTGTHIFEWIGKGANKDEKFKGQEFAQALNSDRNGKAK---VEVVDEA-NISEN--HEFYKHLSDL-------QPDEDDKWQNKLSVKDKKLFRISDASGSLKFENIAIGKFAKKD-INEDDIFIVDNGLEVYVYIGENASPNERQNALIYA 1226
            +K ++ L+     G RHV+T    PR +                   +LNS D F+  T  H + WIG+ AN  EK K  + A  + + R+   +   + +++E  N S N    F+  L           P+ED+ ++N + V     FR+      L  ++   GK  +   +N  D+ + D G EVYV+ G+  +  +R+ A   A
Sbjct:  262 YKPVMLLQVKACEGRRHVQTRLVEPRAI-------------------SLNSGDCFLLLTHQHCYLWIGEFANVIEKAKASDLATYIQTKRDLGCRASSITIIEEGINCSSNRARSFWDLLGGRVSYKGTGPPEEDELYENDV-VATNCAFRLQGE--RLVPDDECWGKVPRCTMLNPCDVVVFDFGSEVYVWHGKEVTLAQRKVAFQLA 448          
BLAST of Gelsolin-like protein vs. Ensembl Nematostella
Match: EDO40348 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S7K4])

HSP 1 Score: 342.043 bits (876), Expect = 8.330e-115
Identity = 179/366 (48.91%), Postives = 243/366 (66.39%), Query Frame = 3
Query:  222 STMQKTKKYDWKDSNVELIGSSEDRAVKKSSAENEPAWKKAKACGHSELFIWRIEKFKVVEWPQKQHGEFYEGDSYIVLNIYQRENELLYDVHFWIGKYSTQDEYGTAAYKTVELDNLLDDKPVQHREVQHYESELFKSYFKNLIYLKGGCESGFRHVKTVEYTPRLLHVRGEKRNIIVSEVTATKHNLNSNDVFIYDTGTHIFEWIGKGANKDEKFKGQEFAQALNSDRNGKAKVEVVDEANISENHEFYKHLSDLQPDEDDKWQNKLSVK--DKKLFRISDASGSLKFENIAIGKFAKKD-INEDDIFIVDNGLEVYVYIGENASPNERQNALIYAHNYLKQTEYPQVPVTVMKKDVKGKNAEN 1310
            S ++K K+YDWKDSN+ L GS  ++ VKK SA+ E AW  A       + IWRI KFKV +WP++ +G FY GDSYI+L   +   EL++DVHFWIGK ST DEYGTAAYKTVELD  LDDKPVQHREV+ +ES+LFKSYF  +  L GG ESGF+HV   EYTPRL  VRG K+N+ ++ +   K NL ++D FI D G  +F+W G  ANK+EK+K  E  +   S R GK +  V+D+  + E  E  + L  + PD ++ ++ +   +  +K LF +SD +G L+   IA GK  K+  + EDD++I D+G   YVY+G+ AS +ER+NA+ YAHNYL +TE+P +PVTV+    K  + EN
Sbjct:    2 SGLRKQKEYDWKDSNLALFGSDTEKNVKKESAQTETAWIGAGE--KPGMKIWRIVKFKVTKWPEENYGSFYNGDSYIILRTKKENEELVHDVHFWIGKKSTADEYGTAAYKTVELDTFLDDKPVQHREVEGHESDLFKSYFSEMTLLDGGAESGFKHVGPKEYTPRLFLVRGNKKNVTLTNIELVKGNLTNDDCFIIDLGLELFQWNGIDANKEEKWKAGEICRDWRSKRGGKPRHIVLDDCTV-EKIEELEELEGILPDGENSFKKQAGSEPSEKVLFSLSDRTGQLQCNEIARGKEVKRSLLKEDDVYIFDSGRHCYVYVGKAASIDERRNAMTYAHNYLMRTEHPLLPVTVINGGQKSVDFEN 364          
BLAST of Gelsolin-like protein vs. Ensembl Nematostella
Match: EDO49235 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RGV0])

HSP 1 Score: 337.421 bits (864), Expect = 5.787e-113
Identity = 177/357 (49.58%), Postives = 242/357 (67.79%), Query Frame = 3
Query:  222 STMQKTKKYDWKDSNVELIGSSEDRAVKKSSAENEPAWKKAKACGHSELFIWRIEKFKVVEWPQKQHGEFYEGDSYIVLNIYQR--ENELLYDVHFWIGKYSTQDEYGTAAYKTVELDNLLDDKPVQHREVQHYESELFKSYFKNLIYLKGGCESGFRHVKTVEYTPRLLHVRGEK-RNIIVSEVTATKHNLNSNDVFIYDTGTHIFEWIGKGANKDEKFKGQEFAQALNSDRNGKAKVEVVDEANISENHEFYKHLSDLQPDEDDKWQNKLSVK--DKKLFRISDASGSLKFENIAIGKFAKKDINEDDIFIVDNGLEVYVYIGENASPNERQNALIYAHNYLKQTEYPQVPVTVM 1277
            S ++K K+ +WKD+N+ L GS  ++ VK+ +A  E AWK A       L IWRIEKFKV  W ++ +G FY+GDSYI+LN Y+   E+EL YDVHFWIGK STQDEYGTAAYKTVELD  L+DKP+QHREVQ +ES+LFKSYFK+L  LKGG +SGFRHVK  EY PRLL VRG    N +V EV   + +L S DVFI D G +++ W+G   +KDEKF+G +    + S+RNGK K EV DE+++  + +FYK L ++  D +D    K      + +L+RISDASG ++   I  G+ ++KD +E D+F+ D G  ++VY G  AS +ER+ AL   HN+L +T++P   ++ +
Sbjct:    2 SGLRKQKQPEWKDTNLALFGSDIEKNVKREAAATEIAWKNAGT--REGLQIWRIEKFKVKVWSREDYGSFYDGDSYIILNTYKESGEDELKYDVHFWIGKDSTQDEYGTAAYKTVELDIHLNDKPIQHREVQGFESKLFKSYFKSLTILKGGVDSGFRHVKPQEYKPRLLRVRGTTVSNCVVEEVLLARSSLCSEDVFILDKGLNLYLWVGVKCDKDEKFRGMQEILKIKSERNGKPKSEVNDESSMKPDDDFYKLLPNVSKDCEDSSFPKGDYDSFEPELYRISDASGKIQKTQIKKGRISRKDFDEQDVFLFDTGRHLFVYTGNKASIDERRLALQIGHNHLMRTDHPFAAISTV 356          
BLAST of Gelsolin-like protein vs. Ensembl Nematostella
Match: EDO43190 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RZ87])

HSP 1 Score: 308.531 bits (789), Expect = 1.158e-101
Identity = 171/379 (45.12%), Postives = 237/379 (62.53%), Query Frame = 3
Query:  222 STMQKTKKYDWKDSNVELIGSSEDRAVKKSSAENEPAWKKA-KACGHSELFIWRIEKFKVVEWPQKQHGEFYEGDSYIVLNIYQRE------NELLYDVHFWIGKYSTQDEYGTAAYKTVELDNLLDDKPVQHREVQHYESELFKSYFKNLIYLKGGCESGFRHVKTVEYTPRLLHVRGEKRNIIVSEVTATKHNLNSNDVFIYDTGTHIFEWIGKGANKDEKFKGQEFAQALN---SDRNGKAKVEVVDEANISENHEFYKHLSDLQPDEDDKWQNKLSVKDKKLFRISDASGSLKFENIAIGKFAKKD-INEDDIFIVDNGLEVYVYIGENASPNERQNALIYAHNYLKQTEYPQVPVTVMKKDVKGKNAENFNKVI 1325
            S + K KKYDWKDSN+ L GS  ++ VKK SAE EPAW+ A K  G   + +WRI KFKV  WP++ +G FY GDSYIVLN Y+++       EL YDVHFWIG++S+QDEYGTAAYKTVELD+ LDDKPV+HREV+ +ES LFKSYF  LI LKGG E+GFR V    Y PRLLH   + + I V+E +  + N+N+ DVFI D G  +++W G   + DEKF    F   +    S   G+  V+      + E  EF   LS  +P  +     + ++       +SDASG L F  ++ G   K+  +N +D+FI+D+G   YV+ G+ +S +ER+ A+ +AHNYL +++ P +P+T +   V+G   ++FNK  
Sbjct:    2 SGLVKAKKYDWKDSNLALFGSDLEKNVKKESAEGEPAWEGAGKEVG---VQVWRIVKFKVTHWPKQDYGHFYNGDSYIVLNTYKKDPSSEACGELSYDVHFWIGRFSSQDEYGTAAYKTVELDHFLDDKPVEHREVEGHESTLFKSYFDALITLKGGAETGFRRVNPEAYKPRLLHFCKKNKKIEVTEKSLKRANMNNGDVFIVDLGLTLYQWNGSRCSPDEKFSAAHFMDIIQKEISTNKGRKSVKSGILKLLLERVEFNSTLSS-EPVAECLVLCQSNI--ICFMVLSDASGHLVFSEVSRGSAVKRSQLNTNDVFIMDSGDHCYVWSGKGSSVDERRRAMEFAHNYLMKSDSPFLPITCV---VEGNETDDFNKAF 371          
BLAST of Gelsolin-like protein vs. Ensembl Nematostella
Match: EDO43191 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RZ88])

