SMED30015660

Overview
NameSMED30015660
Smed IDSMED30015660
Length (bp)875
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of SMED30015660 (SMED30015660) t-SNE clustered cells

Violin plots show distribution of expression levels for SMED30015660 (SMED30015660) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of SMED30015660 (SMED30015660) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for SMED30015660 (SMED30015660) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30015660

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 8

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
pharynxSMED30015660SMESG000018225.1 SMESG000017035.1 dd_Smed_v4_1426_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
protonephridiaSMED30015660SMESG000018225.1 SMESG000017035.1 dd_Smed_v4_1426_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
gutSMED30015660SMESG000018225.1 SMESG000017035.1 dd_Smed_v4_1426_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
neuronSMED30015660SMESG000018225.1 SMESG000017035.1 dd_Smed_v4_1426_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
epidermal cellSMED30015660SMESG000018225.1 SMESG000017035.1 dd_Smed_v4_1426_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
Category 4 cellSMED30015660SMESG000018225.1 SMESG000017035.1 dd_Smed_v4_1426_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
epidermisSMED30015660SMESG000018225.1 SMESG000017035.1 dd_Smed_v4_1426_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
dorsal region of the epidermisSMED30015660SMESG000018225.1 SMESG000017035.1 dd_Smed_v4_1426_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Alignments
SMED30015660 aligns in the following genomic locations:
Alignment LocationAlignment Score
v31.002188:84676..86882 +4148
v31.000560:4100..6034 -4070
Homology
BLAST of SMED30015660 vs. Ensembl Human
Match: RIPK4 (receptor interacting serine/threonine kinase 4 [Source:HGNC Symbol;Acc:HGNC:496])

HSP 1 Score: 112.079 bits (279), Expect = 5.442e-27
Identity = 57/186 (30.65%), Postives = 98/186 (52.69%), Query Frame = 3
Query:  144 PIHFACLKGDIDIVKVLIDHNCDIEVRNR-KWNQQPIHMACWDGHLEILKVLLEKNCDIESCDEWKRRPIHLACENGHTEIVKFLINLHCDIEAINDKAWRPIHFGCWKGHSDIVKVLVEQ-NCDIEACDHLKRRPIHLACEKGHTEIVKVLIDHHCDISACGGRFNQSPIHLARKNNFTELIQLL 695
            P+H A  +    +V++L+     +  ++  +W    +H A  +G     ++LLEKN  +   D   R P+H+AC++G   IV+ L+    D+      AW P+H+  W+GH  IVK+L +Q    + A     R P+HLA ++GH  + ++LID   D++ C     Q+P+H+A +   T   +LL
Sbjct:  522 PLHMAVERRVRGVVELLLARKISVNAKDEDQWTA--LHFAAQNGDESSTRLLLEKNASVNEVDFEGRTPMHVACQHGQENIVRILLRRGVDVSLQGKDAWLPLHYAAWQGHLPIVKLLAKQPGVSVNAQTLDGRTPLHLAAQRGHYRVARILIDLCSDVNVC-SLLAQTPLHVAAETGHTSTARLL 704          

HSP 2 Score: 108.997 bits (271), Expect = 6.777e-26
Identity = 59/190 (31.05%), Postives = 102/190 (53.68%), Query Frame = 3
Query:  138 RRPIHFACLKGDIDIVKVLIDHNCDIEVRNR-KWNQQPIHMACWDGHLEILKVLLEK---NCDIESCDEWKRRPIHLACENGHTEIVKFLINLHCDIEAINDKAWRPIHFGCWKGHSDIVKVLVEQNCDIEACDHLKRRPIHLACEKGHTEIVKVLIDHHCDISACGGRFNQSPIHLARKNNFTELIQLL 695
            R P+H AC  G  +IV++L+    D+ ++ +  W   P+H A W GHL I+K+L ++   + + ++ D   R P+HLA + GH  + + LI+L  D+   +  A  P+H     GH+   ++L+ +    EA        +HLA   GH   VK+L++   D+ A  G  NQ+ +HLA  +  +E+++ L
Sbjct:  586 RTPMHVACQHGQENIVRILLRRGVDVSLQGKDAW--LPLHYAAWQGHLPIVKLLAKQPGVSVNAQTLD--GRTPLHLAAQRGHYRVARILIDLCSDVNVCSLLAQTPLHVAAETGHTSTARLLLHRGAGKEAMTSDGYTALHLAARNGHLATVKLLVEEKADVLAR-GPLNQTALHLAAAHGHSEVVEEL 770          

HSP 3 Score: 98.5969 bits (244), Expect = 2.300e-22
Identity = 53/188 (28.19%), Postives = 94/188 (50.00%), Query Frame = 3
Query:  144 PIHFACLKGDIDIVKVLIDHNCDIEVRNRKWN-QQPIHMACWDGHLEILKVLLEKNCDIESCDEWKRRPIHLACENGHTEIVKFLINLHCDIEAINDKAWRPIHFGCWKGHSDIVKVLVEQNCDIEACDHLKRRPIHLACEKGHTEIVKVLIDHHCDISACGGRFNQSPIHLARKNNFTELIQLLTIH 704
            P+H+A  +G + IVK+L      + V  +  + + P+H+A   GH  + ++L++   D+  C    + P+H+A E GHT   + L++     EA+    +  +H     GH   VK+LVE+  D+ A   L +  +HLA   GH+E+V+ L+    D+         S +HLA +    + ++ L  H
Sbjct:  621 PLHYAAWQGHLPIVKLLAKQP-GVSVNAQTLDGRTPLHLAAQRGHYRVARILIDLCSDVNVCSLLAQTPLHVAAETGHTSTARLLLHRGAGKEAMTSDGYTALHLAARNGHLATVKLLVEEKADVLARGPLNQTALHLAAAHGHSEVVEELVS--ADVIDLFDEQGLSALHLAAQGRHAQTVETLLRH 805          

HSP 4 Score: 67.3958 bits (163), Expect = 5.765e-12
Identity = 46/182 (25.27%), Postives = 84/182 (46.15%), Query Frame = 3
Query:  156 ACLKGDID-IVKVLIDHNCDIEVRNRKWNQQPIHMACWDGHLEILKVLLEKNCDIESCDEWKRRPIHLACENGHTEIVKFLINLHCDIEAINDKAWRPIHFGCWKGHSDIVKVLVEQNCDIEACDHLKRRPIHLACEKGHTEIVKVLIDHHCDISACGGRFNQSPIHLARKNNFTELIQLLT 698
            A + GD   ++K+L   + D+ + +       +H+A   G  E  K LL  N +    +     P+H+A E     +V+ L+     + A ++  W  +HF    G     ++L+E+N  +   D   R P+H+AC+ G   IV++L+    D+S   G+    P+H A       +++LL 
Sbjct:  461 AIVSGDTSKLMKILQPQDVDLALDS---GASLLHLAVEAGQEECAKWLLLNNANPNLSNRRGSTPLHMAVERRVRGVVELLLARKISVNAKDEDQWTALHFAAQNGDESSTRLLLEKNASVNEVDFEGRTPMHVACQHGQENIVRILLRRGVDVS-LQGKDAWLPLHYAAWQGHLPIVKLLA 638          
BLAST of SMED30015660 vs. Ensembl Human
Match: RIPK4 (receptor interacting serine/threonine kinase 4 [Source:HGNC Symbol;Acc:HGNC:496])

HSP 1 Score: 112.079 bits (279), Expect = 5.962e-27
Identity = 57/186 (30.65%), Postives = 98/186 (52.69%), Query Frame = 3
Query:  144 PIHFACLKGDIDIVKVLIDHNCDIEVRNR-KWNQQPIHMACWDGHLEILKVLLEKNCDIESCDEWKRRPIHLACENGHTEIVKFLINLHCDIEAINDKAWRPIHFGCWKGHSDIVKVLVEQ-NCDIEACDHLKRRPIHLACEKGHTEIVKVLIDHHCDISACGGRFNQSPIHLARKNNFTELIQLL 695
            P+H A  +    +V++L+     +  ++  +W    +H A  +G     ++LLEKN  +   D   R P+H+AC++G   IV+ L+    D+      AW P+H+  W+GH  IVK+L +Q    + A     R P+HLA ++GH  + ++LID   D++ C     Q+P+H+A +   T   +LL
Sbjct:  474 PLHMAVERRVRGVVELLLARKISVNAKDEDQWTA--LHFAAQNGDESSTRLLLEKNASVNEVDFEGRTPMHVACQHGQENIVRILLRRGVDVSLQGKDAWLPLHYAAWQGHLPIVKLLAKQPGVSVNAQTLDGRTPLHLAAQRGHYRVARILIDLCSDVNVC-SLLAQTPLHVAAETGHTSTARLL 656          

HSP 2 Score: 108.612 bits (270), Expect = 7.499e-26
Identity = 59/190 (31.05%), Postives = 102/190 (53.68%), Query Frame = 3
Query:  138 RRPIHFACLKGDIDIVKVLIDHNCDIEVRNR-KWNQQPIHMACWDGHLEILKVLLEK---NCDIESCDEWKRRPIHLACENGHTEIVKFLINLHCDIEAINDKAWRPIHFGCWKGHSDIVKVLVEQNCDIEACDHLKRRPIHLACEKGHTEIVKVLIDHHCDISACGGRFNQSPIHLARKNNFTELIQLL 695
            R P+H AC  G  +IV++L+    D+ ++ +  W   P+H A W GHL I+K+L ++   + + ++ D   R P+HLA + GH  + + LI+L  D+   +  A  P+H     GH+   ++L+ +    EA        +HLA   GH   VK+L++   D+ A  G  NQ+ +HLA  +  +E+++ L
Sbjct:  538 RTPMHVACQHGQENIVRILLRRGVDVSLQGKDAW--LPLHYAAWQGHLPIVKLLAKQPGVSVNAQTLD--GRTPLHLAAQRGHYRVARILIDLCSDVNVCSLLAQTPLHVAAETGHTSTARLLLHRGAGKEAMTSDGYTALHLAARNGHLATVKLLVEEKADVLAR-GPLNQTALHLAAAHGHSEVVEEL 722          

HSP 3 Score: 98.5969 bits (244), Expect = 2.189e-22
Identity = 53/188 (28.19%), Postives = 94/188 (50.00%), Query Frame = 3
Query:  144 PIHFACLKGDIDIVKVLIDHNCDIEVRNRKWN-QQPIHMACWDGHLEILKVLLEKNCDIESCDEWKRRPIHLACENGHTEIVKFLINLHCDIEAINDKAWRPIHFGCWKGHSDIVKVLVEQNCDIEACDHLKRRPIHLACEKGHTEIVKVLIDHHCDISACGGRFNQSPIHLARKNNFTELIQLLTIH 704
            P+H+A  +G + IVK+L      + V  +  + + P+H+A   GH  + ++L++   D+  C    + P+H+A E GHT   + L++     EA+    +  +H     GH   VK+LVE+  D+ A   L +  +HLA   GH+E+V+ L+    D+         S +HLA +    + ++ L  H
Sbjct:  573 PLHYAAWQGHLPIVKLLAKQP-GVSVNAQTLDGRTPLHLAAQRGHYRVARILIDLCSDVNVCSLLAQTPLHVAAETGHTSTARLLLHRGAGKEAMTSDGYTALHLAARNGHLATVKLLVEEKADVLARGPLNQTALHLAAAHGHSEVVEELVS--ADVIDLFDEQGLSALHLAAQGRHAQTVETLLRH 757          

HSP 4 Score: 67.3958 bits (163), Expect = 6.321e-12
Identity = 46/182 (25.27%), Postives = 84/182 (46.15%), Query Frame = 3
Query:  156 ACLKGDID-IVKVLIDHNCDIEVRNRKWNQQPIHMACWDGHLEILKVLLEKNCDIESCDEWKRRPIHLACENGHTEIVKFLINLHCDIEAINDKAWRPIHFGCWKGHSDIVKVLVEQNCDIEACDHLKRRPIHLACEKGHTEIVKVLIDHHCDISACGGRFNQSPIHLARKNNFTELIQLLT 698
            A + GD   ++K+L   + D+ + +       +H+A   G  E  K LL  N +    +     P+H+A E     +V+ L+     + A ++  W  +HF    G     ++L+E+N  +   D   R P+H+AC+ G   IV++L+    D+S   G+    P+H A       +++LL 
Sbjct:  413 AIVSGDTSKLMKILQPQDVDLALDS---GASLLHLAVEAGQEECAKWLLLNNANPNLSNRRGSTPLHMAVERRVRGVVELLLARKISVNAKDEDQWTALHFAAQNGDESSTRLLLEKNASVNEVDFEGRTPMHVACQHGQENIVRILLRRGVDVS-LQGKDAWLPLHYAAWQGHLPIVKLLA 590          
BLAST of SMED30015660 vs. Ensembl Human
Match: ANKRD28 (ankyrin repeat domain 28 [Source:HGNC Symbol;Acc:HGNC:29024])

HSP 1 Score: 99.3673 bits (246), Expect = 1.094e-22
Identity = 55/187 (29.41%), Postives = 104/187 (55.61%), Query Frame = 3
Query:  138 RRPIHFACLKGDIDIVKVLIDHNCDIEVRNRKWNQQPIHMACWDGHLEILKVLLEKNCDIESCDEWKRRPIHLACENGHTEIVKFLINLHCDIEAINDKAWR-PIHFGCWKGHSDIVKVLVEQNCDIEACDHLKRRPIHLACEKGHTEIVKVLIDHHCDISACGGRFNQSPIHLARKNNFTELIQLL 695
            R P+H A   GD +I+++LI     +  ++ KW   P+H A      E ++VLL+ + D+ + D+  + P+H+A  N   +  + L+ L  ++  ++D+A R  +H   + GH ++VK+L+ +  +I A D   RR IH A   GH E+VK+L+ H  +++ C  + + +P+H A  +    +++ L
Sbjct:   42 RTPLHAAAYLGDAEIIELLILSGARVNAKDSKW-LTPLHRAVASCSEEAVQVLLKHSADVNARDKNWQTPLHIAAANKAVKCAEALVPLLSNVN-VSDRAGRTALHHAAFSGHGEMVKLLLSRGANINAFDKKDRRAIHWAAYMGHIEVVKLLVSHGAEVT-CKDKKSYTPLHAAASSGMISVVKYL 225          

HSP 2 Score: 93.5893 bits (231), Expect = 9.866e-21
Identity = 51/175 (29.14%), Postives = 91/175 (52.00%), Query Frame = 3
Query:  144 PIHFACLKGDIDIVKVLIDHNCDIEVRNRKWNQQPIHMACWDGHLEILKVLLEKNCDIESCDEWKRRPIHLACENGHTEIVKFLINLHCDIEAINDKAWRPIHFGCWKGHSDIVKVLVEQNCDIEACDHLKRRPIHLACEKGHTEIVKVLIDHHCDISACGGRFNQSPIHLARKN 668
            P+H A      + V+VL+ H+ D+  R++ W Q P+H+A  +  ++  + L+    ++   D   R  +H A  +GH E+VK L++   +I A + K  R IH+  + GH ++VK+LV    ++   D     P+H A   G   +VK L+D   D++     +  +P+H+A  N
Sbjct:   77 PLHRAVASCSEEAVQVLLKHSADVNARDKNW-QTPLHIAAANKAVKCAEALVPLLSNVNVSDRAGRTALHHAAFSGHGEMVKLLLSRGANINAFDKKDRRAIHWAAYMGHIEVVKLLVSHGAEVTCKDKKSYTPLHAAASSGMISVVKYLLDLGVDMNEPNA-YGNTPLHVACYN 249          

HSP 3 Score: 90.1225 bits (222), Expect = 1.763e-19
Identity = 51/188 (27.13%), Postives = 93/188 (49.47%), Query Frame = 3
Query:  135 DRRPIHFACLKGDIDIVKVLIDHNCDIEVRNRKWNQQPIHMACWDGHLEILKVLLEKNCDIESCDEWKRRPIHLACENGHTEIVKFLINLHCDIEAINDKAWRPIHFGCWKGHSDI-VKVLVEQNCDIEACDHLKRRPIHLACEKGHTEIVKVLIDHHCDISACGGRFNQSPIHLARKNNFTELIQLL 695
            DRR IH+A   G I++VK+L+ H  ++  +++K +  P+H A   G + ++K LL+   D+   + +   P+H+AC NG   +V  LI+    +   N+K + P+HF     H  + +++LV    D+       + P+H+    G     + +I     I  C  +   +P+H+A +     LI  L
Sbjct:  173 DRRAIHWAAYMGHIEVVKLLVSHGAEVTCKDKK-SYTPLHAAASSGMISVVKYLLDLGVDMNEPNAYGNTPLHVACYNGQDVVVNELIDCGAIVNQKNEKGFTPLHFAAASTHGALCLELLVGNGADVNMKSKDGKTPLHMTALHGRFSRSQTIIQSGAVID-CEDKNGNTPLHIAARYGHELLINTL 358          

HSP 4 Score: 78.9518 bits (193), Expect = 1.073e-15
Identity = 54/196 (27.55%), Postives = 89/196 (45.41%), Query Frame = 3
Query:  138 RRPIHFACLKGDIDIVKVLIDHNCDIEVRNRKWNQQPIHMACWDGHLEILKVLL---EKNCDIESCDEWKRRPIHLACENGHTEIVKFLINLHCDIEAINDKAWRPIHFGCWKGHSDIVKVLVEQNCDIEACDHLKRRPIHLACEKGHTEIVKVLIDHHCDIS---ACGGRFNQSPIHLARKNNFTELIQLLTIHE 707
            R P+  A  KG ++ V VLI+    I V++    + PIH A  +GH E L++L+   E    ++  D   + P+ L+  NGHT+ V  L+N   +++A +      +H G   GH + V  L++        D   R PIHL+   GH  ++  L+     +    A       + +H A  N     ++LL   E
Sbjct:  584 RTPLDLAAFKGHVECVDVLINQGASILVKDYILKRTPIHAAATNGHSECLRLLIGNAEPQNAVDIQDGNGQTPLMLSVLNGHTDCVYSLLNKGANVDAKDKWGRTALHRGAVTGHEECVDALLQHGAKCLLRDSRGRTPIHLSAACGHIGVLGALLQSAASMDANPATADNHGYTALHWACYNGHETCVELLLEQE 779          

HSP 5 Score: 78.1814 bits (191), Expect = 1.873e-15
Identity = 42/174 (24.14%), Postives = 90/174 (51.72%), Query Frame = 3
Query:  138 RRPIHFACLKGDIDIVKVLIDHNCDIEVRNRKWNQQPIHMACWDGHLEILKVLLEKNCDIESCDEWKRRPIHLACENGHTEIVKFLINLHCDIEAINDKAWRPIHFGCWKGHSDIVKVLVEQNCDIEACDHLKRRPIHLACEKGHTEI-VKVLIDHHCDISACGGRFNQSPIHL 656
            R  +H A   G  ++VK+L+    +I   ++K +++ IH A + GH+E++K+L+    ++   D+    P+H A  +G   +VK+L++L  D+   N     P+H  C+ G   +V  L++    +   +     P+H A    H  + +++L+ +  D++    +  ++P+H+
Sbjct:  141 RTALHHAAFSGHGEMVKLLLSRGANINAFDKK-DRRAIHWAAYMGHIEVVKLLVSHGAEVTCKDKKSYTPLHAAASSGMISVVKYLLDLGVDMNEPNAYGNTPLHVACYNGQDVVVNELIDCGAIVNQKNEKGFTPLHFAAASTHGALCLELLVGNGADVNM-KSKDGKTPLHM 312          

HSP 6 Score: 67.781 bits (164), Expect = 1.205e-12
Identity = 47/192 (24.48%), Postives = 86/192 (44.79%), Query Frame = 3
Query:  144 PIHFACLKGDIDIVKVLIDHNCDIEVRNRKWNQQPIHMACWDGHLEILKVLLEKNCDIESCDEWKRRPIHLACENGHTEIVKFLINLHCDIEA----INDKAWRPIHFGCWKGHSDIVKVLVEQNCDIEACDHLKRRPIHLACEKGHTEIVKVLIDH-HCDISACGGRFNQSPIHLARKNNFTELIQLLTIH 704
            P+  + L G  D V  L++   +++ ++ KW +  +H     GH E +  LL+        D   R PIHL+   GH  ++  L+     ++A     ++  +  +H+ C+ GH   V++L+EQ    +  +     P+H A    +    ++LID     I        ++P+H A   +  E +QLL  H
Sbjct:  656 PLMLSVLNGHTDCVYSLLNKGANVDAKD-KWGRTALHRGAVTGHEECVDALLQHGAKCLLRDSRGRTPIHLSAACGHIGVLGALLQSAASMDANPATADNHGYTALHWACYNGHETCVELLLEQEV-FQKTEGNAFSPLHCAVINDNEGAAEMLIDTLGASIVNATDSKGRTPLHAAAFTDHVECLQLLLSH 845          

HSP 7 Score: 24.2534 bits (51), Expect = 1.205e-12
Identity = 12/27 (44.44%), Postives = 15/27 (55.56%), Query Frame = 2
Query:    2 PIHLAFDNNHREIVKLLIEENCDVNAI 82
            PIH A  N H E ++LLI      NA+
Sbjct:  620 PIHAAATNGHSECLRLLIGNAEPQNAV 646          

HSP 8 Score: 65.855 bits (159), Expect = 1.997e-11
Identity = 43/156 (27.56%), Postives = 75/156 (48.08%), Query Frame = 3
Query:  144 PIHFACLKGDIDIVKVLIDH-NCDIEVRNRKWNQQPIHMACWDGHLEILKVLLEKNCDIESCDEWKRRPIHLACENGHTEIVKFLINLHCDIEAINDKAWR-PIHFGCWKGHSDIVKVLVEQNCD---IEACDHLKRRPIHLACEKGHTEIVKVLI 596
            P+H A +  +    ++LID     I        + P+H A +  H+E L++LL  N  + S D   + P+ +A ENG T  V+ L++       + D +    +H  C KGH     +++E+  D   I A +   + P+H+A   G T +V+ L+
Sbjct:  791 PLHCAVINDNEGAAEMLIDTLGASIVNATDSKGRTPLHAAAFTDHVECLQLLLSHNAQVNSVDSTGKTPLMMAAENGQTNTVEMLVSSASAELTLQDNSKNTALHLACSKGHETSALLILEKITDRNLINATNAALQTPLHVAARNGLTMVVQELL 946          

HSP 9 Score: 64.6994 bits (156), Expect = 5.034e-11
Identity = 49/227 (21.59%), Postives = 97/227 (42.73%), Query Frame = 3
Query:  138 RRPIHFACLKGDIDIVKVLIDHNCDIEVRNRKWNQQ---PIHMACWDGHLEILKVLLEK--------------NCDI--------------------ESCDEWKRRPIHLACENGHTEIVKFLINLHCDIEAINDKAWRPIHFGCWKGHSDIVKVLVEQ-NCDIEACDHLKRRPIHLACEKGHTEIVKVLIDHHCD---ISACGGRFNQSPIHLARKNNFTELIQLL 695
            R PIH +   G I ++  L+     ++      +      +H AC++GH   +++LLE+              +C +                     + D   R P+H A    H E ++ L++ +  + +++     P+      G ++ V++LV   + ++   D+ K   +HLAC KGH     ++++   D   I+A      Q+P+H+A +N  T ++Q L
Sbjct:  720 RTPIHLSAACGHIGVLGALLQSAASMDANPATADNHGYTALHWACYNGHETCVELLLEQEVFQKTEGNAFSPLHCAVINDNEGAAEMLIDTLGASIVNATDSKGRTPLHAAAFTDHVECLQLLLSHNAQVNSVDSTGKTPLMMAAENGQTNTVEMLVSSASAELTLQDNSKNTALHLACSKGHETSALLILEKITDRNLINATNAAL-QTPLHVAARNGLTMVVQEL 945          

HSP 10 Score: 58.9214 bits (141), Expect = 4.527e-9
Identity = 45/186 (24.19%), Postives = 85/186 (45.70%), Query Frame = 3
Query:  144 PIHFACLKGDIDI-VKVLIDHNCDIEVRNRKWNQQPIHMACWDGHLEILKVLLEKNCDIESCDEWKRRPIHLACENGHTEIVKFLINLHCDIEAINDKAWRPIHFGCWKGHSDIVKVLVEQNCDIEACDHLKRRPIHLACEKGHTEIVKVLIDHHCDISACGGRFNQSPIHLARKN-NFTELIQLL 695
            P+HFA       + +++L+ +  D+ ++++   + P+HM    G     + +++    I+  D+    P+H+A   GH  ++  LI    D          P+H     G SD  + L+    DI+  D   R  +H A   G+ E + +L++   D +    +F +SP+H A  N N+  L  L+
Sbjct:  275 PLHFAAASTHGALCLELLVGNGADVNMKSKD-GKTPLHMTALHGRFSRSQTIIQSGAVIDCEDKNGNTPLHIAARYGHELLINTLITSGADTAKRGIHGMFPLHLAALSGFSDCCRKLLSSGFDIDTPDDFGRTCLHAAAAGGNLECLNLLLNTGADFNK-KDKFGRSPLHYAAANCNYQCLFALV 458          

HSP 11 Score: 56.9954 bits (136), Expect = 1.809e-8
Identity = 47/199 (23.62%), Postives = 85/199 (42.71%), Query Frame = 3
Query:  138 RRPIHFACLKGDIDIVKVLIDHNCDIEVRNRKWNQQPIHMACW-DGHLEILKVLLEKNCDIESCDEWKRRPIHLACENGHTEIVKFLIN-LHCDI-----------EAINDKAWRPIHFGCWKGHSDIVKVLVEQNCDIEACDHLKRRPIHLACEKGHTEIVKVLIDHHCDISACGGRFNQSPIHLARKNNFTELIQLL 695
            R P+H+A    +   +  L+     +   + +    P+H A   D   + L+ LL  + +    D+     +H +   GH   ++ + +    D+           ++ N     P+H   + GH   ++VLV+   D++  +   R P+ LA  KGH E V VLI+    I        ++PIH A  N  +E ++LL
Sbjct:  439 RSPLHYAAANCNYQCLFALVGSGASVNDLDER-GCTPLHYAATSDTDGKCLEYLLRNDANPGIRDKQGYNAVHYSAAYGHRLCLQLIASETPLDVLMETSGTDMLSDSDNRATISPLHLAAYHGHHQALEVLVQSLLDLDVRNSSGRTPLDLAAFKGHVECVDVLINQGASILVKDYILKRTPIHAAATNGHSECLRLL 636          
BLAST of SMED30015660 vs. Ensembl Human
Match: ANKRD28 (ankyrin repeat domain 28 [Source:HGNC Symbol;Acc:HGNC:29024])

HSP 1 Score: 99.3673 bits (246), Expect = 1.094e-22
Identity = 55/187 (29.41%), Postives = 104/187 (55.61%), Query Frame = 3
Query:  138 RRPIHFACLKGDIDIVKVLIDHNCDIEVRNRKWNQQPIHMACWDGHLEILKVLLEKNCDIESCDEWKRRPIHLACENGHTEIVKFLINLHCDIEAINDKAWR-PIHFGCWKGHSDIVKVLVEQNCDIEACDHLKRRPIHLACEKGHTEIVKVLIDHHCDISACGGRFNQSPIHLARKNNFTELIQLL 695
            R P+H A   GD +I+++LI     +  ++ KW   P+H A      E ++VLL+ + D+ + D+  + P+H+A  N   +  + L+ L  ++  ++D+A R  +H   + GH ++VK+L+ +  +I A D   RR IH A   GH E+VK+L+ H  +++ C  + + +P+H A  +    +++ L
Sbjct:   42 RTPLHAAAYLGDAEIIELLILSGARVNAKDSKW-LTPLHRAVASCSEEAVQVLLKHSADVNARDKNWQTPLHIAAANKAVKCAEALVPLLSNVN-VSDRAGRTALHHAAFSGHGEMVKLLLSRGANINAFDKKDRRAIHWAAYMGHIEVVKLLVSHGAEVT-CKDKKSYTPLHAAASSGMISVVKYL 225          

HSP 2 Score: 93.5893 bits (231), Expect = 9.866e-21
Identity = 51/175 (29.14%), Postives = 91/175 (52.00%), Query Frame = 3
Query:  144 PIHFACLKGDIDIVKVLIDHNCDIEVRNRKWNQQPIHMACWDGHLEILKVLLEKNCDIESCDEWKRRPIHLACENGHTEIVKFLINLHCDIEAINDKAWRPIHFGCWKGHSDIVKVLVEQNCDIEACDHLKRRPIHLACEKGHTEIVKVLIDHHCDISACGGRFNQSPIHLARKN 668
            P+H A      + V+VL+ H+ D+  R++ W Q P+H+A  +  ++  + L+    ++   D   R  +H A  +GH E+VK L++   +I A + K  R IH+  + GH ++VK+LV    ++   D     P+H A   G   +VK L+D   D++     +  +P+H+A  N
Sbjct:   77 PLHRAVASCSEEAVQVLLKHSADVNARDKNW-QTPLHIAAANKAVKCAEALVPLLSNVNVSDRAGRTALHHAAFSGHGEMVKLLLSRGANINAFDKKDRRAIHWAAYMGHIEVVKLLVSHGAEVTCKDKKSYTPLHAAASSGMISVVKYLLDLGVDMNEPNA-YGNTPLHVACYN 249          

HSP 3 Score: 90.1225 bits (222), Expect = 1.763e-19
Identity = 51/188 (27.13%), Postives = 93/188 (49.47%), Query Frame = 3
Query:  135 DRRPIHFACLKGDIDIVKVLIDHNCDIEVRNRKWNQQPIHMACWDGHLEILKVLLEKNCDIESCDEWKRRPIHLACENGHTEIVKFLINLHCDIEAINDKAWRPIHFGCWKGHSDI-VKVLVEQNCDIEACDHLKRRPIHLACEKGHTEIVKVLIDHHCDISACGGRFNQSPIHLARKNNFTELIQLL 695
            DRR IH+A   G I++VK+L+ H  ++  +++K +  P+H A   G + ++K LL+   D+   + +   P+H+AC NG   +V  LI+    +   N+K + P+HF     H  + +++LV    D+       + P+H+    G     + +I     I  C  +   +P+H+A +     LI  L
Sbjct:  173 DRRAIHWAAYMGHIEVVKLLVSHGAEVTCKDKK-SYTPLHAAASSGMISVVKYLLDLGVDMNEPNAYGNTPLHVACYNGQDVVVNELIDCGAIVNQKNEKGFTPLHFAAASTHGALCLELLVGNGADVNMKSKDGKTPLHMTALHGRFSRSQTIIQSGAVID-CEDKNGNTPLHIAARYGHELLINTL 358          

HSP 4 Score: 78.9518 bits (193), Expect = 1.073e-15
Identity = 54/196 (27.55%), Postives = 89/196 (45.41%), Query Frame = 3
Query:  138 RRPIHFACLKGDIDIVKVLIDHNCDIEVRNRKWNQQPIHMACWDGHLEILKVLL---EKNCDIESCDEWKRRPIHLACENGHTEIVKFLINLHCDIEAINDKAWRPIHFGCWKGHSDIVKVLVEQNCDIEACDHLKRRPIHLACEKGHTEIVKVLIDHHCDIS---ACGGRFNQSPIHLARKNNFTELIQLLTIHE 707
            R P+  A  KG ++ V VLI+    I V++    + PIH A  +GH E L++L+   E    ++  D   + P+ L+  NGHT+ V  L+N   +++A +      +H G   GH + V  L++        D   R PIHL+   GH  ++  L+     +    A       + +H A  N     ++LL   E
Sbjct:  584 RTPLDLAAFKGHVECVDVLINQGASILVKDYILKRTPIHAAATNGHSECLRLLIGNAEPQNAVDIQDGNGQTPLMLSVLNGHTDCVYSLLNKGANVDAKDKWGRTALHRGAVTGHEECVDALLQHGAKCLLRDSRGRTPIHLSAACGHIGVLGALLQSAASMDANPATADNHGYTALHWACYNGHETCVELLLEQE 779          

HSP 5 Score: 78.1814 bits (191), Expect = 1.873e-15
Identity = 42/174 (24.14%), Postives = 90/174 (51.72%), Query Frame = 3
Query:  138 RRPIHFACLKGDIDIVKVLIDHNCDIEVRNRKWNQQPIHMACWDGHLEILKVLLEKNCDIESCDEWKRRPIHLACENGHTEIVKFLINLHCDIEAINDKAWRPIHFGCWKGHSDIVKVLVEQNCDIEACDHLKRRPIHLACEKGHTEI-VKVLIDHHCDISACGGRFNQSPIHL 656
            R  +H A   G  ++VK+L+    +I   ++K +++ IH A + GH+E++K+L+    ++   D+    P+H A  +G   +VK+L++L  D+   N     P+H  C+ G   +V  L++    +   +     P+H A    H  + +++L+ +  D++    +  ++P+H+
Sbjct:  141 RTALHHAAFSGHGEMVKLLLSRGANINAFDKK-DRRAIHWAAYMGHIEVVKLLVSHGAEVTCKDKKSYTPLHAAASSGMISVVKYLLDLGVDMNEPNAYGNTPLHVACYNGQDVVVNELIDCGAIVNQKNEKGFTPLHFAAASTHGALCLELLVGNGADVNM-KSKDGKTPLHM 312          

HSP 6 Score: 67.781 bits (164), Expect = 1.205e-12
Identity = 47/192 (24.48%), Postives = 86/192 (44.79%), Query Frame = 3
Query:  144 PIHFACLKGDIDIVKVLIDHNCDIEVRNRKWNQQPIHMACWDGHLEILKVLLEKNCDIESCDEWKRRPIHLACENGHTEIVKFLINLHCDIEA----INDKAWRPIHFGCWKGHSDIVKVLVEQNCDIEACDHLKRRPIHLACEKGHTEIVKVLIDH-HCDISACGGRFNQSPIHLARKNNFTELIQLLTIH 704
            P+  + L G  D V  L++   +++ ++ KW +  +H     GH E +  LL+        D   R PIHL+   GH  ++  L+     ++A     ++  +  +H+ C+ GH   V++L+EQ    +  +     P+H A    +    ++LID     I        ++P+H A   +  E +QLL  H
Sbjct:  656 PLMLSVLNGHTDCVYSLLNKGANVDAKD-KWGRTALHRGAVTGHEECVDALLQHGAKCLLRDSRGRTPIHLSAACGHIGVLGALLQSAASMDANPATADNHGYTALHWACYNGHETCVELLLEQEV-FQKTEGNAFSPLHCAVINDNEGAAEMLIDTLGASIVNATDSKGRTPLHAAAFTDHVECLQLLLSH 845          

HSP 7 Score: 24.2534 bits (51), Expect = 1.205e-12
Identity = 12/27 (44.44%), Postives = 15/27 (55.56%), Query Frame = 2
Query:    2 PIHLAFDNNHREIVKLLIEENCDVNAI 82
            PIH A  N H E ++LLI      NA+
Sbjct:  620 PIHAAATNGHSECLRLLIGNAEPQNAV 646          

HSP 8 Score: 65.855 bits (159), Expect = 1.997e-11
Identity = 43/156 (27.56%), Postives = 75/156 (48.08%), Query Frame = 3
Query:  144 PIHFACLKGDIDIVKVLIDH-NCDIEVRNRKWNQQPIHMACWDGHLEILKVLLEKNCDIESCDEWKRRPIHLACENGHTEIVKFLINLHCDIEAINDKAWR-PIHFGCWKGHSDIVKVLVEQNCD---IEACDHLKRRPIHLACEKGHTEIVKVLI 596
            P+H A +  +    ++LID     I        + P+H A +  H+E L++LL  N  + S D   + P+ +A ENG T  V+ L++       + D +    +H  C KGH     +++E+  D   I A +   + P+H+A   G T +V+ L+
Sbjct:  791 PLHCAVINDNEGAAEMLIDTLGASIVNATDSKGRTPLHAAAFTDHVECLQLLLSHNAQVNSVDSTGKTPLMMAAENGQTNTVEMLVSSASAELTLQDNSKNTALHLACSKGHETSALLILEKITDRNLINATNAALQTPLHVAARNGLTMVVQELL 946          

HSP 9 Score: 64.6994 bits (156), Expect = 5.034e-11
Identity = 49/227 (21.59%), Postives = 97/227 (42.73%), Query Frame = 3
Query:  138 RRPIHFACLKGDIDIVKVLIDHNCDIEVRNRKWNQQ---PIHMACWDGHLEILKVLLEK--------------NCDI--------------------ESCDEWKRRPIHLACENGHTEIVKFLINLHCDIEAINDKAWRPIHFGCWKGHSDIVKVLVEQ-NCDIEACDHLKRRPIHLACEKGHTEIVKVLIDHHCD---ISACGGRFNQSPIHLARKNNFTELIQLL 695
            R PIH +   G I ++  L+     ++      +      +H AC++GH   +++LLE+              +C +                     + D   R P+H A    H E ++ L++ +  + +++     P+      G ++ V++LV   + ++   D+ K   +HLAC KGH     ++++   D   I+A      Q+P+H+A +N  T ++Q L
Sbjct:  720 RTPIHLSAACGHIGVLGALLQSAASMDANPATADNHGYTALHWACYNGHETCVELLLEQEVFQKTEGNAFSPLHCAVINDNEGAAEMLIDTLGASIVNATDSKGRTPLHAAAFTDHVECLQLLLSHNAQVNSVDSTGKTPLMMAAENGQTNTVEMLVSSASAELTLQDNSKNTALHLACSKGHETSALLILEKITDRNLINATNAAL-QTPLHVAARNGLTMVVQEL 945          

HSP 10 Score: 58.9214 bits (141), Expect = 4.527e-9
Identity = 45/186 (24.19%), Postives = 85/186 (45.70%), Query Frame = 3
Query:  144 PIHFACLKGDIDI-VKVLIDHNCDIEVRNRKWNQQPIHMACWDGHLEILKVLLEKNCDIESCDEWKRRPIHLACENGHTEIVKFLINLHCDIEAINDKAWRPIHFGCWKGHSDIVKVLVEQNCDIEACDHLKRRPIHLACEKGHTEIVKVLIDHHCDISACGGRFNQSPIHLARKN-NFTELIQLL 695
            P+HFA       + +++L+ +  D+ ++++   + P+HM    G     + +++    I+  D+    P+H+A   GH  ++  LI    D          P+H     G SD  + L+    DI+  D   R  +H A   G+ E + +L++   D +    +F +SP+H A  N N+  L  L+
Sbjct:  275 PLHFAAASTHGALCLELLVGNGADVNMKSKD-GKTPLHMTALHGRFSRSQTIIQSGAVIDCEDKNGNTPLHIAARYGHELLINTLITSGADTAKRGIHGMFPLHLAALSGFSDCCRKLLSSGFDIDTPDDFGRTCLHAAAAGGNLECLNLLLNTGADFNK-KDKFGRSPLHYAAANCNYQCLFALV 458          

HSP 11 Score: 56.9954 bits (136), Expect = 1.809e-8
Identity = 47/199 (23.62%), Postives = 85/199 (42.71%), Query Frame = 3
Query:  138 RRPIHFACLKGDIDIVKVLIDHNCDIEVRNRKWNQQPIHMACW-DGHLEILKVLLEKNCDIESCDEWKRRPIHLACENGHTEIVKFLIN-LHCDI-----------EAINDKAWRPIHFGCWKGHSDIVKVLVEQNCDIEACDHLKRRPIHLACEKGHTEIVKVLIDHHCDISACGGRFNQSPIHLARKNNFTELIQLL 695
            R P+H+A    +   +  L+     +   + +    P+H A   D   + L+ LL  + +    D+     +H +   GH   ++ + +    D+           ++ N     P+H   + GH   ++VLV+   D++  +   R P+ LA  KGH E V VLI+    I        ++PIH A  N  +E ++LL
Sbjct:  439 RSPLHYAAANCNYQCLFALVGSGASVNDLDER-GCTPLHYAATSDTDGKCLEYLLRNDANPGIRDKQGYNAVHYSAAYGHRLCLQLIASETPLDVLMETSGTDMLSDSDNRATISPLHLAAYHGHHQALEVLVQSLLDLDVRNSSGRTPLDLAAFKGHVECVDVLINQGASILVKDYILKRTPIHAAATNGHSECLRLL 636          
BLAST of SMED30015660 vs. Ensembl Human
Match: ANKK1 (ankyrin repeat and kinase domain containing 1 [Source:HGNC Symbol;Acc:HGNC:21027])

HSP 1 Score: 98.5969 bits (244), Expect = 1.780e-22
Identity = 54/216 (25.00%), Postives = 100/216 (46.30%), Query Frame = 3
Query:  144 PIHFACLKGDIDIVKVLIDHNCDIEVRNRK-WN-------------------------------QQPIHMACWDGHLEILKVLLEKNCDIESCDEWKRRPIHLACENGHTEIVKFLINLHCDIEAINDKAWRPIHFGCWKGHSDIVKVLVEQNCDIEACDHLKRRPIHLACEKGHTEIVKVLIDHHCDISACGGRFNQSPIHLARKNNFTELIQLL 695
            P+HFA   GD    ++L+DH   ++ + R+ W                                + P+H+A + GH+ ++K+L  +  ++++     R P+HLA E G    ++ L+      +A++   + P+H    +G   I K+L+     +E   H    P+HLA  KGH EI+ +L + H ++ A G   N +P+HLA ++    ++  L
Sbjct:  431 PLHFAAQNGDDGTARLLLDHGACVDAQEREGWTPLHLAAQNNFENVARLLVSRQADPNLHEAEGKTPLHVAAYFGHVSLVKLLTSQGAELDAQQRNLRTPLHLAVERGKVRAIQHLLKSGAVPDALDQSGYGPLHTAAARGKYLICKMLLRYGASLELPTHQGWTPLHLAAYKGHLEIIHLLAESHANMGALGA-VNWTPLHLAARHGEEAVVSAL 645          

HSP 2 Score: 95.5153 bits (236), Expect = 8.466e-22
Identity = 51/190 (26.84%), Postives = 94/190 (49.47%), Query Frame = 3
Query:  138 RRPIHFACLKGDIDIVKVLIDHNCDIEVRNRKWNQQPIHMACWDGHLEILKVLLEKNCDIESCDEWKRRPIHLACENGHTEIVKFLINLHCDIEAINDKAWRPIHFGCWKGHSDIVKVLVEQNCDIEACDHLKRRPIHLACEKGHTEIVKVLIDHHCDISACGGRFNQSPIHLA-RKNNFTELIQLLTIH 704
            + P+H A   G + +VK+L     +++ + R   + P+H+A   G +  ++ LL+     ++ D+    P+H A   G   I K L+     +E    + W P+H   +KGH +I+ +L E + ++ A   +   P+HLA   G   +V  L+    D +A   +   +P+HLA +++ F  +I LL  H
Sbjct:  495 KTPLHVAAYFGHVSLVKLLTSQGAELDAQQRNL-RTPLHLAVERGKVRAIQHLLKSGAVPDALDQSGYGPLHTAAARGKYLICKMLLRYGASLELPTHQGWTPLHLAAYKGHLEIIHLLAESHANMGALGAVNWTPLHLAARHGEEAVVSALLQCGADPNAA-EQSGWTPLHLAVQRSTFLSVINLLEHH 682          

HSP 3 Score: 27.335 bits (59), Expect = 8.466e-22
Identity = 10/25 (40.00%), Postives = 14/25 (56.00%), Query Frame = 2
Query:    2 PIHLAFDNNHREIVKLLIEENCDVN 76
            P+HLA  NN   + +LL+    D N
Sbjct:  464 PLHLAAQNNFENVARLLVSRQADPN 488          

HSP 4 Score: 89.7373 bits (221), Expect = 2.203e-19
Identity = 51/185 (27.57%), Postives = 92/185 (49.73%), Query Frame = 3
Query:  144 PIHFACLKGDIDIVKVLIDHNCDIEVRN-RKWNQQPIHMACWDGHLEILKVLLEKNCDIESCDEWKRRPIHLACENGHTEIVKFLINLHCDIEAINDKAWRPIHFGCWKGHSDIVKVLVEQNCDIEACDHLKRRPIHLACEKGHTEIVKVLIDHHCDISACGGRFNQSPIHLARKNNFTELIQLL 695
            P+H A  +G   I K+L+ +   +E+   + W   P+H+A + GHLEI+ +L E + ++ +       P+HLA  +G   +V  L+    D  A     W P+H    +     V  L+E + ++ A + +   P HLA  KG+T I+KVL++    +    G  + +P+ LA ++    ++  L
Sbjct:  563 PLHTAAARGKYLICKMLLRYGASLELPTHQGWT--PLHLAAYKGHLEIIHLLAESHANMGALGAVNWTPLHLAARHGEEAVVSALLQCGADPNAAEQSGWTPLHLAVQRSTFLSVINLLEHHANVHARNKVGWTPAHLAALKGNTAILKVLVEAGAQLDVQDG-VSCTPLQLALRSRKQGIMSFL 744          

HSP 5 Score: 84.3445 bits (207), Expect = 1.282e-17
Identity = 45/182 (24.73%), Postives = 86/182 (47.25%), Query Frame = 3
Query:  144 PIHFACLKGDIDIVKVLIDHNCDIEVRNRKWNQQPIHMACWDGHLEILKVLLEKNCDIESCDEWKRRPIHLACENGHTEIVKFLINLHCDIEAINDKAWRPIHFGCWKGHSDIVKVLVEQNCDIEACDHLKRRPIHLACEKGHTEIVKVLIDHHCDISACGGRFNQSPIHLARKNNFTELIQ 689
            P+HF   +G ++ V++L+ H  D++ +       P+ +A  D   ++  +LL    D    DE    P+H A +NG     + L++    ++A   + W P+H        ++ ++LV +  D    +   + P+H+A   GH  +VK+L     ++ A   R  ++P+HLA +      IQ
Sbjct:  365 PLHFLVAQGSVEQVRLLLAHEVDVDCQTAS-GYTPLLIAAQDQQPDLCALLLAHGADANRVDEDGWAPLHFAAQNGDDGTARLLLDHGACVDAQEREGWTPLHLAAQNNFENVARLLVSRQADPNLHEAEGKTPLHVAAYFGHVSLVKLLTSQGAELDA-QQRNLRTPLHLAVERGKVRAIQ 544          

HSP 6 Score: 55.8398 bits (133), Expect = 3.784e-8
Identity = 32/122 (26.23%), Postives = 53/122 (43.44%), Query Frame = 3
Query:  330 EWKRRPIHLACENGHTEIVKFLINLHCDIEAINDKAWRPIHFGCWKGHSDIVKVLVEQNCDIEACDHLKRRPIHLACEKGHTEIVKVLIDHHCDISACGGRFNQSPIHLARKNNFTELIQLL 695
            E K  P+H     G  E V+ L+    D++      + P+         D+  +L+    D    D     P+H A + G     ++L+DH   + A   R   +P+HLA +NNF  + +LL
Sbjct:  360 ENKVTPLHFLVAQGSVEQVRLLLAHEVDVDCQTASGYTPLLIAAQDQQPDLCALLLAHGADANRVDEDGWAPLHFAAQNGDDGTARLLLDHGACVDA-QEREGWTPLHLAAQNNFENVARLL 480          
BLAST of SMED30015660 vs. Ensembl Celegans
Match: trp-4 (TRP (Transient receptor potential) channel family [Source:UniProtKB/TrEMBL;Acc:Q9GRV5])

HSP 1 Score: 92.8189 bits (229), Expect = 7.990e-21
Identity = 43/157 (27.39%), Postives = 80/157 (50.96%), Query Frame = 3
Query:  144 PIHFACLKGDIDIVKVLIDHNCDIEVRNRKWNQQPIHMACWDGHLEILKVLLEKNCDIESCDEWK-RRPIHLACENGHTEIVKFLINLHCDIEAINDKAWRPIHFGCWKGHSDIVKVLVEQNCDIEACDHLKRRPIHLACEKGHTEIVKVLIDHHCD 611
            P+H A   G   +V++L++    ++  +   N  P+H+A   GH+ ++ +LL ++   +   +W+ R P+HLA +NGH E+V  LI    +I  ++   W  +HF    GH  +VK+ ++ + D  A     + P+  A    H E ++ L+    D
Sbjct: 1208 PLHLAAQSGHDSLVRMLLNQGVQVDATSTTMNVIPLHLAAQQGHIAVVGMLLSRSTQQQHAKDWRGRTPLHLAAQNGHYEMVSLLIAQGSNINVMDQNGWTGLHFATRAGHLSVVKLFIDSSADPLAETKEGKVPLCFAAAHNHIECLRFLLKQKHD 1364          

HSP 2 Score: 75.8702 bits (185), Expect = 3.491e-15
Identity = 54/231 (23.38%), Postives = 100/231 (43.29%), Query Frame = 3
Query:  150 HFACLKGDIDIVK--VLIDHNCDIEVRNRKWNQQPIHMACWDGHLEILKVLLEKNCD-----------------------IESCDE--WKR-------RPIHLACENGHTEIVKFLI--------------NLHCDIEAINDKAWRPIHFGCWKGHSDIVKVLVEQNCDIEACD-HLKRRPIHLACEKGHTEIVKVLIDHHCDISACGGRFNQSPIHLARKNNFTELIQLL 695
            H A +KG + +V+  ++ID    I+ + +      +HMA   GH  I+K+LLE   +                       +E+ D+  WKR         +H+A   G+++ V  ++              N H + E   +  + P+H     GH  +V++L+ Q   ++A    +   P+HLA ++GH  +V +L+              ++P+HLA +N   E++ LL
Sbjct: 1062 HIAAMKGSLAVVRELMMIDKPMVIQAKTKTLEATTLHMAAAGGHANIVKILLENGANAEDENSHGMTALHLGAKNGFISILEAFDKILWKRCSRKTGLNALHIAAFYGNSDFVNEMLKHVQATVRSEPPIYNHHVNKEFSTEYGFTPLHLAAQSGHDSLVRMLLNQGVQVDATSTTMNVIPLHLAAQQGHIAVVGMLLSRSTQQQHAKDWRGRTPLHLAAQNGHYEMVSLL 1292          

HSP 3 Score: 23.483 bits (49), Expect = 3.491e-15
Identity = 8/19 (42.11%), Postives = 15/19 (78.95%), Query Frame = 2
Query:    2 PIHLAFDNNHREIVKLLIE 58
            P+HLA +N+  ++VKL ++
Sbjct: 1023 PLHLAAENDFPDVVKLFLK 1041          

HSP 4 Score: 75.0998 bits (183), Expect = 7.572e-15
Identity = 46/185 (24.86%), Postives = 86/185 (46.49%), Query Frame = 3
Query:  135 DRRPIHFACLKGDIDIVKVLIDHNCDIEVRNRKWNQQPIHMACWDGHLEILKVLLEKNC--------DIESCDEWKRRPIHLACENGHTEIVKFLINLHCDIEAINDKAWRPIHFGCWKGHSDIVKVLVEQNCDIEACDHLKRRPIHLACEKGHTEIVKVLIDHHCDISACGGRFNQSPIHLARK 665
            ++R +HF     D  +V +LID+   +E+ +   N+  +HMA   G+  +L  ++ K          + +S + W   P+  AC  GH+ +   L+  H  I+  ++     +H   + GH  +V +L++    + +       P+HLA + GH ++V VL+  H          NQ+ +H A K
Sbjct:  816 EQRQLHFP--GEDAKLVNLLIDYGGMVEMPSLNANETAMHMAARSGNQAVLLAMVNKIGAGAVQIVQNKQSKNGWS--PLLEACARGHSGVANILLKHHARIDVFDEMGRTALHLAAFNGHLSLVHLLLQHKAFVNSKSKTGEAPLHLAAQHGHVKVVNVLVQDHGAALEAITLDNQTALHFAAK 996          

HSP 5 Score: 70.4774 bits (171), Expect = 2.622e-13
Identity = 49/190 (25.79%), Postives = 92/190 (48.42%), Query Frame = 3
Query:  144 PIHFACLKGDIDIVKVLI-DHNCDIEVRNRKWNQQPIHMACWDGHLEILKVLLEKNCDIESCDEWKRRPIHLACENGHTEIVKFLINLHCD----IEAINDKAWRPIHFGCWKGHSDIVK--VLVEQNCDIEA-CDHLKRRPIHLACEKGHTEIVKVLIDHHCDISACGGRFNQSPIHLARKNNFTELIQ 689
            P+H A   G + +V VL+ DH   +E      NQ  +H A   G L + + LL    +  + D+  + P+HLA EN   ++VK  + +  +    + AI+   +   H    KG   +V+  +++++   I+A    L+   +H+A   GH  IVK+L+++  + +        + +HL  KN F  +++
Sbjct:  956 PLHLAAQHGHVKVVNVLVQDHGAALEAITLD-NQTALHFAAKFGQLAVSQTLLALGANPNARDDKGQTPLHLAAENDFPDVVKLFLKMRNNNRSVLTAIDHNGFTCAHIAAMKGSLAVVRELMMIDKPMVIQAKTKTLEATTLHMAAAGGHANIVKILLENGAN-AEDENSHGMTALHLGAKNGFISILE 1143          

HSP 6 Score: 67.0106 bits (162), Expect = 2.158e-12
Identity = 52/213 (24.41%), Postives = 89/213 (41.78%), Query Frame = 3
Query:  147 IHFACLKGDIDIVKVLIDHNCD-IEVRNRKWNQQPIHMACWDGHLEILKVLLEKNCDIESCDEWKRRPIHLACENGHTEIVKFLIN----------------LH---CD---------------IEAINDKAWRPIHFGCWKGHSDIVKVLVEQNCDIEACDHLKRRPIHLACEKGHTEIVKVLIDHHCDISACGGRFNQSPIHLARKNNFTE 680
            +H A   G+I+ V+  I   CD   V+NR   + P+H     G   +LK++ +   D    D+  + P+H+A E G T +V+ LI+                LH   C                +   N K    +H     G +D+VK+L+ +  +++         +H+A + G   +V+ L+    DI   GG   Q+ +H+A   N  E
Sbjct:  496 LHLAARSGNIEAVRTAIAAGCDNANVQNRV-GRTPLHEVAEVGDQNMLKIMFKLRADANIHDKEDKTPVHVAAERGDTSMVESLIDKFGGSIRARTRDGSTLLHIAACSGHTSTALAFLKRGVPLFMPNKKGALGLHSAAAAGFNDVVKMLIARGTNVDVRTRDNYTALHVAVQSGKASVVETLLGSGADIHVKGGELGQTALHIAASLNGAE 707          

HSP 7 Score: 23.0978 bits (48), Expect = 2.158e-12
Identity = 11/23 (47.83%), Postives = 14/23 (60.87%), Query Frame = 2
Query:    2 PIHLAFDNNHREIVKLLIEENCD 70
            PIHLAF   +  IV+LL+    D
Sbjct:  460 PIHLAFKFGNVNIVELLLSGPSD 482          

HSP 8 Score: 60.077 bits (144), Expect = 8.169e-10
Identity = 50/194 (25.77%), Postives = 87/194 (44.85%), Query Frame = 3
Query:   69 TLTQLGGK--YICL*IETFYYF*WDR-------RPIHFACLKGDIDIVKVLIDHNCDIEVRNRKWNQQPIHMACWDGHLEILKVLLEKNCDIESCDEWKRRPIHLACENGHTEIVKFLINLHCDIEAINDKA-WRPIHFGCWKGHSDIVKVLVEQNCDIE-ACDHLKRRPIHLACEKGHTEIVKVLIDHHCDIS 617
            T   LG K  +I + +E F    W R         +H A   G+ D V  ++ H     V+    ++ PI+                 + + E   E+   P+HLA ++GH  +V+ L+N    ++A +      P+H    +GH  +V +L+ ++   + A D   R P+HLA + GH E+V +LI    +I+
Sbjct: 1128 TALHLGAKNGFISI-LEAFDKILWKRCSRKTGLNALHIAAFYGNSDFVNEMLKH-----VQATVRSEPPIY---------------NHHVNKEFSTEYGFTPLHLAAQSGHDSLVRMLLNQGVQVDATSTTMNVIPLHLAAQQGHIAVVGMLLSRSTQQQHAKDWRGRTPLHLAAQNGHYEMVSLLIAQGSNIN 1300          
BLAST of SMED30015660 vs. Ensembl Celegans
Match: unc-44 (AO49 ankyrin [Source:UniProtKB/TrEMBL;Acc:Q7JP86])

HSP 1 Score: 84.3445 bits (207), Expect = 5.583e-18
Identity = 51/187 (27.27%), Postives = 94/187 (50.27%), Query Frame = 3
Query:  144 PIHFACLKGDIDIVKVLIDHNCDIEVRNRKWNQQPIHMACWDGHLEILKVLLEKNCDIESCDEWKRRPIHLACENGHTEIVKFLINLHCDIEAINDKAWRPIHFGCWKGHSDIVKVLVEQNCDIEACDHLKRRPIHLACEKGHTEIVKVLIDHHCDISACGGRFNQSPIHLARKNNFTELIQLLTIH 704
            P+H A   G + + K+L+D + D   R       P+H+AC    ++++++LL+    IE+  E    P+H+A   G   IV +L+    + +    +   P+H       +D+V+VL+     ++A     + P+H+A   G+T+IV +L+    + +A   R N SP+H+A K    E+  +L  H
Sbjct:  362 PLHVAAHCGHVRVAKLLLDRSADPNSRALN-GFTPLHIACKKNRIKVVELLLKYRAAIEATTESGLTPLHVAAFMGAINIVIYLLQQGANPDVETVRGETPLHLAARANQTDVVRVLIRNGAKVDAQARELQTPLHIASRLGNTDIVILLLQAGANSNAT-TRDNYSPLHIAAKEGQEEVAGILLDH 546          

HSP 2 Score: 83.1889 bits (204), Expect = 1.743e-17
Identity = 47/186 (25.27%), Postives = 94/186 (50.54%), Query Frame = 3
Query:  144 PIHFACLKGDIDIVKVLIDHNCDIEVRNRKWNQQPIHMACWDGHLEILKVLLEKNCDIESCDEWKRRPIHLACENGHTEIVKFLINLHCDIEAINDKAWRPIHFGCWKGHSDIVKVLVEQNCDIEACDHLKRRPIHLACEKGHTEIVKVLIDHHCDISACGGRFNQ--SPIHLARKNNFTELIQLL 695
            P+H A  +G  ++  +L+DHN D  +  +K    P+H+A   G+LE++++LLE+   ++   + +  P+H+A    + ++   L+      +A     + P+H    K   +I   L++   D  A       P+HL+ ++GH EI  +LI++  D+   G + N   + +HL  + +   + Q+L
Sbjct:  527 PLHIAAKEGQEEVAGILLDHNADKTLLTKK-GFTPLHLASKYGNLEVVRLLLERGTPVDIEGKNQVTPLHVAAHYNNDKVAMLLLENGASAKAAAKNGYTPLHIAAKKNQMEIASTLLQFKADPNAKSRAGFTPLHLSAQEGHKEISGLLIENGSDV---GAKANNGLTAMHLCAQEDHVPVAQIL 708          

HSP 3 Score: 82.8037 bits (203), Expect = 1.967e-17
Identity = 46/187 (24.60%), Postives = 90/187 (48.13%), Query Frame = 3
Query:  144 PIHFACLKGDIDIVKVLIDHNCDIEVRNRKWNQQPIHMACWDGHLEILKVLLEKNCDIESCDEWKRRPIHLACENGHTEIVKFLINLHCDIEAINDKAWRPIHFGCWKGHSDIVKVLVEQNCDIEACDHLKRRPIHLACEKGHTEIVKVLIDHHC---DISACGGRFNQSPIHLARKNNFTELIQLL 695
            P+H A  K  ++I   L+    D   ++R     P+H++  +GH EI  +L+E   D+ +        +HL  +  H  + + L N   +I +  +  + P+H  C  G  ++VK LVE   D+         P+H A ++GH   V+ L+++     + +A G    Q+P+ +A++  +  +++ L
Sbjct:  626 PLHIAAKKNQMEIASTLLQFKADPNAKSRA-GFTPLHLSAQEGHKEISGLLIENGSDVGAKANNGLTAMHLCAQEDHVPVAQILYNNGAEINSKTNAGYTPLHVACHFGQLNMVKFLVENGADVGEKTRASYTPLHQAAQQGHNNCVRYLLENGASPNEQTATG----QTPLSIAQRLGYVSVVETL 807          

HSP 4 Score: 80.4925 bits (197), Expect = 1.221e-16
Identity = 46/186 (24.73%), Postives = 96/186 (51.61%), Query Frame = 3
Query:  144 PIHFACLKGDIDIVKVLIDHNCDIEVRNRKWNQQPIHMACWDGHLEILKVLLEKNCDIESCDEWKRRPIHLACENGHTEIVKFLINLHCDIEAINDKAWRPIHFGCWKGHSDIVKVLVEQN--CDIEACDHLKRRPIHLACEKGHTEIVKVLIDHHCDISACGGRFNQSPIHLARKNNFTELIQLL 695
            P+H A      D+V+VLI +   ++ + R+  Q P+H+A   G+ +I+ +LL+   +  +       P+H+A + G  E+   L++ + D   +  K + P+H     G+ ++V++L+E+    DIE  + +   P+H+A    + ++  +L+++     A   +   +P+H+A K N  E+   L
Sbjct:  461 PLHLAARANQTDVVRVLIRNGAKVDAQAREL-QTPLHIASRLGNTDIVILLLQAGANSNATTRDNYSPLHIAAKEGQEEVAGILLDHNADKTLLTKKGFTPLHLASKYGNLEVVRLLLERGTPVDIEGKNQVT--PLHVAAHYNNDKVAMLLLENGASAKA-AAKNGYTPLHIAAKKNQMEIASTL 642          

HSP 5 Score: 79.337 bits (194), Expect = 2.536e-16
Identity = 44/184 (23.91%), Postives = 91/184 (49.46%), Query Frame = 3
Query:  144 PIHFACLKGDIDIVKVLIDHNCDIEVRNRKWNQQPIHMACWDGHLEILKVLLEKNCDIESCDEWKRRPIHLACENGHTEIVKFLINLHCDIEAINDKAWRPIHFGCWKGHSDIVKVLVEQNCDIEACDHLKRRPIHLACEKGHTEIVKVLIDHHCDISACGGRFNQSPIHLARKNNFTELIQLL 695
            P+H A   G I+IV  L+    + +V   +  + P+H+A      ++++VL+     +++     + P+H+A   G+T+IV  L+    +  A     + P+H    +G  ++  +L++ N D          P+HLA + G+ E+V++L++    +    G+   +P+H+A   N  ++  LL
Sbjct:  428 PLHVAAFMGAINIVIYLLQQGANPDVETVR-GETPLHLAARANQTDVVRVLIRNGAKVDAQARELQTPLHIASRLGNTDIVILLLQAGANSNATTRDNYSPLHIAAKEGQEEVAGILLDHNADKTLLTKKGFTPLHLASKYGNLEVVRLLLERGTPVD-IEGKNQVTPLHVAAHYNNDKVAMLL 609          

HSP 6 Score: 23.8682 bits (50), Expect = 2.536e-16
Identity = 9/26 (34.62%), Postives = 16/26 (61.54%), Query Frame = 2
Query:    2 PIHLAFDNNHREIVKLLIEENCDVNA 79
            P+H+A    H  + KLL++ + D N+
Sbjct:  362 PLHVAAHCGHVRVAKLLLDRSADPNS 387          

HSP 7 Score: 75.485 bits (184), Expect = 5.803e-15
Identity = 47/186 (25.27%), Postives = 86/186 (46.24%), Query Frame = 3
Query:  144 PIHFACLKGDIDIVKVLIDHNCDIEVRNRKWNQQPIHMACWDGHLEILKVLLEKNCDIESCDEWKRRPIHLACENGHTEIVKFLINLHCDIEAINDKAWRPIHFGCWKGHSDIVKVLVEQNCDIEACDHLKRRPIHLACEKGHTEIVKVLIDH--HCDISACGGRFNQSPIHLARKNNFTELIQLL 695
            P+H A   G   +V +L+     I  + +     P+HMA    H++  + LL     ++        P+H+A   GH  + K L++   D  +     + P+H  C K    +V++L++    IEA       P+H+A   G   IV  L+    + D+    G   ++P+HLA + N T+++++L
Sbjct:  296 PLHCAARSGHDQVVDLLVVQGAPISAKTKN-GLAPLHMAAQGDHVDAARTLLYHRAPVDDVTVDYLTPLHVAAHCGHVRVAKLLLDRSADPNSRALNGFTPLHIACKKNRIKVVELLLKYRAAIEATTESGLTPLHVAAFMGAINIVIYLLQQGANPDVETVRG---ETPLHLAARANQTDVVRVL 477          

HSP 8 Score: 70.4774 bits (171), Expect = 2.909e-13
Identity = 48/216 (22.22%), Postives = 90/216 (41.67%), Query Frame = 3
Query:  144 PIHFACLKGDIDIVKVLIDHN--CDIEVRNR------------------------------KWNQQPIHMACWDGHLEILKVLLEKNCDIESCDEWKRRPIHLACENGHTEIVKFLINLHCDIEAINDKAWRPIHFGCWKGHSDIVKVLVEQNCDIEACDHLKRRPIHLACEKGHTEIVKVLIDHHCDISACGGRFNQSPIHLARKNNFTELIQLL 695
            P+H A   G++++V++L++     DIE +N+                              K    P+H+A     +EI   LL+   D  +       P+HL+ + GH EI   LI    D+ A  +     +H    + H  + ++L     +I +  +    P+H+AC  G   +VK L+++  D+     R + +P+H A +      ++ L
Sbjct:  560 PLHLASKYGNLEVVRLLLERGTPVDIEGKNQVTPLHVAAHYNNDKVAMLLLENGASAKAAAKNGYTPLHIAAKKNQMEIASTLLQFKADPNAKSRAGFTPLHLSAQEGHKEISGLLIENGSDVGAKANNGLTAMHLCAQEDHVPVAQILYNNGAEINSKTNAGYTPLHVACHFGQLNMVKFLVENGADVGE-KTRASYTPLHQAAQQGHNNCVRYL 774          

HSP 9 Score: 67.3958 bits (163), Expect = 8.200e-13
Identity = 46/185 (24.86%), Postives = 82/185 (44.32%), Query Frame = 3
Query:  147 IHFACLKGDIDIVKVLI--DHNCDIEVRNRKWNQQPIHMACWDGHLEILKVLLEKNCDIESCDEWKRRPIHLACENGHTEIVKFLINLHCDIEAINDKAWRPIHFGCWKGHSDIVKVLVEQNCDIEACDHLKRRPIHLACEKGHTEIVKVLIDHHCDISACGGRFNQSPIHLARKNNFTELIQLL 695
            +H A  K D     +L+  +HN D+     K    P+H+A   GH  + ++LLEK  ++         P+H+A + G T +   L++    I++       P+H     GH  +V +LV Q   I A       P+H+A +  H +  + L+ H   +      +  +P+H+A       + +LL
Sbjct:  198 LHIAAKKDDTTAATLLLQNEHNPDV---TSKSGFTPLHIAAHYGHENVGQLLLEKGANVNYQARHNISPLHVATKWGRTNMANLLLSRGAIIDSRTKDLLTPLHCAARSGHDQVVDLLVVQGAPISAKTKNGLAPLHMAAQGDHVDAARTLLYHRAPVDDVTVDY-LTPLHVAAHCGHVRVAKLL 378          

HSP 10 Score: 24.2534 bits (51), Expect = 8.200e-13
Identity = 8/23 (34.78%), Postives = 15/23 (65.22%), Query Frame = 2
Query:    2 PIHLAFDNNHREIVKLLIEENCD 70
            P+++A   NH E+VK L++   +
Sbjct:  135 PLYMAAQENHEEVVKYLLKHGAN 157          

HSP 11 Score: 62.3882 bits (150), Expect = 1.283e-10
Identity = 34/111 (30.63%), Postives = 55/111 (49.55%), Query Frame = 3
Query:  270 GHLEILKVLLEKNCDIESCDEWKRRPIHLACENGHTEIVKFLINLHCDIEAINDKAWRPIHFGCWKGHSDIVKVLVEQNCDIEACDHLKRRPIHLACEKGHTEIVKVLIDH 602
            G LE +  LL    DI + +      +HLA + GH+E+V+ LI     ++A   K    +H     G S IV +LVE   ++         P+++A ++ H E+VK L+ H
Sbjct:   44 GDLEKVLELLRAGTDINTSNANGLNSLHLASKEGHSEVVRELIKRQAQVDAATRKGNTALHIASLAGQSLIVTILVENGANVNVQSVNGFTPLYMAAQENHEEVVKYLLKH 154          

HSP 12 Score: 61.2326 bits (147), Expect = 3.275e-10
Identity = 40/184 (21.74%), Postives = 84/184 (45.65%), Query Frame = 3
Query:  156 ACLKGDIDIVKVLIDHNCDIEVRNRKWNQQPIHMACWDGHLEILKVLLEKNCDIESCDEWKRRPIHLACENGHTEIVKFLINLHCDIEAINDKAWRPIHFGCWKGHSDIVKVLVEQNCDIEACDHLKRRPIHLACEKGHTEIVKVLIDHHCDISACGGRFNQSPIHLARKNNFTELIQLLTIHE 707
            A   GD++ V  L+    DI   N       +H+A  +GH E+++ L+++   +++        +H+A   G + IV  L+    ++   +   + P++    + H ++VK L++   +          P+ +A ++GH  +V VL+++        G+     +H+A K + T    LL  +E
Sbjct:   40 AARAGDLEKVLELLRAGTDINTSNAN-GLNSLHLASKEGHSEVVRELIKRQAQVDAATRKGNTALHIASLAGQSLIVTILVENGANVNVQSVNGFTPLYMAAQENHEEVVKYLLKHGANQALSTEDGFTPLAVALQQGHDRVVAVLLENDSK-----GKVRLPALHIAAKKDDTTAATLLLQNE 217          
BLAST of SMED30015660 vs. Ensembl Celegans
Match: unc-44 (AO49 ankyrin [Source:UniProtKB/TrEMBL;Acc:Q7JP86])

HSP 1 Score: 84.3445 bits (207), Expect = 5.583e-18
Identity = 51/187 (27.27%), Postives = 94/187 (50.27%), Query Frame = 3
Query:  144 PIHFACLKGDIDIVKVLIDHNCDIEVRNRKWNQQPIHMACWDGHLEILKVLLEKNCDIESCDEWKRRPIHLACENGHTEIVKFLINLHCDIEAINDKAWRPIHFGCWKGHSDIVKVLVEQNCDIEACDHLKRRPIHLACEKGHTEIVKVLIDHHCDISACGGRFNQSPIHLARKNNFTELIQLLTIH 704
            P+H A   G + + K+L+D + D   R       P+H+AC    ++++++LL+    IE+  E    P+H+A   G   IV +L+    + +    +   P+H       +D+V+VL+     ++A     + P+H+A   G+T+IV +L+    + +A   R N SP+H+A K    E+  +L  H
Sbjct:  362 PLHVAAHCGHVRVAKLLLDRSADPNSRALN-GFTPLHIACKKNRIKVVELLLKYRAAIEATTESGLTPLHVAAFMGAINIVIYLLQQGANPDVETVRGETPLHLAARANQTDVVRVLIRNGAKVDAQARELQTPLHIASRLGNTDIVILLLQAGANSNAT-TRDNYSPLHIAAKEGQEEVAGILLDH 546          

HSP 2 Score: 83.1889 bits (204), Expect = 1.743e-17
Identity = 47/186 (25.27%), Postives = 94/186 (50.54%), Query Frame = 3
Query:  144 PIHFACLKGDIDIVKVLIDHNCDIEVRNRKWNQQPIHMACWDGHLEILKVLLEKNCDIESCDEWKRRPIHLACENGHTEIVKFLINLHCDIEAINDKAWRPIHFGCWKGHSDIVKVLVEQNCDIEACDHLKRRPIHLACEKGHTEIVKVLIDHHCDISACGGRFNQ--SPIHLARKNNFTELIQLL 695
            P+H A  +G  ++  +L+DHN D  +  +K    P+H+A   G+LE++++LLE+   ++   + +  P+H+A    + ++   L+      +A     + P+H    K   +I   L++   D  A       P+HL+ ++GH EI  +LI++  D+   G + N   + +HL  + +   + Q+L
Sbjct:  527 PLHIAAKEGQEEVAGILLDHNADKTLLTKK-GFTPLHLASKYGNLEVVRLLLERGTPVDIEGKNQVTPLHVAAHYNNDKVAMLLLENGASAKAAAKNGYTPLHIAAKKNQMEIASTLLQFKADPNAKSRAGFTPLHLSAQEGHKEISGLLIENGSDV---GAKANNGLTAMHLCAQEDHVPVAQIL 708          

HSP 3 Score: 82.8037 bits (203), Expect = 1.967e-17
Identity = 46/187 (24.60%), Postives = 90/187 (48.13%), Query Frame = 3
Query:  144 PIHFACLKGDIDIVKVLIDHNCDIEVRNRKWNQQPIHMACWDGHLEILKVLLEKNCDIESCDEWKRRPIHLACENGHTEIVKFLINLHCDIEAINDKAWRPIHFGCWKGHSDIVKVLVEQNCDIEACDHLKRRPIHLACEKGHTEIVKVLIDHHC---DISACGGRFNQSPIHLARKNNFTELIQLL 695
            P+H A  K  ++I   L+    D   ++R     P+H++  +GH EI  +L+E   D+ +        +HL  +  H  + + L N   +I +  +  + P+H  C  G  ++VK LVE   D+         P+H A ++GH   V+ L+++     + +A G    Q+P+ +A++  +  +++ L
Sbjct:  626 PLHIAAKKNQMEIASTLLQFKADPNAKSRA-GFTPLHLSAQEGHKEISGLLIENGSDVGAKANNGLTAMHLCAQEDHVPVAQILYNNGAEINSKTNAGYTPLHVACHFGQLNMVKFLVENGADVGEKTRASYTPLHQAAQQGHNNCVRYLLENGASPNEQTATG----QTPLSIAQRLGYVSVVETL 807          

HSP 4 Score: 80.4925 bits (197), Expect = 1.221e-16
Identity = 46/186 (24.73%), Postives = 96/186 (51.61%), Query Frame = 3
Query:  144 PIHFACLKGDIDIVKVLIDHNCDIEVRNRKWNQQPIHMACWDGHLEILKVLLEKNCDIESCDEWKRRPIHLACENGHTEIVKFLINLHCDIEAINDKAWRPIHFGCWKGHSDIVKVLVEQN--CDIEACDHLKRRPIHLACEKGHTEIVKVLIDHHCDISACGGRFNQSPIHLARKNNFTELIQLL 695
            P+H A      D+V+VLI +   ++ + R+  Q P+H+A   G+ +I+ +LL+   +  +       P+H+A + G  E+   L++ + D   +  K + P+H     G+ ++V++L+E+    DIE  + +   P+H+A    + ++  +L+++     A   +   +P+H+A K N  E+   L
Sbjct:  461 PLHLAARANQTDVVRVLIRNGAKVDAQAREL-QTPLHIASRLGNTDIVILLLQAGANSNATTRDNYSPLHIAAKEGQEEVAGILLDHNADKTLLTKKGFTPLHLASKYGNLEVVRLLLERGTPVDIEGKNQVT--PLHVAAHYNNDKVAMLLLENGASAKA-AAKNGYTPLHIAAKKNQMEIASTL 642          

HSP 5 Score: 79.337 bits (194), Expect = 2.536e-16
Identity = 44/184 (23.91%), Postives = 91/184 (49.46%), Query Frame = 3
Query:  144 PIHFACLKGDIDIVKVLIDHNCDIEVRNRKWNQQPIHMACWDGHLEILKVLLEKNCDIESCDEWKRRPIHLACENGHTEIVKFLINLHCDIEAINDKAWRPIHFGCWKGHSDIVKVLVEQNCDIEACDHLKRRPIHLACEKGHTEIVKVLIDHHCDISACGGRFNQSPIHLARKNNFTELIQLL 695
            P+H A   G I+IV  L+    + +V   +  + P+H+A      ++++VL+     +++     + P+H+A   G+T+IV  L+    +  A     + P+H    +G  ++  +L++ N D          P+HLA + G+ E+V++L++    +    G+   +P+H+A   N  ++  LL
Sbjct:  428 PLHVAAFMGAINIVIYLLQQGANPDVETVR-GETPLHLAARANQTDVVRVLIRNGAKVDAQARELQTPLHIASRLGNTDIVILLLQAGANSNATTRDNYSPLHIAAKEGQEEVAGILLDHNADKTLLTKKGFTPLHLASKYGNLEVVRLLLERGTPVD-IEGKNQVTPLHVAAHYNNDKVAMLL 609          

HSP 6 Score: 23.8682 bits (50), Expect = 2.536e-16
Identity = 9/26 (34.62%), Postives = 16/26 (61.54%), Query Frame = 2
Query:    2 PIHLAFDNNHREIVKLLIEENCDVNA 79
            P+H+A    H  + KLL++ + D N+
Sbjct:  362 PLHVAAHCGHVRVAKLLLDRSADPNS 387          