HSP 1 Score: 297.745 bits (761), Expect = 9.508e-98
Identity = 167/372 (44.89%), Postives = 233/372 (62.63%), Query Frame = 3
Query:  222 STMQKTKKYDWKDSNVELIGSSEDRAVKKSSAENEPAWKKA-KACGHSELFIWRIEKFKVVEWPQKQHGEFYEGDSYIVLNIYQRENE--LLYDVHFWIGKYSTQDEYGTAAYKTVELDNLLDDKPVQHREVQHYESELFKSYFKNLIYLKGGCESGFRHVKTVEYTPRLLHVRGEKRNIIVSEVTATKHNLNSNDVFIYDTGTHIFEWIGKGANKDEKFKGQEFAQALNSDRNGKAKVEVVDEANISENHEFYKHLSDLQPDEDDKWQNKLSV---KDKKLFRISDASGSLKFENIAIGK-FAKKDINEDDIFIVDNGLEVYVYIGENASPNERQNALIYAHNYLKQTEYPQVPVTVMKKDVKGKNAENFN 1316
            S + K KKYDWKDSN+ L GS  ++ VKK SAE EPAW+ A K  G   + +WRI KFKV  WP++ +G+F+ GDSYIVLN Y+  +   LLYDVHFWIGK+S+QDEYGTAAYKTVELD+ L+D PVQHREV+ +ES+LFK YF  L  +KGG +SGF+HV    YTPRL HV  E + +IV +    + N+ ++DVFI D G  I++W               ++  LN      A     ++   + N +  K + + +P +D K Q  LS+    + +   +SDASGSL  E ++ G   ++  ++ +D+F+ D G   YV++G  AS +ER  A+ YAHNYL QT++P +PVTV+    +GK   +FN
Sbjct:    2 SGLVKAKKYDWKDSNLALFGSDLEKNVKKESAEGEPAWEGAGKEVG---VQVWRIVKFKVEHWPKEDYGKFFNGDSYIVLNTYKEPSTENLLYDVHFWIGKFSSQDEYGTAAYKTVELDHFLNDVPVQHREVEGHESKLFKGYFSTLTIMKGGADSGFKHVLPEAYTPRLFHVFKEGKCVIVRQKQMKRTNMCNSDVFIVDLGLVIYQW---------------YSVLLN------AVFYTENQTVENFNPKLAKTIPEGKPKKD-KVQALLSLLIKAEMEQMEVSDASGSLNCEEVSRGSAISRSQLDSNDVFLFDTGCHCYVWVGAGASIDERGKAMTYAHNYLGQTDHPFLPVTVV---AEGKETNDFN 345          
BLAST of Gelsolin-like protein vs. Ensembl Nematostella
Match: EDO49234 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RGU9])

HSP 1 Score: 294.664 bits (753), Expect = 5.923e-96
Identity = 162/357 (45.38%), Postives = 226/357 (63.31%), Query Frame = 3
Query:  222 STMQKTKKYDWKDSNVELIGSSEDRAVKKSSAENEPAWKKAKACGHSELFIWRIEKFKVVEWPQKQHGEFYEGDSYIVLNIYQ--RENELLYDVHFWIGKYSTQDEYGTAAYKTVELDNLLDDKPVQHREVQHYESELFKSYFKNLIYLKGGCESGFRHVKTVEYTPRLLHVRG-EKRNIIVSEVTATKHNLNSNDVFIYDTGTHIFEWIGKGANKDEKFKGQEFAQALNSDRNGKAKVEVVDEANISENHEFYKHLSDLQPDEDDKWQNKLSVKDKKLFRISDASGSLKFENIAIGK--FAKKDINEDDIFIVDNGLEVYVYIGENASPNERQNALIYAHNYLKQTEYPQVPVTVM 1277
            S ++K ++  W+D+N+ L GS  ++ VK+ +A  E AW  + A     L IWR+E+FKV    +  +G+FY+GDSYI+LN Y+   E+E  YDVHFWIG+ STQDEYGTAAYKTVELD  L+DKPVQHREVQ +ES+LF SYF +L  LKGG +SGF+HV+   Y PRLL V G   +++ V EV   + +LNS+DVFI D G  I++W GK  +KDEKF+  + A  L S+R G+  +EV+DE     +  FY+ L DL   E+    +     +  L R+SDASG +K   +  GK    + D +E D+F+ D G  ++VY G  AS +ER+ AL    NYL  T +P   ++ +
Sbjct:    2 SGLRKQEQPKWQDTNLALFGSDIEKNVKREAAGQERAW--SGAGKREGLQIWRVEQFKVKSVLRDDYGKFYDGDSYIILNTYKDPEEDEFKYDVHFWIGQDSTQDEYGTAAYKTVELDIYLNDKPVQHREVQGHESKLFMSYFDSLTILKGGVKSGFKHVRPEVYQPRLLRVYGTTPKSVKVEEVPFVRKSLNSDDVFILDKGKTIYQWNGKDCDKDEKFRAAQEANRLKSERGGRPVIEVIDEGE-DRSAPFYRFLPDLPCKEEKGDYDDF---EPVLLRVSDASGQMKLTEMKKGKGRITRNDFDEKDVFLFDTGNVLFVYSGNKASIDERRLALQIGTNYLNGTNHPFASISAI 352          
BLAST of Gelsolin-like protein vs. Ensembl Medaka
Match: avil (advillin [Source:NCBI gene;Acc:101170835])

HSP 1 Score: 218.394 bits (555), Expect = 1.397e-62
Identity = 128/322 (39.75%), Postives = 191/322 (59.32%), Query Frame = 3
Query:  345 KACGHSE-LFIWRIEKFKVVEWPQKQHGEFYEGDSYIVLNIYQRENELLYDVHFWIGKYSTQDEYGTAAYKTVELDNLLDDKPVQHREVQHYESELFKSYFKN-LIYLKGGCESGFRHVKTVEY-TPRLLHVRGEKRNIIVSEVTATKHNLNSNDVFIYDTGTHIFEWIGKGANKDEKFKGQEFAQAL-NSDRNGKAKVEVVD---EANISENHEFYKH--------LSDLQPDE--DDKWQNKLSVKDKKLFRISDASGSLKFENIAIGKFAKKDINEDDIFIVD-NGLEVYVYIGENASPNERQNALIYAHNYLKQTEYP 1256
            KA  H+  + IWR+EK ++V   +K HG FYEGD Y++L+ ++ +N L YD+H+WIG  S+QDE G AA  TV+LD  L   P+QHREVQ++ES+ FK YFKN +IY KGG  +G RHV+T  Y   RLLHV+G+KR +I  EV  +  + N  DVF+ DTG  I +W G  +NK E+ KG   A+ + + +R G+A+V  V+   E    +  E            L+D  PDE  D +   KLS     L+ +SDA G +K   +A     +  ++ +  +++D  G +++V+ G+ A+  ERQ A+  A +++K   YP
Sbjct:    6 KAVTHNPGIIIWRVEKMELVLVSEKTHGNFYEGDCYVLLSTHKVKNVLSYDIHYWIGSESSQDEQGAAAVYTVQLDEYLGSSPIQHREVQNHESDTFKGYFKNGIIYKKGGVATGMRHVETNTYDVKRLLHVKGKKR-VIAQEVELSWKSFNLGDVFLLDTGKTIIQWNGPKSNKQERHKGLLLAKDIRDRERGGRAEVRTVEGEAEKQSPQEMEIMNSFLGERTFKLTDGPPDETFDQEQMGKLS-----LYCVSDADGQMKVTEVATRPLVQDLLDHESCYLLDQGGAKIFVWKGKKANKAERQAAMARALDFIKTKNYP 321          