HSP 7 Score: 75.485 bits (184), Expect = 5.803e-15
Identity = 47/186 (25.27%), Postives = 86/186 (46.24%), Query Frame = 3
Query:  144 PIHFACLKGDIDIVKVLIDHNCDIEVRNRKWNQQPIHMACWDGHLEILKVLLEKNCDIESCDEWKRRPIHLACENGHTEIVKFLINLHCDIEAINDKAWRPIHFGCWKGHSDIVKVLVEQNCDIEACDHLKRRPIHLACEKGHTEIVKVLIDH--HCDISACGGRFNQSPIHLARKNNFTELIQLL 695
            P+H A   G   +V +L+     I  + +     P+HMA    H++  + LL     ++        P+H+A   GH  + K L++   D  +     + P+H  C K    +V++L++    IEA       P+H+A   G   IV  L+    + D+    G   ++P+HLA + N T+++++L
Sbjct:  296 PLHCAARSGHDQVVDLLVVQGAPISAKTKN-GLAPLHMAAQGDHVDAARTLLYHRAPVDDVTVDYLTPLHVAAHCGHVRVAKLLLDRSADPNSRALNGFTPLHIACKKNRIKVVELLLKYRAAIEATTESGLTPLHVAAFMGAINIVIYLLQQGANPDVETVRG---ETPLHLAARANQTDVVRVL 477          

HSP 8 Score: 70.4774 bits (171), Expect = 2.909e-13
Identity = 48/216 (22.22%), Postives = 90/216 (41.67%), Query Frame = 3
Query:  144 PIHFACLKGDIDIVKVLIDHN--CDIEVRNR------------------------------KWNQQPIHMACWDGHLEILKVLLEKNCDIESCDEWKRRPIHLACENGHTEIVKFLINLHCDIEAINDKAWRPIHFGCWKGHSDIVKVLVEQNCDIEACDHLKRRPIHLACEKGHTEIVKVLIDHHCDISACGGRFNQSPIHLARKNNFTELIQLL 695
            P+H A   G++++V++L++     DIE +N+                              K    P+H+A     +EI   LL+   D  +       P+HL+ + GH EI   LI    D+ A  +     +H    + H  + ++L     +I +  +    P+H+AC  G   +VK L+++  D+     R + +P+H A +      ++ L
Sbjct:  560 PLHLASKYGNLEVVRLLLERGTPVDIEGKNQVTPLHVAAHYNNDKVAMLLLENGASAKAAAKNGYTPLHIAAKKNQMEIASTLLQFKADPNAKSRAGFTPLHLSAQEGHKEISGLLIENGSDVGAKANNGLTAMHLCAQEDHVPVAQILYNNGAEINSKTNAGYTPLHVACHFGQLNMVKFLVENGADVGE-KTRASYTPLHQAAQQGHNNCVRYL 774          

HSP 9 Score: 67.3958 bits (163), Expect = 8.200e-13
Identity = 46/185 (24.86%), Postives = 82/185 (44.32%), Query Frame = 3
Query:  147 IHFACLKGDIDIVKVLI--DHNCDIEVRNRKWNQQPIHMACWDGHLEILKVLLEKNCDIESCDEWKRRPIHLACENGHTEIVKFLINLHCDIEAINDKAWRPIHFGCWKGHSDIVKVLVEQNCDIEACDHLKRRPIHLACEKGHTEIVKVLIDHHCDISACGGRFNQSPIHLARKNNFTELIQLL 695
            +H A  K D     +L+  +HN D+     K    P+H+A   GH  + ++LLEK  ++         P+H+A + G T +   L++    I++       P+H     GH  +V +LV Q   I A       P+H+A +  H +  + L+ H   +      +  +P+H+A       + +LL
Sbjct:  198 LHIAAKKDDTTAATLLLQNEHNPDV---TSKSGFTPLHIAAHYGHENVGQLLLEKGANVNYQARHNISPLHVATKWGRTNMANLLLSRGAIIDSRTKDLLTPLHCAARSGHDQVVDLLVVQGAPISAKTKNGLAPLHMAAQGDHVDAARTLLYHRAPVDDVTVDY-LTPLHVAAHCGHVRVAKLL 378          

HSP 10 Score: 24.2534 bits (51), Expect = 8.200e-13
Identity = 8/23 (34.78%), Postives = 15/23 (65.22%), Query Frame = 2
Query:    2 PIHLAFDNNHREIVKLLIEENCD 70
            P+++A   NH E+VK L++   +
Sbjct:  135 PLYMAAQENHEEVVKYLLKHGAN 157          

HSP 11 Score: 62.3882 bits (150), Expect = 1.283e-10
Identity = 34/111 (30.63%), Postives = 55/111 (49.55%), Query Frame = 3
Query:  270 GHLEILKVLLEKNCDIESCDEWKRRPIHLACENGHTEIVKFLINLHCDIEAINDKAWRPIHFGCWKGHSDIVKVLVEQNCDIEACDHLKRRPIHLACEKGHTEIVKVLIDH 602
            G LE +  LL    DI + +      +HLA + GH+E+V+ LI     ++A   K    +H     G S IV +LVE   ++         P+++A ++ H E+VK L+ H
Sbjct:   44 GDLEKVLELLRAGTDINTSNANGLNSLHLASKEGHSEVVRELIKRQAQVDAATRKGNTALHIASLAGQSLIVTILVENGANVNVQSVNGFTPLYMAAQENHEEVVKYLLKH 154          

HSP 12 Score: 61.2326 bits (147), Expect = 3.275e-10
Identity = 40/184 (21.74%), Postives = 84/184 (45.65%), Query Frame = 3
Query:  156 ACLKGDIDIVKVLIDHNCDIEVRNRKWNQQPIHMACWDGHLEILKVLLEKNCDIESCDEWKRRPIHLACENGHTEIVKFLINLHCDIEAINDKAWRPIHFGCWKGHSDIVKVLVEQNCDIEACDHLKRRPIHLACEKGHTEIVKVLIDHHCDISACGGRFNQSPIHLARKNNFTELIQLLTIHE 707
            A   GD++ V  L+    DI   N       +H+A  +GH E+++ L+++   +++        +H+A   G + IV  L+    ++   +   + P++    + H ++VK L++   +          P+ +A ++GH  +V VL+++        G+     +H+A K + T    LL  +E
Sbjct:   40 AARAGDLEKVLELLRAGTDINTSNAN-GLNSLHLASKEGHSEVVRELIKRQAQVDAATRKGNTALHIASLAGQSLIVTILVENGANVNVQSVNGFTPLYMAAQENHEEVVKYLLKHGANQALSTEDGFTPLAVALQQGHDRVVAVLLENDSK-----GKVRLPALHIAAKKDDTTAATLLLQNE 217          
BLAST of SMED30015660 vs. Ensembl Celegans
Match: unc-44 (AO49 ankyrin [Source:UniProtKB/TrEMBL;Acc:Q7JP86])

HSP 1 Score: 84.3445 bits (207), Expect = 5.593e-18
Identity = 51/187 (27.27%), Postives = 94/187 (50.27%), Query Frame = 3
Query:  144 PIHFACLKGDIDIVKVLIDHNCDIEVRNRKWNQQPIHMACWDGHLEILKVLLEKNCDIESCDEWKRRPIHLACENGHTEIVKFLINLHCDIEAINDKAWRPIHFGCWKGHSDIVKVLVEQNCDIEACDHLKRRPIHLACEKGHTEIVKVLIDHHCDISACGGRFNQSPIHLARKNNFTELIQLLTIH 704
            P+H A   G + + K+L+D + D   R       P+H+AC    ++++++LL+    IE+  E    P+H+A   G   IV +L+    + +    +   P+H       +D+V+VL+     ++A     + P+H+A   G+T+IV +L+    + +A   R N SP+H+A K    E+  +L  H
Sbjct:  362 PLHVAAHCGHVRVAKLLLDRSADPNSRALN-GFTPLHIACKKNRIKVVELLLKYRAAIEATTESGLTPLHVAAFMGAINIVIYLLQQGANPDVETVRGETPLHLAARANQTDVVRVLIRNGAKVDAQARELQTPLHIASRLGNTDIVILLLQAGANSNAT-TRDNYSPLHIAAKEGQEEVAGILLDH 546          

HSP 2 Score: 83.1889 bits (204), Expect = 1.746e-17
Identity = 47/186 (25.27%), Postives = 94/186 (50.54%), Query Frame = 3
Query:  144 PIHFACLKGDIDIVKVLIDHNCDIEVRNRKWNQQPIHMACWDGHLEILKVLLEKNCDIESCDEWKRRPIHLACENGHTEIVKFLINLHCDIEAINDKAWRPIHFGCWKGHSDIVKVLVEQNCDIEACDHLKRRPIHLACEKGHTEIVKVLIDHHCDISACGGRFNQ--SPIHLARKNNFTELIQLL 695
            P+H A  +G  ++  +L+DHN D  +  +K    P+H+A   G+LE++++LLE+   ++   + +  P+H+A    + ++   L+      +A     + P+H    K   +I   L++   D  A       P+HL+ ++GH EI  +LI++  D+   G + N   + +HL  + +   + Q+L
Sbjct:  527 PLHIAAKEGQEEVAGILLDHNADKTLLTKK-GFTPLHLASKYGNLEVVRLLLERGTPVDIEGKNQVTPLHVAAHYNNDKVAMLLLENGASAKAAAKNGYTPLHIAAKKNQMEIASTLLQFKADPNAKSRAGFTPLHLSAQEGHKEISGLLIENGSDV---GAKANNGLTAMHLCAQEDHVPVAQIL 708          

HSP 3 Score: 82.8037 bits (203), Expect = 1.971e-17
Identity = 46/187 (24.60%), Postives = 90/187 (48.13%), Query Frame = 3
Query:  144 PIHFACLKGDIDIVKVLIDHNCDIEVRNRKWNQQPIHMACWDGHLEILKVLLEKNCDIESCDEWKRRPIHLACENGHTEIVKFLINLHCDIEAINDKAWRPIHFGCWKGHSDIVKVLVEQNCDIEACDHLKRRPIHLACEKGHTEIVKVLIDHHC---DISACGGRFNQSPIHLARKNNFTELIQLL 695
            P+H A  K  ++I   L+    D   ++R     P+H++  +GH EI  +L+E   D+ +        +HL  +  H  + + L N   +I +  +  + P+H  C  G  ++VK LVE   D+         P+H A ++GH   V+ L+++     + +A G    Q+P+ +A++  +  +++ L
Sbjct:  626 PLHIAAKKNQMEIASTLLQFKADPNAKSRA-GFTPLHLSAQEGHKEISGLLIENGSDVGAKANNGLTAMHLCAQEDHVPVAQILYNNGAEINSKTNAGYTPLHVACHFGQLNMVKFLVENGADVGEKTRASYTPLHQAAQQGHNNCVRYLLENGASPNEQTATG----QTPLSIAQRLGYVSVVETL 807          

HSP 4 Score: 80.4925 bits (197), Expect = 1.223e-16
Identity = 46/186 (24.73%), Postives = 96/186 (51.61%), Query Frame = 3
Query:  144 PIHFACLKGDIDIVKVLIDHNCDIEVRNRKWNQQPIHMACWDGHLEILKVLLEKNCDIESCDEWKRRPIHLACENGHTEIVKFLINLHCDIEAINDKAWRPIHFGCWKGHSDIVKVLVEQN--CDIEACDHLKRRPIHLACEKGHTEIVKVLIDHHCDISACGGRFNQSPIHLARKNNFTELIQLL 695
            P+H A      D+V+VLI +   ++ + R+  Q P+H+A   G+ +I+ +LL+   +  +       P+H+A + G  E+   L++ + D   +  K + P+H     G+ ++V++L+E+    DIE  + +   P+H+A    + ++  +L+++     A   +   +P+H+A K N  E+   L
Sbjct:  461 PLHLAARANQTDVVRVLIRNGAKVDAQAREL-QTPLHIASRLGNTDIVILLLQAGANSNATTRDNYSPLHIAAKEGQEEVAGILLDHNADKTLLTKKGFTPLHLASKYGNLEVVRLLLERGTPVDIEGKNQVT--PLHVAAHYNNDKVAMLLLENGASAKA-AAKNGYTPLHIAAKKNQMEIASTL 642          

HSP 5 Score: 79.337 bits (194), Expect = 2.494e-16
Identity = 44/184 (23.91%), Postives = 91/184 (49.46%), Query Frame = 3
Query:  144 PIHFACLKGDIDIVKVLIDHNCDIEVRNRKWNQQPIHMACWDGHLEILKVLLEKNCDIESCDEWKRRPIHLACENGHTEIVKFLINLHCDIEAINDKAWRPIHFGCWKGHSDIVKVLVEQNCDIEACDHLKRRPIHLACEKGHTEIVKVLIDHHCDISACGGRFNQSPIHLARKNNFTELIQLL 695
            P+H A   G I+IV  L+    + +V   +  + P+H+A      ++++VL+     +++     + P+H+A   G+T+IV  L+    +  A     + P+H    +G  ++  +L++ N D          P+HLA + G+ E+V++L++    +    G+   +P+H+A   N  ++  LL
Sbjct:  428 PLHVAAFMGAINIVIYLLQQGANPDVETVR-GETPLHLAARANQTDVVRVLIRNGAKVDAQARELQTPLHIASRLGNTDIVILLLQAGANSNATTRDNYSPLHIAAKEGQEEVAGILLDHNADKTLLTKKGFTPLHLASKYGNLEVVRLLLERGTPVD-IEGKNQVTPLHVAAHYNNDKVAMLL 609          

HSP 6 Score: 23.8682 bits (50), Expect = 2.494e-16
Identity = 9/26 (34.62%), Postives = 16/26 (61.54%), Query Frame = 2
Query:    2 PIHLAFDNNHREIVKLLIEENCDVNA 79
            P+H+A    H  + KLL++ + D N+
Sbjct:  362 PLHVAAHCGHVRVAKLLLDRSADPNS 387          

HSP 7 Score: 75.485 bits (184), Expect = 5.813e-15
Identity = 47/186 (25.27%), Postives = 86/186 (46.24%), Query Frame = 3
Query:  144 PIHFACLKGDIDIVKVLIDHNCDIEVRNRKWNQQPIHMACWDGHLEILKVLLEKNCDIESCDEWKRRPIHLACENGHTEIVKFLINLHCDIEAINDKAWRPIHFGCWKGHSDIVKVLVEQNCDIEACDHLKRRPIHLACEKGHTEIVKVLIDH--HCDISACGGRFNQSPIHLARKNNFTELIQLL 695
            P+H A   G   +V +L+     I  + +     P+HMA    H++  + LL     ++        P+H+A   GH  + K L++   D  +     + P+H  C K    +V++L++    IEA       P+H+A   G   IV  L+    + D+    G   ++P+HLA + N T+++++L
Sbjct:  296 PLHCAARSGHDQVVDLLVVQGAPISAKTKN-GLAPLHMAAQGDHVDAARTLLYHRAPVDDVTVDYLTPLHVAAHCGHVRVAKLLLDRSADPNSRALNGFTPLHIACKKNRIKVVELLLKYRAAIEATTESGLTPLHVAAFMGAINIVIYLLQQGANPDVETVRG---ETPLHLAARANQTDVVRVL 477          

HSP 8 Score: 70.4774 bits (171), Expect = 2.914e-13
Identity = 48/216 (22.22%), Postives = 90/216 (41.67%), Query Frame = 3
Query:  144 PIHFACLKGDIDIVKVLIDHN--CDIEVRNR------------------------------KWNQQPIHMACWDGHLEILKVLLEKNCDIESCDEWKRRPIHLACENGHTEIVKFLINLHCDIEAINDKAWRPIHFGCWKGHSDIVKVLVEQNCDIEACDHLKRRPIHLACEKGHTEIVKVLIDHHCDISACGGRFNQSPIHLARKNNFTELIQLL 695
            P+H A   G++++V++L++     DIE +N+                              K    P+H+A     +EI   LL+   D  +       P+HL+ + GH EI   LI    D+ A  +     +H    + H  + ++L     +I +  +    P+H+AC  G   +VK L+++  D+     R + +P+H A +      ++ L
Sbjct:  560 PLHLASKYGNLEVVRLLLERGTPVDIEGKNQVTPLHVAAHYNNDKVAMLLLENGASAKAAAKNGYTPLHIAAKKNQMEIASTLLQFKADPNAKSRAGFTPLHLSAQEGHKEISGLLIENGSDVGAKANNGLTAMHLCAQEDHVPVAQILYNNGAEINSKTNAGYTPLHVACHFGQLNMVKFLVENGADVGE-KTRASYTPLHQAAQQGHNNCVRYL 774          

HSP 9 Score: 67.3958 bits (163), Expect = 8.130e-13
Identity = 46/185 (24.86%), Postives = 82/185 (44.32%), Query Frame = 3
Query:  147 IHFACLKGDIDIVKVLI--DHNCDIEVRNRKWNQQPIHMACWDGHLEILKVLLEKNCDIESCDEWKRRPIHLACENGHTEIVKFLINLHCDIEAINDKAWRPIHFGCWKGHSDIVKVLVEQNCDIEACDHLKRRPIHLACEKGHTEIVKVLIDHHCDISACGGRFNQSPIHLARKNNFTELIQLL 695
            +H A  K D     +L+  +HN D+     K    P+H+A   GH  + ++LLEK  ++         P+H+A + G T +   L++    I++       P+H     GH  +V +LV Q   I A       P+H+A +  H +  + L+ H   +      +  +P+H+A       + +LL
Sbjct:  198 LHIAAKKDDTTAATLLLQNEHNPDV---TSKSGFTPLHIAAHYGHENVGQLLLEKGANVNYQARHNISPLHVATKWGRTNMANLLLSRGAIIDSRTKDLLTPLHCAARSGHDQVVDLLVVQGAPISAKTKNGLAPLHMAAQGDHVDAARTLLYHRAPVDDVTVDY-LTPLHVAAHCGHVRVAKLL 378          

HSP 10 Score: 24.2534 bits (51), Expect = 8.130e-13
Identity = 8/23 (34.78%), Postives = 15/23 (65.22%), Query Frame = 2
Query:    2 PIHLAFDNNHREIVKLLIEENCD 70
            P+++A   NH E+VK L++   +
Sbjct:  135 PLYMAAQENHEEVVKYLLKHGAN 157          

HSP 11 Score: 62.3882 bits (150), Expect = 1.285e-10
Identity = 34/111 (30.63%), Postives = 55/111 (49.55%), Query Frame = 3
Query:  270 GHLEILKVLLEKNCDIESCDEWKRRPIHLACENGHTEIVKFLINLHCDIEAINDKAWRPIHFGCWKGHSDIVKVLVEQNCDIEACDHLKRRPIHLACEKGHTEIVKVLIDH 602
            G LE +  LL    DI + +      +HLA + GH+E+V+ LI     ++A   K    +H     G S IV +LVE   ++         P+++A ++ H E+VK L+ H
Sbjct:   44 GDLEKVLELLRAGTDINTSNANGLNSLHLASKEGHSEVVRELIKRQAQVDAATRKGNTALHIASLAGQSLIVTILVENGANVNVQSVNGFTPLYMAAQENHEEVVKYLLKH 154          

HSP 12 Score: 61.2326 bits (147), Expect = 3.280e-10
Identity = 40/184 (21.74%), Postives = 84/184 (45.65%), Query Frame = 3
Query:  156 ACLKGDIDIVKVLIDHNCDIEVRNRKWNQQPIHMACWDGHLEILKVLLEKNCDIESCDEWKRRPIHLACENGHTEIVKFLINLHCDIEAINDKAWRPIHFGCWKGHSDIVKVLVEQNCDIEACDHLKRRPIHLACEKGHTEIVKVLIDHHCDISACGGRFNQSPIHLARKNNFTELIQLLTIHE 707
            A   GD++ V  L+    DI   N       +H+A  +GH E+++ L+++   +++        +H+A   G + IV  L+    ++   +   + P++    + H ++VK L++   +          P+ +A ++GH  +V VL+++        G+     +H+A K + T    LL  +E
Sbjct:   40 AARAGDLEKVLELLRAGTDINTSNAN-GLNSLHLASKEGHSEVVRELIKRQAQVDAATRKGNTALHIASLAGQSLIVTILVENGANVNVQSVNGFTPLYMAAQENHEEVVKYLLKHGANQALSTEDGFTPLAVALQQGHDRVVAVLLENDSK-----GKVRLPALHIAAKKDDTTAATLLLQNE 217          
BLAST of SMED30015660 vs. Ensembl Celegans
Match: unc-44 (AO49 ankyrin [Source:UniProtKB/TrEMBL;Acc:Q7JP86])

HSP 1 Score: 84.3445 bits (207), Expect = 5.593e-18
Identity = 51/187 (27.27%), Postives = 94/187 (50.27%), Query Frame = 3
Query:  144 PIHFACLKGDIDIVKVLIDHNCDIEVRNRKWNQQPIHMACWDGHLEILKVLLEKNCDIESCDEWKRRPIHLACENGHTEIVKFLINLHCDIEAINDKAWRPIHFGCWKGHSDIVKVLVEQNCDIEACDHLKRRPIHLACEKGHTEIVKVLIDHHCDISACGGRFNQSPIHLARKNNFTELIQLLTIH 704
            P+H A   G + + K+L+D + D   R       P+H+AC    ++++++LL+    IE+  E    P+H+A   G   IV +L+    + +    +   P+H       +D+V+VL+     ++A     + P+H+A   G+T+IV +L+    + +A   R N SP+H+A K    E+  +L  H
Sbjct:  362 PLHVAAHCGHVRVAKLLLDRSADPNSRALN-GFTPLHIACKKNRIKVVELLLKYRAAIEATTESGLTPLHVAAFMGAINIVIYLLQQGANPDVETVRGETPLHLAARANQTDVVRVLIRNGAKVDAQARELQTPLHIASRLGNTDIVILLLQAGANSNAT-TRDNYSPLHIAAKEGQEEVAGILLDH 546          

HSP 2 Score: 83.1889 bits (204), Expect = 1.746e-17
Identity = 47/186 (25.27%), Postives = 94/186 (50.54%), Query Frame = 3
Query:  144 PIHFACLKGDIDIVKVLIDHNCDIEVRNRKWNQQPIHMACWDGHLEILKVLLEKNCDIESCDEWKRRPIHLACENGHTEIVKFLINLHCDIEAINDKAWRPIHFGCWKGHSDIVKVLVEQNCDIEACDHLKRRPIHLACEKGHTEIVKVLIDHHCDISACGGRFNQ--SPIHLARKNNFTELIQLL 695
            P+H A  +G  ++  +L+DHN D  +  +K    P+H+A   G+LE++++LLE+   ++   + +  P+H+A    + ++   L+      +A     + P+H    K   +I   L++   D  A       P+HL+ ++GH EI  +LI++  D+   G + N   + +HL  + +   + Q+L
Sbjct:  527 PLHIAAKEGQEEVAGILLDHNADKTLLTKK-GFTPLHLASKYGNLEVVRLLLERGTPVDIEGKNQVTPLHVAAHYNNDKVAMLLLENGASAKAAAKNGYTPLHIAAKKNQMEIASTLLQFKADPNAKSRAGFTPLHLSAQEGHKEISGLLIENGSDV---GAKANNGLTAMHLCAQEDHVPVAQIL 708          

HSP 3 Score: 82.8037 bits (203), Expect = 1.971e-17
Identity = 46/187 (24.60%), Postives = 90/187 (48.13%), Query Frame = 3
Query:  144 PIHFACLKGDIDIVKVLIDHNCDIEVRNRKWNQQPIHMACWDGHLEILKVLLEKNCDIESCDEWKRRPIHLACENGHTEIVKFLINLHCDIEAINDKAWRPIHFGCWKGHSDIVKVLVEQNCDIEACDHLKRRPIHLACEKGHTEIVKVLIDHHC---DISACGGRFNQSPIHLARKNNFTELIQLL 695
            P+H A  K  ++I   L+    D   ++R     P+H++  +GH EI  +L+E   D+ +        +HL  +  H  + + L N   +I +  +  + P+H  C  G  ++VK LVE   D+         P+H A ++GH   V+ L+++     + +A G    Q+P+ +A++  +  +++ L
Sbjct:  626 PLHIAAKKNQMEIASTLLQFKADPNAKSRA-GFTPLHLSAQEGHKEISGLLIENGSDVGAKANNGLTAMHLCAQEDHVPVAQILYNNGAEINSKTNAGYTPLHVACHFGQLNMVKFLVENGADVGEKTRASYTPLHQAAQQGHNNCVRYLLENGASPNEQTATG----QTPLSIAQRLGYVSVVETL 807          

HSP 4 Score: 80.4925 bits (197), Expect = 1.223e-16
Identity = 46/186 (24.73%), Postives = 96/186 (51.61%), Query Frame = 3
Query:  144 PIHFACLKGDIDIVKVLIDHNCDIEVRNRKWNQQPIHMACWDGHLEILKVLLEKNCDIESCDEWKRRPIHLACENGHTEIVKFLINLHCDIEAINDKAWRPIHFGCWKGHSDIVKVLVEQN--CDIEACDHLKRRPIHLACEKGHTEIVKVLIDHHCDISACGGRFNQSPIHLARKNNFTELIQLL 695
            P+H A      D+V+VLI +   ++ + R+  Q P+H+A   G+ +I+ +LL+   +  +       P+H+A + G  E+   L++ + D   +  K + P+H     G+ ++V++L+E+    DIE  + +   P+H+A    + ++  +L+++     A   +   +P+H+A K N  E+   L
Sbjct:  461 PLHLAARANQTDVVRVLIRNGAKVDAQAREL-QTPLHIASRLGNTDIVILLLQAGANSNATTRDNYSPLHIAAKEGQEEVAGILLDHNADKTLLTKKGFTPLHLASKYGNLEVVRLLLERGTPVDIEGKNQVT--PLHVAAHYNNDKVAMLLLENGASAKA-AAKNGYTPLHIAAKKNQMEIASTL 642          

HSP 5 Score: 79.337 bits (194), Expect = 2.494e-16
Identity = 44/184 (23.91%), Postives = 91/184 (49.46%), Query Frame = 3
Query:  144 PIHFACLKGDIDIVKVLIDHNCDIEVRNRKWNQQPIHMACWDGHLEILKVLLEKNCDIESCDEWKRRPIHLACENGHTEIVKFLINLHCDIEAINDKAWRPIHFGCWKGHSDIVKVLVEQNCDIEACDHLKRRPIHLACEKGHTEIVKVLIDHHCDISACGGRFNQSPIHLARKNNFTELIQLL 695
            P+H A   G I+IV  L+    + +V   +  + P+H+A      ++++VL+     +++     + P+H+A   G+T+IV  L+    +  A     + P+H    +G  ++  +L++ N D          P+HLA + G+ E+V++L++    +    G+   +P+H+A   N  ++  LL
Sbjct:  428 PLHVAAFMGAINIVIYLLQQGANPDVETVR-GETPLHLAARANQTDVVRVLIRNGAKVDAQARELQTPLHIASRLGNTDIVILLLQAGANSNATTRDNYSPLHIAAKEGQEEVAGILLDHNADKTLLTKKGFTPLHLASKYGNLEVVRLLLERGTPVD-IEGKNQVTPLHVAAHYNNDKVAMLL 609          

HSP 6 Score: 23.8682 bits (50), Expect = 2.494e-16
Identity = 9/26 (34.62%), Postives = 16/26 (61.54%), Query Frame = 2
Query:    2 PIHLAFDNNHREIVKLLIEENCDVNA 79
            P+H+A    H  + KLL++ + D N+
Sbjct:  362 PLHVAAHCGHVRVAKLLLDRSADPNS 387          

HSP 7 Score: 75.485 bits (184), Expect = 5.813e-15
Identity = 47/186 (25.27%), Postives = 86/186 (46.24%), Query Frame = 3
Query:  144 PIHFACLKGDIDIVKVLIDHNCDIEVRNRKWNQQPIHMACWDGHLEILKVLLEKNCDIESCDEWKRRPIHLACENGHTEIVKFLINLHCDIEAINDKAWRPIHFGCWKGHSDIVKVLVEQNCDIEACDHLKRRPIHLACEKGHTEIVKVLIDH--HCDISACGGRFNQSPIHLARKNNFTELIQLL 695
            P+H A   G   +V +L+     I  + +     P+HMA    H++  + LL     ++        P+H+A   GH  + K L++   D  +     + P+H  C K    +V++L++    IEA       P+H+A   G   IV  L+    + D+    G   ++P+HLA + N T+++++L
Sbjct:  296 PLHCAARSGHDQVVDLLVVQGAPISAKTKN-GLAPLHMAAQGDHVDAARTLLYHRAPVDDVTVDYLTPLHVAAHCGHVRVAKLLLDRSADPNSRALNGFTPLHIACKKNRIKVVELLLKYRAAIEATTESGLTPLHVAAFMGAINIVIYLLQQGANPDVETVRG---ETPLHLAARANQTDVVRVL 477          

HSP 8 Score: 70.4774 bits (171), Expect = 2.914e-13
Identity = 48/216 (22.22%), Postives = 90/216 (41.67%), Query Frame = 3
Query:  144 PIHFACLKGDIDIVKVLIDHN--CDIEVRNR------------------------------KWNQQPIHMACWDGHLEILKVLLEKNCDIESCDEWKRRPIHLACENGHTEIVKFLINLHCDIEAINDKAWRPIHFGCWKGHSDIVKVLVEQNCDIEACDHLKRRPIHLACEKGHTEIVKVLIDHHCDISACGGRFNQSPIHLARKNNFTELIQLL 695
            P+H A   G++++V++L++     DIE +N+                              K    P+H+A     +EI   LL+   D  +       P+HL+ + GH EI   LI    D+ A  +     +H    + H  + ++L     +I +  +    P+H+AC  G   +VK L+++  D+     R + +P+H A +      ++ L
Sbjct:  560 PLHLASKYGNLEVVRLLLERGTPVDIEGKNQVTPLHVAAHYNNDKVAMLLLENGASAKAAAKNGYTPLHIAAKKNQMEIASTLLQFKADPNAKSRAGFTPLHLSAQEGHKEISGLLIENGSDVGAKANNGLTAMHLCAQEDHVPVAQILYNNGAEINSKTNAGYTPLHVACHFGQLNMVKFLVENGADVGE-KTRASYTPLHQAAQQGHNNCVRYL 774          

HSP 9 Score: 67.3958 bits (163), Expect = 8.130e-13
Identity = 46/185 (24.86%), Postives = 82/185 (44.32%), Query Frame = 3
Query:  147 IHFACLKGDIDIVKVLI--DHNCDIEVRNRKWNQQPIHMACWDGHLEILKVLLEKNCDIESCDEWKRRPIHLACENGHTEIVKFLINLHCDIEAINDKAWRPIHFGCWKGHSDIVKVLVEQNCDIEACDHLKRRPIHLACEKGHTEIVKVLIDHHCDISACGGRFNQSPIHLARKNNFTELIQLL 695
            +H A  K D     +L+  +HN D+     K    P+H+A   GH  + ++LLEK  ++         P+H+A + G T +   L++    I++       P+H     GH  +V +LV Q   I A       P+H+A +  H +  + L+ H   +      +  +P+H+A       + +LL
Sbjct:  198 LHIAAKKDDTTAATLLLQNEHNPDV---TSKSGFTPLHIAAHYGHENVGQLLLEKGANVNYQARHNISPLHVATKWGRTNMANLLLSRGAIIDSRTKDLLTPLHCAARSGHDQVVDLLVVQGAPISAKTKNGLAPLHMAAQGDHVDAARTLLYHRAPVDDVTVDY-LTPLHVAAHCGHVRVAKLL 378          

HSP 10 Score: 24.2534 bits (51), Expect = 8.130e-13
Identity = 8/23 (34.78%), Postives = 15/23 (65.22%), Query Frame = 2
Query:    2 PIHLAFDNNHREIVKLLIEENCD 70
            P+++A   NH E+VK L++   +
Sbjct:  135 PLYMAAQENHEEVVKYLLKHGAN 157          

HSP 11 Score: 62.3882 bits (150), Expect = 1.285e-10
Identity = 34/111 (30.63%), Postives = 55/111 (49.55%), Query Frame = 3
Query:  270 GHLEILKVLLEKNCDIESCDEWKRRPIHLACENGHTEIVKFLINLHCDIEAINDKAWRPIHFGCWKGHSDIVKVLVEQNCDIEACDHLKRRPIHLACEKGHTEIVKVLIDH 602
            G LE +  LL    DI + +      +HLA + GH+E+V+ LI     ++A   K    +H     G S IV +LVE   ++         P+++A ++ H E+VK L+ H
Sbjct:   44 GDLEKVLELLRAGTDINTSNANGLNSLHLASKEGHSEVVRELIKRQAQVDAATRKGNTALHIASLAGQSLIVTILVENGANVNVQSVNGFTPLYMAAQENHEEVVKYLLKH 154          

HSP 12 Score: 61.2326 bits (147), Expect = 3.280e-10
Identity = 40/184 (21.74%), Postives = 84/184 (45.65%), Query Frame = 3
Query:  156 ACLKGDIDIVKVLIDHNCDIEVRNRKWNQQPIHMACWDGHLEILKVLLEKNCDIESCDEWKRRPIHLACENGHTEIVKFLINLHCDIEAINDKAWRPIHFGCWKGHSDIVKVLVEQNCDIEACDHLKRRPIHLACEKGHTEIVKVLIDHHCDISACGGRFNQSPIHLARKNNFTELIQLLTIHE 707
            A   GD++ V  L+    DI   N       +H+A  +GH E+++ L+++   +++        +H+A   G + IV  L+    ++   +   + P++    + H ++VK L++   +          P+ +A ++GH  +V VL+++        G+     +H+A K + T    LL  +E
Sbjct:   40 AARAGDLEKVLELLRAGTDINTSNAN-GLNSLHLASKEGHSEVVRELIKRQAQVDAATRKGNTALHIASLAGQSLIVTILVENGANVNVQSVNGFTPLYMAAQENHEEVVKYLLKHGANQALSTEDGFTPLAVALQQGHDRVVAVLLENDSK-----GKVRLPALHIAAKKDDTTAATLLLQNE 217          
BLAST of SMED30015660 vs. Ensembl Fly
Match: Ank (gene:FBgn0011747 transcript:FBtr0089172)

HSP 1 Score: 96.2857 bits (238), Expect = 7.072e-22
Identity = 50/185 (27.03%), Postives = 96/185 (51.89%), Query Frame = 3
Query:  147 IHFACLKGDIDIVKVLIDHNCDIEVRNRKWNQQPIHMACWDGHLEILKVLLEKNCDIESCDEWKRRPIHLACENGHTEIVKFLINLHCDIEAINDKAWRPIHFGCWKGHSDIVKVLVEQNCDIEACDHLKRRPIHLACEKGHTEIVKVLIDHHCDISACGGRFNQSPIHLARKNNFTELIQLLTI 701
            IH AC K  ++I   L+ H  D+ + + K    P+H+A   G+++++++LLE    I +  +    P+H+A + GH  + + L+    +I       + P+H     GH D+VK  +E + DIE   ++   P+H A ++GH  I+ +L+ H  + +A     N + +H+A    +  +++ L I
Sbjct:  633 IHIACKKNYLEIAMQLLQHGADVNIIS-KSGFSPLHLAAQGGNVDMVQLLLEYGV-ISAAAKNGLTPLHVAAQEGHVLVSQILLEHGANISERTRNGYTPLHMAAHYGHLDLVKFFIENDADIEMSSNIGYTPLHQAAQQGHIMIINLLLRHKANPNALTKDGNTA-LHIASNLGYVTVMESLKI 814          

HSP 2 Score: 90.5077 bits (223), Expect = 6.680e-20
Identity = 52/187 (27.81%), Postives = 96/187 (51.34%), Query Frame = 3
Query:  138 RRPIHFACLKGDIDIVKVLIDHNCDIEVR-NRKWNQQPIHMACWDGHLEILKVLLEKNCDIESCDEWKRRPIHLACENGHTEIVKFLINLHCDIEAINDKAWRPIHFGCWKGHSDIVKVLVEQNCDIEACDHLKRRPIHLACEKGHTEIVKVLIDHHCDISACGGRFNQSPIHLARKNNFTELIQLL 695
            + P+H A   G+I+I+ +L+ H  +I  + N K++   +H+A  +G   I++VLLE   +  +  +    P+HLAC+ G   +V+ L+     I+        P+H      +  IV++L++       C    +  IH+AC+K + EI   L+ H  D++    +   SP+HLA +    +++QLL
Sbjct:  498 QTPLHVASRLGNINIIMLLLQHGAEINAQSNDKYSA--LHIAAKEGQENIVQVLLENGAENNAVTKKGFTPLHLACKYGKQNVVQILLQNGASIDFQGKNDVTPLHVATHYNNPSIVELLLKNGSSPNLCARNGQCAIHIACKKNYLEIAMQLLQHGADVNII-SKSGFSPLHLAAQGGNVDMVQLL 681          

HSP 3 Score: 87.0409 bits (214), Expect = 8.304e-19
Identity = 48/184 (26.09%), Postives = 95/184 (51.63%), Query Frame = 3
Query:  144 PIHFACLKGDIDIVKVLIDHNCDIEVRNRKWNQQPIHMACWDGHLEILKVLLEKNCDIESCDEWKRRPIHLACENGHTEIVKFLINLHCDIEAINDKAWRPIHFGCWKGHSDIVKVLVEQNCDIEACDHLKRRPIHLACEKGHTEIVKVLIDHHCDISACGGRFNQSPIHLARKNNFTELIQLL 695
            P+H AC  G  ++V++L+ +   I+ +  K +  P+H+A    +  I+++LL+       C    +  IH+AC+  + EI   L+    D+  I+   + P+H     G+ D+V++L+E    I A       P+H+A ++GH  + ++L++H  +IS    R   +P+H+A      +L++  
Sbjct:  566 PLHLACKYGKQNVVQILLQNGASIDFQG-KNDVTPLHVATHYNNPSIVELLLKNGSSPNLCARNGQCAIHIACKKNYLEIAMQLLQHGADVNIISKSGFSPLHLAAQGGNVDMVQLLLEYGV-ISAAAKNGLTPLHVAAQEGHVLVSQILLEHGANISE-RTRNGYTPLHMAAHYGHLDLVKFF 746          