HSP 2 Score: 149.443 bits (376), Expect = 2.457e-38
Identity = 96/316 (30.38%), Postives = 163/316 (51.58%), Query Frame = 3
Query:  354 GHSELFIWRIEKFKVVEWPQKQHGEFYEGDSYIVLNIYQRENELLYDVHFWIGKYSTQDEYGTAAYKTVELDNLLDDKPVQHREVQHYESELFKSYFKN-LIYLKGGCESGFRHVKTVEYTPRLLHVRG-EKRNIIVSEVTATKHNLNSNDVFIYDTGTHIFEWIGKGANKDEKFKGQEFAQALNSDRNGKAKVEVVDEANISENHEFYKHLSDLQPDEDDK-WQNKLSVKDKKLFRISDASGSLKFENIAIGKFAKKDINEDDIFIVDNGLEVYVYIGENASPNERQNALIYAHNYLKQ---TEYPQVPVTVMKK 1283
            G  ++ +WRIE  + V   ++ +G FY GD Y++L  Y   N+  Y ++ W G+++TQDE    A++ V LD   +D+PVQ R     E   F + FK  ++  +GG     +     E   RL  V G +  N    EV A   +LNSNDVF+  + T I+ W GKG++ DE+   +E +  +  D   ++  E+V E    E  EF++ L    P    K  Q  L     +LF  S+ +G  +F    +  F + D+NEDD+ ++D   +V++++G++A+  ER+ ++  +  YL+       P  P+ ++K+
Sbjct:  392 GSGQVEVWRIENLEPVPVDRQWYGYFYGGDCYLILYTYLVNNKKCYLLYMWQGRHATQDELAACAFQAVALDQKYNDEPVQVRVTMGKEPRHFMALFKGKMVIFEGGTSR--KGASEPEPPVRLFQVHGSDLSNTKTFEVPALAASLNSNDVFLLRSQTQIYLWCGKGSSGDERAMAKEVSSVICLDSQ-RSSEEIVAEGQ--EPMEFWELLGGKAPYASSKRLQQVLLDYQPRLFECSNKTG--RFIVTEVTHFNQDDLNEDDVMLLDTWDQVFLWVGKDANEIERKESVATSQEYLRTHPGDRDPDTPIIMIKQ 700          
BLAST of Gelsolin-like protein vs. Ensembl Medaka
Match: gsna (gelsolin [Source:NCBI gene;Acc:101167720])

HSP 1 Score: 214.542 bits (545), Expect = 4.475e-61
Identity = 122/310 (39.35%), Postives = 192/310 (61.94%), Query Frame = 3
Query:  366 LFIWRIEKFKVVEWPQKQHGEFYEGDSYIVLN-IYQRENELLYDVHFWIGKYSTQDEYGTAAYKTVELDNLLDDKPVQHREVQHYESELFKSYFKNLI-YLKGGCESGFRHVKTVEYT-PRLLHVRGEKRNIIVSEVTATKHNLNSNDVFIYDTGTHIFEWIGKGANKDEKFKGQEFAQAL-NSDRNGKAKVEVVDEANISENHEFYKHLSDLQPD-----EDDKWQNKLSVKDKKLFRISDASGSLKFENIAI-GKFAKKDINEDDIFIVDNGLE--VYVYIGENASPNERQNALIYAHNYLKQTEYPQ 1259
            L +WR+EKF +V  P+  +G FY GD+Y+VLN I QR  +L YD+HFW+G   +QDE G+AA  TV++D+ L  KP+Q+REVQ +ES+ F  YFK+ I Y++GG  SGF+HV T E +  RLL ++G +R +  +EV     + N +D FI D G  I++W G  +N+ EK K  + A+ + +++R+G+A+V V DE    E  +  K L   +PD      DD   +  + K  KL+++S+ASG +    +A    FA+  +   D FI+D G +  ++V+ G++A+ +ER+ AL  A  ++K+  YP+
Sbjct:  113 LQVWRVEKFNLVPVPENLYGGFYTGDAYLVLNTIKQRSGQLQYDLHFWLGDSCSQDESGSAAIFTVQMDDFLGGKPIQYREVQGHESKTFLGYFKSGIKYMQGGVASGFKHVVTNEVSVQRLLQIKG-RRVVRATEVAVGWDSFNQDDCFILDLGDEIYQWCGSQSNRFEKLKATQVAKDIRDNERSGRARVYVCDEG--MEREQMLKVLGP-KPDLPAGASDDIHADVSNRKSAKLYKVSNASGGMTIALVAAENPFAQSALESGDCFILDYGSDGKIFVWKGKDANMDERKAALKAADEFIKKMGYPK 418          

HSP 2 Score: 125.176 bits (313), Expect = 4.328e-30
Identity = 94/325 (28.92%), Postives = 145/325 (44.62%), Query Frame = 3
Query:  354 GHSELFIWRIEKFKVVEWPQKQHGEFYEGDSYIVLNIYQRENELLYDVHFWIGKYSTQDEYGTAAYKTVELDNLLDDKPVQHREVQHYESELFKSYF--KNLIYLKGGC--ESGFRHVKTVEYTPRLLHVR----GEKRNIIVSEVTATKHNLNSNDVFIYDTGTHIFEWIGKGANKDEKFKGQEFAQALNSDRNGKAKVEVVDEANISENHEFYKHLSDLQPDED----DKWQNKLSVKDKKLFRISDASGSLKFENIAIGKFAKKDINEDDIFIVDNGLEVYVYIGENASPNERQNALIYAHNYLKQTEY---PQVPVTVMKK 1283
            G  +  IWR+E           +G+FY GDSYI+L  Y+      + ++ W G  S+QDE G  A    +LD  L   PVQ R +Q  E     S F  K ++  KGG   E G    ++     RL  VR    G  R +   E+ A   NLNSND F+  T      W+G GA++ EK   Q+    L            V  + +SE  E  +    L    D     + ++K+     +LF  S+ +G+   E +  G+  + D+  DD+ I+D   +V+V+IG  A   E+  A+  A  Y++       P+ P+  +K+
Sbjct:  488 GSGDKQIWRVEGSDKAPVDPSTYGQFYGGDSYIILYNYRHGGRQGHIIYLWQGMDSSQDEKGACAILGAQLDEELGGGPVQVRVIQGKEPAHLMSLFGGKPMVVYKGGTSREGG----QSAPAETRLFQVRSNSTGHTRAV---ELDAAASNLNSNDAFLLVTPNGTSLWMGAGASEAEKQGAQQLCDILG-----------VSASELSEGGETAQFWGALGGKADYRTSTRLKDKMDAHPPRLFACSNKTGNFVIEEVP-GELTQDDLATDDVMILDTWDQVFVWIGNEAQEEEKTEAMASAVRYVETDPANRDPRTPIVKIKQ 793          
BLAST of Gelsolin-like protein vs. Ensembl Medaka
Match: gsna (gelsolin [Source:NCBI gene;Acc:101167720])