HSP 4 Score: 85.8853 bits (211), Expect = 2.077e-18
Identity = 50/185 (27.03%), Postives = 96/185 (51.89%), Query Frame = 3
Query:  144 PIHFACLKGDIDIVKVLIDHNCDIEVRNRKWNQQPIHMACWDGHLEILKVLLEKNCDIESCDEWKRRPIHLACENGHTEIVKFLINLHCDIEAINDKAWRPIHFGCWKGHSDIVKVLVEQNCDIEACDHLKRRPIHLACEKGHTEIVKVLIDHHCDISACGGRFNQSPIHLARKNNFTEL-IQLL 695
            P+H A      DI+++L+  +  ++   R+  Q P+H+A   G++ I+ +LL+   +I +    K   +H+A + G   IV+ L+    +  A+  K + P+H  C  G  ++V++L++    I+        P+H+A    +  IV++L+ +    + C  R  Q  IH+A K N+ E+ +QLL
Sbjct:  468 PLHLAARANQADIIRILL-RSAKVDAIARE-GQTPLHVASRLGNINIIMLLLQHGAEINAQSNDKYSALHIAAKEGQENIVQVLLENGAENNAVTKKGFTPLHLACKYGKQNVVQILLQNGASIDFQGKNDVTPLHVATHYNNPSIVELLLKNGSSPNLC-ARNGQCAIHIACKKNYLEIAMQLL 649          

HSP 5 Score: 82.4185 bits (202), Expect = 3.385e-17
Identity = 40/150 (26.67%), Postives = 77/150 (51.33%), Query Frame = 3
Query:  144 PIHFACLKGDIDIVKVLIDHNCDIEVRNRKWNQQPIHMACWDGHLEILKVLLEKNCDIESCDEWKRRPIHLACENGHTEIVKFLINLHCDIEAINDKAWRPIHFGCWKGHSDIVKVLVEQNCDIEACDHLKRRPIHLACEKGHTEIVKVL 593
            P+H A   G++D+V++L+++   +     K    P+H+A  +GH+ + ++LLE   +I         P+H+A   GH ++VKF I    DIE  ++  + P+H    +GH  I+ +L+    +  A        +H+A   G+  +++ L
Sbjct:  665 PLHLAAQGGNVDMVQLLLEYG--VISAAAKNGLTPLHVAAQEGHVLVSQILLEHGANISERTRNGYTPLHMAAHYGHLDLVKFFIENDADIEMSSNIGYTPLHQAAQQGHIMIINLLLRHKANPNALTKDGNTALHIASNLGYVTVMESL 812          

HSP 6 Score: 78.5666 bits (192), Expect = 7.297e-16
Identity = 47/187 (25.13%), Postives = 91/187 (48.66%), Query Frame = 3
Query:  144 PIHFACLKGDIDIVKVLIDHNCDIEVRNRKWNQQPIHMACWDGHLEILKVLLEKNCDIESCDEWKRRPIHLACENGHTEIVKFLINLHCDIEAINDKAWRPIHFGCWKGHSDIVKVLVEQNCDIEACDHLKRRPIHLACEKGHTEIVKVLIDHHCDISACGGRFNQSPIHLARKNNFTELIQLLTIH 704
            P+H A   G++DI  +L+++  D+     K N  P+H+AC  G L +  +LL +   I++       P+H A  +GH E++K L+  +  I          +H      H +   +L++    ++         +H+A   GH ++ K+L+D+  + +A       +P+H+A K N  ++++LL  H
Sbjct:  237 PLHIAAHYGNVDIATLLLNNKADVNYV-AKHNITPLHVACKWGKLSLCTLLLCRGAKIDAATRDGLTPLHCASRSGHVEVIKHLLQQNAPILTKTKNGLSALHMAAQGEHDEAAHLLLDNKAPVDEVTVDYLTALHVAAHCGHVKVAKLLLDYKANPNARALN-GFTPLHIACKKNRIKMVELLIKH 421          

HSP 7 Score: 75.0998 bits (183), Expect = 1.064e-14
Identity = 48/186 (25.81%), Postives = 87/186 (46.77%), Query Frame = 3
Query:  144 PIHFACLKGDIDIVKVLIDHNCDIEVRNRKWNQQPIHMACWDGHLEILKVLLEKNCDIESCDEWKRRPIHLACENGHTEIVKFLINLHCDIEAINDKAWRPIHFGCWKGHSDIVKVLVEQNCDIEACDHLKRRPIHLACEKGHTEIVKVLIDHH--CDISACGGRFNQSPIHLARKNNFTELIQLL 695
            P+H A   G ++++K L+  N  I  +  K     +HMA    H E   +LL+    ++         +H+A   GH ++ K L++   +  A     + P+H  C K    +V++L++   +I A       P+H+A   G   IV  L+ H    D+    G   ++P+HLA + N  ++I++L
Sbjct:  303 PLHCASRSGHVEVIKHLLQQNAPILTKT-KNGLSALHMAAQGEHDEAAHLLLDNKAPVDEVTVDYLTALHVAAHCGHVKVAKLLLDYKANPNARALNGFTPLHIACKKNRIKMVELLIKHGANIGATTESGLTPLHVASFMGCINIVIYLLQHEASADLPTIRG---ETPLHLAARANQADIIRIL 484          

HSP 8 Score: 72.0182 bits (175), Expect = 1.033e-13
Identity = 42/183 (22.95%), Postives = 91/183 (49.73%), Query Frame = 3
Query:  147 IHFACLKGDIDIVKVLIDHNCDIEVRNRKWNQQPIHMACWDGHLEILKVLLEKNCDIESCDEWKRRPIHLACENGHTEIVKFLINLHCDIEAINDKAWRPIHFGCWKGHSDIVKVLVEQNCDIEACDHLKRRPIHLACEKGHTEIVKVLIDHHCDISACGGRFNQSPIHLARKNNFTELIQLL 695
            +H A   G + + K+L+D+  +   R       P+H+AC    ++++++L++   +I +  E    P+H+A   G   IV +L+      +    +   P+H       +DI+++L+ ++  ++A     + P+H+A   G+  I+ +L+ H  +I+A       S +H+A K     ++Q+L
Sbjct:  370 LHVAAHCGHVKVAKLLLDYKANPNARALN-GFTPLHIACKKNRIKMVELLIKHGANIGATTESGLTPLHVASFMGCINIVIYLLQHEASADLPTIRGETPLHLAARANQADIIRILL-RSAKVDAIAREGQTPLHVASRLGNINIIMLLLQHGAEINAQSND-KYSALHIAAKEGQENIVQVL 549          

HSP 9 Score: 61.6178 bits (148), Expect = 2.564e-10
Identity = 44/184 (23.91%), Postives = 82/184 (44.57%), Query Frame = 3
Query:  144 PIHFACLKGDIDIVKVLIDHNCDIEVRNRKWNQQPIHMACWDGHLEILKVLLEKNCDIESCDEWKRRPIHLACENGHTEIVKFLINLHCDIEAINDKAWRPIHFGCWKGHSDIVKVLVEQNCDIEACDHLKRRPIHLACEKGHTEIVKVLIDHHCDISACGGRFNQSPIHLARKNNFTELIQLL 695
            P+  A  +G   IV VL++++   +VR        +H+A     +   K+LL+ + + +   +    P+H+A   G+ +I   L+N   D+  +      P+H  C  G   +  +L+ +   I+A       P+H A   GH E++K L+  +  I     +   S +H+A +    E   LL
Sbjct:  175 PLAVAMQQGHDKIVAVLLENDVRGKVR-----LPALHIAAKKNDVNAAKLLLQHDPNADIVSKSGFTPLHIAAHYGNVDIATLLLNNKADVNYVAKHNITPLHVACKWGKLSLCTLLLCRGAKIDAATRDGLTPLHCASRSGHVEVIKHLLQQNAPI-LTKTKNGLSALHMAAQGEHDEAAHLL 352          

HSP 10 Score: 61.6178 bits (148), Expect = 2.834e-10
Identity = 42/172 (24.42%), Postives = 82/172 (47.67%), Query Frame = 3
Query:  147 IHFACLKGDIDIVKVLIDHNCDIEVRNRKWNQQPIHMACWDGHLEILKVLLEKNCDIESCDEWKRRPIHLACENGHTEIVKFLINLHCDIEAINDKAWRP-IHFGCWKGHSDIVKVLVEQNCDIEACDHLKRRPIHLACEKGHTEIVKVLIDHHCDISACGGRFNQSPIHLA 659
            +H A L G  D++  LI +N ++ V++      P++MA  + H    + LL    +     E    P+ +A + GH +IV  L  L  D+     K   P +H    K   +  K+L++ + + +        P+H+A   G+ +I  +L+++  D++    + N +P+H+A
Sbjct:  110 LHIASLAGQHDVINQLILYNANVNVQSLN-GFTPLYMAAQENHDNCCRTLLANGANPSLSTEDGFTPLAVAMQQGHDKIVAVL--LENDVRG---KVRLPALHIAAKKNDVNAAKLLLQHDPNADIVSKSGFTPLHIAAHYGNVDIATLLLNNKADVNYV-AKHNITPLHVA 274          

HSP 11 Score: 53.5286 bits (127), Expect = 1.277e-7
Identity = 32/153 (20.92%), Postives = 71/153 (46.41%), Query Frame = 3
Query:  249 IHMACWDGHLEILKVLLEKNCDIESCDEWKRRPIHLACENGHTEIVKFLINLHCDIEAINDKAWRPIHFGCWKGHSDIVKVLVEQNCDIEACDHLKRRPIHLACEKGHTEIVKVLIDHHCDISACGGRFNQSPIHLARKNNFTELIQLLTIHE 707
            +H+A  DG+++I   LL +   I++  +     +H+A   G  +++  LI  + ++   +   + P++    + H +  + L+    +          P+ +A ++GH +IV VL+++        G+     +H+A K N     +LL  H+
Sbjct:   77 LHLAAKDGYVDICCELLRRGIKIDNATKKGNTALHIASLAGQHDVINQLILYNANVNVQSLNGFTPLYMAAQENHDNCCRTLLANGANPSLSTEDGFTPLAVAMQQGHDKIVAVLLENDVR-----GKVRLPALHIAAKKNDVNAAKLLLQHD 224          
BLAST of SMED30015660 vs. Ensembl Fly
Match: Ank (gene:FBgn0011747 transcript:FBtr0300497)

HSP 1 Score: 96.2857 bits (238), Expect = 7.072e-22
Identity = 50/185 (27.03%), Postives = 96/185 (51.89%), Query Frame = 3
Query:  147 IHFACLKGDIDIVKVLIDHNCDIEVRNRKWNQQPIHMACWDGHLEILKVLLEKNCDIESCDEWKRRPIHLACENGHTEIVKFLINLHCDIEAINDKAWRPIHFGCWKGHSDIVKVLVEQNCDIEACDHLKRRPIHLACEKGHTEIVKVLIDHHCDISACGGRFNQSPIHLARKNNFTELIQLLTI 701
            IH AC K  ++I   L+ H  D+ + + K    P+H+A   G+++++++LLE    I +  +    P+H+A + GH  + + L+    +I       + P+H     GH D+VK  +E + DIE   ++   P+H A ++GH  I+ +L+ H  + +A     N + +H+A    +  +++ L I
Sbjct:  633 IHIACKKNYLEIAMQLLQHGADVNIIS-KSGFSPLHLAAQGGNVDMVQLLLEYGV-ISAAAKNGLTPLHVAAQEGHVLVSQILLEHGANISERTRNGYTPLHMAAHYGHLDLVKFFIENDADIEMSSNIGYTPLHQAAQQGHIMIINLLLRHKANPNALTKDGNTA-LHIASNLGYVTVMESLKI 814          

HSP 2 Score: 90.5077 bits (223), Expect = 6.680e-20
Identity = 52/187 (27.81%), Postives = 96/187 (51.34%), Query Frame = 3
Query:  138 RRPIHFACLKGDIDIVKVLIDHNCDIEVR-NRKWNQQPIHMACWDGHLEILKVLLEKNCDIESCDEWKRRPIHLACENGHTEIVKFLINLHCDIEAINDKAWRPIHFGCWKGHSDIVKVLVEQNCDIEACDHLKRRPIHLACEKGHTEIVKVLIDHHCDISACGGRFNQSPIHLARKNNFTELIQLL 695
            + P+H A   G+I+I+ +L+ H  +I  + N K++   +H+A  +G   I++VLLE   +  +  +    P+HLAC+ G   +V+ L+     I+        P+H      +  IV++L++       C    +  IH+AC+K + EI   L+ H  D++    +   SP+HLA +    +++QLL
Sbjct:  498 QTPLHVASRLGNINIIMLLLQHGAEINAQSNDKYSA--LHIAAKEGQENIVQVLLENGAENNAVTKKGFTPLHLACKYGKQNVVQILLQNGASIDFQGKNDVTPLHVATHYNNPSIVELLLKNGSSPNLCARNGQCAIHIACKKNYLEIAMQLLQHGADVNII-SKSGFSPLHLAAQGGNVDMVQLL 681          

HSP 3 Score: 87.0409 bits (214), Expect = 8.304e-19
Identity = 48/184 (26.09%), Postives = 95/184 (51.63%), Query Frame = 3
Query:  144 PIHFACLKGDIDIVKVLIDHNCDIEVRNRKWNQQPIHMACWDGHLEILKVLLEKNCDIESCDEWKRRPIHLACENGHTEIVKFLINLHCDIEAINDKAWRPIHFGCWKGHSDIVKVLVEQNCDIEACDHLKRRPIHLACEKGHTEIVKVLIDHHCDISACGGRFNQSPIHLARKNNFTELIQLL 695
            P+H AC  G  ++V++L+ +   I+ +  K +  P+H+A    +  I+++LL+       C    +  IH+AC+  + EI   L+    D+  I+   + P+H     G+ D+V++L+E    I A       P+H+A ++GH  + ++L++H  +IS    R   +P+H+A      +L++  
Sbjct:  566 PLHLACKYGKQNVVQILLQNGASIDFQG-KNDVTPLHVATHYNNPSIVELLLKNGSSPNLCARNGQCAIHIACKKNYLEIAMQLLQHGADVNIISKSGFSPLHLAAQGGNVDMVQLLLEYGV-ISAAAKNGLTPLHVAAQEGHVLVSQILLEHGANISE-RTRNGYTPLHMAAHYGHLDLVKFF 746          

HSP 4 Score: 85.8853 bits (211), Expect = 2.077e-18
Identity = 50/185 (27.03%), Postives = 96/185 (51.89%), Query Frame = 3
Query:  144 PIHFACLKGDIDIVKVLIDHNCDIEVRNRKWNQQPIHMACWDGHLEILKVLLEKNCDIESCDEWKRRPIHLACENGHTEIVKFLINLHCDIEAINDKAWRPIHFGCWKGHSDIVKVLVEQNCDIEACDHLKRRPIHLACEKGHTEIVKVLIDHHCDISACGGRFNQSPIHLARKNNFTEL-IQLL 695
            P+H A      DI+++L+  +  ++   R+  Q P+H+A   G++ I+ +LL+   +I +    K   +H+A + G   IV+ L+    +  A+  K + P+H  C  G  ++V++L++    I+        P+H+A    +  IV++L+ +    + C  R  Q  IH+A K N+ E+ +QLL
Sbjct:  468 PLHLAARANQADIIRILL-RSAKVDAIARE-GQTPLHVASRLGNINIIMLLLQHGAEINAQSNDKYSALHIAAKEGQENIVQVLLENGAENNAVTKKGFTPLHLACKYGKQNVVQILLQNGASIDFQGKNDVTPLHVATHYNNPSIVELLLKNGSSPNLC-ARNGQCAIHIACKKNYLEIAMQLL 649          

HSP 5 Score: 82.4185 bits (202), Expect = 3.385e-17
Identity = 40/150 (26.67%), Postives = 77/150 (51.33%), Query Frame = 3
Query:  144 PIHFACLKGDIDIVKVLIDHNCDIEVRNRKWNQQPIHMACWDGHLEILKVLLEKNCDIESCDEWKRRPIHLACENGHTEIVKFLINLHCDIEAINDKAWRPIHFGCWKGHSDIVKVLVEQNCDIEACDHLKRRPIHLACEKGHTEIVKVL 593
            P+H A   G++D+V++L+++   +     K    P+H+A  +GH+ + ++LLE   +I         P+H+A   GH ++VKF I    DIE  ++  + P+H    +GH  I+ +L+    +  A        +H+A   G+  +++ L
Sbjct:  665 PLHLAAQGGNVDMVQLLLEYG--VISAAAKNGLTPLHVAAQEGHVLVSQILLEHGANISERTRNGYTPLHMAAHYGHLDLVKFFIENDADIEMSSNIGYTPLHQAAQQGHIMIINLLLRHKANPNALTKDGNTALHIASNLGYVTVMESL 812          

HSP 6 Score: 78.5666 bits (192), Expect = 7.297e-16
Identity = 47/187 (25.13%), Postives = 91/187 (48.66%), Query Frame = 3
Query:  144 PIHFACLKGDIDIVKVLIDHNCDIEVRNRKWNQQPIHMACWDGHLEILKVLLEKNCDIESCDEWKRRPIHLACENGHTEIVKFLINLHCDIEAINDKAWRPIHFGCWKGHSDIVKVLVEQNCDIEACDHLKRRPIHLACEKGHTEIVKVLIDHHCDISACGGRFNQSPIHLARKNNFTELIQLLTIH 704
            P+H A   G++DI  +L+++  D+     K N  P+H+AC  G L +  +LL +   I++       P+H A  +GH E++K L+  +  I          +H      H +   +L++    ++         +H+A   GH ++ K+L+D+  + +A       +P+H+A K N  ++++LL  H
Sbjct:  237 PLHIAAHYGNVDIATLLLNNKADVNYV-AKHNITPLHVACKWGKLSLCTLLLCRGAKIDAATRDGLTPLHCASRSGHVEVIKHLLQQNAPILTKTKNGLSALHMAAQGEHDEAAHLLLDNKAPVDEVTVDYLTALHVAAHCGHVKVAKLLLDYKANPNARALN-GFTPLHIACKKNRIKMVELLIKH 421          

HSP 7 Score: 75.0998 bits (183), Expect = 1.064e-14
Identity = 48/186 (25.81%), Postives = 87/186 (46.77%), Query Frame = 3
Query:  144 PIHFACLKGDIDIVKVLIDHNCDIEVRNRKWNQQPIHMACWDGHLEILKVLLEKNCDIESCDEWKRRPIHLACENGHTEIVKFLINLHCDIEAINDKAWRPIHFGCWKGHSDIVKVLVEQNCDIEACDHLKRRPIHLACEKGHTEIVKVLIDHH--CDISACGGRFNQSPIHLARKNNFTELIQLL 695
            P+H A   G ++++K L+  N  I  +  K     +HMA    H E   +LL+    ++         +H+A   GH ++ K L++   +  A     + P+H  C K    +V++L++   +I A       P+H+A   G   IV  L+ H    D+    G   ++P+HLA + N  ++I++L
Sbjct:  303 PLHCASRSGHVEVIKHLLQQNAPILTKT-KNGLSALHMAAQGEHDEAAHLLLDNKAPVDEVTVDYLTALHVAAHCGHVKVAKLLLDYKANPNARALNGFTPLHIACKKNRIKMVELLIKHGANIGATTESGLTPLHVASFMGCINIVIYLLQHEASADLPTIRG---ETPLHLAARANQADIIRIL 484          

HSP 8 Score: 72.0182 bits (175), Expect = 1.033e-13
Identity = 42/183 (22.95%), Postives = 91/183 (49.73%), Query Frame = 3
Query:  147 IHFACLKGDIDIVKVLIDHNCDIEVRNRKWNQQPIHMACWDGHLEILKVLLEKNCDIESCDEWKRRPIHLACENGHTEIVKFLINLHCDIEAINDKAWRPIHFGCWKGHSDIVKVLVEQNCDIEACDHLKRRPIHLACEKGHTEIVKVLIDHHCDISACGGRFNQSPIHLARKNNFTELIQLL 695
            +H A   G + + K+L+D+  +   R       P+H+AC    ++++++L++   +I +  E    P+H+A   G   IV +L+      +    +   P+H       +DI+++L+ ++  ++A     + P+H+A   G+  I+ +L+ H  +I+A       S +H+A K     ++Q+L
Sbjct:  370 LHVAAHCGHVKVAKLLLDYKANPNARALN-GFTPLHIACKKNRIKMVELLIKHGANIGATTESGLTPLHVASFMGCINIVIYLLQHEASADLPTIRGETPLHLAARANQADIIRILL-RSAKVDAIAREGQTPLHVASRLGNINIIMLLLQHGAEINAQSND-KYSALHIAAKEGQENIVQVL 549          

HSP 9 Score: 61.6178 bits (148), Expect = 2.564e-10
Identity = 44/184 (23.91%), Postives = 82/184 (44.57%), Query Frame = 3
Query:  144 PIHFACLKGDIDIVKVLIDHNCDIEVRNRKWNQQPIHMACWDGHLEILKVLLEKNCDIESCDEWKRRPIHLACENGHTEIVKFLINLHCDIEAINDKAWRPIHFGCWKGHSDIVKVLVEQNCDIEACDHLKRRPIHLACEKGHTEIVKVLIDHHCDISACGGRFNQSPIHLARKNNFTELIQLL 695
            P+  A  +G   IV VL++++   +VR        +H+A     +   K+LL+ + + +   +    P+H+A   G+ +I   L+N   D+  +      P+H  C  G   +  +L+ +   I+A       P+H A   GH E++K L+  +  I     +   S +H+A +    E   LL
Sbjct:  175 PLAVAMQQGHDKIVAVLLENDVRGKVR-----LPALHIAAKKNDVNAAKLLLQHDPNADIVSKSGFTPLHIAAHYGNVDIATLLLNNKADVNYVAKHNITPLHVACKWGKLSLCTLLLCRGAKIDAATRDGLTPLHCASRSGHVEVIKHLLQQNAPI-LTKTKNGLSALHMAAQGEHDEAAHLL 352          

HSP 10 Score: 61.6178 bits (148), Expect = 2.834e-10
Identity = 42/172 (24.42%), Postives = 82/172 (47.67%), Query Frame = 3
Query:  147 IHFACLKGDIDIVKVLIDHNCDIEVRNRKWNQQPIHMACWDGHLEILKVLLEKNCDIESCDEWKRRPIHLACENGHTEIVKFLINLHCDIEAINDKAWRP-IHFGCWKGHSDIVKVLVEQNCDIEACDHLKRRPIHLACEKGHTEIVKVLIDHHCDISACGGRFNQSPIHLA 659
            +H A L G  D++  LI +N ++ V++      P++MA  + H    + LL    +     E    P+ +A + GH +IV  L  L  D+     K   P +H    K   +  K+L++ + + +        P+H+A   G+ +I  +L+++  D++    + N +P+H+A
Sbjct:  110 LHIASLAGQHDVINQLILYNANVNVQSLN-GFTPLYMAAQENHDNCCRTLLANGANPSLSTEDGFTPLAVAMQQGHDKIVAVL--LENDVRG---KVRLPALHIAAKKNDVNAAKLLLQHDPNADIVSKSGFTPLHIAAHYGNVDIATLLLNNKADVNYV-AKHNITPLHVA 274          

HSP 11 Score: 53.5286 bits (127), Expect = 1.277e-7
Identity = 32/153 (20.92%), Postives = 71/153 (46.41%), Query Frame = 3
Query:  249 IHMACWDGHLEILKVLLEKNCDIESCDEWKRRPIHLACENGHTEIVKFLINLHCDIEAINDKAWRPIHFGCWKGHSDIVKVLVEQNCDIEACDHLKRRPIHLACEKGHTEIVKVLIDHHCDISACGGRFNQSPIHLARKNNFTELIQLLTIHE 707
            +H+A  DG+++I   LL +   I++  +     +H+A   G  +++  LI  + ++   +   + P++    + H +  + L+    +          P+ +A ++GH +IV VL+++        G+     +H+A K N     +LL  H+
Sbjct:   77 LHLAAKDGYVDICCELLRRGIKIDNATKKGNTALHIASLAGQHDVINQLILYNANVNVQSLNGFTPLYMAAQENHDNCCRTLLANGANPSLSTEDGFTPLAVAMQQGHDKIVAVLLENDVR-----GKVRLPALHIAAKKNDVNAAKLLLQHD 224          
BLAST of SMED30015660 vs. Ensembl Fly
Match: Ank (gene:FBgn0011747 transcript:FBtr0089171)

HSP 1 Score: 96.2857 bits (238), Expect = 7.072e-22
Identity = 50/185 (27.03%), Postives = 96/185 (51.89%), Query Frame = 3
Query:  147 IHFACLKGDIDIVKVLIDHNCDIEVRNRKWNQQPIHMACWDGHLEILKVLLEKNCDIESCDEWKRRPIHLACENGHTEIVKFLINLHCDIEAINDKAWRPIHFGCWKGHSDIVKVLVEQNCDIEACDHLKRRPIHLACEKGHTEIVKVLIDHHCDISACGGRFNQSPIHLARKNNFTELIQLLTI 701
            IH AC K  ++I   L+ H  D+ + + K    P+H+A   G+++++++LLE    I +  +    P+H+A + GH  + + L+    +I       + P+H     GH D+VK  +E + DIE   ++   P+H A ++GH  I+ +L+ H  + +A     N + +H+A    +  +++ L I
Sbjct:  633 IHIACKKNYLEIAMQLLQHGADVNIIS-KSGFSPLHLAAQGGNVDMVQLLLEYGV-ISAAAKNGLTPLHVAAQEGHVLVSQILLEHGANISERTRNGYTPLHMAAHYGHLDLVKFFIENDADIEMSSNIGYTPLHQAAQQGHIMIINLLLRHKANPNALTKDGNTA-LHIASNLGYVTVMESLKI 814          

HSP 2 Score: 90.5077 bits (223), Expect = 6.680e-20
Identity = 52/187 (27.81%), Postives = 96/187 (51.34%), Query Frame = 3
Query:  138 RRPIHFACLKGDIDIVKVLIDHNCDIEVR-NRKWNQQPIHMACWDGHLEILKVLLEKNCDIESCDEWKRRPIHLACENGHTEIVKFLINLHCDIEAINDKAWRPIHFGCWKGHSDIVKVLVEQNCDIEACDHLKRRPIHLACEKGHTEIVKVLIDHHCDISACGGRFNQSPIHLARKNNFTELIQLL 695
            + P+H A   G+I+I+ +L+ H  +I  + N K++   +H+A  +G   I++VLLE   +  +  +    P+HLAC+ G   +V+ L+     I+        P+H      +  IV++L++       C    +  IH+AC+K + EI   L+ H  D++    +   SP+HLA +    +++QLL
Sbjct:  498 QTPLHVASRLGNINIIMLLLQHGAEINAQSNDKYSA--LHIAAKEGQENIVQVLLENGAENNAVTKKGFTPLHLACKYGKQNVVQILLQNGASIDFQGKNDVTPLHVATHYNNPSIVELLLKNGSSPNLCARNGQCAIHIACKKNYLEIAMQLLQHGADVNII-SKSGFSPLHLAAQGGNVDMVQLL 681          

HSP 3 Score: 87.0409 bits (214), Expect = 8.304e-19
Identity = 48/184 (26.09%), Postives = 95/184 (51.63%), Query Frame = 3
Query:  144 PIHFACLKGDIDIVKVLIDHNCDIEVRNRKWNQQPIHMACWDGHLEILKVLLEKNCDIESCDEWKRRPIHLACENGHTEIVKFLINLHCDIEAINDKAWRPIHFGCWKGHSDIVKVLVEQNCDIEACDHLKRRPIHLACEKGHTEIVKVLIDHHCDISACGGRFNQSPIHLARKNNFTELIQLL 695
            P+H AC  G  ++V++L+ +   I+ +  K +  P+H+A    +  I+++LL+       C    +  IH+AC+  + EI   L+    D+  I+   + P+H     G+ D+V++L+E    I A       P+H+A ++GH  + ++L++H  +IS    R   +P+H+A      +L++  
Sbjct:  566 PLHLACKYGKQNVVQILLQNGASIDFQG-KNDVTPLHVATHYNNPSIVELLLKNGSSPNLCARNGQCAIHIACKKNYLEIAMQLLQHGADVNIISKSGFSPLHLAAQGGNVDMVQLLLEYGV-ISAAAKNGLTPLHVAAQEGHVLVSQILLEHGANISE-RTRNGYTPLHMAAHYGHLDLVKFF 746          

HSP 4 Score: 85.8853 bits (211), Expect = 2.077e-18
Identity = 50/185 (27.03%), Postives = 96/185 (51.89%), Query Frame = 3
Query:  144 PIHFACLKGDIDIVKVLIDHNCDIEVRNRKWNQQPIHMACWDGHLEILKVLLEKNCDIESCDEWKRRPIHLACENGHTEIVKFLINLHCDIEAINDKAWRPIHFGCWKGHSDIVKVLVEQNCDIEACDHLKRRPIHLACEKGHTEIVKVLIDHHCDISACGGRFNQSPIHLARKNNFTEL-IQLL 695
            P+H A      DI+++L+  +  ++   R+  Q P+H+A   G++ I+ +LL+   +I +    K   +H+A + G   IV+ L+    +  A+  K + P+H  C  G  ++V++L++    I+        P+H+A    +  IV++L+ +    + C  R  Q  IH+A K N+ E+ +QLL
Sbjct:  468 PLHLAARANQADIIRILL-RSAKVDAIARE-GQTPLHVASRLGNINIIMLLLQHGAEINAQSNDKYSALHIAAKEGQENIVQVLLENGAENNAVTKKGFTPLHLACKYGKQNVVQILLQNGASIDFQGKNDVTPLHVATHYNNPSIVELLLKNGSSPNLC-ARNGQCAIHIACKKNYLEIAMQLL 649          

HSP 5 Score: 82.4185 bits (202), Expect = 3.385e-17
Identity = 40/150 (26.67%), Postives = 77/150 (51.33%), Query Frame = 3
Query:  144 PIHFACLKGDIDIVKVLIDHNCDIEVRNRKWNQQPIHMACWDGHLEILKVLLEKNCDIESCDEWKRRPIHLACENGHTEIVKFLINLHCDIEAINDKAWRPIHFGCWKGHSDIVKVLVEQNCDIEACDHLKRRPIHLACEKGHTEIVKVL 593
            P+H A   G++D+V++L+++   +     K    P+H+A  +GH+ + ++LLE   +I         P+H+A   GH ++VKF I    DIE  ++  + P+H    +GH  I+ +L+    +  A        +H+A   G+  +++ L
Sbjct:  665 PLHLAAQGGNVDMVQLLLEYG--VISAAAKNGLTPLHVAAQEGHVLVSQILLEHGANISERTRNGYTPLHMAAHYGHLDLVKFFIENDADIEMSSNIGYTPLHQAAQQGHIMIINLLLRHKANPNALTKDGNTALHIASNLGYVTVMESL 812          

HSP 6 Score: 78.5666 bits (192), Expect = 7.297e-16
Identity = 47/187 (25.13%), Postives = 91/187 (48.66%), Query Frame = 3
Query:  144 PIHFACLKGDIDIVKVLIDHNCDIEVRNRKWNQQPIHMACWDGHLEILKVLLEKNCDIESCDEWKRRPIHLACENGHTEIVKFLINLHCDIEAINDKAWRPIHFGCWKGHSDIVKVLVEQNCDIEACDHLKRRPIHLACEKGHTEIVKVLIDHHCDISACGGRFNQSPIHLARKNNFTELIQLLTIH 704
            P+H A   G++DI  +L+++  D+     K N  P+H+AC  G L +  +LL +   I++       P+H A  +GH E++K L+  +  I          +H      H +   +L++    ++         +H+A   GH ++ K+L+D+  + +A       +P+H+A K N  ++++LL  H
Sbjct:  237 PLHIAAHYGNVDIATLLLNNKADVNYV-AKHNITPLHVACKWGKLSLCTLLLCRGAKIDAATRDGLTPLHCASRSGHVEVIKHLLQQNAPILTKTKNGLSALHMAAQGEHDEAAHLLLDNKAPVDEVTVDYLTALHVAAHCGHVKVAKLLLDYKANPNARALN-GFTPLHIACKKNRIKMVELLIKH 421          

HSP 7 Score: 75.0998 bits (183), Expect = 1.064e-14
Identity = 48/186 (25.81%), Postives = 87/186 (46.77%), Query Frame = 3
Query:  144 PIHFACLKGDIDIVKVLIDHNCDIEVRNRKWNQQPIHMACWDGHLEILKVLLEKNCDIESCDEWKRRPIHLACENGHTEIVKFLINLHCDIEAINDKAWRPIHFGCWKGHSDIVKVLVEQNCDIEACDHLKRRPIHLACEKGHTEIVKVLIDHH--CDISACGGRFNQSPIHLARKNNFTELIQLL 695
            P+H A   G ++++K L+  N  I  +  K     +HMA    H E   +LL+    ++         +H+A   GH ++ K L++   +  A     + P+H  C K    +V++L++   +I A       P+H+A   G   IV  L+ H    D+    G   ++P+HLA + N  ++I++L
Sbjct:  303 PLHCASRSGHVEVIKHLLQQNAPILTKT-KNGLSALHMAAQGEHDEAAHLLLDNKAPVDEVTVDYLTALHVAAHCGHVKVAKLLLDYKANPNARALNGFTPLHIACKKNRIKMVELLIKHGANIGATTESGLTPLHVASFMGCINIVIYLLQHEASADLPTIRG---ETPLHLAARANQADIIRIL 484          

HSP 8 Score: 72.0182 bits (175), Expect = 1.033e-13
Identity = 42/183 (22.95%), Postives = 91/183 (49.73%), Query Frame = 3
Query:  147 IHFACLKGDIDIVKVLIDHNCDIEVRNRKWNQQPIHMACWDGHLEILKVLLEKNCDIESCDEWKRRPIHLACENGHTEIVKFLINLHCDIEAINDKAWRPIHFGCWKGHSDIVKVLVEQNCDIEACDHLKRRPIHLACEKGHTEIVKVLIDHHCDISACGGRFNQSPIHLARKNNFTELIQLL 695
            +H A   G + + K+L+D+  +   R       P+H+AC    ++++++L++   +I +  E    P+H+A   G   IV +L+      +    +   P+H       +DI+++L+ ++  ++A     + P+H+A   G+  I+ +L+ H  +I+A       S +H+A K     ++Q+L
Sbjct:  370 LHVAAHCGHVKVAKLLLDYKANPNARALN-GFTPLHIACKKNRIKMVELLIKHGANIGATTESGLTPLHVASFMGCINIVIYLLQHEASADLPTIRGETPLHLAARANQADIIRILL-RSAKVDAIAREGQTPLHVASRLGNINIIMLLLQHGAEINAQSND-KYSALHIAAKEGQENIVQVL 549          

HSP 9 Score: 61.6178 bits (148), Expect = 2.564e-10
Identity = 44/184 (23.91%), Postives = 82/184 (44.57%), Query Frame = 3
Query:  144 PIHFACLKGDIDIVKVLIDHNCDIEVRNRKWNQQPIHMACWDGHLEILKVLLEKNCDIESCDEWKRRPIHLACENGHTEIVKFLINLHCDIEAINDKAWRPIHFGCWKGHSDIVKVLVEQNCDIEACDHLKRRPIHLACEKGHTEIVKVLIDHHCDISACGGRFNQSPIHLARKNNFTELIQLL 695
            P+  A  +G   IV VL++++   +VR        +H+A     +   K+LL+ + + +   +    P+H+A   G+ +I   L+N   D+  +      P+H  C  G   +  +L+ +   I+A       P+H A   GH E++K L+  +  I     +   S +H+A +    E   LL
Sbjct:  175 PLAVAMQQGHDKIVAVLLENDVRGKVR-----LPALHIAAKKNDVNAAKLLLQHDPNADIVSKSGFTPLHIAAHYGNVDIATLLLNNKADVNYVAKHNITPLHVACKWGKLSLCTLLLCRGAKIDAATRDGLTPLHCASRSGHVEVIKHLLQQNAPI-LTKTKNGLSALHMAAQGEHDEAAHLL 352          

HSP 10 Score: 61.6178 bits (148), Expect = 2.834e-10
Identity = 42/172 (24.42%), Postives = 82/172 (47.67%), Query Frame = 3
Query:  147 IHFACLKGDIDIVKVLIDHNCDIEVRNRKWNQQPIHMACWDGHLEILKVLLEKNCDIESCDEWKRRPIHLACENGHTEIVKFLINLHCDIEAINDKAWRP-IHFGCWKGHSDIVKVLVEQNCDIEACDHLKRRPIHLACEKGHTEIVKVLIDHHCDISACGGRFNQSPIHLA 659
            +H A L G  D++  LI +N ++ V++      P++MA  + H    + LL    +     E    P+ +A + GH +IV  L  L  D+     K   P +H    K   +  K+L++ + + +        P+H+A   G+ +I  +L+++  D++    + N +P+H+A
Sbjct:  110 LHIASLAGQHDVINQLILYNANVNVQSLN-GFTPLYMAAQENHDNCCRTLLANGANPSLSTEDGFTPLAVAMQQGHDKIVAVL--LENDVRG---KVRLPALHIAAKKNDVNAAKLLLQHDPNADIVSKSGFTPLHIAAHYGNVDIATLLLNNKADVNYV-AKHNITPLHVA 274          

HSP 11 Score: 53.5286 bits (127), Expect = 1.277e-7
Identity = 32/153 (20.92%), Postives = 71/153 (46.41%), Query Frame = 3
Query:  249 IHMACWDGHLEILKVLLEKNCDIESCDEWKRRPIHLACENGHTEIVKFLINLHCDIEAINDKAWRPIHFGCWKGHSDIVKVLVEQNCDIEACDHLKRRPIHLACEKGHTEIVKVLIDHHCDISACGGRFNQSPIHLARKNNFTELIQLLTIHE 707
            +H+A  DG+++I   LL +   I++  +     +H+A   G  +++  LI  + ++   +   + P++    + H +  + L+    +          P+ +A ++GH +IV VL+++        G+     +H+A K N     +LL  H+
Sbjct:   77 LHLAAKDGYVDICCELLRRGIKIDNATKKGNTALHIASLAGQHDVINQLILYNANVNVQSLNGFTPLYMAAQENHDNCCRTLLANGANPSLSTEDGFTPLAVAMQQGHDKIVAVLLENDVR-----GKVRLPALHIAAKKNDVNAAKLLLQHD 224          
BLAST of SMED30015660 vs. Ensembl Fly
Match: Ank (gene:FBgn0011747 transcript:FBtr0089173)

HSP 1 Score: 96.2857 bits (238), Expect = 7.072e-22
Identity = 50/185 (27.03%), Postives = 96/185 (51.89%), Query Frame = 3
Query:  147 IHFACLKGDIDIVKVLIDHNCDIEVRNRKWNQQPIHMACWDGHLEILKVLLEKNCDIESCDEWKRRPIHLACENGHTEIVKFLINLHCDIEAINDKAWRPIHFGCWKGHSDIVKVLVEQNCDIEACDHLKRRPIHLACEKGHTEIVKVLIDHHCDISACGGRFNQSPIHLARKNNFTELIQLLTI 701
            IH AC K  ++I   L+ H  D+ + + K    P+H+A   G+++++++LLE    I +  +    P+H+A + GH  + + L+    +I       + P+H     GH D+VK  +E + DIE   ++   P+H A ++GH  I+ +L+ H  + +A     N + +H+A    +  +++ L I
Sbjct:  633 IHIACKKNYLEIAMQLLQHGADVNIIS-KSGFSPLHLAAQGGNVDMVQLLLEYGV-ISAAAKNGLTPLHVAAQEGHVLVSQILLEHGANISERTRNGYTPLHMAAHYGHLDLVKFFIENDADIEMSSNIGYTPLHQAAQQGHIMIINLLLRHKANPNALTKDGNTA-LHIASNLGYVTVMESLKI 814          

HSP 2 Score: 90.5077 bits (223), Expect = 6.680e-20
Identity = 52/187 (27.81%), Postives = 96/187 (51.34%), Query Frame = 3
Query:  138 RRPIHFACLKGDIDIVKVLIDHNCDIEVR-NRKWNQQPIHMACWDGHLEILKVLLEKNCDIESCDEWKRRPIHLACENGHTEIVKFLINLHCDIEAINDKAWRPIHFGCWKGHSDIVKVLVEQNCDIEACDHLKRRPIHLACEKGHTEIVKVLIDHHCDISACGGRFNQSPIHLARKNNFTELIQLL 695
            + P+H A   G+I+I+ +L+ H  +I  + N K++   +H+A  +G   I++VLLE   +  +  +    P+HLAC+ G   +V+ L+     I+        P+H      +  IV++L++       C    +  IH+AC+K + EI   L+ H  D++    +   SP+HLA +    +++QLL
Sbjct:  498 QTPLHVASRLGNINIIMLLLQHGAEINAQSNDKYSA--LHIAAKEGQENIVQVLLENGAENNAVTKKGFTPLHLACKYGKQNVVQILLQNGASIDFQGKNDVTPLHVATHYNNPSIVELLLKNGSSPNLCARNGQCAIHIACKKNYLEIAMQLLQHGADVNII-SKSGFSPLHLAAQGGNVDMVQLL 681          

HSP 3 Score: 87.0409 bits (214), Expect = 8.304e-19
Identity = 48/184 (26.09%), Postives = 95/184 (51.63%), Query Frame = 3
Query:  144 PIHFACLKGDIDIVKVLIDHNCDIEVRNRKWNQQPIHMACWDGHLEILKVLLEKNCDIESCDEWKRRPIHLACENGHTEIVKFLINLHCDIEAINDKAWRPIHFGCWKGHSDIVKVLVEQNCDIEACDHLKRRPIHLACEKGHTEIVKVLIDHHCDISACGGRFNQSPIHLARKNNFTELIQLL 695
            P+H AC  G  ++V++L+ +   I+ +  K +  P+H+A    +  I+++LL+       C    +  IH+AC+  + EI   L+    D+  I+   + P+H     G+ D+V++L+E    I A       P+H+A ++GH  + ++L++H  +IS    R   +P+H+A      +L++  
Sbjct:  566 PLHLACKYGKQNVVQILLQNGASIDFQG-KNDVTPLHVATHYNNPSIVELLLKNGSSPNLCARNGQCAIHIACKKNYLEIAMQLLQHGADVNIISKSGFSPLHLAAQGGNVDMVQLLLEYGV-ISAAAKNGLTPLHVAAQEGHVLVSQILLEHGANISE-RTRNGYTPLHMAAHYGHLDLVKFF 746          

HSP 4 Score: 85.8853 bits (211), Expect = 2.077e-18
Identity = 50/185 (27.03%), Postives = 96/185 (51.89%), Query Frame = 3
Query:  144 PIHFACLKGDIDIVKVLIDHNCDIEVRNRKWNQQPIHMACWDGHLEILKVLLEKNCDIESCDEWKRRPIHLACENGHTEIVKFLINLHCDIEAINDKAWRPIHFGCWKGHSDIVKVLVEQNCDIEACDHLKRRPIHLACEKGHTEIVKVLIDHHCDISACGGRFNQSPIHLARKNNFTEL-IQLL 695
            P+H A      DI+++L+  +  ++   R+  Q P+H+A   G++ I+ +LL+   +I +    K   +H+A + G   IV+ L+    +  A+  K + P+H  C  G  ++V++L++    I+        P+H+A    +  IV++L+ +    + C  R  Q  IH+A K N+ E+ +QLL
Sbjct:  468 PLHLAARANQADIIRILL-RSAKVDAIARE-GQTPLHVASRLGNINIIMLLLQHGAEINAQSNDKYSALHIAAKEGQENIVQVLLENGAENNAVTKKGFTPLHLACKYGKQNVVQILLQNGASIDFQGKNDVTPLHVATHYNNPSIVELLLKNGSSPNLC-ARNGQCAIHIACKKNYLEIAMQLL 649          

HSP 5 Score: 82.4185 bits (202), Expect = 3.385e-17
Identity = 40/150 (26.67%), Postives = 77/150 (51.33%), Query Frame = 3
Query:  144 PIHFACLKGDIDIVKVLIDHNCDIEVRNRKWNQQPIHMACWDGHLEILKVLLEKNCDIESCDEWKRRPIHLACENGHTEIVKFLINLHCDIEAINDKAWRPIHFGCWKGHSDIVKVLVEQNCDIEACDHLKRRPIHLACEKGHTEIVKVL 593
            P+H A   G++D+V++L+++   +     K    P+H+A  +GH+ + ++LLE   +I         P+H+A   GH ++VKF I    DIE  ++  + P+H    +GH  I+ +L+    +  A        +H+A   G+  +++ L
Sbjct:  665 PLHLAAQGGNVDMVQLLLEYG--VISAAAKNGLTPLHVAAQEGHVLVSQILLEHGANISERTRNGYTPLHMAAHYGHLDLVKFFIENDADIEMSSNIGYTPLHQAAQQGHIMIINLLLRHKANPNALTKDGNTALHIASNLGYVTVMESL 812          

HSP 6 Score: 78.5666 bits (192), Expect = 7.297e-16
Identity = 47/187 (25.13%), Postives = 91/187 (48.66%), Query Frame = 3
Query:  144 PIHFACLKGDIDIVKVLIDHNCDIEVRNRKWNQQPIHMACWDGHLEILKVLLEKNCDIESCDEWKRRPIHLACENGHTEIVKFLINLHCDIEAINDKAWRPIHFGCWKGHSDIVKVLVEQNCDIEACDHLKRRPIHLACEKGHTEIVKVLIDHHCDISACGGRFNQSPIHLARKNNFTELIQLLTIH 704
            P+H A   G++DI  +L+++  D+     K N  P+H+AC  G L +  +LL +   I++       P+H A  +GH E++K L+  +  I          +H      H +   +L++    ++         +H+A   GH ++ K+L+D+  + +A       +P+H+A K N  ++++LL  H
Sbjct:  237 PLHIAAHYGNVDIATLLLNNKADVNYV-AKHNITPLHVACKWGKLSLCTLLLCRGAKIDAATRDGLTPLHCASRSGHVEVIKHLLQQNAPILTKTKNGLSALHMAAQGEHDEAAHLLLDNKAPVDEVTVDYLTALHVAAHCGHVKVAKLLLDYKANPNARALN-GFTPLHIACKKNRIKMVELLIKH 421          

HSP 7 Score: 75.0998 bits (183), Expect = 1.064e-14
Identity = 48/186 (25.81%), Postives = 87/186 (46.77%), Query Frame = 3
Query:  144 PIHFACLKGDIDIVKVLIDHNCDIEVRNRKWNQQPIHMACWDGHLEILKVLLEKNCDIESCDEWKRRPIHLACENGHTEIVKFLINLHCDIEAINDKAWRPIHFGCWKGHSDIVKVLVEQNCDIEACDHLKRRPIHLACEKGHTEIVKVLIDHH--CDISACGGRFNQSPIHLARKNNFTELIQLL 695
            P+H A   G ++++K L+  N  I  +  K     +HMA    H E   +LL+    ++         +H+A   GH ++ K L++   +  A     + P+H  C K    +V++L++   +I A       P+H+A   G   IV  L+ H    D+    G   ++P+HLA + N  ++I++L
Sbjct:  303 PLHCASRSGHVEVIKHLLQQNAPILTKT-KNGLSALHMAAQGEHDEAAHLLLDNKAPVDEVTVDYLTALHVAAHCGHVKVAKLLLDYKANPNARALNGFTPLHIACKKNRIKMVELLIKHGANIGATTESGLTPLHVASFMGCINIVIYLLQHEASADLPTIRG---ETPLHLAARANQADIIRIL 484          

HSP 8 Score: 72.0182 bits (175), Expect = 1.033e-13
Identity = 42/183 (22.95%), Postives = 91/183 (49.73%), Query Frame = 3
Query:  147 IHFACLKGDIDIVKVLIDHNCDIEVRNRKWNQQPIHMACWDGHLEILKVLLEKNCDIESCDEWKRRPIHLACENGHTEIVKFLINLHCDIEAINDKAWRPIHFGCWKGHSDIVKVLVEQNCDIEACDHLKRRPIHLACEKGHTEIVKVLIDHHCDISACGGRFNQSPIHLARKNNFTELIQLL 695
            +H A   G + + K+L+D+  +   R       P+H+AC    ++++++L++   +I +  E    P+H+A   G   IV +L+      +    +   P+H       +DI+++L+ ++  ++A     + P+H+A   G+  I+ +L+ H  +I+A       S +H+A K     ++Q+L
Sbjct:  370 LHVAAHCGHVKVAKLLLDYKANPNARALN-GFTPLHIACKKNRIKMVELLIKHGANIGATTESGLTPLHVASFMGCINIVIYLLQHEASADLPTIRGETPLHLAARANQADIIRILL-RSAKVDAIAREGQTPLHVASRLGNINIIMLLLQHGAEINAQSND-KYSALHIAAKEGQENIVQVL 549          

HSP 9 Score: 61.6178 bits (148), Expect = 2.564e-10
Identity = 44/184 (23.91%), Postives = 82/184 (44.57%), Query Frame = 3
Query:  144 PIHFACLKGDIDIVKVLIDHNCDIEVRNRKWNQQPIHMACWDGHLEILKVLLEKNCDIESCDEWKRRPIHLACENGHTEIVKFLINLHCDIEAINDKAWRPIHFGCWKGHSDIVKVLVEQNCDIEACDHLKRRPIHLACEKGHTEIVKVLIDHHCDISACGGRFNQSPIHLARKNNFTELIQLL 695
            P+  A  +G   IV VL++++   +VR        +H+A     +   K+LL+ + + +   +    P+H+A   G+ +I   L+N   D+  +      P+H  C  G   +  +L+ +   I+A       P+H A   GH E++K L+  +  I     +   S +H+A +    E   LL
Sbjct:  175 PLAVAMQQGHDKIVAVLLENDVRGKVR-----LPALHIAAKKNDVNAAKLLLQHDPNADIVSKSGFTPLHIAAHYGNVDIATLLLNNKADVNYVAKHNITPLHVACKWGKLSLCTLLLCRGAKIDAATRDGLTPLHCASRSGHVEVIKHLLQQNAPI-LTKTKNGLSALHMAAQGEHDEAAHLL 352          

HSP 10 Score: 61.6178 bits (148), Expect = 2.834e-10
Identity = 42/172 (24.42%), Postives = 82/172 (47.67%), Query Frame = 3
Query:  147 IHFACLKGDIDIVKVLIDHNCDIEVRNRKWNQQPIHMACWDGHLEILKVLLEKNCDIESCDEWKRRPIHLACENGHTEIVKFLINLHCDIEAINDKAWRP-IHFGCWKGHSDIVKVLVEQNCDIEACDHLKRRPIHLACEKGHTEIVKVLIDHHCDISACGGRFNQSPIHLA 659
            +H A L G  D++  LI +N ++ V++      P++MA  + H    + LL    +     E    P+ +A + GH +IV  L  L  D+     K   P +H    K   +  K+L++ + + +        P+H+A   G+ +I  +L+++  D++    + N +P+H+A
Sbjct:  110 LHIASLAGQHDVINQLILYNANVNVQSLN-GFTPLYMAAQENHDNCCRTLLANGANPSLSTEDGFTPLAVAMQQGHDKIVAVL--LENDVRG---KVRLPALHIAAKKNDVNAAKLLLQHDPNADIVSKSGFTPLHIAAHYGNVDIATLLLNNKADVNYV-AKHNITPLHVA 274          

HSP 11 Score: 53.5286 bits (127), Expect = 1.277e-7
Identity = 32/153 (20.92%), Postives = 71/153 (46.41%), Query Frame = 3
Query:  249 IHMACWDGHLEILKVLLEKNCDIESCDEWKRRPIHLACENGHTEIVKFLINLHCDIEAINDKAWRPIHFGCWKGHSDIVKVLVEQNCDIEACDHLKRRPIHLACEKGHTEIVKVLIDHHCDISACGGRFNQSPIHLARKNNFTELIQLLTIHE 707
            +H+A  DG+++I   LL +   I++  +     +H+A   G  +++  LI  + ++   +   + P++    + H +  + L+    +          P+ +A ++GH +IV VL+++        G+     +H+A K N     +LL  H+
Sbjct:   77 LHLAAKDGYVDICCELLRRGIKIDNATKKGNTALHIASLAGQHDVINQLILYNANVNVQSLNGFTPLYMAAQENHDNCCRTLLANGANPSLSTEDGFTPLAVAMQQGHDKIVAVLLENDVR-----GKVRLPALHIAAKKNDVNAAKLLLQHD 224          
BLAST of SMED30015660 vs. Ensembl Fly
Match: Patsas (gene:FBgn0029137 transcript:FBtr0474166)

HSP 1 Score: 92.4337 bits (228), Expect = 1.174e-20
Identity = 47/185 (25.41%), Postives = 95/185 (51.35%), Query Frame = 3
Query:  144 PIHFACLKGDIDIVKVLIDHNCDIEVR-NRKWNQQPIHMACWDGHLEILKVLLEKNCDIESCDEWKRRPIHLACENGHTEIVKFLINLHCDIEAINDKAWRPIHFGCWKGHSDIVKVLVEQNCDIEACDHLKRRPIHLACEKGHTEIVKVLIDHHCDISACGGRFNQSPIHLARKNNFTELIQLL 695
            P H+  L G++ +++ LI+    I++        +PIH AC  GH  +++VLL+    + + D     P+HLAC  G T    +L+ +       +      +H+  +KGH+D++++L+    +++  D+    P+HLAC  G+   V++L +          +  ++PI LA+ +   ++++LL
Sbjct:  152 PAHWIALNGNVQLMRYLIERTAPIDLPCLGTQGPRPIHWACRKGHASVVQVLLQAGVAVNAADFKGLTPLHLACMYGRTATAAYLLGMGALNNLTDINGDTALHWAAYKGHADLMRLLMYSGVELQKTDNFGSTPLHLACLSGNMTCVRLLCEKSQLDLEPRDKNGKTPIMLAQAHQHQDVVRLL 336          

HSP 2 Score: 72.0182 bits (175), Expect = 8.386e-14
Identity = 42/152 (27.63%), Postives = 73/152 (48.03%), Query Frame = 3
Query:  141 RPIHFACLKGDIDIVKVLIDHNCDIEVRNRKWNQQPIHMACWDGHLEILKVLLEKNCDIESCDEWKRRPIHLACENGHTEIVKFLINLHCDIEAINDKAWRPIHFGCWKGHSDIVKVLVEQN-CDIEACDHLKRRPIHLACEKGHTEIVKVL 593
            RPIH+AC KG   +V+VL+     +   + K    P+H+AC  G       LL         D      +H A   GH ++++ L+    +++  ++    P+H  C  G+   V++L E++  D+E  D   + PI LA    H ++V++L
Sbjct:  186 RPIHWACRKGHASVVQVLLQAGVAVNAADFK-GLTPLHLACMYGRTATAAYLLGMGALNNLTDINGDTALHWAAYKGHADLMRLLMYSGVELQKTDNFGSTPLHLACLSGNMTCVRLLCEKSQLDLEPRDKNGKTPIMLAQAHQHQDVVRLL 336          
BLAST of SMED30015660 vs. Ensembl Zebrafish
Match: ripk4 (receptor-interacting serine-threonine kinase 4 [Source:ZFIN;Acc:ZDB-GENE-040426-2042])

HSP 1 Score: 105.916 bits (263), Expect = 4.351e-25
Identity = 56/188 (29.79%), Postives = 100/188 (53.19%), Query Frame = 3
Query:  138 RRPIHFACLKGDIDIVKVLIDHNCDIEVRNR-KWNQQPIHMACWDGHLEILKVLLEK-NCDIESCDEWKRRPIHLACENGHTEIVKFLINLHCDIEAINDKAWRPIHFGCWKGHSDIVKVLVEQNCDIEACDHLKRRPIHLACEKGHTEIVKVLIDHHCDISACGGRFNQSPIHLARKNNFTELIQLL 695
            R P H AC  G  ++V+VL+    D+ V+ +  W    +H+A W GHL I+K+L+++   D++      R P+HLA + G   + + L+ L  ++   +D  + P+H     GH+   ++LV+ + DI++        +HLA +KGH   VK+L+    D  +      ++P HLA +N   E+++ L
Sbjct:  507 RTPTHIACHHGQENVVRVLLSRGADVHVKGKDDWTA--LHLAAWKGHLGIVKLLVKQAGADVDGQTSDGRSPLHLASQRGQYRVARILVELGANVHLTSDDLYAPLHVAAETGHTSTSRLLVKHDADIKSRTANGCTALHLASQKGHLPTVKMLLAEGADPESVNHDL-RTPCHLAAQNGHCEVLKEL 691          

HSP 2 Score: 95.9005 bits (237), Expect = 1.221e-21
Identity = 51/190 (26.84%), Postives = 94/190 (49.47%), Query Frame = 3
Query:  144 PIHFACLKGDIDIVKVLIDHNCDIEVRNRKWNQ-QPIHMACWDGHLEILKVLLEKNCDIESCDEWKRRPIHLACENGHTEIVKFLINLHCDIEAINDKAWRPIHFGCWKGHSDIVKVLVEQ-NCDIEACDHLKRRPIHLACEKGHTEIVKVLIDHHCDISACGGRFNQSPIHLARKNNFTELIQLLTIHE 707
            P+H A  K    + ++L+       V  +  +Q  P+H A  +G   + ++LL+++  I   D   R P H+AC +G   +V+ L++   D+       W  +H   WKGH  IVK+LV+Q   D++      R P+HLA ++G   + ++L++   ++         +P+H+A +   T   +LL  H+
Sbjct:  442 PLHQAAEKRLKGVSEILLSRKT-TNVNAKDEDQYTPLHFAAQNGDEALTRLLLDRSASINETDAQGRTPTHIACHHGQENVVRVLLSRGADVHVKGKDDWTALHLAAWKGHLGIVKLLVKQAGADVDGQTSDGRSPLHLASQRGQYRVARILVELGANVHLTSDDL-YAPLHVAAETGHTSTSRLLVKHD 629          

HSP 3 Score: 75.8702 bits (185), Expect = 5.852e-15
Identity = 43/161 (26.71%), Postives = 78/161 (48.45%), Query Frame = 3
Query:  138 RRPIHFACLKGDIDIVKVLIDHNCDIEVRNRKWNQQPIHMACWDGHLEILKVLLEKNCDIESCDEWKRRPIHLACENGHTEIVKFLINLHCDIEAINDKAWRPIHFGCWKGHSDIVKVLVEQNCDI-EACDHLKRRPIHLACEKGHTEIVKVLIDHHCDIS 617
            R P+H A  +G   + ++L++   ++ + +      P+H+A   GH    ++L++ + DI+S        +HLA + GH   VK L+    D E++N     P H     GH +++K L+    D+  A D      +HLA   GH + + VL++   D +
Sbjct:  574 RSPLHLASQRGQYRVARILVELGANVHLTSDDL-YAPLHVAAETGHTSTSRLLVKHDADIKSRTANGCTALHLASQKGHLPTVKMLLAEGADPESVNHDLRTPCHLAAQNGHCEVLKELLRSCSDVANAQDRNGLTALHLAVSGGHKDAICVLLEGGADAA 733          

HSP 4 Score: 64.6994 bits (156), Expect = 3.234e-11
Identity = 37/150 (24.67%), Postives = 72/150 (48.00%), Query Frame = 3
Query:  249 IHMACWDGHLEILKVLLEKNCDIESCDEWKRRPIHLACENGHTEIVKFLINLH-CDIEAINDKAWRPIHFGCWKGHSDIVKVLVEQNCDIEACDHLKRRPIHLACEKGHTEIVKVLIDHHCDISACGGRFNQSPIHLARKNNFTELIQLL 695
            +H A    + E +K LL  NC+    +     P+H A E     + + L++    ++ A ++  + P+HF    G   + ++L++++  I   D   R P H+AC  G   +V+VL+    D+    G+ + + +HLA       +++LL
Sbjct:  410 LHYAVSLANEEAVKFLLLSNCNPNLANAQGATPLHQAAEKRLKGVSEILLSRKTTNVNAKDEDQYTPLHFAAQNGDEALTRLLLDRSASINETDAQGRTPTHIACHHGQENVVRVLLSRGADVH-VKGKDDWTALHLAAWKGHLGIVKLL 558          
BLAST of SMED30015660 vs. Ensembl Zebrafish
Match: ripk4 (receptor-interacting serine-threonine kinase 4 [Source:ZFIN;Acc:ZDB-GENE-040426-2042])

HSP 1 Score: 105.916 bits (263), Expect = 4.798e-25
Identity = 56/188 (29.79%), Postives = 100/188 (53.19%), Query Frame = 3
Query:  138 RRPIHFACLKGDIDIVKVLIDHNCDIEVRNR-KWNQQPIHMACWDGHLEILKVLLEK-NCDIESCDEWKRRPIHLACENGHTEIVKFLINLHCDIEAINDKAWRPIHFGCWKGHSDIVKVLVEQNCDIEACDHLKRRPIHLACEKGHTEIVKVLIDHHCDISACGGRFNQSPIHLARKNNFTELIQLL 695
            R P H AC  G  ++V+VL+    D+ V+ +  W    +H+A W GHL I+K+L+++   D++      R P+HLA + G   + + L+ L  ++   +D  + P+H     GH+   ++LV+ + DI++        +HLA +KGH   VK+L+    D  +      ++P HLA +N   E+++ L
Sbjct:  535 RTPTHIACHHGQENVVRVLLSRGADVHVKGKDDWTA--LHLAAWKGHLGIVKLLVKQAGADVDGQTSDGRSPLHLASQRGQYRVARILVELGANVHLTSDDLYAPLHVAAETGHTSTSRLLVKHDADIKSRTANGCTALHLASQKGHLPTVKMLLAEGADPESVNHDL-RTPCHLAAQNGHCEVLKEL 719          

HSP 2 Score: 95.9005 bits (237), Expect = 1.271e-21
Identity = 51/190 (26.84%), Postives = 94/190 (49.47%), Query Frame = 3
Query:  144 PIHFACLKGDIDIVKVLIDHNCDIEVRNRKWNQ-QPIHMACWDGHLEILKVLLEKNCDIESCDEWKRRPIHLACENGHTEIVKFLINLHCDIEAINDKAWRPIHFGCWKGHSDIVKVLVEQ-NCDIEACDHLKRRPIHLACEKGHTEIVKVLIDHHCDISACGGRFNQSPIHLARKNNFTELIQLLTIHE 707
            P+H A  K    + ++L+       V  +  +Q  P+H A  +G   + ++LL+++  I   D   R P H+AC +G   +V+ L++   D+       W  +H   WKGH  IVK+LV+Q   D++      R P+HLA ++G   + ++L++   ++         +P+H+A +   T   +LL  H+
Sbjct:  470 PLHQAAEKRLKGVSEILLSRKT-TNVNAKDEDQYTPLHFAAQNGDEALTRLLLDRSASINETDAQGRTPTHIACHHGQENVVRVLLSRGADVHVKGKDDWTALHLAAWKGHLGIVKLLVKQAGADVDGQTSDGRSPLHLASQRGQYRVARILVELGANVHLTSDDL-YAPLHVAAETGHTSTSRLLVKHD 657          

HSP 3 Score: 75.8702 bits (185), Expect = 6.553e-15
Identity = 43/161 (26.71%), Postives = 78/161 (48.45%), Query Frame = 3
Query:  138 RRPIHFACLKGDIDIVKVLIDHNCDIEVRNRKWNQQPIHMACWDGHLEILKVLLEKNCDIESCDEWKRRPIHLACENGHTEIVKFLINLHCDIEAINDKAWRPIHFGCWKGHSDIVKVLVEQNCDIE-ACDHLKRRPIHLACEKGHTEIVKVLIDHHCDIS 617
            R P+H A  +G   + ++L++   ++ + +      P+H+A   GH    ++L++ + DI+S        +HLA + GH   VK L+    D E++N     P H     GH +++K L+    D+  A D      +HLA   GH + + VL++   D +
Sbjct:  602 RSPLHLASQRGQYRVARILVELGANVHLTSDDL-YAPLHVAAETGHTSTSRLLVKHDADIKSRTANGCTALHLASQKGHLPTVKMLLAEGADPESVNHDLRTPCHLAAQNGHCEVLKELLRSCSDVANAQDRNGLTALHLAVSGGHKDAICVLLEGGADAA 761          

HSP 4 Score: 64.6994 bits (156), Expect = 3.420e-11
Identity = 37/150 (24.67%), Postives = 72/150 (48.00%), Query Frame = 3
Query:  249 IHMACWDGHLEILKVLLEKNCDIESCDEWKRRPIHLACENGHTEIVKFLINLH-CDIEAINDKAWRPIHFGCWKGHSDIVKVLVEQNCDIEACDHLKRRPIHLACEKGHTEIVKVLIDHHCDISACGGRFNQSPIHLARKNNFTELIQLL 695
            +H A    + E +K LL  NC+    +     P+H A E     + + L++    ++ A ++  + P+HF    G   + ++L++++  I   D   R P H+AC  G   +V+VL+    D+    G+ + + +HLA       +++LL
Sbjct:  438 LHYAVSLANEEAVKFLLLSNCNPNLANAQGATPLHQAAEKRLKGVSEILLSRKTTNVNAKDEDQYTPLHFAAQNGDEALTRLLLDRSASINETDAQGRTPTHIACHHGQENVVRVLLSRGADVH-VKGKDDWTALHLAAWKGHLGIVKLL 586          
BLAST of SMED30015660 vs. Ensembl Zebrafish
Match: ripk4 (receptor-interacting serine-threonine kinase 4 [Source:ZFIN;Acc:ZDB-GENE-040426-2042])

HSP 1 Score: 105.531 bits (262), Expect = 5.208e-25
Identity = 56/188 (29.79%), Postives = 100/188 (53.19%), Query Frame = 3
Query:  138 RRPIHFACLKGDIDIVKVLIDHNCDIEVRNR-KWNQQPIHMACWDGHLEILKVLLEK-NCDIESCDEWKRRPIHLACENGHTEIVKFLINLHCDIEAINDKAWRPIHFGCWKGHSDIVKVLVEQNCDIEACDHLKRRPIHLACEKGHTEIVKVLIDHHCDISACGGRFNQSPIHLARKNNFTELIQLL 695
            R P H AC  G  ++V+VL+    D+ V+ +  W    +H+A W GHL I+K+L+++   D++      R P+HLA + G   + + L+ L  ++   +D  + P+H     GH+   ++LV+ + DI++        +HLA +KGH   VK+L+    D  +      ++P HLA +N   E+++ L
Sbjct:  550 RTPTHIACHHGQENVVRVLLSRGADVHVKGKDDWTA--LHLAAWKGHLGIVKLLVKQAGADVDGQTSDGRSPLHLASQRGQYRVARILVELGANVHLTSDDLYAPLHVAAETGHTSTSRLLVKHDADIKSRTANGCTALHLASQKGHLPTVKMLLAEGADPESVNHDL-RTPCHLAAQNGHCEVLKEL 734          

HSP 2 Score: 95.5153 bits (236), Expect = 1.379e-21
Identity = 51/190 (26.84%), Postives = 94/190 (49.47%), Query Frame = 3
Query:  144 PIHFACLKGDIDIVKVLIDHNCDIEVRNRKWNQ-QPIHMACWDGHLEILKVLLEKNCDIESCDEWKRRPIHLACENGHTEIVKFLINLHCDIEAINDKAWRPIHFGCWKGHSDIVKVLVEQ-NCDIEACDHLKRRPIHLACEKGHTEIVKVLIDHHCDISACGGRFNQSPIHLARKNNFTELIQLLTIHE 707
            P+H A  K    + ++L+       V  +  +Q  P+H A  +G   + ++LL+++  I   D   R P H+AC +G   +V+ L++   D+       W  +H   WKGH  IVK+LV+Q   D++      R P+HLA ++G   + ++L++   ++         +P+H+A +   T   +LL  H+
Sbjct:  485 PLHQAAEKRLKGVSEILLSRKT-TNVNAKDEDQYTPLHFAAQNGDEALTRLLLDRSASINETDAQGRTPTHIACHHGQENVVRVLLSRGADVHVKGKDDWTALHLAAWKGHLGIVKLLVKQAGADVDGQTSDGRSPLHLASQRGQYRVARILVELGANVHLTSDDL-YAPLHVAAETGHTSTSRLLVKHD 672          

HSP 3 Score: 75.8702 bits (185), Expect = 6.469e-15
Identity = 43/161 (26.71%), Postives = 78/161 (48.45%), Query Frame = 3
Query:  138 RRPIHFACLKGDIDIVKVLIDHNCDIEVRNRKWNQQPIHMACWDGHLEILKVLLEKNCDIESCDEWKRRPIHLACENGHTEIVKFLINLHCDIEAINDKAWRPIHFGCWKGHSDIVKVLVEQNCDIE-ACDHLKRRPIHLACEKGHTEIVKVLIDHHCDIS 617
            R P+H A  +G   + ++L++   ++ + +      P+H+A   GH    ++L++ + DI+S        +HLA + GH   VK L+    D E++N     P H     GH +++K L+    D+  A D      +HLA   GH + + VL++   D +
Sbjct:  617 RSPLHLASQRGQYRVARILVELGANVHLTSDDL-YAPLHVAAETGHTSTSRLLVKHDADIKSRTANGCTALHLASQKGHLPTVKMLLAEGADPESVNHDLRTPCHLAAQNGHCEVLKELLRSCSDVANAQDRNGLTALHLAVSGGHKDAICVLLEGGADAA 776          

HSP 4 Score: 64.6994 bits (156), Expect = 3.376e-11
Identity = 37/150 (24.67%), Postives = 72/150 (48.00%), Query Frame = 3
Query:  249 IHMACWDGHLEILKVLLEKNCDIESCDEWKRRPIHLACENGHTEIVKFLINLH-CDIEAINDKAWRPIHFGCWKGHSDIVKVLVEQNCDIEACDHLKRRPIHLACEKGHTEIVKVLIDHHCDISACGGRFNQSPIHLARKNNFTELIQLL 695
            +H A    + E +K LL  NC+    +     P+H A E     + + L++    ++ A ++  + P+HF    G   + ++L++++  I   D   R P H+AC  G   +V+VL+    D+    G+ + + +HLA       +++LL
Sbjct:  453 LHYAVSLANEEAVKFLLLSNCNPNLANAQGATPLHQAAEKRLKGVSEILLSRKTTNVNAKDEDQYTPLHFAAQNGDEALTRLLLDRSASINETDAQGRTPTHIACHHGQENVVRVLLSRGADVH-VKGKDDWTALHLAAWKGHLGIVKLL 601          
BLAST of SMED30015660 vs. Ensembl Zebrafish
Match: ankk1 (ankyrin repeat and kinase domain containing 1 [Source:ZFIN;Acc:ZDB-GENE-071015-4])

HSP 1 Score: 103.219 bits (256), Expect = 3.786e-24
Identity = 51/172 (29.65%), Postives = 96/172 (55.81%), Query Frame = 3
Query:  144 PIHFACLKGDIDIVKVLIDHNCDIEVRNRKWNQQPIHMACWDGHLEILKVLLEKNCDIESCDEWKRRPIHLACENGHTEIVKFLINLHCDIEAINDKAWRPIHFGCWKGHSDIVKVLVEQNCDIEACDHLKRRPIHLACEKGHTEIVKVLIDHHCDISACGGRFNQSPIHLA 659
            P+H A   G  +IV++L+     ++V+  +  +  +H+A   GH+ I+K+LL K  DI+  D  +   +HLA E GH  +V+ L+N   D+  ++++++  +HF    G++ I ++L+ +  D  +  +     +HLA  KGH EI+  L +H   ++   G+   +P+HLA
Sbjct:  450 PLHLAAQNGHENIVRILLRRLDSVDVQEHQSCRTALHVASIYGHINIVKLLLNKGADIDKQDNNQSTALHLAAEEGHFRVVRLLVNSGADVNKVDEQSYSSLHFAALNGYTGICRLLLSKGIDPNSRTNKNWTAMHLAALKGHPEIILTLEEHQGSVN-IQGKNGWTPLHLA 620          

HSP 2 Score: 97.8265 bits (242), Expect = 2.650e-22
Identity = 53/188 (28.19%), Postives = 94/188 (50.00%), Query Frame = 3
Query:  138 RRPIHFACLKGDIDIVKVLIDHNCDIEVRNRKWNQQPIHMACWDGHLEILKVLLEKNCDIESCDEWKRRPIHLACENGHTEIVKFLINLHCDIEAINDKAWRPIHFGCWKGHSDIVKVLVEQNCDIEACDHLKRRPIHLACEKGHTEIVKVLIDHHCDISACGGRFNQSPIHLA-RKNNFTELIQLLT 698
            R  +H A + G I+IVK+L++   DI+ ++       +H+A  +GH  ++++L+    D+   DE     +H A  NG+T I + L++   D  +  +K W  +H    KGH +I+  L E    +         P+HLAC  G  E+V  L+    D +        +P+HLA   ++F  ++QL++
Sbjct:  482 RTALHVASIYGHINIVKLLLNKGADIDKQDNN-QSTALHLAAEEGHFRVVRLLVNSGADVNKVDEQSYSSLHFAALNGYTGICRLLLSKGIDPNSRTNKNWTAMHLAALKGHPEIILTLEEHQGSVNIQGKNGWTPLHLACHHGQEEVVTGLLTAGADPNLAEDN-GWTPLHLACNSSSFPSVLQLIS 667          

HSP 3 Score: 63.5438 bits (153), Expect = 2.965e-12
Identity = 41/150 (27.33%), Postives = 71/150 (47.33%), Query Frame = 3
Query:  147 IHFACLKGDIDIVKVLIDHNCDIEVRNRK-WNQQPIHMACWDGHLEILKVLLEKNCDIESCDEWKRRPIHLACENGHTEIVKFLINLHCDIEAINDKAWRPIHFGCWKGHSDIVKVLVEQNCDIEACDHLKRRPIHLACEKGHTEIVKVL 593
            +H A LKG  +I+  L +H   + ++ +  W   P+H+AC  G  E++  LL    D    ++    P+HLAC +     V  LI+   ++ A N+    P+H      +  I+K L+  N   E  D      + LA +  ++E V++L
Sbjct:  584 MHLAALKGHPEIILTLEEHQGSVNIQGKNGWT--PLHLACHHGQEEVVTGLLTAGADPNLAEDNGWTPLHLACNSSSFPSVLQLISHKANVNAQNNSQSTPLHLAAQLSNIPIIKALLMNNAQREMQDSKGCTALTLAQQCNNSEAVELL 731          

HSP 4 Score: 26.5646 bits (57), Expect = 2.965e-12
Identity = 10/26 (38.46%), Postives = 16/26 (61.54%), Query Frame = 2
Query:    5 IHLAFDNNHREIVKLLIEENCDVNAI 82
            +HLA +  H  +V+LL+    DVN +
Sbjct:  518 LHLAAEEGHFRVVRLLVNSGADVNKV 543          
BLAST of SMED30015660 vs. Ensembl Zebrafish
Match: ank1b (ankyrin 1, erythrocytic b [Source:ZFIN;Acc:ZDB-GENE-091113-6])

HSP 1 Score: 98.2117 bits (243), Expect = 2.031e-22
Identity = 53/188 (28.19%), Postives = 97/188 (51.60%), Query Frame = 3
Query:  144 PIHFACLKGDIDIVKVLIDHNCDIEVRNRKWNQQPIHMACWDGHLEILKVLLEKNCDIESCDEWKRRPIHLACENGHTEIVKFLINLHCDIEAINDKAWRPIHFGCWKGHSDIVKVLVEQNCDIEACDHLKRRPIHLACEKGHTEIVKVLIDHHCDISACGGRFNQSPIHLARKNNFTELIQLLTIHE 707
            PIH A     +D V+ L+ +N +I+      +  P+H+A   GH  ++KVLL+K     +       P+H+AC+  H   +  L+     +EA+ +    P+H   + GH +IVK L+++     A +     P+H+A   GH E+ + L+ ++  + A   + +Q+P+H A +    EL++LL  H+
Sbjct:  249 PIHMAAQGDHMDCVRQLLQYNAEIDDITLD-HLTPLHVAAHCGHHRMVKVLLDKGAKANARALNGFTPLHIACKKNHMRSMDLLLKHSASLEAVTESGLTPLHVAAFMGHLNIVKSLLQRGASPNASNVKVETPLHMAARAGHCEVAQFLLQNNAQVDA-KAKDDQTPLHCAARMGHKELVKLLMEHK 434          

HSP 2 Score: 97.4413 bits (241), Expect = 3.442e-22
Identity = 51/186 (27.42%), Postives = 99/186 (53.23%), Query Frame = 3
Query:  144 PIHFACLKGDIDIVKVLIDHNCDIEVRNRKWNQQPIHMACWDGHLEILKVLLEKNCDIESCDEWKRRPIHLACENGHTEIVKFLI--NLHCDIEAINDKAWRPIHFGCWKGHSDIVKVLVEQNCDIEACDHLKRRPIHLACEKGHTEIVKVLIDHHCDISACGGRFNQSPIHLARKNNFTELIQLL 695
            P+H AC K  +  + +L+ H+  +E         P+H+A + GHL I+K LL++     + +     P+H+A   GH E+ +FL+  N   D +A +D+   P+H     GH ++VK+L+E   + ++       P+H+A  +GH +  ++L+D +   +    +   +P+H+A K    ++++LL
Sbjct:  315 PLHIACKKNHMRSMDLLLKHSASLEAVTES-GLTPLHVAAFMGHLNIVKSLLQRGASPNASNVKVETPLHMAARAGHCEVAQFLLQNNAQVDAKAKDDQT--PLHCAARMGHKELVKLLMEHKANPDSATTAGHTPLHIAAREGHAQTTRILLDENAQQTKMTKK-GFTPLHVACKYGKVDVVELL 496          