HSP 1 Score: 214.542 bits (545), Expect = 5.483e-61
Identity = 122/310 (39.35%), Postives = 192/310 (61.94%), Query Frame = 3
Query:  366 LFIWRIEKFKVVEWPQKQHGEFYEGDSYIVLN-IYQRENELLYDVHFWIGKYSTQDEYGTAAYKTVELDNLLDDKPVQHREVQHYESELFKSYFKNLI-YLKGGCESGFRHVKTVEYT-PRLLHVRGEKRNIIVSEVTATKHNLNSNDVFIYDTGTHIFEWIGKGANKDEKFKGQEFAQAL-NSDRNGKAKVEVVDEANISENHEFYKHLSDLQPD-----EDDKWQNKLSVKDKKLFRISDASGSLKFENIAI-GKFAKKDINEDDIFIVDNGLE--VYVYIGENASPNERQNALIYAHNYLKQTEYPQ 1259
            L +WR+EKF +V  P+  +G FY GD+Y+VLN I QR  +L YD+HFW+G   +QDE G+AA  TV++D+ L  KP+Q+REVQ +ES+ F  YFK+ I Y++GG  SGF+HV T E +  RLL ++G +R +  +EV     + N +D FI D G  I++W G  +N+ EK K  + A+ + +++R+G+A+V V DE    E  +  K L   +PD      DD   +  + K  KL+++S+ASG +    +A    FA+  +   D FI+D G +  ++V+ G++A+ +ER+ AL  A  ++K+  YP+
Sbjct:  113 LQVWRVEKFNLVPVPENLYGGFYTGDAYLVLNTIKQRSGQLQYDLHFWLGDSCSQDESGSAAIFTVQMDDFLGGKPIQYREVQGHESKTFLGYFKSGIKYMQGGVASGFKHVVTNEVSVQRLLQIKG-RRVVRATEVAVGWDSFNQDDCFILDLGDEIYQWCGSQSNRFEKLKATQVAKDIRDNERSGRARVYVCDEG--MEREQMLKVLGP-KPDLPAGASDDIHADVSNRKSAKLYKVSNASGGMTIALVAAENPFAQSALESGDCFILDYGSDGKIFVWKGKDANMDERKAALKAADEFIKKMGYPK 418          

HSP 2 Score: 116.701 bits (291), Expect = 2.653e-27
Identity = 94/337 (27.89%), Postives = 145/337 (43.03%), Query Frame = 3
Query:  354 GHSELFIWRIEKFKVVEWPQKQHGEFYEGDSYIVLNIYQRENELLYDVHFWIGKYSTQDEYGTAAYKTVELDNLLDDKPVQH------------REVQHYESELFKSYF--KNLIYLKGGC--ESGFRHVKTVEYTPRLLHVR----GEKRNIIVSEVTATKHNLNSNDVFIYDTGTHIFEWIGKGANKDEKFKGQEFAQALNSDRNGKAKVEVVDEANISENHEFYKHLSDLQPDED----DKWQNKLSVKDKKLFRISDASGSLKFENIAIGKFAKKDINEDDIFIVDNGLEVYVYIGENASPNERQNALIYAHNYLKQTEY---PQVPVTVMKK 1283
            G  +  IWR+E           +G+FY GDSYI+L  Y+      + ++ W G  S+QDE G  A    +LD  L   PVQ             R +Q  E     S F  K ++  KGG   E G    ++     RL  VR    G  R +   E+ A   NLNSND F+  T      W+G GA++ EK   Q+    L            V  + +SE  E  +    L    D     + ++K+     +LF  S+ +G+   E +  G+  + D+  DD+ I+D   +V+V+IG  A   E+  A+  A  Y++       P+ P+  +K+
Sbjct:  488 GSGDKQIWRVEGSDKAPVDPSTYGQFYGGDSYIILYNYRHGGRQGHIIYLWQGMDSSQDEKGACAILGAQLDEELGGGPVQFSQVVGAPITTQVRVIQGKEPAHLMSLFGGKPMVVYKGGTSREGG----QSAPAETRLFQVRSNSTGHTRAV---ELDAAASNLNSNDAFLLVTPNGTSLWMGAGASEAEKQGAQQLCDILG-----------VSASELSEGGETAQFWGALGGKADYRTSTRLKDKMDAHPPRLFACSNKTGNFVIEEVP-GELTQDDLATDDVMILDTWDQVFVWIGNEAQEEEKTEAMASAVRYVETDPANRDPRTPIVKIKQ 805          
BLAST of Gelsolin-like protein vs. Ensembl Medaka
Match: vill (villin like [Source:NCBI gene;Acc:101155645])

HSP 1 Score: 200.675 bits (509), Expect = 7.121e-56
Identity = 125/315 (39.68%), Postives = 175/315 (55.56%), Query Frame = 3
Query:  366 LFIWRIEKFKVVEWPQKQHGEFYEGDSYIVLNIYQRENELL---YDVHFWIGKYSTQDEYGTAAYKTVELDNLLDDKPVQHREVQHYESELFKSYFKN-LIYLKGGCESGFRHVKTVEYT-PRLLHVRGEKRNIIVSEVTATKHNLNSNDVFIYDTGTHIFEWIGKGANKDEKFKGQEFAQAL-NSDRNGKAKVEVVDEANISENHEFYK-----------HLSDLQPDEDDKWQNKLSVKDKKLFRISDASGSLKFENIAIGKFAKKDINEDDIFIVDN-GLEVYVYIGENASPNERQNALIYAHNYLKQTEYP 1256
            L IW I   K+V  P K  G F+EGD YIVLNI  REN+      DVH+WIG  S+QDE G AA    +LD  L   PVQ+REVQ YES  F+SYFK+ +IY  GG  SGF HV T  Y   RL+HV+G K+++   EV  + ++ N+ D+F+ DTG  I +W G  +N+ EK K    AQ + + +R G+A++ VV+ +N  E+ E  K            L D  PDE     +++     +L+ + +  G+L  + +A     +  +   D FIVD+ G  V V+ G+ AS  ERQ A+  A  Y+K   YP
Sbjct:   37 LQIWTINNMKMVSVPTKAFGNFFEGDCYIVLNI--RENKGAAQSIDVHYWIGNSSSQDEQGAAAIYVTQLDEYLGGSPVQYREVQGYESPQFRSYFKSGIIYKTGGVSSGFTHVDTNSYNILRLMHVKG-KKHVTAKEVEVSWNSFNNGDIFLLDTGKLIVQWNGPQSNRTEKLKAVLLAQDIRDRERGGRAQIGVVEGSNERESPELMKIMTTVLGEKPNKLRDAIPDEK---HDQMQTNSVRLYHVFENGGNLVVQEVATQPLTQDLLLSSDCFIVDHKGSSVMVWKGKRASKVERQEAMNRALGYIKAKNYP 345          

HSP 2 Score: 152.91 bits (385), Expect = 2.091e-39
Identity = 102/314 (32.48%), Postives = 160/314 (50.96%), Query Frame = 3
Query:  360 SELFIWRIEKFKVVEWPQKQHGEFYEGDSYIVLNIYQRENELLYDVHFWIGKYSTQDEYGTAAYKTVELDNLLDDKPVQHREVQHYESELFKSYFKN-LIYLKGGCESGFRHVKTVEYTPRLLHVRGE-KRNIIVSEVTATKHNLNSNDVFIYDTGTHIFEWIGKGANKDEKFKGQEFAQALNSDRNGKAKVEVVDEANISENHEFYKHLSDLQPDEDDK-WQNKLSVKDKKLFRISDASGSLKFENIAIGKFAKKDINEDDIFIVDNGLEVYVYIGENASPNERQNALIYAHNYLKQTEY---PQVPVTVMKK 1283
             ++ +WRIE  ++VE   K HG+FY GD Y+VL  Y R N+  Y ++ W G+++TQDE    AY+ V +D+  +  PVQ R V   E   F + FK   I  +GG  +G       E + RL  VRG  + N   +EV A   +LNSNDVF+  T    + W GKG + DE+   +       SD   +   +VV E    E   F+  L        DK  Q +  +   +LF  S+ +G  +F    +  FA+ D++EDD+ ++D   E++++IG++A+ +E  +A   A  YL+       P  P+  +K+
Sbjct:  418 GDVTVWRIENLELVEVDPKTHGQFYGGDCYLVLYTYLRSNQKQYILYMWQGRHATQDEIAACAYQAVTVDSKYNGAPVQVRVVMGKEPRHFLAIFKGKFIIFEGG--TGRAGAANPESSTRLFQVRGTNEMNTKATEVPARASSLNSNDVFLLKTDRVCYLWYGKGCSGDERVMAK-----TTSDVLFRQDKQVVMEGQ--EPANFWVALGGKSSYASDKRLQKEELIHSPRLFECSNQTG--RFRMTEVYDFAQSDLDEDDVMLLDTWEELFLWIGKHANKSETTDAWKSAQEYLRSHPAGRDPDTPIISIKQ 720          
BLAST of Gelsolin-like protein vs. Ensembl Medaka
Match: vill (villin like [Source:NCBI gene;Acc:101155645])