HSP 3 Score: 94.3597 bits (233), Expect = 3.622e-21
Identity = 54/186 (29.03%), Postives = 91/186 (48.92%), Query Frame = 3
Query:  144 PIHFACLKGDIDIVKVLIDHNCDIEVRNRKWNQQPIHMACWDGHLEILKVLLEKNCDIESCDEWKRRPIHLACENGHTEIVKFLINLHCDIEAINDKAWRPIHFGCWKGHSDIVKVLVEQNCDIEACDHLKRRPIHLACEKGHTEIVKVLIDHHC--DISACGGRFNQSPIHLARKNNFTELIQLL 695
            P+H A   G   +VKVL+D       R       P+H+AC   H+  + +LL+ +  +E+  E    P+H+A   GH  IVK L+       A N K   P+H     GH ++ + L++ N  ++A     + P+H A   GH E+VK+L++H    D +   G    +P+H+A +    +  ++L
Sbjct:  282 PLHVAAHCGHHRMVKVLLDKGAKANARALN-GFTPLHIACKKNHMRSMDLLLKHSASLEAVTESGLTPLHVAAFMGHLNIVKSLLQRGASPNASNVKVETPLHMAARAGHCEVAQFLLQNNAQVDAKAKDDQTPLHCAARMGHKELVKLLMEHKANPDSATTAG---HTPLHIAAREGHAQTTRIL 463          

HSP 4 Score: 91.2781 bits (225), Expect = 4.664e-20
Identity = 50/184 (27.17%), Postives = 91/184 (49.46%), Query Frame = 3
Query:  144 PIHFACLKGDIDIVKVLIDHNCDIEVRNRKWNQQPIHMACWDGHLEILKVLLEKNCDIESCDEWKRRPIHLACENGHTEIVKFLINLHCDIEAINDKAWRPIHFGCWKGHSDIVKVLVEQNCDIEACDHLKRRPIHLACEKGHTEIVKVLIDHHCDISACGGRFNQSPIHLARKNNFTELIQLL 695
            P+H A   G + +V++L+D    ++ + +     PIHMA    H++ ++ LL+ N +I+        P+H+A   GH  +VK L++      A     + P+H  C K H   + +L++ +  +EA       P+H+A   GH  IVK L+      +A   +  ++P+H+A +    E+ Q L
Sbjct:  216 PLHCAARNGHVRVVEILLDQGAPLQAKTKN-GLSPIHMAAQGDHMDCVRQLLQYNAEIDDITLDHLTPLHVAAHCGHHRMVKVLLDKGAKANARALNGFTPLHIACKKNHMRSMDLLLKHSASLEAVTESGLTPLHVAAFMGHLNIVKSLLQRGASPNASNVKV-ETPLHMAARAGHCEVAQFL 397          

HSP 5 Score: 88.5817 bits (218), Expect = 3.636e-19
Identity = 45/180 (25.00%), Postives = 91/180 (50.56%), Query Frame = 3
Query:  144 PIHFACLKGDIDIVKVLIDHNCDIEVRNRKWNQQPIHMACWDGHLEILKVLLEKNCDIESCDEWKRRPIHLACENGHTEIVKFLINLHCDIEAINDKAWRPIHFGCWKGHSDIVKVLVEQNCDIEACDHLKRRPIHLACEKGHTEIVKVLIDHHCDISACGGRFNQSPIHLARKNNFTEL 683
            P+H A   G  ++ + L+ +N  ++ + +  +Q P+H A   GH E++K+L+E   + +S       P+H+A   GH +  + L++ +     +  K + P+H  C  G  D+V++L+E+  +  A       P+H+A    + ++VK+L+       +   R   + +H+A K N  E+
Sbjct:  381 PLHMAARAGHCEVAQFLLQNNAQVDAKAKD-DQTPLHCAARMGHKELVKLLMEHKANPDSATTAGHTPLHIAAREGHAQTTRILLDENAQQTKMTKKGFTPLHVACKYGKVDVVELLLERGANPNAAGKNGLTPLHVAVHHNNLDVVKLLVSKGGSPHST-ARNGYTALHIAAKQNQLEV 558          

HSP 6 Score: 86.2705 bits (212), Expect = 1.925e-18
Identity = 52/195 (26.67%), Postives = 98/195 (50.26%), Query Frame = 3
Query:  144 PIHFACLKGDIDIVKVLIDHNCDIEVRNRKWNQQPIHMACWDGHLEILKVLLEKNCDIESCDEWKRRPIHLACENGHTEIVKFLINLHCDIEAINDKAWRPIHFGCWKGHSDIVKVLVEQNCDIE--ACDHLKRRPIHLACEKGHTEIVKVLIDHHCDISACGGRFNQ------SPIHLARKNNFTELIQLLTIH 704
            P+H A    ++ + ++L++   ++    +     P+H+A   G++ ++++LL++   I++  + +  P+H A  NGH  +V+ L++    ++A       PIH      H D V+ L++ N +I+    DHL   P+H+A   GH  +VKVL+D        G + N       +P+H+A K N    + LL  H
Sbjct:  150 PLHIAAHYENLSVAQLLLNRGANVNFTPKN-GITPLHIASRRGNVIMVRLLLDRGAQIDAKTKDELTPLHCAARNGHVRVVEILLDQGAPLQAKTKNGLSPIHMAAQGDHMDCVRQLLQYNAEIDDITLDHLT--PLHVAAHCGHHRMVKVLLDK-------GAKANARALNGFTPLHIACKKNHMRSMDLLLKH 334          

HSP 7 Score: 80.1073 bits (196), Expect = 2.533e-16
Identity = 43/188 (22.87%), Postives = 94/188 (50.00%), Query Frame = 3
Query:  147 IHFACLKGDIDIVKVLIDHNCDIEVRNRKWNQQPIHMACWDGHLEILKVLLEKNCDIESCDEWKRRPIHLACENGHTEIVKFLINLHCDIEAINDKAWRPIHFGCWKGHSDIVKVLVEQNCDIEACDHLKRRPIHLACEKGHTEIVKVLIDHHC---DISACGGRFNQSPIHLARKNNFTELIQLLTI 701
            +H A  +  +++   L+ +  +    + +    P+H+A  +G  +++ +L+ K  ++   ++    P+HL  + GH  I   L+     + A +   + P+H  C  G+  +VK L++Q   + +   L   P+H A ++GHT+IV +L+ H     +I+  G     SP+ +A++  +  +I +L +
Sbjct:  547 LHIAAKQNQLEVASSLLQYGANANSESLQ-GITPLHLASQEGQPDMVALLISKQANVNLGNKNGLTPLHLVAQEGHVGIADMLVKQGASVYAASRMGYTPLHVACHYGNIKMVKFLLQQQAHVNSKTRLGYTPLHQAAQQGHTDIVTLLLKHGALPNEITTNG----TSPLGIAKRLGYISVIDVLKL 729          

HSP 8 Score: 73.559 bits (179), Expect = 3.952e-14
Identity = 39/184 (21.20%), Postives = 87/184 (47.28%), Query Frame = 3
Query:  144 PIHFACLKGDIDIVKVLIDHNCDIEVRNRKWNQQPIHMACWDGHLEILKVLLEKNCDIESCDEWKRRPIHLACENGHTEIVKFLINLHCDIEAINDKAWRPIHFGCWKGHSDIVKVLVEQNCDIEACDHLKRRPIHLACEKGHTEIVKVLIDHHCDISACGGRFNQSPIHLARKNNFTELIQLL 695
            P+H AC  G +D+V++L++   +     +     P+H+A    +L+++K+L+ K     S        +H+A +    E+   L+    +  + + +   P+H    +G  D+V +L+ +  ++   +     P+HL  ++GH  I  +L+     + A   R   +P+H+A      ++++ L
Sbjct:  480 PLHVACKYGKVDVVELLLERGANPNAAGKN-GLTPLHVAVHHNNLDVVKLLVSKGGSPHSTARNGYTALHIAAKQNQLEVASSLLQYGANANSESLQGITPLHLASQEGQPDMVALLISKQANVNLGNKNGLTPLHLVAQEGHVGIADMLVKQGASVYA-ASRMGYTPLHVACHYGNIKMVKFL 661          

HSP 9 Score: 23.0978 bits (48), Expect = 3.952e-14
Identity = 7/21 (33.33%), Postives = 14/21 (66.67%), Query Frame = 2
Query:    2 PIHLAFDNNHREIVKLLIEEN 64
            P+H+A    H +  ++L++EN
Sbjct:  447 PLHIAAREGHAQTTRILLDEN 467          

HSP 10 Score: 63.1586 bits (152), Expect = 1.342e-11
Identity = 40/184 (21.74%), Postives = 88/184 (47.83%), Query Frame = 3
Query:  144 PIHFACLKGDIDIVKVLIDHNCDIEVRNRKWNQQPIHMACWDGHLEILKVLLEKNCDIESCDEWKRRPIHLACENGHTEIVKFLINLHCDIEAINDKAWRPIHFGCWKGHSDIVKVLVEQNCDIEACDHLKRRPIHLACEKGHTEIVKVLIDHHCDISACGGRFNQSPIHLARKNNFTELIQLL 695
            P+  A  +G  ++V +LI++    +VR        +H+A  +       VLL+ + + +   +    P+H+A    +  + + L+N   ++         P+H    +G+  +V++L+++   I+A    +  P+H A   GH  +V++L+D    + A   +   SPIH+A + +  + ++ L
Sbjct:   88 PLAVALQQGHENVVALLINYGTKGKVR-----LPALHIAARNDDTRTAAVLLQNDPNPDVLSKTGFTPLHIAAHYENLSVAQLLLNRGANVNFTPKNGITPLHIASRRGNVIMVRLLLDRGAQIDAKTKDELTPLHCAARNGHVRVVEILLDQGAPLQA-KTKNGLSPIHMAAQGDHMDCVRQL 265          

HSP 11 Score: 25.0238 bits (53), Expect = 1.342e-11
Identity = 9/23 (39.13%), Postives = 15/23 (65.22%), Query Frame = 2
Query:    2 PIHLAFDNNHREIVKLLIEENCD 70
            P+++A   NH E+VK L+E   +
Sbjct:   55 PLYMAAQENHLEVVKYLLEHGAN 77          

HSP 12 Score: 55.0694 bits (131), Expect = 4.793e-8
Identity = 32/134 (23.88%), Postives = 64/134 (47.76%), Query Frame = 3
Query:  294 LLEKNCDIESCDEWKRRPIHLACENGHTEIVKFLINLHCDIEAINDKAWRPIHFGCWKGHSDIVKVLVEQNCDIEACDHLKRRPIHLACEKGHTEIVKVLIDHHCDISACGGRFNQSPIHLARKNNFTELIQLL 695
            LL    D+E+  +     +H+A   G  ++V  LIN   ++ A + K + P++    + H ++VK L+E   +          P+ +A ++GH  +V +LI++        G+     +H+A +N+ T    +L
Sbjct:    5 LLHNGIDLETTTKKGNTALHIAALAGQEKVVAELINYGANVNAQSQKGFSPLYMAAQENHLEVVKYLLEHGANQSLPTEDGFTPLAVALQQGHENVVALLINY-----GTKGKVRLPALHIAARNDDTRTAAVL 133          
BLAST of SMED30015660 vs. Ensembl Xenopus
Match: fbxo9 (F-box protein 9 [Source:Xenbase;Acc:XB-GENE-1002447])

HSP 1 Score: 98.9821 bits (245), Expect = 5.597e-23
Identity = 51/183 (27.87%), Postives = 101/183 (55.19%), Query Frame = 3
Query:  147 IHFACLKGDIDIVKVLIDHNCDIEVRNRKWNQQPIHMACWDGHLEILKVLLEKNCDIESCDEWKRRPIHLACENGHTEIVKFLINLHCDIEAINDKAWRPIHFGCWKGHSDIVKVLVEQNCDIEACDHLKRRPIHLACEKGHTEIVKVLIDHHCDISACGGRFNQSPIHLARKNNFTELIQLL 695
            +H + L G++ ++  L++ N DI V++       +H+A  +GH +I+K LL+K   +   D     P+H A   G+TEIV  L+     +  ++ +   P+H   +KG +D   +L++   DI++ D L + P+HLA E+GH ++VK L +   D      ++N++   +A ++N  +++ ++
Sbjct:  229 LHLSALAGNLQVINYLLNTNVDINVKDIN-GLTALHLAAENGHSKIIKCLLKKGAIVNITDINHLTPLHRAAGRGYTEIVTLLLKQKAAVNNMDIQNLTPLHHAAYKGQNDTSSILLQFGADIDSKDWLGKTPLHLAVERGHFDVVKTLKEWGAD-PWVKTKWNETATDMALQSNRKDILSIV 409          

HSP 2 Score: 78.9518 bits (193), Expect = 5.828e-16
Identity = 54/216 (25.00%), Postives = 90/216 (41.67%), Query Frame = 3
Query:  147 IHFACLKGDIDIVKVLIDHNCDIEVRNRKWNQQPIHMACWDGHLEILKVLLEKNCDIESCDEWKRRPIHLACENGHTEIVKFLINLHCDIEAINDKAWRPI---------------------------------HFGCWKGHSDIVKVLVEQNCDIEACDHLKRRPIHLACEKGHTEIVKVLIDHHCDISACGGRFNQSPIHLARKNNFTELIQLL 695
            +H A   GD+ +VK L+     + +R+ + +  P+H A W GH E+   LL+     +  +     P+HLA  NGH   VK LI     I+  ++  W P+                                 H     G+  ++  L+  N DI   D      +HLA E GH++I+K L+     ++      + +P+H A    +TE++ LL
Sbjct:   97 LHSAAFCGDLALVKYLLQKGASVNLRDVR-SYTPLHRAAWTGHAELTDYLLQCGALPDIVNYCGETPLHLAAANGHLLCVKILIQNKASIDIKDNNKWTPLQWCSINDQIDVLEYLVSLGASLEEKSTTGMTLLHLSALAGNLQVINYLLNTNVDINVKDINGLTALHLAAENGHSKIIKCLLKKGAIVNITDIN-HLTPLHRAAGRGYTEIVTLL 310          

HSP 3 Score: 76.6406 bits (187), Expect = 3.633e-15
Identity = 43/171 (25.15%), Postives = 84/171 (49.12%), Query Frame = 3
Query:  144 PIHFACLKGDIDIVKVLIDHNCDIEVR-NRKWNQQPIHMACWDGHLEILKVLLEKNCDIESCDEWKRRPIHLACENGHTEIVKFLINLHCDIEAINDKAWRPIHFGCWKGHSDIVKVLVEQNCDIEACDHLKRRPIHLACEKGHTEIVKVLIDHHCDISACGGRFNQSPIH 653
            P+H A   G +  VK+LI +   I+++ N KW   P+     +  +++L+ L+     +E         +HL+   G+ +++ +L+N + DI   +      +H     GHS I+K L+++   +   D     P+H A  +G+TEIV +L+     ++    + N +P+H
Sbjct:  162 PLHLAAANGHLLCVKILIQNKASIDIKDNNKWT--PLQWCSINDQIDVLEYLVSLGASLEEKSTTGMTLLHLSALAGNLQVINYLLNTNVDINVKDINGLTALHLAAENGHSKIIKCLLKKGAIVNITDINHLTPLHRAAGRGYTEIVTLLLKQKAAVNNMDIQ-NLTPLH 329          

HSP 4 Score: 61.6178 bits (148), Expect = 3.316e-10
Identity = 38/155 (24.52%), Postives = 72/155 (46.45%), Query Frame = 3
Query:  138 RRPIHFACLKGDIDIVKVLIDHNCDIEVRN-RKWNQQPIHMACWDGHLEILKVLLEKNCDIESCDEWKRRPIHLACENGHTEIVKFLINLHCDIEAINDKAWRPIHFGCWKGHSDIVKVLVEQNCDIEACDHLKRRPIHLACEKGHTEIVKVLID 599
            +  +H A  +GD+D V  L++    +  ++ R W+   +H A + G L ++K LL+K   +   D     P+H A   GH E+  +L+      + +N     P+H     GH   VK+L++    I+  D+ K  P+         ++++ L+ 
Sbjct:   61 KTSLHEAVRRGDMDQVNTLLNFGIAVNCQDYRGWSL--LHSAAFCGDLALVKYLLQKGASVNLRDVRSYTPLHRAAWTGHAELTDYLLQCGALPDIVNYCGETPLHLAAANGHLLCVKILIQNKASIDIKDNNKWTPLQWCSINDQIDVLEYLVS 213          

HSP 5 Score: 51.9878 bits (123), Expect = 5.406e-7
Identity = 29/125 (23.20%), Postives = 56/125 (44.80%), Query Frame = 3
Query:  240 QQPIHMACWDGHLEILKVLLEKNCDIESCDEWKRRPIHLACENGHTEIVKFLINLHCDIEAINDKAWRPIHFGCWKGHSDIVKVLVEQNCDIEACDHLKRRPIHLACEKGHTEIVKVLIDHHCDI 614
            +  +H A   G ++ +  LL     +   D      +H A   G   +VK+L+     +   + +++ P+H   W GH+++   L++     +  ++    P+HLA   GH   VK+LI +   I
Sbjct:   61 KTSLHEAVRRGDMDQVNTLLNFGIAVNCQDYRGWSLLHSAAFCGDLALVKYLLQKGASVNLRDVRSYTPLHRAAWTGHAELTDYLLQCGALPDIVNYCGETPLHLAAANGHLLCVKILIQNKASI 185          
BLAST of SMED30015660 vs. Ensembl Xenopus
Match: senp1 (SUMO specific peptidase 1 [Source:Xenbase;Acc:XB-GENE-1014921])

HSP 1 Score: 99.3673 bits (246), Expect = 9.351e-23
Identity = 51/185 (27.57%), Postives = 98/185 (52.97%), Query Frame = 3
Query:  144 PIHFACLKGDIDIVKVLIDHNCDIEVRNRKWNQQPIHMACWDGHLEILKVLLEKNCDIESCDEWKRRPIHLACENGHTEIVKFLINLHCDIEAINDKAWRPIHFGCWKGHSDIVKVLVEQ-NCDIEACDHLKRRPIHLACEKGHTEIVKVLIDHHCDISACGGRFNQSPIHLARKNNFTELIQLL 695
            P+H A  K   +IV++L+    ++  ++   +   +H +  +G   I ++LLEK+  +   D   R P+H+AC++G   IV+  +    D+       W  +H+  W+GH +IV++L +Q   +I A     R P+HLA ++GH  + ++L+D  CD++       ++P+H+A +   T   + L
Sbjct:  475 PLHIAADKKLKNIVELLLGKKINVNAKDED-HFTALHFSAQNGDECITRMLLEKSASLNEVDIKGRTPLHVACQHGQENIVRVFLRREADLTFKGQDNWLALHYAAWQGHLNIVRLLAKQPGANINAQTSDGRTPLHLAAQRGHYRVARILVDLRCDVN-IPSILMKTPLHVAAETGHTSTARFL 657          

HSP 2 Score: 91.6633 bits (226), Expect = 2.102e-20
Identity = 45/160 (28.12%), Postives = 79/160 (49.38%), Query Frame = 3
Query:  138 RRPIHFACLKGDIDIVKVLIDHNCDIEVRNRKWNQQPIHMACWDGHLEILKVLLEK-NCDIESCDEWKRRPIHLACENGHTEIVKFLINLHCDIEAINDKAWRPIHFGCWKGHSDIVKVLVEQNCDIEACDHLKRRPIHLACEKGHTEIVKVLIDHHCDI 614
            R P+H AC  G  +IV+V +    D+  + +  N   +H A W GHL I+++L ++   +I +     R P+HLA + GH  + + L++L CD+   +     P+H     GH+   + L+ +   + A        + LA   GH   VK+L+D   ++
Sbjct:  539 RTPLHVACQHGQENIVRVFLRREADLTFKGQD-NWLALHYAAWQGHLNIVRLLAKQPGANINAQTSDGRTPLHLAAQRGHYRVARILVDLRCDVNIPSILMKTPLHVAAETGHTSTARFLLSRGASVNAVTSEGFTALDLASNLGHYSAVKLLMDEQSNV 697          

HSP 3 Score: 26.9498 bits (58), Expect = 2.102e-20
Identity = 11/26 (42.31%), Postives = 18/26 (69.23%), Query Frame = 2
Query:    2 PIHLAFDNNHREIVKLLIEENCDVNA 79
            P+H+A D   + IV+LL+ +  +VNA
Sbjct:  475 PLHIAADKKLKNIVELLLGKKINVNA 500          

HSP 4 Score: 81.6481 bits (200), Expect = 9.008e-17
Identity = 45/161 (27.95%), Postives = 79/161 (49.07%), Query Frame = 3
Query:  147 IHFACLKGDIDIVKVLIDHNCDIEVRNRKWNQQPIHMACWDGHLEILKVLLEKNCDI--ESCDEWKRRPIHLACENGHTEIVKFLINL-HCDIEAINDKAWRPIHFGCWKGHSDIVKVLVEQNCDIEACDHLKRRPIHLACEKGHTEIVKVLIDHHCDISA 620
            +HF+   GD  I ++L++ +  +   + K  + P+H+AC  G   I++V L +  D+  +  D W    +H A   GH  IV+ L      +I A       P+H    +GH  + ++LV+  CD+     L + P+H+A E GHT   + L+     ++A
Sbjct:  509 LHFSAQNGDECITRMLLEKSASLNEVDIK-GRTPLHVACQHGQENIVRVFLRREADLTFKGQDNW--LALHYAAWQGHLNIVRLLAKQPGANINAQTSDGRTPLHLAAQRGHYRVARILVDLRCDVNIPSILMKTPLHVAAETGHTSTARFLLSRGASVNA 666          

HSP 5 Score: 70.4774 bits (171), Expect = 4.673e-13
Identity = 31/128 (24.22%), Postives = 67/128 (52.34%), Query Frame = 3
Query:  147 IHFACLKGDIDIVKVLIDH-NCDIEVRNRKWNQQPIHMACWDGHLEILKVLLEKNCDIESCDEWKRRPIHLACENGHTEIVKFLINLHCDIEAINDKAWRPIHFGCWKGHSDIVKVLVEQNCDIEACD 527
            +H+A  +G ++IV++L      +I  +     + P+H+A   GH  + ++L++  CD+       + P+H+A E GHT   +FL++    + A+  + +  +      GH   VK+L+++  +++  D
Sbjct:  575 LHYAAWQGHLNIVRLLAKQPGANINAQTSD-GRTPLHLAAQRGHYRVARILVDLRCDVNIPSILMKTPLHVAAETGHTSTARFLLSRGASVNAVTSEGFTALDLASNLGHYSAVKLLMDEQSNVKLKD 701          

HSP 6 Score: 67.781 bits (164), Expect = 4.585e-12
Identity = 45/182 (24.73%), Postives = 85/182 (46.70%), Query Frame = 3
Query:  156 ACLKGDI-DIVKVLIDHNCDIEVRNRKWNQQPIHMACWDGHLEILKVLLEKNCDIESCDEWKRRPIHLACENGHTEIVKFLINLHCDIEAINDKAWRPIHFGCWKGHSDIVKVLVEQNCDIEACDHLKRRPIHLACEKGHTEIVKVLIDHHCDISACGGRFNQSPIHLARKNNFTELIQLLT 698
            A   GD   ++K+L   + D+ +  R      +H+A  +G  E  K+LL  N      +     P+H+A +     IV+ L+    ++ A ++  +  +HF    G   I ++L+E++  +   D   R P+H+AC+ G   IV+V +    D++   G+ N   +H A       +++LL 
Sbjct:  414 AIAGGDTAKLMKILQPQDVDLVLEGR---SSLLHLAVENGQEECAKLLLLYNASPNMTNLKGSTPLHIAADKKLKNIVELLLGKKINVNAKDEDHFTALHFSAQNGDECITRMLLEKSASLNEVDIKGRTPLHVACQHGQENIVRVFLRREADLT-FKGQDNWLALHYAAWQGHLNIVRLLA 591          
BLAST of SMED30015660 vs. Ensembl Xenopus
Match: ANKDD1A (ankyrin repeat and death domain containing 1A [Source:NCBI gene;Acc:100489003])

HSP 1 Score: 97.8265 bits (242), Expect = 2.013e-22
Identity = 50/189 (26.46%), Postives = 101/189 (53.44%), Query Frame = 3
Query:  138 RRPIHFACLKGDIDIVKVLIDHNCDIEVRNRKWNQQPIHMACWDGHLEILKVLLEKNCDIESCDEWKRRPIHLACENGHTEIVKFLINLHCDIEA-INDKAWRPIHFGCWKGHSDIVKVLVEQNCDIEACDHLKRRPIHLACEKGHTEIVKVLIDHHCDISACGGRFNQSPIHLARKNNFTELIQLLTI 701
            +   H A   G ++ V+ LI   C   ++++  N   +H+A  +GH+E+L+ ++E   ++   +      +HLA E G+ + V+ L++  CD+ A    K    +H+  + G+ DI ++L++   +I A +H K   +H++  +     VK+LID  CD+     R  Q+P+H+A +N   ++ +++ I
Sbjct:  150 KTAFHLAAEHGQLEAVEFLIGSGCQHSLKDKDKNT-ALHLATKNGHVEVLQKIVETGVELNEKNTEGMTALHLATEGGYFDCVRILLDAGCDVNAQTEQKCMNGLHYSAFHGYEDIARILIDAGININAVNHRKSTALHISILQNFPATVKLLIDFECDLDIPDYRL-QTPLHIAAENGRQDMAEMILI 336          

HSP 2 Score: 70.0922 bits (170), Expect = 6.381e-13
Identity = 40/178 (22.47%), Postives = 91/178 (51.12%), Query Frame = 3
Query:  168 GDIDIVKVLIDHNCDIEVRNRKWNQQPIHMACWDGHLEILKVLLE--KNCDIESCDEWKRRPIHLACENGHTEIVKFLINLHCDIEAINDKAWRPIHFGCWKGHSDIVKVLVEQNCDIEACDHLKRRPIHLACEKGHTEIVKVLIDHHCDISACGGRFNQSPIHLARKNNFTELIQLL 695
            G + I+++L++    I  +N+      +H A   GH+++++ ++E  +   ++  D+  +   HLA E+G  E V+FLI   C     +      +H     GH ++++ +VE   ++   +      +HLA E G+ + V++L+D  CD++A   +   + +H +  + + ++ ++L
Sbjct:   92 GHLPILQILVNAGAKINCQNKN-GLNLLHCAALRGHIKVMEFIMEDLEGIRLDKVDKSGKTAFHLAAEHGQLEAVEFLIGSGCQHSLKDKDKNTALHLATKNGHVEVLQKIVETGVELNEKNTEGMTALHLATEGGYFDCVRILLDAGCDVNAQTEQKCMNGLHYSAFHGYEDIARIL 268          

HSP 3 Score: 60.8474 bits (146), Expect = 5.479e-10
Identity = 27/128 (21.09%), Postives = 63/128 (49.22%), Query Frame = 3
Query:  144 PIHFACLKGDIDIVKVLIDHNCDIEVRNRKWNQQPIHMACWDGHLEILKVLLEKNCDIESCDEWKRRPIHLACENGHTEIVKFLINLHCDIEAINDKAWRPIHFGCWKGHSDIVKVLVEQNCDIEACD 527
             +H A   G  D V++L+D  CD+  +  +     +H + + G+ +I ++L++   +I + +  K   +H++        VK LI+  CD++  + +   P+H     G  D+ ++++    +++  D
Sbjct:  218 ALHLATEGGYFDCVRILLDAGCDVNAQTEQKCMNGLHYSAFHGYEDIARILIDAGININAVNHRKSTALHISILQNFPATVKLLIDFECDLDIPDYRLQTPLHIAAENGRQDMAEMILIAGVNLKLQD 345          

HSP 4 Score: 22.3274 bits (46), Expect = 5.479e-10
Identity = 8/25 (32.00%), Postives = 16/25 (64.00%), Query Frame = 2
Query:    2 PIHLAFDNNHREIVKLLIEENCDVN 76
             +HLA  N H E+++ ++E   ++N
Sbjct:  185 ALHLATKNGHVEVLQKIVETGVELN 209          

HSP 5 Score: 50.0618 bits (118), Expect = 2.194e-6
Identity = 44/196 (22.45%), Postives = 72/196 (36.73%), Query Frame = 3
Query:  207 CDIEVRNRKWNQQPIHMACWDGHLEILKVLLEKNCDIESCDEWKRRPIHLACENGHTEIVKFLINLHCDIEAINDKAWRPIHFGCWKGHSDIVKVLVEQNCDI-----------------------------------EACDHLKRRPIHLACEKGHTEIVKVLIDHHCDISACGGRFNQSPIHLARKNNFTELIQ 689
            CD E+  R  +++  H A      E ++ L+E   D+   +   R  +H A   GH + V+ L+     ++  +      +  G W GH  I+++LV     I                                   +  D   +   HLA E G  E V+ LI   C  S    +   + +HLA KN   E++Q
Sbjct:    7 CDDEILLR--SERDFHNAAKTNDTEKMRQLIELGVDVRVKNSVDRTALHWAAGAGHKQAVQLLLEHDAPMDKEDSFGMNALLLGAWFGHLPILQILVNAGAKINCQNKNGLNLLHCAALRGHIKVMEFIMEDLEGIRLDKVDKSGKTAFHLAAEHGQLEAVEFLIGSGCQHS-LKDKDKNTALHLATKNGHVEVLQ 199          
BLAST of SMED30015660 vs. Ensembl Xenopus
Match: ANKDD1A (ankyrin repeat and death domain containing 1A [Source:NCBI gene;Acc:100489003])

HSP 1 Score: 97.8265 bits (242), Expect = 2.261e-22
Identity = 50/189 (26.46%), Postives = 102/189 (53.97%), Query Frame = 3
Query:  138 RRPIHFACLKGDIDIVKVLIDHNCDIEVRNRKWNQQPIHMACWDGHLEILKVLLEKNCDIESCDEWKRRPIHLACENGHTEIVKFLINLHCDIEAIND-KAWRPIHFGCWKGHSDIVKVLVEQNCDIEACDHLKRRPIHLACEKGHTEIVKVLIDHHCDISACGGRFNQSPIHLARKNNFTELIQLLTI 701
            +   H A   G ++ V+ LI   C   ++++  N   +H+A  +GH+E+L+ ++E   ++   +      +HLA E G+ + V+ L++  CD+ A  + K    +H+  + G+ DI ++L++   +I A +H K   +H++  +     VK+LID  CD+     R  Q+P+H+A +N   ++ +++ I
Sbjct:  150 KTAFHLAAEHGQLEAVEFLIGSGCQHSLKDKDKNT-ALHLATKNGHVEVLQKIVETGVELNEKNTEGMTALHLATEGGYFDCVRILLDAGCDVNAQTEQKCMNGLHYSAFHGYEDIARILIDAGININAVNHRKSTALHISILQNFPATVKLLIDFECDLDIPDYRL-QTPLHIAAENGRQDMAEMILI 336          

HSP 2 Score: 70.0922 bits (170), Expect = 6.851e-13
Identity = 40/178 (22.47%), Postives = 91/178 (51.12%), Query Frame = 3
Query:  168 GDIDIVKVLIDHNCDIEVRNRKWNQQPIHMACWDGHLEILKVLLE--KNCDIESCDEWKRRPIHLACENGHTEIVKFLINLHCDIEAINDKAWRPIHFGCWKGHSDIVKVLVEQNCDIEACDHLKRRPIHLACEKGHTEIVKVLIDHHCDISACGGRFNQSPIHLARKNNFTELIQLL 695
            G + I+++L++    I  +N+      +H A   GH+++++ ++E  +   ++  D+  +   HLA E+G  E V+FLI   C     +      +H     GH ++++ +VE   ++   +      +HLA E G+ + V++L+D  CD++A   +   + +H +  + + ++ ++L
Sbjct:   92 GHLPILQILVNAGAKINCQNKN-GLNLLHCAALRGHIKVMEFIMEDLEGIRLDKVDKSGKTAFHLAAEHGQLEAVEFLIGSGCQHSLKDKDKNTALHLATKNGHVEVLQKIVETGVELNEKNTEGMTALHLATEGGYFDCVRILLDAGCDVNAQTEQKCMNGLHYSAFHGYEDIARIL 268          

HSP 3 Score: 66.2402 bits (160), Expect = 1.237e-11
Identity = 30/151 (19.87%), Postives = 72/151 (47.68%), Query Frame = 3
Query:  144 PIHFACLKGDIDIVKVLIDHNCDIEVRNRKWNQQPIHMACWDGHLEILKVLLEKNCDIESCDEWKRRPIHLACENGHTEIVKFLINLHCDIEAINDKAWRPIHFGCWKGHSDIVKVLVEQNCDIEACDHLKRRPIHLACEKGHTEIVKVLI 596
             +H A   G  D V++L+D  CD+  +  +     +H + + G+ +I ++L++   +I + +  K   +H++        VK LI+  CD++  + +   P+H     G  D+ ++++    +++  D   +  + +A    H  +  ++I
Sbjct:  218 ALHLATEGGYFDCVRILLDAGCDVNAQTEQKCMNGLHYSAFHGYEDIARILIDAGININAVNHRKSTALHISILQNFPATVKLLIDFECDLDIPDYRLQTPLHIAAENGRQDMAEMILIAGVNLKLQDKQGKTSLDVAARGNHINLADMII 368          

HSP 4 Score: 50.447 bits (119), Expect = 1.907e-6
Identity = 44/196 (22.45%), Postives = 72/196 (36.73%), Query Frame = 3
Query:  207 CDIEVRNRKWNQQPIHMACWDGHLEILKVLLEKNCDIESCDEWKRRPIHLACENGHTEIVKFLINLHCDIEAINDKAWRPIHFGCWKGHSDIVKVLVEQNCDI-----------------------------------EACDHLKRRPIHLACEKGHTEIVKVLIDHHCDISACGGRFNQSPIHLARKNNFTELIQ 689
            CD E+  R  +++  H A      E ++ L+E   D+   +   R  +H A   GH + V+ L+     ++  +      +  G W GH  I+++LV     I                                   +  D   +   HLA E G  E V+ LI   C  S    +   + +HLA KN   E++Q
Sbjct:    7 CDDEILLR--SERDFHNAAKTNDTEKMRQLIELGVDVRVKNSVDRTALHWAAGAGHKQAVQLLLEHDAPMDKEDSFGMNALLLGAWFGHLPILQILVNAGAKINCQNKNGLNLLHCAALRGHIKVMEFIMEDLEGIRLDKVDKSGKTAFHLAAEHGQLEAVEFLIGSGCQHS-LKDKDKNTALHLATKNGHVEVLQ 199          
BLAST of SMED30015660 vs. Ensembl Xenopus
Match: ptprc (protein tyrosine phosphatase, receptor type C [Source:Xenbase;Acc:XB-GENE-981257])

HSP 1 Score: 94.7449 bits (234), Expect = 2.938e-21
Identity = 56/190 (29.47%), Postives = 92/190 (48.42%), Query Frame = 3
Query:  138 RRPIHFACLKGDIDIVKVLIDHNCDIEVRNRKWNQQPIHMACWDGHLEILKVLLE--KNCDIESCDEWKRRPIHLACENGHTEIVKFLINLHCDIEAINDKAWRPIHFGCWKGHSDIVKVLVEQNCDIEACDHLKRRPIHLACEKGHTEIVKVLIDHHCDISACGGRFNQSPIHLARKNNFTELIQLLTI 701
            R+P H A  KG ID+V  LI+       ++++ N   +H A  +GH  +++ LLE  K  +I+  +E    P +LA   GH    + L++   +I       +  +H     G +  V  L+    +     + +  P HLA    H EI+ +L++   DI+A   R  QSP+HLA +   TEL++ L I
Sbjct:  200 RKPFHLAAEKGHIDMVTKLIEFELFTLEKDKEGNT-ALHYAAKNGHSSVVETLLEIWKENEIDEPNESGATPFYLAAGGGHVACAELLLHKGSNINTTTHDGYGALHIAAQNGFTSFVSFLLNNAIESNPEPNERNNPFHLALLNNHMEIIDILLERKYDINATNAR-QQSPLHLAAEYKNTELVEKLLI 387          

HSP 2 Score: 74.7146 bits (182), Expect = 1.961e-14
Identity = 49/186 (26.34%), Postives = 85/186 (45.70%), Query Frame = 3
Query:  144 PIHFACLKGDIDIVKVLIDHNCDIEVRNRKWNQQPIHMACWDGHLEILKVLLEKNCDIESCDEWKRRPIHLACENGHTEIVKFLINLHCDIEAINDKAWRPIHFGCWKGHSDIVKVLVE--QNCDIEACDHLKRRPIHLACEKGHTEIVKVLIDHHCDISACGGRFNQSPIHLARKNNFTELIQLL 695
              H A  K D+  +  L++   +I  +N   N+  +H A     ++ +  LL     ++  D+     +HLA  +    IV+ LI      +A N      +HF      +DIV+ L++  Q  D+   D  KR+P HLA EKGH ++V  LI+     +    +   + +H A KN  + +++ L
Sbjct:   68 AFHDAAKKDDVLAMTRLLEQKANINAKNN-LNRTALHFAVAANKMQAVSFLLSHKARVDIADKHGLTVLHLAAWSADLTIVQMLIKAGISQKATNQDGMNVLHFAAQNDKNDIVEYLIKDLQLKDLNILDKKKRKPFHLAAEKGHIDMVTKLIEFEL-FTLEKDKEGNTALHYAAKNGHSSVVETL 251          

HSP 3 Score: 63.1586 bits (152), Expect = 1.327e-10
Identity = 42/153 (27.45%), Postives = 67/153 (43.79%), Query Frame = 3
Query:  144 PIHFACLKGDIDIVKVLIDHNCDIEVRNRKWNQQPIHMACWDGHLEILKVLLEKNCDIESCDEWKRR--PIHLACENGHTEIVKFLINLHCDIEAINDKAWRPIHFGCWKGHSDIVKVLVEQNCDIEACDHLKRRPIHLACEKGHTEIVKVLI 596
            P + A   G +   ++L+    +I           +H+A  +G    +  LL  N  IES  E   R  P HLA  N H EI+  L+    DI A N +   P+H      ++++V+ L+   CD+   D  K+  +  A    H  IV ++I
Sbjct:  270 PFYLAAGGGHVACAELLLHKGSNINTTTHD-GYGALHIAAQNGFTSFVSFLL--NNAIESNPEPNERNNPFHLALLNNHMEIIDILLERKYDINATNARQQSPLHLAAEYKNTELVEKLLIAGCDLTISDKQKKTALGTAARSNHILIVDMII 419          
BLAST of SMED30015660 vs. Ensembl Mouse
Match: Ripk4 (receptor-interacting serine-threonine kinase 4 [Source:MGI Symbol;Acc:MGI:1919638])

HSP 1 Score: 111.694 bits (278), Expect = 5.344e-27
Identity = 58/186 (31.18%), Postives = 99/186 (53.23%), Query Frame = 3
Query:  144 PIHFACLKGDIDIVKVLIDHNCDIEVRNR-KWNQQPIHMACWDGHLEILKVLLEKNCDIESCDEWKRRPIHLACENGHTEIVKFLINLHCDIEAINDKAWRPIHFGCWKGHSDIVKVLVEQ-NCDIEACDHLKRRPIHLACEKGHTEIVKVLIDHHCDISACGGRFNQSPIHLARKNNFTELIQLL 695
            P+H A  +    IV++L+     +  ++  +W    +H A  +G     ++LLEKN  +   D   R P+H+AC++G   IV+ L+    D+      AW P+H+  W+GH  IVK+L +Q    + A     R P+HLA ++GH  + ++LID   D++ C  +  Q+P+H+A +   T   +LL
Sbjct:  476 PLHMAVERKGRGIVELLLARKTSVNAKDEDQWTA--LHFAAQNGDEASTRLLLEKNASVNEVDFEGRTPMHVACQHGQENIVRTLLRRGVDVGLQGKDAWLPLHYAAWQGHLPIVKLLAKQPGVSVNAQTLDGRTPLHLAAQRGHYRVARILIDLCSDVNICSLQ-AQTPLHVAAETGHTSTARLL 658          

HSP 2 Score: 110.923 bits (276), Expect = 9.808e-27
Identity = 60/190 (31.58%), Postives = 102/190 (53.68%), Query Frame = 3
Query:  138 RRPIHFACLKGDIDIVKVLIDHNCDIEVRNR-KWNQQPIHMACWDGHLEILKVLLEK---NCDIESCDEWKRRPIHLACENGHTEIVKFLINLHCDIEAINDKAWRPIHFGCWKGHSDIVKVLVEQNCDIEACDHLKRRPIHLACEKGHTEIVKVLIDHHCDISACGGRFNQSPIHLARKNNFTELIQLL 695
            R P+H AC  G  +IV+ L+    D+ ++ +  W   P+H A W GHL I+K+L ++   + + ++ D   R P+HLA + GH  + + LI+L  D+   + +A  P+H     GH+   ++L+ +    EA        +HLA + GH   VK+LI+   D+ A  G  NQ+ +HLA     +E+++ L
Sbjct:  540 RTPMHVACQHGQENIVRTLLRRGVDVGLQGKDAW--LPLHYAAWQGHLPIVKLLAKQPGVSVNAQTLD--GRTPLHLAAQRGHYRVARILIDLCSDVNICSLQAQTPLHVAAETGHTSTARLLLHRGAGKEALTSEGYTALHLAAQNGHLATVKLLIEEKADVMAR-GPLNQTALHLAAARGHSEVVEEL 724          

HSP 3 Score: 102.064 bits (253), Expect = 9.032e-24
Identity = 52/188 (27.66%), Postives = 97/188 (51.60%), Query Frame = 3
Query:  144 PIHFACLKGDIDIVKVLIDHNCDIEVRNRKWN-QQPIHMACWDGHLEILKVLLEKNCDIESCDEWKRRPIHLACENGHTEIVKFLINLHCDIEAINDKAWRPIHFGCWKGHSDIVKVLVEQNCDIEACDHLKRRPIHLACEKGHTEIVKVLIDHHCDISACGGRFNQSPIHLARKNNFTELIQLLTIH 704
            P+H+A  +G + IVK+L      + V  +  + + P+H+A   GH  + ++L++   D+  C    + P+H+A E GHT   + L++     EA+  + +  +H     GH   VK+L+E+  D+ A   L +  +HLA  +GH+E+V+ L+    D+         S +HLA +   ++ ++ L  H
Sbjct:  575 PLHYAAWQGHLPIVKLLAKQP-GVSVNAQTLDGRTPLHLAAQRGHYRVARILIDLCSDVNICSLQAQTPLHVAAETGHTSTARLLLHRGAGKEALTSEGYTALHLAAQNGHLATVKLLIEEKADVMARGPLNQTALHLAAARGHSEVVEELVS--ADLIDLSDEQGLSALHLAAQGRHSQTVETLLKH 759          

HSP 4 Score: 66.6254 bits (161), Expect = 7.001e-12
Identity = 46/182 (25.27%), Postives = 84/182 (46.15%), Query Frame = 3
Query:  156 ACLKGDID-IVKVLIDHNCDIEVRNRKWNQQPIHMACWDGHLEILKVLLEKNCDIESCDEWKRRPIHLACENGHTEIVKFLINLHCDIEAINDKAWRPIHFGCWKGHSDIVKVLVEQNCDIEACDHLKRRPIHLACEKGHTEIVKVLIDHHCDISACGGRFNQSPIHLARKNNFTELIQLLT 698
            A + GD   ++K+L   + D+ + +   +   +H+A   G  E +K LL  N +    +     P+H+A E     IV+ L+     + A ++  W  +HF    G     ++L+E+N  +   D   R P+H+AC+ G   IV+ L+    D+    G+    P+H A       +++LL 
Sbjct:  415 AIISGDTSRLMKILQPQDVDLVLDS---SASLLHLAVEAGQEECVKWLLLNNANPNLTNRKGSTPLHMAVERKGRGIVELLLARKTSVNAKDEDQWTALHFAAQNGDEASTRLLLEKNASVNEVDFEGRTPMHVACQHGQENIVRTLLRRGVDV-GLQGKDAWLPLHYAAWQGHLPIVKLLA 592          
BLAST of SMED30015660 vs. Ensembl Mouse
Match: Ankrd28 (ankyrin repeat domain 28 [Source:MGI Symbol;Acc:MGI:2145661])

HSP 1 Score: 99.7525 bits (247), Expect = 4.466e-25
Identity = 53/175 (30.29%), Postives = 99/175 (56.57%), Query Frame = 3
Query:  138 RRPIHFACLKGDIDIVKVLIDHNCDIEVRNRKWNQQPIHMACWDGHLEILKVLLEKNCDIESCDEWKRRPIHLACENGHTEIVKFLINLHCDIEAINDKAWR-PIHFGCWKGHSDIVKVLVEQNCDIEACDHLKRRPIHLACEKGHTEIVKVLIDHHCDISACGGRFNQSPIHLA 659
            R P+H A   GD +I+++LI     +  ++ KW   P+H A      E +++LL+ + D+ + D+  + P+H+A  N   +  + L+ L  ++  ++D+A R  +H   + GH ++VK+L+ +  +I A D   RR IH A   GH E+VK+L+ H  +++ C  + + +P+H A
Sbjct:   14 RTPLHAAAYLGDAEIIELLILSGARVNAKDSKW-LTPLHRAVASCSEEAVQILLKHSADVNARDKNWQTPLHIAAANKAVKCAESLVPLLSNVN-VSDRAGRTALHHAAFSGHGEMVKLLLSRGANINAFDKKDRRAIHWAAYMGHIEVVKLLVSHGAEVT-CKDKKSYTPLHAA 185          

HSP 2 Score: 48.1358 bits (113), Expect = 2.287e-6
Identity = 30/123 (24.39%), Postives = 59/123 (47.97%), Query Frame = 3
Query:  327 DEWKRRPIHLACENGHTEIVKFLINLHCDIEAINDKAWRPIHFGCWKGHSDIVKVLVEQNCDIEACDHLKRRPIHLACEKGHTEIVKVLIDHHCDISACGGRFNQSPIHLARKNNFTELIQLL 695
            D  KR P+H A   G  EI++ LI     + A + K   P+H        + V++L++ + D+ A D   + P+H+A      +  + L+    +++    R  ++ +H A  +   E+++LL
Sbjct:   10 DNEKRTPLHAAAYLGDAEIIELLILSGARVNAKDSKWLTPLHRAVASCSEEAVQILLKHSADVNARDKNWQTPLHIAAANKAVKCAESLVPLLSNVN-VSDRAGRTALHHAAFSGHGEMVKLL 131          
BLAST of SMED30015660 vs. Ensembl Mouse
Match: Ankk1 (ankyrin repeat and kinase domain containing 1 [Source:MGI Symbol;Acc:MGI:3045301])

HSP 1 Score: 99.7525 bits (247), Expect = 4.934e-23
Identity = 54/173 (31.21%), Postives = 90/173 (52.02%), Query Frame = 3
Query:  144 PIHFACLKGDIDIVKVLIDHNCDIEVRNRK-WNQQPIHMACWDGHLEILKVLLEKNCDIESCDEWKRRPIHLACENGHTEIVKFLINLHCDIEAINDKAWRPIHFGCWKGHSDIVKVLVEQNCDIEACDHLKRRPIHLACEKGHTEIVKVLIDHHCDISACGGRFNQSPIHLA 659
            P+H A  +G   I K+L+ +   +E+R ++ W   P+H+A + GHLEI+  L + + D+++    +  P+HLA   G   ++  L+    +  A     W P+H    KG    +  L+E   DI AC+ +   P HLA  KG+T I+KVL+     +   GG  + +P+ LA
Sbjct:  571 PLHIAAARGKDLIFKMLLRYGASLELRTQQGWT--PLHLATYKGHLEIIHQLAKSHVDLDALGSMQWTPLHLAAFQGEEGVMLALLQCGANPNAAEQSGWTPLHLAVHKGTFLGITHLLEYGADIHACNKVGWTPAHLAALKGNTAILKVLVKAAAQVDVKGG-VSCTPLQLA 740          

HSP 2 Score: 90.8929 bits (224), Expect = 5.858e-20
Identity = 46/172 (26.74%), Postives = 85/172 (49.42%), Query Frame = 3
Query:  144 PIHFACLKGDIDIVKVLIDHNCDIEVRNRKWNQQPIHMACWDGHLEILKVLLEKNCDIESCDEWKRRPIHLACENGHTEIVKFLINLHCDIEAINDKAWRPIHFGCWKGHSDIVKVLVEQNCDIEACDHLKRRPIHLACEKGHTEIVKVLIDHHCDISACGGRFNQSPIHLA 659
            P+H A      ++ ++L+    D+     +  + P+H+A + GH+ ++K+L  +  ++++     R P+HLA E G    ++ L+      +A++   + P+H    +G   I K+L+     +E        P+HLA  KGH EI+  L   H D+ A G     +P+HLA
Sbjct:  472 PLHLAAQNNFENVARLLVSRQADLSPHEAE-GKTPLHVAAYFGHIGLVKLLSGQGAELDAQQRNLRTPLHLAVERGKVRAIQHLLKCGALPDALDHSGYSPLHIAAARGKDLIFKMLLRYGASLELRTQQGWTPLHLATYKGHLEIIHQLAKSHVDLDALGS-MQWTPLHLA 641          

HSP 3 Score: 88.1965 bits (217), Expect = 1.582e-19
Identity = 51/193 (26.42%), Postives = 91/193 (47.15%), Query Frame = 3
Query:  138 RRPIHFACLKGDIDIVKVLIDHNCDIEVRNRKWNQQPIHMACWDGHLEILKVLLEKNCDIESCDEWKRRPIHLACENGHTEIVKFLINLHCDIEAINDKAWRPIHFGCWKGHSDIVKVLVEQNCDIEACDHLKRRPIHLACEKGHTEIVKVLIDHHCDISACGGRFNQ------SPIHLA-RKNNFTELIQLL 695
            + P+H A   G I +VK+L     +++ + R   + P+H+A   G +  ++ LL+     ++ D     P+H+A   G   I K L+     +E    + W P+H   +KGH +I+  L + + D++A   ++  P+HLA  +G   ++  L+        CG   N       +P+HLA  K  F  +  LL
Sbjct:  503 KTPLHVAAYFGHIGLVKLLSGQGAELDAQQRNL-RTPLHLAVERGKVRAIQHLLKCGALPDALDHSGYSPLHIAAARGKDLIFKMLLRYGASLELRTQQGWTPLHLATYKGHLEIIHQLAKSHVDLDALGSMQWTPLHLAAFQGEEGVMLALLQ-------CGANPNAAEQSGWTPLHLAVHKGTFLGITHLL 687          

HSP 4 Score: 26.5646 bits (57), Expect = 1.582e-19
Identity = 9/25 (36.00%), Postives = 15/25 (60.00%), Query Frame = 2
Query:    2 PIHLAFDNNHREIVKLLIEENCDVN 76
            P+HLA  NN   + +LL+    D++
Sbjct:  472 PLHLAAQNNFENVARLLVSRQADLS 496          

HSP 5 Score: 69.3218 bits (168), Expect = 9.979e-13
Identity = 47/222 (21.17%), Postives = 91/222 (40.99%), Query Frame = 3
Query:  144 PIHFACLKGDIDIVKVLIDHNCDIEVRNRK---------WNQQP-----------------------IHMACWDGHLEILKVLLEKNCDIESCDEWKRRPIHLACENGHTEIVKFLINLHCDIEAINDKAWRPIHFGCWKGHSDIVKVLVEQNCDIEACDHLKRRPIHLACEKGHTEIVKVLIDHHCDISACGG------RFNQSPIHLARKNNFTELIQLL 695
            P+HF    G ++ V++L+ H+ D++ +             +QQP                       +H A  +G     ++LL+    + + +     P+HLA +N    + + L++   D+     +   P+H   + GH  +VK+L  Q  +++A     R P+HLA E+G    ++ L+        CG           SP+H+A       + ++L
Sbjct:  373 PLHFLVAGGSLEQVRLLLSHDVDVDCQTASGYTPLLIATQDQQPDLCALLLAHGADTNLADEDGWAPLHFAAQNGDDHTARLLLDHGALVNAREHEGWTPLHLAAQNNFENVARLLVSRQADLSPHEAEGKTPLHVAAYFGHIGLVKLLSGQGAELDAQQRNLRTPLHLAVERGKVRAIQHLLK-------CGALPDALDHSGYSPLHIAAARGKDLIFKML 587          

HSP 6 Score: 66.2402 bits (160), Expect = 1.161e-11
Identity = 33/151 (21.85%), Postives = 70/151 (46.36%), Query Frame = 3
Query:  246 PIHMACWDGHLEILKVLLEKNCDIESCDEWKRRPIHLACENGHTEIVKFLINLHCDIEAINDKAWRPIHFGCWKGHSDIVKVLVEQNCDIEACDHLKRRPIHLACEKGHTEIVKVLIDHHCDISACGGRFNQSPIHLARKNNFTELIQLLT 698
            P+H     G LE +++LL  + D++        P+ +A ++   ++   L+    D    ++  W P+HF    G     ++L++    + A +H    P+HLA +     + ++L+    D+S       ++P+H+A       L++LL+
Sbjct:  373 PLHFLVAGGSLEQVRLLLSHDVDVDCQTASGYTPLLIATQDQQPDLCALLLAHGADTNLADEDGWAPLHFAAQNGDDHTARLLLDHGALVNAREHEGWTPLHLAAQNNFENVARLLVSRQADLSPHEAE-GKTPLHVAAYFGHIGLVKLLS 522          

HSP 7 Score: 55.0694 bits (131), Expect = 4.596e-8
Identity = 34/140 (24.29%), Postives = 63/140 (45.00%), Query Frame = 3
Query:  282 ILKVLLEKNCDIESCDEWKRRPIHLACENGHTEIVKFLINLHCDIEAINDKAWRPIHFGCWKGHSDIVKVLVEQNCDIEACDHLKRRPIHLACEKGHTEIVKVLIDHHCDISACGGRFNQ--SPIHLARKNNFTELIQLL 695
            IL++   K+       E +  P+H     G  E V+ L++   D++      + P+         D+  +L+    D    D     P+H A + G     ++L+DH   ++A   R ++  +P+HLA +NNF  + +LL
Sbjct:  352 ILQLSDSKSLVASDVYENRVTPLHFLVAGGSLEQVRLLLSHDVDVDCQTASGYTPLLIATQDQQPDLCALLLAHGADTNLADEDGWAPLHFAAQNGDDHTARLLLDHGALVNA---REHEGWTPLHLAAQNNFENVARLL 488          
BLAST of SMED30015660 vs. Ensembl Mouse
Match: Ankrd28 (ankyrin repeat domain 28 [Source:MGI Symbol;Acc:MGI:2145661])

HSP 1 Score: 98.9821 bits (245), Expect = 1.274e-22
Identity = 54/187 (28.88%), Postives = 104/187 (55.61%), Query Frame = 3
Query:  138 RRPIHFACLKGDIDIVKVLIDHNCDIEVRNRKWNQQPIHMACWDGHLEILKVLLEKNCDIESCDEWKRRPIHLACENGHTEIVKFLINLHCDIEAINDKAWR-PIHFGCWKGHSDIVKVLVEQNCDIEACDHLKRRPIHLACEKGHTEIVKVLIDHHCDISACGGRFNQSPIHLARKNNFTELIQLL 695
            R P+H A   GD +I+++LI     +  ++ KW   P+H A      E +++LL+ + D+ + D+  + P+H+A  N   +  + L+ L  ++  ++D+A R  +H   + GH ++VK+L+ +  +I A D   RR IH A   GH E+VK+L+ H  +++ C  + + +P+H A  +    +++ L
Sbjct:   42 RTPLHAAAYLGDAEIIELLILSGARVNAKDSKW-LTPLHRAVASCSEEAVQILLKHSADVNARDKNWQTPLHIAAANKAVKCAESLVPLLSNVN-VSDRAGRTALHHAAFSGHGEMVKLLLSRGANINAFDKKDRRAIHWAAYMGHIEVVKLLVSHGAEVT-CKDKKSYTPLHAAASSGMISVVKYL 225          

HSP 2 Score: 92.4337 bits (228), Expect = 1.767e-20
Identity = 50/175 (28.57%), Postives = 91/175 (52.00%), Query Frame = 3
Query:  144 PIHFACLKGDIDIVKVLIDHNCDIEVRNRKWNQQPIHMACWDGHLEILKVLLEKNCDIESCDEWKRRPIHLACENGHTEIVKFLINLHCDIEAINDKAWRPIHFGCWKGHSDIVKVLVEQNCDIEACDHLKRRPIHLACEKGHTEIVKVLIDHHCDISACGGRFNQSPIHLARKN 668
            P+H A      + V++L+ H+ D+  R++ W Q P+H+A  +  ++  + L+    ++   D   R  +H A  +GH E+VK L++   +I A + K  R IH+  + GH ++VK+LV    ++   D     P+H A   G   +VK L+D   D++     +  +P+H+A  N
Sbjct:   77 PLHRAVASCSEEAVQILLKHSADVNARDKNW-QTPLHIAAANKAVKCAESLVPLLSNVNVSDRAGRTALHHAAFSGHGEMVKLLLSRGANINAFDKKDRRAIHWAAYMGHIEVVKLLVSHGAEVTCKDKKSYTPLHAAASSGMISVVKYLLDLGVDMNEPNA-YGNTPLHVACYN 249          

HSP 3 Score: 91.6633 bits (226), Expect = 3.133e-20
Identity = 51/188 (27.13%), Postives = 94/188 (50.00%), Query Frame = 3
Query:  135 DRRPIHFACLKGDIDIVKVLIDHNCDIEVRNRKWNQQPIHMACWDGHLEILKVLLEKNCDIESCDEWKRRPIHLACENGHTEIVKFLINLHCDIEAINDKAWRPIHFGCWKGHSDI-VKVLVEQNCDIEACDHLKRRPIHLACEKGHTEIVKVLIDHHCDISACGGRFNQSPIHLARKNNFTELIQLL 695
            DRR IH+A   G I++VK+L+ H  ++  +++K +  P+H A   G + ++K LL+   D+   + +   P+H+AC NG   +V  LI+   ++   N+K + P+HF     H  + +++LV    D+       + P+H+    G     + +I     I  C  +   +P+H+A +     LI  L
Sbjct:  173 DRRAIHWAAYMGHIEVVKLLVSHGAEVTCKDKK-SYTPLHAAASSGMISVVKYLLDLGVDMNEPNAYGNTPLHVACYNGQDVVVNELIDCGANVNQKNEKGFTPLHFAAASTHGALCLELLVGNGADVNMKSKDGKTPLHMTALHGRFSRSQTIIQSGAVID-CEDKNGNTPLHIAARYGHELLINTL 358          

HSP 4 Score: 79.7221 bits (195), Expect = 3.403e-16
Identity = 42/174 (24.14%), Postives = 91/174 (52.30%), Query Frame = 3
Query:  138 RRPIHFACLKGDIDIVKVLIDHNCDIEVRNRKWNQQPIHMACWDGHLEILKVLLEKNCDIESCDEWKRRPIHLACENGHTEIVKFLINLHCDIEAINDKAWRPIHFGCWKGHSDIVKVLVEQNCDIEACDHLKRRPIHLACEKGHTEI-VKVLIDHHCDISACGGRFNQSPIHL 656
            R  +H A   G  ++VK+L+    +I   ++K +++ IH A + GH+E++K+L+    ++   D+    P+H A  +G   +VK+L++L  D+   N     P+H  C+ G   +V  L++   ++   +     P+H A    H  + +++L+ +  D++    +  ++P+H+
Sbjct:  141 RTALHHAAFSGHGEMVKLLLSRGANINAFDKK-DRRAIHWAAYMGHIEVVKLLVSHGAEVTCKDKKSYTPLHAAASSGMISVVKYLLDLGVDMNEPNAYGNTPLHVACYNGQDVVVNELIDCGANVNQKNEKGFTPLHFAAASTHGALCLELLVGNGADVNM-KSKDGKTPLHM 312          

HSP 5 Score: 78.5666 bits (192), Expect = 9.915e-16
Identity = 48/164 (29.27%), Postives = 79/164 (48.17%), Query Frame = 3
Query:  138 RRPIHFACLKGDIDIVKVLIDHNCDIEVRNRKWNQQPIHMACWDGHLEILKVLL---EKNCDIESCDEWKRRPIHLACENGHTEIVKFLINLHCDIEAINDKAWRPIHFGCWKGHSDIVKVLVEQNCDIEACDHLKRRPIHLACEKGHTEIVKVLIDHHCDISA 620
            R P+  A  KG ++ V VLI+    I V++    + PIH A  +GH E L++L+   E    ++  D   + P+ L+  NGHT+ V  L+N   +++A +      +H G   GH + V  L++        D   R PIHL+   GH  ++  L+     + A
Sbjct:  584 RTPLDLAAFKGHVECVDVLINQGASILVKDYVLKRTPIHAAATNGHSECLRLLIGNAEPQNAVDIQDGNGQTPLMLSVLNGHTDCVYSLLNKGANVDAKDKWGRTALHRGAVTGHEECVDALLQHGAKCLLRDSRGRTPIHLSAACGHIGVLGALLQSATSVDA 747          

HSP 6 Score: 69.3218 bits (168), Expect = 1.118e-12
Identity = 44/156 (28.21%), Postives = 77/156 (49.36%), Query Frame = 3
Query:  144 PIHFACLKGDIDIVKVLIDH-NCDIEVRNRKWNQQPIHMACWDGHLEILKVLLEKNCDIESCDEWKRRPIHLACENGHTEIVKFLINLHCDIEAINDKAWR-PIHFGCWKGHSDIVKVLVEQNCD---IEACDHLKRRPIHLACEKGHTEIVKVLI 596
            P+H A +  +    ++LID     I        + P+H A +  H+E L++LL +N  + S D   + P+ +A ENG T  V+ L++       + DK+    +H  C KGH     +++E+  D   I A +   + P+H+A   G T +V+ L+
Sbjct:  791 PLHCAVINDNEGAAEMLIDSLGASIVNATDSKGRTPLHAAAFTDHVECLQLLLSQNAQVNSADSTGKTPLMMAAENGQTNTVEMLVSSASADLTLQDKSKNTALHLACGKGHETSALLILEKITDRNLINATNAALQTPLHVAARNGLTMVVQELL 946          

HSP 7 Score: 68.1662 bits (165), Expect = 2.466e-12
Identity = 56/262 (21.37%), Postives = 100/262 (38.17%), Query Frame = 3
Query:  132 WDRRPIHFACLKGDIDIVKVLIDHNCDIEVRNRKWNQQPIHMACWDGHLEILKVLLEKNCDIES----CDEWKRRPIHLACENGHTEIVKFLIN--------------LHCDI--------------------EAINDKAWRPIHFGCWKGHSDIVKVLVEQNCDIEACDHLKRRPIHLACEKGHTEIVKVLIDH-HCDIS------------ACGGRFN-----------------------QSPIHLARKNNFTELIQLL 695
            W R  +H   + G  + V  L+ H     +R+ +  + PIH++   GH+ +L  LL+    +++     D      +H AC NGH   V+ L+               LHC +                     A + K   P+H   +  H + +++L+ QN  + + D   + P+ +A E G T  V++L+     D++            ACG                           Q+P+H+A +N  T ++Q L
Sbjct:  685 WGRTALHRGAVTGHEECVDALLQHGAKCLLRDSR-GRTPIHLSAACGHIGVLGALLQSATSVDANPAVVDNHGYTALHWACYNGHETCVELLLEQDVFQKIDGNAFSPLHCAVINDNEGAAEMLIDSLGASIVNATDSKGRTPLHAAAFTDHVECLQLLLSQNAQVNSADSTGKTPLMMAAENGQTNTVEMLVSSASADLTLQDKSKNTALHLACGKGHETSALLILEKITDRNLINATNAALQTPLHVAARNGLTMVVQEL 945          

HSP 8 Score: 58.9214 bits (141), Expect = 3.282e-9
Identity = 45/186 (24.19%), Postives = 85/186 (45.70%), Query Frame = 3
Query:  144 PIHFACLKGDIDI-VKVLIDHNCDIEVRNRKWNQQPIHMACWDGHLEILKVLLEKNCDIESCDEWKRRPIHLACENGHTEIVKFLINLHCDIEAINDKAWRPIHFGCWKGHSDIVKVLVEQNCDIEACDHLKRRPIHLACEKGHTEIVKVLIDHHCDISACGGRFNQSPIHLARKN-NFTELIQLL 695
            P+HFA       + +++L+ +  D+ ++++   + P+HM    G     + +++    I+  D+    P+H+A   GH  ++  LI    D          P+H     G SD  + L+    DI+  D   R  +H A   G+ E + +L++   D +    +F +SP+H A  N N+  L  L+
Sbjct:  275 PLHFAAASTHGALCLELLVGNGADVNMKSKD-GKTPLHMTALHGRFSRSQTIIQSGAVIDCEDKNGNTPLHIAARYGHELLINTLITSGADTAKRGIHGMFPLHLAALSGFSDCCRKLLSSGFDIDTPDDFGRTCLHAAAAGGNLECLNLLLNTGADFNK-KDKFGRSPLHYAAANCNYQCLFALV 458          

HSP 9 Score: 56.9954 bits (136), Expect = 1.166e-8
Identity = 47/199 (23.62%), Postives = 85/199 (42.71%), Query Frame = 3
Query:  138 RRPIHFACLKGDIDIVKVLIDHNCDIEVRNRKWNQQPIHMACW-DGHLEILKVLLEKNCDIESCDEWKRRPIHLACENGHTEIVKFLIN-LHCDI-----------EAINDKAWRPIHFGCWKGHSDIVKVLVEQNCDIEACDHLKRRPIHLACEKGHTEIVKVLIDHHCDISACGGRFNQSPIHLARKNNFTELIQLL 695
            R P+H+A    +   +  L+     +   + +    P+H A   D   + L+ LL  + +    D+     +H +   GH   ++ + +    D+           ++ N     P+H   + GH   ++VLV+   D++  +   R P+ LA  KGH E V VLI+    I        ++PIH A  N  +E ++LL
Sbjct:  439 RSPLHYAAANCNYQCLFALVGSGASVNDLDER-GCTPLHYAATSDTDGKCLEYLLRNDANPGIRDKQGYNAVHYSAAYGHRLCLQLIASETPLDVLMETSGTDMLSDSDNRATISPLHLAAYHGHHQALEVLVQSLLDLDVRNSSGRTPLDLAAFKGHVECVDVLINQGASILVKDYVLKRTPIHAAATNGHSECLRLL 636          
BLAST of SMED30015660 vs. Ensembl Mouse
Match: Ankrd28 (ankyrin repeat domain 28 [Source:MGI Symbol;Acc:MGI:2145661])

HSP 1 Score: 98.5969 bits (244), Expect = 1.357e-22
Identity = 54/187 (28.88%), Postives = 104/187 (55.61%), Query Frame = 3
Query:  138 RRPIHFACLKGDIDIVKVLIDHNCDIEVRNRKWNQQPIHMACWDGHLEILKVLLEKNCDIESCDEWKRRPIHLACENGHTEIVKFLINLHCDIEAINDKAWR-PIHFGCWKGHSDIVKVLVEQNCDIEACDHLKRRPIHLACEKGHTEIVKVLIDHHCDISACGGRFNQSPIHLARKNNFTELIQLL 695
            R P+H A   GD +I+++LI     +  ++ KW   P+H A      E +++LL+ + D+ + D+  + P+H+A  N   +  + L+ L  ++  ++D+A R  +H   + GH ++VK+L+ +  +I A D   RR IH A   GH E+VK+L+ H  +++ C  + + +P+H A  +    +++ L
Sbjct:   72 RTPLHAAAYLGDAEIIELLILSGARVNAKDSKW-LTPLHRAVASCSEEAVQILLKHSADVNARDKNWQTPLHIAAANKAVKCAESLVPLLSNVN-VSDRAGRTALHHAAFSGHGEMVKLLLSRGANINAFDKKDRRAIHWAAYMGHIEVVKLLVSHGAEVT-CKDKKSYTPLHAAASSGMISVVKYL 255          

HSP 2 Score: 92.4337 bits (228), Expect = 1.795e-20
Identity = 50/175 (28.57%), Postives = 91/175 (52.00%), Query Frame = 3
Query:  144 PIHFACLKGDIDIVKVLIDHNCDIEVRNRKWNQQPIHMACWDGHLEILKVLLEKNCDIESCDEWKRRPIHLACENGHTEIVKFLINLHCDIEAINDKAWRPIHFGCWKGHSDIVKVLVEQNCDIEACDHLKRRPIHLACEKGHTEIVKVLIDHHCDISACGGRFNQSPIHLARKN 668
            P+H A      + V++L+ H+ D+  R++ W Q P+H+A  +  ++  + L+    ++   D   R  +H A  +GH E+VK L++   +I A + K  R IH+  + GH ++VK+LV    ++   D     P+H A   G   +VK L+D   D++     +  +P+H+A  N
Sbjct:  107 PLHRAVASCSEEAVQILLKHSADVNARDKNW-QTPLHIAAANKAVKCAESLVPLLSNVNVSDRAGRTALHHAAFSGHGEMVKLLLSRGANINAFDKKDRRAIHWAAYMGHIEVVKLLVSHGAEVTCKDKKSYTPLHAAASSGMISVVKYLLDLGVDMNEPNA-YGNTPLHVACYN 279          

HSP 3 Score: 91.6633 bits (226), Expect = 3.184e-20
Identity = 51/188 (27.13%), Postives = 94/188 (50.00%), Query Frame = 3
Query:  135 DRRPIHFACLKGDIDIVKVLIDHNCDIEVRNRKWNQQPIHMACWDGHLEILKVLLEKNCDIESCDEWKRRPIHLACENGHTEIVKFLINLHCDIEAINDKAWRPIHFGCWKGHSDI-VKVLVEQNCDIEACDHLKRRPIHLACEKGHTEIVKVLIDHHCDISACGGRFNQSPIHLARKNNFTELIQLL 695
            DRR IH+A   G I++VK+L+ H  ++  +++K +  P+H A   G + ++K LL+   D+   + +   P+H+AC NG   +V  LI+   ++   N+K + P+HF     H  + +++LV    D+       + P+H+    G     + +I     I  C  +   +P+H+A +     LI  L
Sbjct:  203 DRRAIHWAAYMGHIEVVKLLVSHGAEVTCKDKK-SYTPLHAAASSGMISVVKYLLDLGVDMNEPNAYGNTPLHVACYNGQDVVVNELIDCGANVNQKNEKGFTPLHFAAASTHGALCLELLVGNGADVNMKSKDGKTPLHMTALHGRFSRSQTIIQSGAVID-CEDKNGNTPLHIAARYGHELLINTL 388          

HSP 4 Score: 79.7221 bits (195), Expect = 3.522e-16
Identity = 42/174 (24.14%), Postives = 91/174 (52.30%), Query Frame = 3
Query:  138 RRPIHFACLKGDIDIVKVLIDHNCDIEVRNRKWNQQPIHMACWDGHLEILKVLLEKNCDIESCDEWKRRPIHLACENGHTEIVKFLINLHCDIEAINDKAWRPIHFGCWKGHSDIVKVLVEQNCDIEACDHLKRRPIHLACEKGHTEI-VKVLIDHHCDISACGGRFNQSPIHL 656
            R  +H A   G  ++VK+L+    +I   ++K +++ IH A + GH+E++K+L+    ++   D+    P+H A  +G   +VK+L++L  D+   N     P+H  C+ G   +V  L++   ++   +     P+H A    H  + +++L+ +  D++    +  ++P+H+
Sbjct:  171 RTALHHAAFSGHGEMVKLLLSRGANINAFDKK-DRRAIHWAAYMGHIEVVKLLVSHGAEVTCKDKKSYTPLHAAASSGMISVVKYLLDLGVDMNEPNAYGNTPLHVACYNGQDVVVNELIDCGANVNQKNEKGFTPLHFAAASTHGALCLELLVGNGADVNM-KSKDGKTPLHM 342          

HSP 5 Score: 78.5666 bits (192), Expect = 9.886e-16
Identity = 48/164 (29.27%), Postives = 79/164 (48.17%), Query Frame = 3
Query:  138 RRPIHFACLKGDIDIVKVLIDHNCDIEVRNRKWNQQPIHMACWDGHLEILKVLL---EKNCDIESCDEWKRRPIHLACENGHTEIVKFLINLHCDIEAINDKAWRPIHFGCWKGHSDIVKVLVEQNCDIEACDHLKRRPIHLACEKGHTEIVKVLIDHHCDISA 620
            R P+  A  KG ++ V VLI+    I V++    + PIH A  +GH E L++L+   E    ++  D   + P+ L+  NGHT+ V  L+N   +++A +      +H G   GH + V  L++        D   R PIHL+   GH  ++  L+     + A
Sbjct:  614 RTPLDLAAFKGHVECVDVLINQGASILVKDYVLKRTPIHAAATNGHSECLRLLIGNAEPQNAVDIQDGNGQTPLMLSVLNGHTDCVYSLLNKGANVDAKDKWGRTALHRGAVTGHEECVDALLQHGAKCLLRDSRGRTPIHLSAACGHIGVLGALLQSATSVDA 777          

HSP 6 Score: 69.3218 bits (168), Expect = 1.167e-12
Identity = 44/156 (28.21%), Postives = 77/156 (49.36%), Query Frame = 3
Query:  144 PIHFACLKGDIDIVKVLIDH-NCDIEVRNRKWNQQPIHMACWDGHLEILKVLLEKNCDIESCDEWKRRPIHLACENGHTEIVKFLINLHCDIEAINDKAWR-PIHFGCWKGHSDIVKVLVEQNCD---IEACDHLKRRPIHLACEKGHTEIVKVLI 596
            P+H A +  +    ++LID     I        + P+H A +  H+E L++LL +N  + S D   + P+ +A ENG T  V+ L++       + DK+    +H  C KGH     +++E+  D   I A +   + P+H+A   G T +V+ L+
Sbjct:  821 PLHCAVINDNEGAAEMLIDSLGASIVNATDSKGRTPLHAAAFTDHVECLQLLLSQNAQVNSADSTGKTPLMMAAENGQTNTVEMLVSSASADLTLQDKSKNTALHLACGKGHETSALLILEKITDRNLINATNAALQTPLHVAARNGLTMVVQELL 976          

HSP 7 Score: 68.1662 bits (165), Expect = 2.574e-12
Identity = 56/262 (21.37%), Postives = 100/262 (38.17%), Query Frame = 3
Query:  132 WDRRPIHFACLKGDIDIVKVLIDHNCDIEVRNRKWNQQPIHMACWDGHLEILKVLLEKNCDIES----CDEWKRRPIHLACENGHTEIVKFLIN--------------LHCDI--------------------EAINDKAWRPIHFGCWKGHSDIVKVLVEQNCDIEACDHLKRRPIHLACEKGHTEIVKVLIDH-HCDIS------------ACGGRFN-----------------------QSPIHLARKNNFTELIQLL 695
            W R  +H   + G  + V  L+ H     +R+ +  + PIH++   GH+ +L  LL+    +++     D      +H AC NGH   V+ L+               LHC +                     A + K   P+H   +  H + +++L+ QN  + + D   + P+ +A E G T  V++L+     D++            ACG                           Q+P+H+A +N  T ++Q L
Sbjct:  715 WGRTALHRGAVTGHEECVDALLQHGAKCLLRDSR-GRTPIHLSAACGHIGVLGALLQSATSVDANPAVVDNHGYTALHWACYNGHETCVELLLEQDVFQKIDGNAFSPLHCAVINDNEGAAEMLIDSLGASIVNATDSKGRTPLHAAAFTDHVECLQLLLSQNAQVNSADSTGKTPLMMAAENGQTNTVEMLVSSASADLTLQDKSKNTALHLACGKGHETSALLILEKITDRNLINATNAALQTPLHVAARNGLTMVVQEL 975          

HSP 8 Score: 58.9214 bits (141), Expect = 3.300e-9
Identity = 45/186 (24.19%), Postives = 85/186 (45.70%), Query Frame = 3
Query:  144 PIHFACLKGDIDI-VKVLIDHNCDIEVRNRKWNQQPIHMACWDGHLEILKVLLEKNCDIESCDEWKRRPIHLACENGHTEIVKFLINLHCDIEAINDKAWRPIHFGCWKGHSDIVKVLVEQNCDIEACDHLKRRPIHLACEKGHTEIVKVLIDHHCDISACGGRFNQSPIHLARKN-NFTELIQLL 695
            P+HFA       + +++L+ +  D+ ++++   + P+HM    G     + +++    I+  D+    P+H+A   GH  ++  LI    D          P+H     G SD  + L+    DI+  D   R  +H A   G+ E + +L++   D +    +F +SP+H A  N N+  L  L+
Sbjct:  305 PLHFAAASTHGALCLELLVGNGADVNMKSKD-GKTPLHMTALHGRFSRSQTIIQSGAVIDCEDKNGNTPLHIAARYGHELLINTLITSGADTAKRGIHGMFPLHLAALSGFSDCCRKLLSSGFDIDTPDDFGRTCLHAAAAGGNLECLNLLLNTGADFNK-KDKFGRSPLHYAAANCNYQCLFALV 488          