HSP 1 Score: 200.29 bits (508), Expect = 7.417e-56
Identity = 125/315 (39.68%), Postives = 175/315 (55.56%), Query Frame = 3
Query:  366 LFIWRIEKFKVVEWPQKQHGEFYEGDSYIVLNIYQRENELL---YDVHFWIGKYSTQDEYGTAAYKTVELDNLLDDKPVQHREVQHYESELFKSYFKN-LIYLKGGCESGFRHVKTVEY-TPRLLHVRGEKRNIIVSEVTATKHNLNSNDVFIYDTGTHIFEWIGKGANKDEKFKGQEFAQAL-NSDRNGKAKVEVVDEANISENHEFYK-----------HLSDLQPDEDDKWQNKLSVKDKKLFRISDASGSLKFENIAIGKFAKKDINEDDIFIVDN-GLEVYVYIGENASPNERQNALIYAHNYLKQTEYP 1256
            L IW I   K+V  P K  G F+EGD YIVLNI  REN+      DVH+WIG  S+QDE G AA    +LD  L   PVQ+REVQ YES  F+SYFK+ +IY  GG  SGF HV T  Y   RL+HV+G K+++   EV  + ++ N+ D+F+ DTG  I +W G  +N+ EK K    AQ + + +R G+A++ VV+ +N  E+ E  K            L D  PDE     +++     +L+ + +  G+L  + +A     +  +   D FIVD+ G  V V+ G+ AS  ERQ A+  A  Y+K   YP
Sbjct:   19 LQIWTINNMKMVSVPTKAFGNFFEGDCYIVLNI--RENKGAAQSIDVHYWIGNSSSQDEQGAAAIYVTQLDEYLGGSPVQYREVQGYESPQFRSYFKSGIIYKTGGVSSGFTHVDTNSYNILRLMHVKG-KKHVTAKEVEVSWNSFNNGDIFLLDTGKLIVQWNGPQSNRTEKLKAVLLAQDIRDRERGGRAQIGVVEGSNERESPELMKIMTTVLGEKPNKLRDAIPDEK---HDQMQTNSVRLYHVFENGGNLVVQEVATQPLTQDLLLSSDCFIVDHKGSSVMVWKGKRASKVERQEAMNRALGYIKAKNYP 327          

HSP 2 Score: 152.91 bits (385), Expect = 2.270e-39
Identity = 102/314 (32.48%), Postives = 160/314 (50.96%), Query Frame = 3
Query:  360 SELFIWRIEKFKVVEWPQKQHGEFYEGDSYIVLNIYQRENELLYDVHFWIGKYSTQDEYGTAAYKTVELDNLLDDKPVQHREVQHYESELFKSYFKN-LIYLKGGCESGFRHVKTVEYTPRLLHVRGE-KRNIIVSEVTATKHNLNSNDVFIYDTGTHIFEWIGKGANKDEKFKGQEFAQALNSDRNGKAKVEVVDEANISENHEFYKHLSDLQPDEDDK-WQNKLSVKDKKLFRISDASGSLKFENIAIGKFAKKDINEDDIFIVDNGLEVYVYIGENASPNERQNALIYAHNYLKQTEY---PQVPVTVMKK 1283
             ++ +WRIE  ++VE   K HG+FY GD Y+VL  Y R N+  Y ++ W G+++TQDE    AY+ V +D+  +  PVQ R V   E   F + FK   I  +GG  +G       E + RL  VRG  + N   +EV A   +LNSNDVF+  T    + W GKG + DE+   +       SD   +   +VV E    E   F+  L        DK  Q +  +   +LF  S+ +G  +F    +  FA+ D++EDD+ ++D   E++++IG++A+ +E  +A   A  YL+       P  P+  +K+
Sbjct:  400 GDVTVWRIENLELVEVDPKTHGQFYGGDCYLVLYTYLRSNQKQYILYMWQGRHATQDEIAACAYQAVTVDSKYNGAPVQVRVVMGKEPRHFLAIFKGKFIIFEGG--TGRAGAANPESSTRLFQVRGTNEMNTKATEVPARASSLNSNDVFLLKTDRVCYLWYGKGCSGDERVMAKT-----TSDVLFRQDKQVVMEGQ--EPANFWVALGGKSSYASDKRLQKEELIHSPRLFECSNQTG--RFRMTEVYDFAQSDLDEDDVMLLDTWEELFLWIGKHANKSETTDAWKSAQEYLRSHPAGRDPDTPIISIKQ 702          
BLAST of Gelsolin-like protein vs. Planmine SMEST
Match: SMESG000015928.1 (SMESG000015928.1)

HSP 1 Score: 754.207 bits (1946), Expect = 0.000e+0
Identity = 367/368 (99.73%), Postives = 367/368 (99.73%), Query Frame = 3
Query:  228 MQKTKKYDWKDSNVELIGSSEDRAVKKSSAENEPAWKKAKACGHSELFIWRIEKFKVVEWPQKQHGEFYEGDSYIVLNIYQRENELLYDVHFWIGKYSTQDEYGTAAYKTVELDNLLDDKPVQHREVQHYESELFKSYFKNLIYLKGGCESGFRHVKTVEYTPRLLHVRGEKRNIIVSEVTATKHNLNSNDVFIYDTGTHIFEWIGKGANKDEKFKGQEFAQALNSDRNGKAKVEVVDEANISENHEFYKHLSDLQPDEDDKWQNKLSVKDKKLFRISDASGSLKFENIAIGKFAKKDINEDDIFIVDNGLEVYVYIGENASPNERQNALIYAHNYLKQTEYPQVPVTVMKKDVKGKNAENFNKVIEG 1331
            MQKTKKYDWKDSNVELIGSSEDRAVKKSSAENEPAWKKAKAC HSELFIWRIEKFKVVEWPQKQHGEFYEGDSYIVLNIYQRENELLYDVHFWIGKYSTQDEYGTAAYKTVELDNLLDDKPVQHREVQHYESELFKSYFKNLIYLKGGCESGFRHVKTVEYTPRLLHVRGEKRNIIVSEVTATKHNLNSNDVFIYDTGTHIFEWIGKGANKDEKFKGQEFAQALNSDRNGKAKVEVVDEANISENHEFYKHLSDLQPDEDDKWQNKLSVKDKKLFRISDASGSLKFENIAIGKFAKKDINEDDIFIVDNGLEVYVYIGENASPNERQNALIYAHNYLKQTEYPQVPVTVMKKDVKGKNAENFNKVIEG
Sbjct:    1 MQKTKKYDWKDSNVELIGSSEDRAVKKSSAENEPAWKKAKACSHSELFIWRIEKFKVVEWPQKQHGEFYEGDSYIVLNIYQRENELLYDVHFWIGKYSTQDEYGTAAYKTVELDNLLDDKPVQHREVQHYESELFKSYFKNLIYLKGGCESGFRHVKTVEYTPRLLHVRGEKRNIIVSEVTATKHNLNSNDVFIYDTGTHIFEWIGKGANKDEKFKGQEFAQALNSDRNGKAKVEVVDEANISENHEFYKHLSDLQPDEDDKWQNKLSVKDKKLFRISDASGSLKFENIAIGKFAKKDINEDDIFIVDNGLEVYVYIGENASPNERQNALIYAHNYLKQTEYPQVPVTVMKKDVKGKNAENFNKVIEG 368          
BLAST of Gelsolin-like protein vs. Planmine SMEST
Match: SMESG000015924.1 (SMESG000015924.1)

HSP 1 Score: 572.392 bits (1474), Expect = 0.000e+0
Identity = 268/368 (72.83%), Postives = 316/368 (85.87%), Query Frame = 3
Query:  228 MQKTKKYDWKDSNVELIGSSEDRAVKKSSAENEPAWKKAKACGHSELFIWRIEKFKVVEWPQKQHGEFYEGDSYIVLNIYQRENELLYDVHFWIGKYSTQDEYGTAAYKTVELDNLLDDKPVQHREVQHYESELFKSYFKNLIYLKGGCESGFRHVKTVEYTPRLLHVRGEKRNIIVSEVTATKHNLNSNDVFIYDTGTHIFEWIGKGANKDEKFKGQEFAQALNSDRNGKAKVEVVDEANISENHEFYKHLSDLQPDEDDKWQNKLSVKDKKLFRISDASGSLKFENIAIGKFAKKDINEDDIFIVDNGLEVYVYIGENASPNERQNALIYAHNYLKQTEYPQVPVTVMKKDVKGKNAENFNKVIEG 1331
            M+K +KYDWKDSNVELIGSSEDR+VKKSSA+ E AW  AK C  + LFIWRIEKFKVVEWP+++ GEF+EGDSYIVLNIYQ+E ELLYD+HFWIGKYSTQDEYGTAAYKTVELD LLDDKP+QHREVQ YES++FKSYF N+IYLKGGCESGFRHV T EY PRLLHVRGEK NII+SEV++TK NLNS+DVFI+D+G+ I++WIGKGANKDE+FK Q+FAQ LNSDRNGK K+EV+DE  +S NHEFY  LS+ +P  DDK    L+  +KKLFRISD +G LKFE +A G F K +I+E+D+FI+DNG  +YVY+GE AS NER+NALIYAHNYLK T+YPQ P+TV+KKD+KGKNAE FNKV+ G
Sbjct:    1 MKKAEKYDWKDSNVELIGSSEDRSVKKSSADTEKAWNAAKTCKTTALFIWRIEKFKVVEWPKQRFGEFFEGDSYIVLNIYQKEKELLYDIHFWIGKYSTQDEYGTAAYKTVELDTLLDDKPIQHREVQDYESDMFKSYFPNIIYLKGGCESGFRHVNTREYNPRLLHVRGEKNNIIISEVSSTKKNLNSDDVFIFDSGSCIYQWIGKGANKDERFKAQQFAQQLNSDRNGKLKIEVLDEGQMSPNHEFYNKLSNNEPIADDKNHKSLTAHEKKLFRISDETGHLKFEQVASGNFNKSNIHENDVFIIDNGQVIYVYVGEKASDNERKNALIYAHNYLKATDYPQAPITVVKKDIKGKNAEEFNKVLNG 368          
BLAST of Gelsolin-like protein vs. Planmine SMEST
Match: SMESG000015927.1 (SMESG000015927.1)

HSP 1 Score: 557.755 bits (1436), Expect = 0.000e+0
Identity = 266/367 (72.48%), Postives = 317/367 (86.38%), Query Frame = 3
Query:  228 MQKTKKYDWKDSNVELIGSSEDRAVKKSSAENEPAWKKAKACGHSELFIWRIEKFKVVEWPQKQHGEFYEGDSYIVLNIYQRENELLYDVHFWIGKYSTQDEYGTAAYKTVELDNLLDDKPVQHREVQHYESELFKSYFKNLIYLKGGCESGFRHVKTVEYTPRLLHVRGEKRNIIVSEVTATKHNLNSNDVFIYDTGTHIFEWIGKGANKDEKFKGQEFAQALNSDRNGKAKVEVVDEANISENHEFYKHLSDLQPDEDDKWQNKLSVKDKKLFRISDASGSLKFENIAIGKFAKKDINEDDIFIVDNGLEVYVYIGENASPNERQNALIYAHNYLKQTEYPQVPVTVMKKDVKGKNAENFNKVIE 1328
            M+++ KYDWKDSNVELIGSSEDR+VKKSSAE E AW  AKAC H+ LF+WRIEKFKVVEWP+ Q+GEFYEGDSYIVL I+++E +L YDVHFWIGKYSTQDEYGTAAYKTVELD LLDDKPVQHREVQHYES LFKSYF+N++YLKGG ESGFRHV T EY PRLLH +G+KRNII++E++ATK NL S+DVFIYDTG+ IF+WIGKGANKDEK+K Q+FAQ LN+DRNGK  +EV+DE     NHE +KHLSD  P+E+D+    L++++ +LF+ISDA+GSLKFE +A GK  K  INE+D+FIVDNG  VYVY+GE +SPNER+NALIYAHNYLK+T+YPQ PVTV+ KDVKG NAENFNK++E
Sbjct:    1 MKRSAKYDWKDSNVELIGSSEDRSVKKSSAETEKAWAAAKACNHAALFVWRIEKFKVVEWPKVQYGEFYEGDSYIVLKIFEKEKQLNYDVHFWIGKYSTQDEYGTAAYKTVELDTLLDDKPVQHREVQHYESNLFKSYFQNIVYLKGGHESGFRHVNTREYIPRLLHFKGDKRNIIITEISATKKNLKSDDVFIYDTGSSIFQWIGKGANKDEKYKAQQFAQQLNADRNGKLNIEVLDEEETPSNHELFKHLSDSDPEEEDQHLKVLNLQETQLFKISDATGSLKFEKVAAGKLNKSQINEEDVFIVDNGQIVYVYVGEGSSPNERKNALIYAHNYLKETDYPQAPVTVINKDVKGANAENFNKLVE 367          
BLAST of Gelsolin-like protein vs. Planmine SMEST
Match: SMESG000015925.1 (SMESG000015925.1)

HSP 1 Score: 543.888 bits (1400), Expect = 0.000e+0
Identity = 266/370 (71.89%), Postives = 301/370 (81.35%), Query Frame = 3
Query:  228 MQKTKKYDWKDSNVELIGSSEDRAVKKSSAENEPAWKKAKACGHSELFIWRIEKFKVVEWPQKQHGEFYEGDSYIVLNIYQRENELLYDVHFWIGKYSTQDEYGTAAYKTVELDNLLDDKPVQHREVQHYESELFKSYFKNLIYLKGGCESGFRHVKTVEYTPRLLHVRGEKRNIIVSEVTATKHNLNSNDVFIYDTGTHIFEWIGKGANKDEKFKGQEFAQALNSDRNGKAKVEVVDEANISENHEFYKHLSD-LQPD-EDDKWQNKLSVKDKKLFRISDASGSLKFENIAIGKFAKKDINEDDIFIVDNGLEVYVYIGENASPNERQNALIYAHNYLKQTEYPQVPVTVMKKDVKGKNAENFNKVIEG 1331
            M K KKY WKDSNVELIG+ EDR++KK SAE E AW K K+C H ELFIWRIEKFKVVEWP+ Q GEFY GDSYI+LNIY R NE+LYDVHFWIGKYSTQDEYGTAAYKTVELDN LDDKPVQHREVQHYESELFKSYF  LIYL GG ESGFRHV T EY+PRLLHVRG+K  +IVSEV ATK NLNS+DVF+YDTGTHIF+WIGKGANKDE++ GQ FAQ L+SDRNGK K+EVVDE + S N  FY  LSD +  D +DDK    L   +K LFRISD +G LKFE I  G  ++  INEDD+FI+DNG +++VYIGE +S  ERQNALIYAHNYLK TEYPQ P++V+KKD+KG +AE F KVI G
Sbjct:    1 MVKPKKYSWKDSNVELIGTKEDRSIKKISAETEKAWAKVKSCNHPELFIWRIEKFKVVEWPKNQFGEFYNGDSYIILNIYTRGNEILYDVHFWIGKYSTQDEYGTAAYKTVELDNFLDDKPVQHREVQHYESELFKSYFSQLIYLNGGIESGFRHVITKEYSPRLLHVRGDKLKVIVSEVAATKRNLNSDDVFLYDTGTHIFQWIGKGANKDERYHGQRFAQQLSSDRNGKVKIEVVDEDDSSSNLIFYNKLSDEISEDWDDDKHHKPLCEHEKLLFRISDETGKLKFEKIGKGNISRAQINEDDVFIIDNGQQIFVYIGEKSSRAERQNALIYAHNYLKGTEYPQAPISVVKKDLKGNSAEQFKKVIGG 370          
BLAST of Gelsolin-like protein vs. Planmine SMEST
Match: SMESG000015922.1 (SMESG000015922.1)

HSP 1 Score: 525.013 bits (1351), Expect = 0.000e+0
Identity = 251/365 (68.77%), Postives = 297/365 (81.37%), Query Frame = 3
Query:  228 MQKTKKYDWKDSNVELIGSSEDRAVKKSSAENEPAWKKAKACGHSELFIWRIEKFKVVEWPQKQHGEFYEGDSYIVLNIYQRENELLYDVHFWIGKYSTQDEYGTAAYKTVELDNLLDDKPVQHREVQHYESELFKSYFKNLIYLKGGCESGFRHVKTVEYTPRLLHVRGEKRNIIVSEVTATKHNLNSNDVFIYDTGTHIFEWIGKGANKDEKFKGQEFAQALNSDRNGKAKVEVVDEANISENHEFYKHLSDLQPDEDDKWQNKLSVKDKKLFRISDASGSLKFENIAIGKFAKKDINEDDIFIVDNGLEVYVYIGENASPNERQNALIYAHNYLKQTEYPQVPVTVMKKDVKGKNAENFNKV 1322
            MQK +KY WKDSNV L GSSEDR VKKSSAE E AWKKAK C  S L IWRIEKFKV+EWP +Q+G FYEGDSYI+LNI ++EN LLYD+HFWIGK+STQDEYGTA YKTVELD LLDD+PVQHREVQHYES+LFKSYFK LIYLKGGCESGFR V    Y PRLLHV+G KR+I VSEV+AT  NLNS DVFI DTG  IF+WIGKGANKDEKFK ++F Q LNSDRNGK  VEV+DE    +NHEFY  LSD++P +D+K    LS ++K++FRISD +GSLKFE +   KF K +++E+D+FI+D+G+EV VYIGEN+SP+ER+ +LIYAH YLK+T +PQ PVTV+ K V GKN + FN +
Sbjct:    1 MQKPEKYAWKDSNVALTGSSEDREVKKSSAETEAAWKKAKLCNKSTLLIWRIEKFKVMEWPNEQNGVFYEGDSYIILNIKEKENVLLYDLHFWIGKFSTQDEYGTAVYKTVELDTLLDDRPVQHREVQHYESDLFKSYFKELIYLKGGCESGFRIVNVQTYNPRLLHVKGRKRSITVSEVSATTKNLNSEDVFILDTGMKIFQWIGKGANKDEKFKARQFVQQLNSDRNGKCLVEVIDEEETLDNHEFYNFLSDIKPVDDEKNFTALSSQEKQIFRISDITGSLKFEKL---KFDKSNLDENDVFIIDSGMEVIVYIGENSSPDERKKSLIYAHEYLKETGHPQAPVTVLNKKVDGKNLDRFNNI 362          
The following BLAST results are available for this feature:
BLAST of Gelsolin-like protein vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
VIL17.951e-6136.07villin 1 [Source:HGNC Symbol;Acc:HGNC:12690][more]
AVIL5.652e-6037.99advillin [Source:HGNC Symbol;Acc:HGNC:14188][more]
SCIN8.169e-5838.61scinderin [Source:HGNC Symbol;Acc:HGNC:21695][more]
VIL12.568e-5736.07villin 1 [Source:HGNC Symbol;Acc:HGNC:12690][more]
SCIN9.065e-5738.61scinderin [Source:HGNC Symbol;Acc:HGNC:21695][more]
back to top
BLAST of Gelsolin-like protein vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 2
Match NameE-valueIdentityDescription
gsnl-15.677e-5938.66Gelsolin-like protein 1 [Source:UniProtKB/Swiss-P... [more]
fli-14.305e-2224.92pep chromosome:WBcel235:III:8675297:8683732:-1 gen... [more]
back to top
BLAST of Gelsolin-like protein vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Gel1.321e-6237.65gene:FBgn0010225 transcript:FBtr0336707[more]
Gel1.321e-6237.65gene:FBgn0010225 transcript:FBtr0078971[more]
Gel1.564e-6237.65gene:FBgn0010225 transcript:FBtr0078973[more]
Gel1.564e-6237.65gene:FBgn0010225 transcript:FBtr0309256[more]
Gel1.564e-6237.65gene:FBgn0010225 transcript:FBtr0078969[more]
back to top
BLAST of Gelsolin-like protein vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
scin1.190e-5936.62scinderin [Source:ZFIN;Acc:ZDB-GENE-060503-6][more]
scin1.487e-5936.62scinderin [Source:ZFIN;Acc:ZDB-GENE-060503-6][more]
gsna2.065e-5938.71gelsolin a [Source:ZFIN;Acc:ZDB-GENE-030131-9653][more]
gsna2.182e-5938.71gelsolin a [Source:ZFIN;Acc:ZDB-GENE-030131-9653][more]
gsna2.182e-5938.71gelsolin a [Source:ZFIN;Acc:ZDB-GENE-030131-9653][more]
back to top
BLAST of Gelsolin-like protein vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
jazf15.688e-6136.87JAZF zinc finger 1 [Source:Xenbase;Acc:XB-GENE-950... [more]
jazf17.771e-6136.87JAZF zinc finger 1 [Source:Xenbase;Acc:XB-GENE-950... [more]
jazf14.036e-5936.58JAZF zinc finger 1 [Source:Xenbase;Acc:XB-GENE-950... [more]
ndc802.629e-5739.61NDC80 kinetochore complex component [Source:Xenbas... [more]
ndc803.021e-5739.61NDC80 kinetochore complex component [Source:Xenbas... [more]
back to top
BLAST of Gelsolin-like protein vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Vil13.838e-5936.39villin 1 [Source:MGI Symbol;Acc:MGI:98930][more]
Scin2.924e-5838.73scinderin [Source:MGI Symbol;Acc:MGI:1306794][more]
Gsn5.415e-5836.45gelsolin [Source:MGI Symbol;Acc:MGI:95851][more]
Gsn1.283e-5734.96gelsolin [Source:MGI Symbol;Acc:MGI:95851][more]
Scin1.480e-5738.73scinderin [Source:MGI Symbol;Acc:MGI:1306794][more]
back to top
BLAST of Gelsolin-like protein vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q7JQD3|GELS1_LUMTE2.838e-10846.67Gelsolin-like protein 1 OS=Lumbricus terrestris OX... [more]
sp|Q8MPM1|GELS2_LUMTE1.472e-10745.77Gelsolin-like protein 2 OS=Lumbricus terrestris OX... [more]
sp|Q24800|SEVE_ECHGR2.830e-9643.35Severin OS=Echinococcus granulosus OX=6210 GN=AG8 ... [more]
sp|P10733|SEVE_DICDI1.116e-8943.27Severin OS=Dictyostelium discoideum OX=44689 GN=se... [more]
sp|Q07171|GELS_DROME1.568e-6137.65Gelsolin OS=Drosophila melanogaster OX=7227 GN=Gel... [more]
back to top
BLAST of Gelsolin-like protein vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A1I8FYV18.547e-14053.28Uncharacterized protein OS=Macrostomum lignano OX=... [more]
A0A1I8GIF71.147e-13953.28Uncharacterized protein OS=Macrostomum lignano OX=... [more]
A0A1W6I1A32.223e-13877.37Gelsolin-like protein OS=Schmidtea mediterranea OX... [more]
A0A1I8GFK53.042e-13553.85Uncharacterized protein OS=Macrostomum lignano OX=... [more]
A0A267FTU36.051e-13550.93Uncharacterized protein OS=Macrostomum lignano OX=... [more]
back to top
BLAST of Gelsolin-like protein vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
gsna1.360e-6239.43gelsolin-like [Source:NCBI gene;Acc:103033745][more]
gsna1.514e-6239.43gelsolin-like [Source:NCBI gene;Acc:103033745][more]
scin1.537e-5936.83scinderin [Source:NCBI gene;Acc:103042167][more]
avil1.661e-5937.86advillin [Source:NCBI gene;Acc:103036458][more]
avil6.195e-5937.86advillin [Source:NCBI gene;Acc:103036458][more]
back to top
BLAST of Gelsolin-like protein vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 4
Match NameE-valueIdentityDescription
avil1.262e-5936.98advillin [Source:ZFIN;Acc:ZDB-GENE-060421-6683][more]
gsna8.352e-5042.42gelsolin a [Source:ZFIN;Acc:ZDB-GENE-030131-9653][more]
ENSPMAT00000008894.15.172e-1334.92pep scaffold:Pmarinus_7.0:GL484493:7018:36468:1 ge... [more]
ENSPMAT00000003626.12.460e-825.84pep scaffold:Pmarinus_7.0:GL477855:13850:40700:-1 ... [more]
back to top
BLAST of Gelsolin-like protein vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Gelsolin-like protein vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
EDO403488.330e-11548.91Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO492355.787e-11349.58Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO431901.158e-10145.12Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO431919.508e-9844.89Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO492345.923e-9645.38Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Gelsolin-like protein vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
avil1.397e-6239.75advillin [Source:NCBI gene;Acc:101170835][more]
gsna4.475e-6139.35gelsolin [Source:NCBI gene;Acc:101167720][more]
gsna5.483e-6139.35gelsolin [Source:NCBI gene;Acc:101167720][more]
vill7.121e-5639.68villin like [Source:NCBI gene;Acc:101155645][more]
vill7.417e-5639.68villin like [Source:NCBI gene;Acc:101155645][more]
back to top
BLAST of Gelsolin-like protein vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000015928.10.000e+099.73SMESG000015928.1[more]
SMESG000015924.10.000e+072.83SMESG000015924.1[more]
SMESG000015927.10.000e+072.48SMESG000015927.1[more]
SMESG000015925.10.000e+071.89SMESG000015925.1[more]
SMESG000015922.10.000e+068.77SMESG000015922.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30015672 ID=SMED30015672|Name=Gelsolin-like protein|organism=Schmidtea mediterranea sexual|type=transcript|length=1435bp
TCTTGTCATTTCAGCATGCATATATCATTAGCGTAAAGATAAAAATACTA
ACAACTCCTAGTCAAATTGCAACCAACCGTAAATTGCAGACACACACGAA
CCAATCACATTTGCTGCCATCGGACAGCCTATGAGACAGCAGATTGGATT
AATCAATAAAGATTTATTGTTCGGTTTTCATTGTATAAATACTGAAATCA
TTTGTCAATCCAATTGTTAAGTCAACCATGCAGAAAACTAAAAAATATGA
CTGGAAAGATTCCAATGTGGAATTGATTGGAAGCAGCGAGGACAGAGCTG
TCAAGAAATCATCGGCTGAAAACGAGCCAGCTTGGAAGAAAGCTAAAGCT
TGCGGCCATTCTGAATTGTTTATATGGCGAATTGAGAAATTCAAAGTTGT
TGAATGGCCTCAAAAGCAACATGGGGAATTTTATGAAGGAGATTCTTACA
TTGTCTTAAATATATATCAAAGAGAAAATGAATTACTGTACGATGTGCAT
TTTTGGATTGGTAAATATTCTACCCAAGACGAGTATGGGACTGCTGCCTA
CAAAACTGTGGAATTGGACAATTTGCTCGATGACAAACCAGTTCAACATA
GAGAGGTCCAACATTACGAATCGGAATTGTTCAAAAGTTATTTCAAAAAT
CTAATATATCTGAAAGGTGGTTGCGAAAGTGGATTTAGACATGTTAAAAC
TGTAGAGTACACTCCGAGATTATTACATGTACGAGGGGAAAAACGTAACA
TCATTGTTTCTGAGGTGACTGCAACTAAACATAATTTAAATTCCAATGAT
GTGTTCATCTATGACACTGGAACTCACATTTTTGAGTGGATTGGAAAAGG
TGCGAACAAAGATGAAAAGTTCAAAGGTCAAGAATTTGCGCAAGCGCTAA
ATAGTGACCGCAATGGAAAGGCTAAAGTTGAAGTTGTCGACGAGGCAAAT
ATATCAGAAAATCACGAATTCTACAAACATTTATCAGATTTACAACCCGA
CGAAGATGACAAATGGCAAAATAAGTTATCAGTTAAAGATAAGAAACTTT
TTAGAATATCTGATGCCAGTGGATCTTTGAAATTCGAAAATATTGCTATT
GGAAAATTTGCAAAAAAGGACATTAACGAAGATGATATTTTCATTGTTGA
CAACGGTTTAGAAGTATATGTTTATATTGGAGAAAACGCCAGCCCTAACG
AAAGGCAAAATGCCTTGATTTATGCCCATAATTACCTAAAACAAACCGAA
TATCCCCAAGTTCCGGTGACAGTAATGAAAAAGGATGTCAAAGGCAAGAA
TGCTGAAAACTTCAATAAAGTAATTGAAGGATAAACTCTGGCAAATTTGT
TTGTTATTTAATTCATAATTTATTTTCAATCTAACTAGGTTTTACTTTTC
AATAATAAAATATTTATGTTTGTTTTAAAAAAAAA
back to top

protein sequence of SMED30015672-orf-1

>SMED30015672-orf-1 ID=SMED30015672-orf-1|Name=SMED30015672-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=369bp
MQKTKKYDWKDSNVELIGSSEDRAVKKSSAENEPAWKKAKACGHSELFIW
RIEKFKVVEWPQKQHGEFYEGDSYIVLNIYQRENELLYDVHFWIGKYSTQ
DEYGTAAYKTVELDNLLDDKPVQHREVQHYESELFKSYFKNLIYLKGGCE
SGFRHVKTVEYTPRLLHVRGEKRNIIVSEVTATKHNLNSNDVFIYDTGTH
IFEWIGKGANKDEKFKGQEFAQALNSDRNGKAKVEVVDEANISENHEFYK
HLSDLQPDEDDKWQNKLSVKDKKLFRISDASGSLKFENIAIGKFAKKDIN
EDDIFIVDNGLEVYVYIGENASPNERQNALIYAHNYLKQTEYPQVPVTVM
KKDVKGKNAENFNKVIEG*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: molecular function
TermDefinition
GO:0051015actin filament binding
GO:0003779actin binding
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000028Category 2 cell
PLANA:0000034epidermis
PLANA:0000035Category 3 cell
PLANA:0000099neuron
PLANA:0002032epidermal cell
PLANA:0003116parenchymal cell
Vocabulary: INTERPRO
TermDefinition
IPR007122Villin/Gelsolin
IPR007123Gelsolin-like_dom
IPR029006ADF-H/Gelsolin-like_dom_sf
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR007122Villin/GelsolinPRINTSPR00597GELSOLINcoord: 64..80
score: 48.66
coord: 296..318
score: 33.79
coord: 89..107
score: 32.3
coord: 175..195
score: 37.66
coord: 122..142
score: 32.25
coord: 325..344
score: 22.95
IPR007122Villin/GelsolinSMARTSM00262VILL_6coord: 273..357
e-value: 3.1E-8
score: 43.3
coord: 45..142
e-value: 1.3E-22
score: 91.1
coord: 161..255
e-value: 4.2E-17
score: 72.8
IPR007122Villin/GelsolinPANTHERPTHR11977VILLINcoord: 20..343
IPR029006ADF-H/Gelsolin-like domain superfamilyGENE3DG3DSA:3.40.20.10coord: 156..262
e-value: 9.8E-31
score: 108.2
IPR029006ADF-H/Gelsolin-like domain superfamilyGENE3DG3DSA:3.40.20.10coord: 30..155
e-value: 2.9E-43
score: 148.7
IPR029006ADF-H/Gelsolin-like domain superfamilyGENE3DG3DSA:3.40.20.10coord: 263..368
e-value: 9.2E-21
score: 75.6
IPR007123Gelsolin-like domainPFAMPF00626Gelsolincoord: 174..241
e-value: 2.4E-14
score: 53.0
coord: 291..351
e-value: 2.2E-8
score: 33.9
coord: 55..135
e-value: 2.5E-13
score: 49.7
NoneNo IPR availableCDDcd11290gelsolin_S1_likecoord: 40..148
e-value: 3.69926E-54
score: 172.408
NoneNo IPR availableSUPERFAMILYSSF55753Actin depolymerizing proteinscoord: 153..256
NoneNo IPR availableSUPERFAMILYSSF55753Actin depolymerizing proteinscoord: 244..349
NoneNo IPR availableSUPERFAMILYSSF55753Actin depolymerizing proteinscoord: 44..172