HSP 9 Score: 56.9954 bits (136), Expect = 1.183e-8
Identity = 47/199 (23.62%), Postives = 85/199 (42.71%), Query Frame = 3
Query:  138 RRPIHFACLKGDIDIVKVLIDHNCDIEVRNRKWNQQPIHMACW-DGHLEILKVLLEKNCDIESCDEWKRRPIHLACENGHTEIVKFLIN-LHCDI-----------EAINDKAWRPIHFGCWKGHSDIVKVLVEQNCDIEACDHLKRRPIHLACEKGHTEIVKVLIDHHCDISACGGRFNQSPIHLARKNNFTELIQLL 695
            R P+H+A    +   +  L+     +   + +    P+H A   D   + L+ LL  + +    D+     +H +   GH   ++ + +    D+           ++ N     P+H   + GH   ++VLV+   D++  +   R P+ LA  KGH E V VLI+    I        ++PIH A  N  +E ++LL
Sbjct:  469 RSPLHYAAANCNYQCLFALVGSGASVNDLDER-GCTPLHYAATSDTDGKCLEYLLRNDANPGIRDKQGYNAVHYSAAYGHRLCLQLIASETPLDVLMETSGTDMLSDSDNRATISPLHLAAYHGHHQALEVLVQSLLDLDVRNSSGRTPLDLAAFKGHVECVDVLINQGASILVKDYVLKRTPIHAAATNGHSECLRLL 666          
BLAST of SMED30015660 vs. UniProt/SwissProt
Match: sp|P57078|RIPK4_HUMAN (Receptor-interacting serine/threonine-protein kinase 4 OS=Homo sapiens OX=9606 GN=RIPK4 PE=1 SV=1)

HSP 1 Score: 112.079 bits (279), Expect = 2.614e-26
Identity = 57/186 (30.65%), Postives = 98/186 (52.69%), Query Frame = 3
Query:  144 PIHFACLKGDIDIVKVLIDHNCDIEVRNR-KWNQQPIHMACWDGHLEILKVLLEKNCDIESCDEWKRRPIHLACENGHTEIVKFLINLHCDIEAINDKAWRPIHFGCWKGHSDIVKVLVEQ-NCDIEACDHLKRRPIHLACEKGHTEIVKVLIDHHCDISACGGRFNQSPIHLARKNNFTELIQLL 695
            P+H A  +    +V++L+     +  ++  +W    +H A  +G     ++LLEKN  +   D   R P+H+AC++G   IV+ L+    D+      AW P+H+  W+GH  IVK+L +Q    + A     R P+HLA ++GH  + ++LID   D++ C     Q+P+H+A +   T   +LL
Sbjct:  522 PLHMAVERRVRGVVELLLARKISVNAKDEDQWTA--LHFAAQNGDESSTRLLLEKNASVNEVDFEGRTPMHVACQHGQENIVRILLRRGVDVSLQGKDAWLPLHYAAWQGHLPIVKLLAKQPGVSVNAQTLDGRTPLHLAAQRGHYRVARILIDLCSDVNVC-SLLAQTPLHVAAETGHTSTARLL 704          

HSP 2 Score: 108.997 bits (271), Expect = 3.255e-25
Identity = 59/190 (31.05%), Postives = 102/190 (53.68%), Query Frame = 3
Query:  138 RRPIHFACLKGDIDIVKVLIDHNCDIEVRNR-KWNQQPIHMACWDGHLEILKVLLEK---NCDIESCDEWKRRPIHLACENGHTEIVKFLINLHCDIEAINDKAWRPIHFGCWKGHSDIVKVLVEQNCDIEACDHLKRRPIHLACEKGHTEIVKVLIDHHCDISACGGRFNQSPIHLARKNNFTELIQLL 695
            R P+H AC  G  +IV++L+    D+ ++ +  W   P+H A W GHL I+K+L ++   + + ++ D   R P+HLA + GH  + + LI+L  D+   +  A  P+H     GH+   ++L+ +    EA        +HLA   GH   VK+L++   D+ A  G  NQ+ +HLA  +  +E+++ L
Sbjct:  586 RTPMHVACQHGQENIVRILLRRGVDVSLQGKDAW--LPLHYAAWQGHLPIVKLLAKQPGVSVNAQTLD--GRTPLHLAAQRGHYRVARILIDLCSDVNVCSLLAQTPLHVAAETGHTSTARLLLHRGAGKEAMTSDGYTALHLAARNGHLATVKLLVEEKADVLAR-GPLNQTALHLAAAHGHSEVVEEL 770          

HSP 3 Score: 98.5969 bits (244), Expect = 1.104e-21
Identity = 53/188 (28.19%), Postives = 94/188 (50.00%), Query Frame = 3
Query:  144 PIHFACLKGDIDIVKVLIDHNCDIEVRNRKWN-QQPIHMACWDGHLEILKVLLEKNCDIESCDEWKRRPIHLACENGHTEIVKFLINLHCDIEAINDKAWRPIHFGCWKGHSDIVKVLVEQNCDIEACDHLKRRPIHLACEKGHTEIVKVLIDHHCDISACGGRFNQSPIHLARKNNFTELIQLLTIH 704
            P+H+A  +G + IVK+L      + V  +  + + P+H+A   GH  + ++L++   D+  C    + P+H+A E GHT   + L++     EA+    +  +H     GH   VK+LVE+  D+ A   L +  +HLA   GH+E+V+ L+    D+         S +HLA +    + ++ L  H
Sbjct:  621 PLHYAAWQGHLPIVKLLAKQP-GVSVNAQTLDGRTPLHLAAQRGHYRVARILIDLCSDVNVCSLLAQTPLHVAAETGHTSTARLLLHRGAGKEAMTSDGYTALHLAARNGHLATVKLLVEEKADVLARGPLNQTALHLAAAHGHSEVVEELVS--ADVIDLFDEQGLSALHLAAQGRHAQTVETLLRH 805          

HSP 4 Score: 67.3958 bits (163), Expect = 2.768e-11
Identity = 46/182 (25.27%), Postives = 84/182 (46.15%), Query Frame = 3
Query:  156 ACLKGDID-IVKVLIDHNCDIEVRNRKWNQQPIHMACWDGHLEILKVLLEKNCDIESCDEWKRRPIHLACENGHTEIVKFLINLHCDIEAINDKAWRPIHFGCWKGHSDIVKVLVEQNCDIEACDHLKRRPIHLACEKGHTEIVKVLIDHHCDISACGGRFNQSPIHLARKNNFTELIQLLT 698
            A + GD   ++K+L   + D+ + +       +H+A   G  E  K LL  N +    +     P+H+A E     +V+ L+     + A ++  W  +HF    G     ++L+E+N  +   D   R P+H+AC+ G   IV++L+    D+S   G+    P+H A       +++LL 
Sbjct:  461 AIVSGDTSKLMKILQPQDVDLALDS---GASLLHLAVEAGQEECAKWLLLNNANPNLSNRRGSTPLHMAVERRVRGVVELLLARKISVNAKDEDQWTALHFAAQNGDESSTRLLLEKNASVNEVDFEGRTPMHVACQHGQENIVRILLRRGVDVS-LQGKDAWLPLHYAAWQGHLPIVKLLA 638          
BLAST of SMED30015660 vs. UniProt/SwissProt
Match: sp|Q9ERK0|RIPK4_MOUSE (Receptor-interacting serine/threonine-protein kinase 4 OS=Mus musculus OX=10090 GN=Ripk4 PE=1 SV=2)

HSP 1 Score: 111.694 bits (278), Expect = 3.738e-26
Identity = 58/186 (31.18%), Postives = 99/186 (53.23%), Query Frame = 3
Query:  144 PIHFACLKGDIDIVKVLIDHNCDIEVRNR-KWNQQPIHMACWDGHLEILKVLLEKNCDIESCDEWKRRPIHLACENGHTEIVKFLINLHCDIEAINDKAWRPIHFGCWKGHSDIVKVLVEQ-NCDIEACDHLKRRPIHLACEKGHTEIVKVLIDHHCDISACGGRFNQSPIHLARKNNFTELIQLL 695
            P+H A  +    IV++L+     +  ++  +W    +H A  +G     ++LLEKN  +   D   R P+H+AC++G   IV+ L+    D+      AW P+H+  W+GH  IVK+L +Q    + A     R P+HLA ++GH  + ++LID   D++ C  +  Q+P+H+A +   T   +LL
Sbjct:  476 PLHMAVERKGRGIVELLLARKTSVNAKDEDQWTA--LHFAAQNGDEASTRLLLEKNASVNEVDFEGRTPMHVACQHGQENIVRTLLRRGVDVGLQGKDAWLPLHYAAWQGHLPIVKLLAKQPGVSVNAQTLDGRTPLHLAAQRGHYRVARILIDLCSDVNICSLQ-AQTPLHVAAETGHTSTARLL 658          

HSP 2 Score: 110.923 bits (276), Expect = 6.861e-26
Identity = 60/190 (31.58%), Postives = 102/190 (53.68%), Query Frame = 3
Query:  138 RRPIHFACLKGDIDIVKVLIDHNCDIEVRNR-KWNQQPIHMACWDGHLEILKVLLEK---NCDIESCDEWKRRPIHLACENGHTEIVKFLINLHCDIEAINDKAWRPIHFGCWKGHSDIVKVLVEQNCDIEACDHLKRRPIHLACEKGHTEIVKVLIDHHCDISACGGRFNQSPIHLARKNNFTELIQLL 695
            R P+H AC  G  +IV+ L+    D+ ++ +  W   P+H A W GHL I+K+L ++   + + ++ D   R P+HLA + GH  + + LI+L  D+   + +A  P+H     GH+   ++L+ +    EA        +HLA + GH   VK+LI+   D+ A  G  NQ+ +HLA     +E+++ L
Sbjct:  540 RTPMHVACQHGQENIVRTLLRRGVDVGLQGKDAW--LPLHYAAWQGHLPIVKLLAKQPGVSVNAQTLD--GRTPLHLAAQRGHYRVARILIDLCSDVNICSLQAQTPLHVAAETGHTSTARLLLHRGAGKEALTSEGYTALHLAAQNGHLATVKLLIEEKADVMAR-GPLNQTALHLAAARGHSEVVEEL 724          

HSP 3 Score: 102.064 bits (253), Expect = 6.318e-23
Identity = 52/188 (27.66%), Postives = 97/188 (51.60%), Query Frame = 3
Query:  144 PIHFACLKGDIDIVKVLIDHNCDIEVRNRKWN-QQPIHMACWDGHLEILKVLLEKNCDIESCDEWKRRPIHLACENGHTEIVKFLINLHCDIEAINDKAWRPIHFGCWKGHSDIVKVLVEQNCDIEACDHLKRRPIHLACEKGHTEIVKVLIDHHCDISACGGRFNQSPIHLARKNNFTELIQLLTIH 704
            P+H+A  +G + IVK+L      + V  +  + + P+H+A   GH  + ++L++   D+  C    + P+H+A E GHT   + L++     EA+  + +  +H     GH   VK+L+E+  D+ A   L +  +HLA  +GH+E+V+ L+    D+         S +HLA +   ++ ++ L  H
Sbjct:  575 PLHYAAWQGHLPIVKLLAKQP-GVSVNAQTLDGRTPLHLAAQRGHYRVARILIDLCSDVNICSLQAQTPLHVAAETGHTSTARLLLHRGAGKEALTSEGYTALHLAAQNGHLATVKLLIEEKADVMARGPLNQTALHLAAARGHSEVVEELVS--ADLIDLSDEQGLSALHLAAQGRHSQTVETLLKH 759          

HSP 4 Score: 66.6254 bits (161), Expect = 4.897e-11
Identity = 46/182 (25.27%), Postives = 84/182 (46.15%), Query Frame = 3
Query:  156 ACLKGDID-IVKVLIDHNCDIEVRNRKWNQQPIHMACWDGHLEILKVLLEKNCDIESCDEWKRRPIHLACENGHTEIVKFLINLHCDIEAINDKAWRPIHFGCWKGHSDIVKVLVEQNCDIEACDHLKRRPIHLACEKGHTEIVKVLIDHHCDISACGGRFNQSPIHLARKNNFTELIQLLT 698
            A + GD   ++K+L   + D+ + +   +   +H+A   G  E +K LL  N +    +     P+H+A E     IV+ L+     + A ++  W  +HF    G     ++L+E+N  +   D   R P+H+AC+ G   IV+ L+    D+    G+    P+H A       +++LL 
Sbjct:  415 AIISGDTSRLMKILQPQDVDLVLDS---SASLLHLAVEAGQEECVKWLLLNNANPNLTNRKGSTPLHMAVERKGRGIVELLLARKTSVNAKDEDQWTALHFAAQNGDEASTRLLLEKNASVNEVDFEGRTPMHVACQHGQENIVRTLLRRGVDV-GLQGKDAWLPLHYAAWQGHLPIVKLLA 592          
BLAST of SMED30015660 vs. UniProt/SwissProt
Match: sp|Q8BZ25|ANKK1_MOUSE (Ankyrin repeat and protein kinase domain-containing protein 1 OS=Mus musculus OX=10090 GN=Ankk1 PE=2 SV=1)

HSP 1 Score: 99.7525 bits (247), Expect = 3.451e-22
Identity = 54/173 (31.21%), Postives = 90/173 (52.02%), Query Frame = 3
Query:  144 PIHFACLKGDIDIVKVLIDHNCDIEVRNRK-WNQQPIHMACWDGHLEILKVLLEKNCDIESCDEWKRRPIHLACENGHTEIVKFLINLHCDIEAINDKAWRPIHFGCWKGHSDIVKVLVEQNCDIEACDHLKRRPIHLACEKGHTEIVKVLIDHHCDISACGGRFNQSPIHLA 659
            P+H A  +G   I K+L+ +   +E+R ++ W   P+H+A + GHLEI+  L + + D+++    +  P+HLA   G   ++  L+    +  A     W P+H    KG    +  L+E   DI AC+ +   P HLA  KG+T I+KVL+     +   GG  + +P+ LA
Sbjct:  571 PLHIAAARGKDLIFKMLLRYGASLELRTQQGWT--PLHLATYKGHLEIIHQLAKSHVDLDALGSMQWTPLHLAAFQGEEGVMLALLQCGANPNAAEQSGWTPLHLAVHKGTFLGITHLLEYGADIHACNKVGWTPAHLAALKGNTAILKVLVKAAAQVDVKGG-VSCTPLQLA 740          

HSP 2 Score: 90.8929 bits (224), Expect = 4.098e-19
Identity = 46/172 (26.74%), Postives = 85/172 (49.42%), Query Frame = 3
Query:  144 PIHFACLKGDIDIVKVLIDHNCDIEVRNRKWNQQPIHMACWDGHLEILKVLLEKNCDIESCDEWKRRPIHLACENGHTEIVKFLINLHCDIEAINDKAWRPIHFGCWKGHSDIVKVLVEQNCDIEACDHLKRRPIHLACEKGHTEIVKVLIDHHCDISACGGRFNQSPIHLA 659
            P+H A      ++ ++L+    D+     +  + P+H+A + GH+ ++K+L  +  ++++     R P+HLA E G    ++ L+      +A++   + P+H    +G   I K+L+     +E        P+HLA  KGH EI+  L   H D+ A G     +P+HLA
Sbjct:  472 PLHLAAQNNFENVARLLVSRQADLSPHEAE-GKTPLHVAAYFGHIGLVKLLSGQGAELDAQQRNLRTPLHLAVERGKVRAIQHLLKCGALPDALDHSGYSPLHIAAARGKDLIFKMLLRYGASLELRTQQGWTPLHLATYKGHLEIIHQLAKSHVDLDALGS-MQWTPLHLA 641          

HSP 3 Score: 88.1965 bits (217), Expect = 9.227e-19
Identity = 51/193 (26.42%), Postives = 91/193 (47.15%), Query Frame = 3
Query:  138 RRPIHFACLKGDIDIVKVLIDHNCDIEVRNRKWNQQPIHMACWDGHLEILKVLLEKNCDIESCDEWKRRPIHLACENGHTEIVKFLINLHCDIEAINDKAWRPIHFGCWKGHSDIVKVLVEQNCDIEACDHLKRRPIHLACEKGHTEIVKVLIDHHCDISACGGRFNQ------SPIHLA-RKNNFTELIQLL 695
            + P+H A   G I +VK+L     +++ + R   + P+H+A   G +  ++ LL+     ++ D     P+H+A   G   I K L+     +E    + W P+H   +KGH +I+  L + + D++A   ++  P+HLA  +G   ++  L+        CG   N       +P+HLA  K  F  +  LL
Sbjct:  503 KTPLHVAAYFGHIGLVKLLSGQGAELDAQQRNL-RTPLHLAVERGKVRAIQHLLKCGALPDALDHSGYSPLHIAAARGKDLIFKMLLRYGASLELRTQQGWTPLHLATYKGHLEIIHQLAKSHVDLDALGSMQWTPLHLAAFQGEEGVMLALLQ-------CGANPNAAEQSGWTPLHLAVHKGTFLGITHLL 687          

HSP 4 Score: 26.5646 bits (57), Expect = 9.227e-19
Identity = 9/25 (36.00%), Postives = 15/25 (60.00%), Query Frame = 2
Query:    2 PIHLAFDNNHREIVKLLIEENCDVN 76
            P+HLA  NN   + +LL+    D++
Sbjct:  472 PLHLAAQNNFENVARLLVSRQADLS 496          

HSP 5 Score: 69.3218 bits (168), Expect = 6.980e-12
Identity = 47/222 (21.17%), Postives = 91/222 (40.99%), Query Frame = 3
Query:  144 PIHFACLKGDIDIVKVLIDHNCDIEVRNRK---------WNQQP-----------------------IHMACWDGHLEILKVLLEKNCDIESCDEWKRRPIHLACENGHTEIVKFLINLHCDIEAINDKAWRPIHFGCWKGHSDIVKVLVEQNCDIEACDHLKRRPIHLACEKGHTEIVKVLIDHHCDISACGG------RFNQSPIHLARKNNFTELIQLL 695
            P+HF    G ++ V++L+ H+ D++ +             +QQP                       +H A  +G     ++LL+    + + +     P+HLA +N    + + L++   D+     +   P+H   + GH  +VK+L  Q  +++A     R P+HLA E+G    ++ L+        CG           SP+H+A       + ++L
Sbjct:  373 PLHFLVAGGSLEQVRLLLSHDVDVDCQTASGYTPLLIATQDQQPDLCALLLAHGADTNLADEDGWAPLHFAAQNGDDHTARLLLDHGALVNAREHEGWTPLHLAAQNNFENVARLLVSRQADLSPHEAEGKTPLHVAAYFGHIGLVKLLSGQGAELDAQQRNLRTPLHLAVERGKVRAIQHLLK-------CGALPDALDHSGYSPLHIAAARGKDLIFKML 587          

HSP 6 Score: 66.2402 bits (160), Expect = 8.121e-11
Identity = 33/151 (21.85%), Postives = 70/151 (46.36%), Query Frame = 3
Query:  246 PIHMACWDGHLEILKVLLEKNCDIESCDEWKRRPIHLACENGHTEIVKFLINLHCDIEAINDKAWRPIHFGCWKGHSDIVKVLVEQNCDIEACDHLKRRPIHLACEKGHTEIVKVLIDHHCDISACGGRFNQSPIHLARKNNFTELIQLLT 698
            P+H     G LE +++LL  + D++        P+ +A ++   ++   L+    D    ++  W P+HF    G     ++L++    + A +H    P+HLA +     + ++L+    D+S       ++P+H+A       L++LL+
Sbjct:  373 PLHFLVAGGSLEQVRLLLSHDVDVDCQTASGYTPLLIATQDQQPDLCALLLAHGADTNLADEDGWAPLHFAAQNGDDHTARLLLDHGALVNAREHEGWTPLHLAAQNNFENVARLLVSRQADLSPHEAE-GKTPLHVAAYFGHIGLVKLLS 522          

HSP 7 Score: 55.0694 bits (131), Expect = 3.215e-7
Identity = 34/140 (24.29%), Postives = 63/140 (45.00%), Query Frame = 3
Query:  282 ILKVLLEKNCDIESCDEWKRRPIHLACENGHTEIVKFLINLHCDIEAINDKAWRPIHFGCWKGHSDIVKVLVEQNCDIEACDHLKRRPIHLACEKGHTEIVKVLIDHHCDISACGGRFNQ--SPIHLARKNNFTELIQLL 695
            IL++   K+       E +  P+H     G  E V+ L++   D++      + P+         D+  +L+    D    D     P+H A + G     ++L+DH   ++A   R ++  +P+HLA +NNF  + +LL
Sbjct:  352 ILQLSDSKSLVASDVYENRVTPLHFLVAGGSLEQVRLLLSHDVDVDCQTASGYTPLLIATQDQQPDLCALLLAHGADTNLADEDGWAPLHFAAQNGDDHTARLLLDHGALVNA---REHEGWTPLHLAAQNNFENVARLL 488          
BLAST of SMED30015660 vs. UniProt/SwissProt
Match: sp|O15084|ANR28_HUMAN (Serine/threonine-protein phosphatase 6 regulatory ankyrin repeat subunit A OS=Homo sapiens OX=9606 GN=ANKRD28 PE=1 SV=5)

HSP 1 Score: 99.3673 bits (246), Expect = 5.255e-22
Identity = 55/187 (29.41%), Postives = 104/187 (55.61%), Query Frame = 3
Query:  138 RRPIHFACLKGDIDIVKVLIDHNCDIEVRNRKWNQQPIHMACWDGHLEILKVLLEKNCDIESCDEWKRRPIHLACENGHTEIVKFLINLHCDIEAINDKAWR-PIHFGCWKGHSDIVKVLVEQNCDIEACDHLKRRPIHLACEKGHTEIVKVLIDHHCDISACGGRFNQSPIHLARKNNFTELIQLL 695
            R P+H A   GD +I+++LI     +  ++ KW   P+H A      E ++VLL+ + D+ + D+  + P+H+A  N   +  + L+ L  ++  ++D+A R  +H   + GH ++VK+L+ +  +I A D   RR IH A   GH E+VK+L+ H  +++ C  + + +P+H A  +    +++ L
Sbjct:   42 RTPLHAAAYLGDAEIIELLILSGARVNAKDSKW-LTPLHRAVASCSEEAVQVLLKHSADVNARDKNWQTPLHIAAANKAVKCAEALVPLLSNVN-VSDRAGRTALHHAAFSGHGEMVKLLLSRGANINAFDKKDRRAIHWAAYMGHIEVVKLLVSHGAEVT-CKDKKSYTPLHAAASSGMISVVKYL 225          

HSP 2 Score: 93.5893 bits (231), Expect = 4.738e-20
Identity = 51/175 (29.14%), Postives = 91/175 (52.00%), Query Frame = 3
Query:  144 PIHFACLKGDIDIVKVLIDHNCDIEVRNRKWNQQPIHMACWDGHLEILKVLLEKNCDIESCDEWKRRPIHLACENGHTEIVKFLINLHCDIEAINDKAWRPIHFGCWKGHSDIVKVLVEQNCDIEACDHLKRRPIHLACEKGHTEIVKVLIDHHCDISACGGRFNQSPIHLARKN 668
            P+H A      + V+VL+ H+ D+  R++ W Q P+H+A  +  ++  + L+    ++   D   R  +H A  +GH E+VK L++   +I A + K  R IH+  + GH ++VK+LV    ++   D     P+H A   G   +VK L+D   D++     +  +P+H+A  N
Sbjct:   77 PLHRAVASCSEEAVQVLLKHSADVNARDKNW-QTPLHIAAANKAVKCAEALVPLLSNVNVSDRAGRTALHHAAFSGHGEMVKLLLSRGANINAFDKKDRRAIHWAAYMGHIEVVKLLVSHGAEVTCKDKKSYTPLHAAASSGMISVVKYLLDLGVDMNEPNA-YGNTPLHVACYN 249          

HSP 3 Score: 90.1225 bits (222), Expect = 8.465e-19
Identity = 51/188 (27.13%), Postives = 93/188 (49.47%), Query Frame = 3
Query:  135 DRRPIHFACLKGDIDIVKVLIDHNCDIEVRNRKWNQQPIHMACWDGHLEILKVLLEKNCDIESCDEWKRRPIHLACENGHTEIVKFLINLHCDIEAINDKAWRPIHFGCWKGHSDI-VKVLVEQNCDIEACDHLKRRPIHLACEKGHTEIVKVLIDHHCDISACGGRFNQSPIHLARKNNFTELIQLL 695
            DRR IH+A   G I++VK+L+ H  ++  +++K +  P+H A   G + ++K LL+   D+   + +   P+H+AC NG   +V  LI+    +   N+K + P+HF     H  + +++LV    D+       + P+H+    G     + +I     I  C  +   +P+H+A +     LI  L
Sbjct:  173 DRRAIHWAAYMGHIEVVKLLVSHGAEVTCKDKK-SYTPLHAAASSGMISVVKYLLDLGVDMNEPNAYGNTPLHVACYNGQDVVVNELIDCGAIVNQKNEKGFTPLHFAAASTHGALCLELLVGNGADVNMKSKDGKTPLHMTALHGRFSRSQTIIQSGAVID-CEDKNGNTPLHIAARYGHELLINTL 358          

HSP 4 Score: 78.9518 bits (193), Expect = 5.151e-15
Identity = 54/196 (27.55%), Postives = 89/196 (45.41%), Query Frame = 3
Query:  138 RRPIHFACLKGDIDIVKVLIDHNCDIEVRNRKWNQQPIHMACWDGHLEILKVLL---EKNCDIESCDEWKRRPIHLACENGHTEIVKFLINLHCDIEAINDKAWRPIHFGCWKGHSDIVKVLVEQNCDIEACDHLKRRPIHLACEKGHTEIVKVLIDHHCDIS---ACGGRFNQSPIHLARKNNFTELIQLLTIHE 707
            R P+  A  KG ++ V VLI+    I V++    + PIH A  +GH E L++L+   E    ++  D   + P+ L+  NGHT+ V  L+N   +++A +      +H G   GH + V  L++        D   R PIHL+   GH  ++  L+     +    A       + +H A  N     ++LL   E
Sbjct:  584 RTPLDLAAFKGHVECVDVLINQGASILVKDYILKRTPIHAAATNGHSECLRLLIGNAEPQNAVDIQDGNGQTPLMLSVLNGHTDCVYSLLNKGANVDAKDKWGRTALHRGAVTGHEECVDALLQHGAKCLLRDSRGRTPIHLSAACGHIGVLGALLQSAASMDANPATADNHGYTALHWACYNGHETCVELLLEQE 779          

HSP 5 Score: 78.1814 bits (191), Expect = 8.273e-15
Identity = 42/174 (24.14%), Postives = 90/174 (51.72%), Query Frame = 3
Query:  138 RRPIHFACLKGDIDIVKVLIDHNCDIEVRNRKWNQQPIHMACWDGHLEILKVLLEKNCDIESCDEWKRRPIHLACENGHTEIVKFLINLHCDIEAINDKAWRPIHFGCWKGHSDIVKVLVEQNCDIEACDHLKRRPIHLACEKGHTEI-VKVLIDHHCDISACGGRFNQSPIHL 656
            R  +H A   G  ++VK+L+    +I   ++K +++ IH A + GH+E++K+L+    ++   D+    P+H A  +G   +VK+L++L  D+   N     P+H  C+ G   +V  L++    +   +     P+H A    H  + +++L+ +  D++    +  ++P+H+
Sbjct:  141 RTALHHAAFSGHGEMVKLLLSRGANINAFDKK-DRRAIHWAAYMGHIEVVKLLVSHGAEVTCKDKKSYTPLHAAASSGMISVVKYLLDLGVDMNEPNAYGNTPLHVACYNGQDVVVNELIDCGAIVNQKNEKGFTPLHFAAASTHGALCLELLVGNGADVNM-KSKDGKTPLHM 312          

HSP 6 Score: 23.483 bits (49), Expect = 8.273e-15
Identity = 10/26 (38.46%), Postives = 17/26 (65.38%), Query Frame = 2
Query:    2 PIHLAFDNNHREIVKLLIEENCDVNA 79
            P+H A  +   E V++L++ + DVNA
Sbjct:   77 PLHRAVASCSEEAVQVLLKHSADVNA 102          

HSP 7 Score: 67.781 bits (164), Expect = 5.108e-12
Identity = 47/192 (24.48%), Postives = 86/192 (44.79%), Query Frame = 3
Query:  144 PIHFACLKGDIDIVKVLIDHNCDIEVRNRKWNQQPIHMACWDGHLEILKVLLEKNCDIESCDEWKRRPIHLACENGHTEIVKFLINLHCDIEA----INDKAWRPIHFGCWKGHSDIVKVLVEQNCDIEACDHLKRRPIHLACEKGHTEIVKVLIDH-HCDISACGGRFNQSPIHLARKNNFTELIQLLTIH 704
            P+  + L G  D V  L++   +++ ++ KW +  +H     GH E +  LL+        D   R PIHL+   GH  ++  L+     ++A     ++  +  +H+ C+ GH   V++L+EQ    +  +     P+H A    +    ++LID     I        ++P+H A   +  E +QLL  H
Sbjct:  656 PLMLSVLNGHTDCVYSLLNKGANVDAKD-KWGRTALHRGAVTGHEECVDALLQHGAKCLLRDSRGRTPIHLSAACGHIGVLGALLQSAASMDANPATADNHGYTALHWACYNGHETCVELLLEQEV-FQKTEGNAFSPLHCAVINDNEGAAEMLIDTLGASIVNATDSKGRTPLHAAAFTDHVECLQLLLSH 845          

HSP 8 Score: 24.2534 bits (51), Expect = 5.108e-12
Identity = 12/27 (44.44%), Postives = 15/27 (55.56%), Query Frame = 2
Query:    2 PIHLAFDNNHREIVKLLIEENCDVNAI 82
            PIH A  N H E ++LLI      NA+
Sbjct:  620 PIHAAATNGHSECLRLLIGNAEPQNAV 646          

HSP 9 Score: 65.855 bits (159), Expect = 9.590e-11
Identity = 43/156 (27.56%), Postives = 75/156 (48.08%), Query Frame = 3
Query:  144 PIHFACLKGDIDIVKVLIDH-NCDIEVRNRKWNQQPIHMACWDGHLEILKVLLEKNCDIESCDEWKRRPIHLACENGHTEIVKFLINLHCDIEAINDKAWR-PIHFGCWKGHSDIVKVLVEQNCD---IEACDHLKRRPIHLACEKGHTEIVKVLI 596
            P+H A +  +    ++LID     I        + P+H A +  H+E L++LL  N  + S D   + P+ +A ENG T  V+ L++       + D +    +H  C KGH     +++E+  D   I A +   + P+H+A   G T +V+ L+
Sbjct:  791 PLHCAVINDNEGAAEMLIDTLGASIVNATDSKGRTPLHAAAFTDHVECLQLLLSHNAQVNSVDSTGKTPLMMAAENGQTNTVEMLVSSASAELTLQDNSKNTALHLACSKGHETSALLILEKITDRNLINATNAALQTPLHVAARNGLTMVVQELL 946          

HSP 10 Score: 64.6994 bits (156), Expect = 2.417e-10
Identity = 49/227 (21.59%), Postives = 97/227 (42.73%), Query Frame = 3
Query:  138 RRPIHFACLKGDIDIVKVLIDHNCDIEVRNRKWNQQ---PIHMACWDGHLEILKVLLEK--------------NCDI--------------------ESCDEWKRRPIHLACENGHTEIVKFLINLHCDIEAINDKAWRPIHFGCWKGHSDIVKVLVEQ-NCDIEACDHLKRRPIHLACEKGHTEIVKVLIDHHCD---ISACGGRFNQSPIHLARKNNFTELIQLL 695
            R PIH +   G I ++  L+     ++      +      +H AC++GH   +++LLE+              +C +                     + D   R P+H A    H E ++ L++ +  + +++     P+      G ++ V++LV   + ++   D+ K   +HLAC KGH     ++++   D   I+A      Q+P+H+A +N  T ++Q L
Sbjct:  720 RTPIHLSAACGHIGVLGALLQSAASMDANPATADNHGYTALHWACYNGHETCVELLLEQEVFQKTEGNAFSPLHCAVINDNEGAAEMLIDTLGASIVNATDSKGRTPLHAAAFTDHVECLQLLLSHNAQVNSVDSTGKTPLMMAAENGQTNTVEMLVSSASAELTLQDNSKNTALHLACSKGHETSALLILEKITDRNLINATNAAL-QTPLHVAARNGLTMVVQEL 945          

HSP 11 Score: 58.9214 bits (141), Expect = 2.174e-8
Identity = 45/186 (24.19%), Postives = 85/186 (45.70%), Query Frame = 3
Query:  144 PIHFACLKGDIDI-VKVLIDHNCDIEVRNRKWNQQPIHMACWDGHLEILKVLLEKNCDIESCDEWKRRPIHLACENGHTEIVKFLINLHCDIEAINDKAWRPIHFGCWKGHSDIVKVLVEQNCDIEACDHLKRRPIHLACEKGHTEIVKVLIDHHCDISACGGRFNQSPIHLARKN-NFTELIQLL 695
            P+HFA       + +++L+ +  D+ ++++   + P+HM    G     + +++    I+  D+    P+H+A   GH  ++  LI    D          P+H     G SD  + L+    DI+  D   R  +H A   G+ E + +L++   D +    +F +SP+H A  N N+  L  L+
Sbjct:  275 PLHFAAASTHGALCLELLVGNGADVNMKSKD-GKTPLHMTALHGRFSRSQTIIQSGAVIDCEDKNGNTPLHIAARYGHELLINTLITSGADTAKRGIHGMFPLHLAALSGFSDCCRKLLSSGFDIDTPDDFGRTCLHAAAAGGNLECLNLLLNTGADFNK-KDKFGRSPLHYAAANCNYQCLFALV 458          

HSP 12 Score: 56.9954 bits (136), Expect = 8.688e-8
Identity = 47/199 (23.62%), Postives = 85/199 (42.71%), Query Frame = 3
Query:  138 RRPIHFACLKGDIDIVKVLIDHNCDIEVRNRKWNQQPIHMACW-DGHLEILKVLLEKNCDIESCDEWKRRPIHLACENGHTEIVKFLIN-LHCDI-----------EAINDKAWRPIHFGCWKGHSDIVKVLVEQNCDIEACDHLKRRPIHLACEKGHTEIVKVLIDHHCDISACGGRFNQSPIHLARKNNFTELIQLL 695
            R P+H+A    +   +  L+     +   + +    P+H A   D   + L+ LL  + +    D+     +H +   GH   ++ + +    D+           ++ N     P+H   + GH   ++VLV+   D++  +   R P+ LA  KGH E V VLI+    I        ++PIH A  N  +E ++LL
Sbjct:  439 RSPLHYAAANCNYQCLFALVGSGASVNDLDER-GCTPLHYAATSDTDGKCLEYLLRNDANPGIRDKQGYNAVHYSAAYGHRLCLQLIASETPLDVLMETSGTDMLSDSDNRATISPLHLAAYHGHHQALEVLVQSLLDLDVRNSSGRTPLDLAAFKGHVECVDVLINQGASILVKDYILKRTPIHAAATNGHSECLRLL 636          
BLAST of SMED30015660 vs. UniProt/SwissProt
Match: sp|Q8NFD2|ANKK1_HUMAN (Ankyrin repeat and protein kinase domain-containing protein 1 OS=Homo sapiens OX=9606 GN=ANKK1 PE=1 SV=1)

HSP 1 Score: 98.5969 bits (244), Expect = 8.546e-22
Identity = 54/216 (25.00%), Postives = 100/216 (46.30%), Query Frame = 3
Query:  144 PIHFACLKGDIDIVKVLIDHNCDIEVRNRK-WN-------------------------------QQPIHMACWDGHLEILKVLLEKNCDIESCDEWKRRPIHLACENGHTEIVKFLINLHCDIEAINDKAWRPIHFGCWKGHSDIVKVLVEQNCDIEACDHLKRRPIHLACEKGHTEIVKVLIDHHCDISACGGRFNQSPIHLARKNNFTELIQLL 695
            P+HFA   GD    ++L+DH   ++ + R+ W                                + P+H+A + GH+ ++K+L  +  ++++     R P+HLA E G    ++ L+      +A++   + P+H    +G   I K+L+     +E   H    P+HLA  KGH EI+ +L + H ++ A G   N +P+HLA ++    ++  L
Sbjct:  431 PLHFAAQNGDDGTARLLLDHGACVDAQEREGWTPLHLAAQNNFENVARLLVSRQADPNLHEAEGKTPLHVAAYFGHVSLVKLLTSQGAELDAQQRNLRTPLHLAVERGKVRAIQHLLKSGAVPDALDQSGYGPLHTAAARGKYLICKMLLRYGASLELPTHQGWTPLHLAAYKGHLEIIHLLAESHANMGALGA-VNWTPLHLAARHGEEAVVSAL 645          

HSP 2 Score: 95.5153 bits (236), Expect = 3.585e-21
Identity = 51/190 (26.84%), Postives = 94/190 (49.47%), Query Frame = 3
Query:  138 RRPIHFACLKGDIDIVKVLIDHNCDIEVRNRKWNQQPIHMACWDGHLEILKVLLEKNCDIESCDEWKRRPIHLACENGHTEIVKFLINLHCDIEAINDKAWRPIHFGCWKGHSDIVKVLVEQNCDIEACDHLKRRPIHLACEKGHTEIVKVLIDHHCDISACGGRFNQSPIHLA-RKNNFTELIQLLTIH 704
            + P+H A   G + +VK+L     +++ + R   + P+H+A   G +  ++ LL+     ++ D+    P+H A   G   I K L+     +E    + W P+H   +KGH +I+ +L E + ++ A   +   P+HLA   G   +V  L+    D +A   +   +P+HLA +++ F  +I LL  H
Sbjct:  495 KTPLHVAAYFGHVSLVKLLTSQGAELDAQQRNL-RTPLHLAVERGKVRAIQHLLKSGAVPDALDQSGYGPLHTAAARGKYLICKMLLRYGASLELPTHQGWTPLHLAAYKGHLEIIHLLAESHANMGALGAVNWTPLHLAARHGEEAVVSALLQCGADPNAA-EQSGWTPLHLAVQRSTFLSVINLLEHH 682          

HSP 3 Score: 27.335 bits (59), Expect = 3.585e-21
Identity = 10/25 (40.00%), Postives = 14/25 (56.00%), Query Frame = 2
Query:    2 PIHLAFDNNHREIVKLLIEENCDVN 76
            P+HLA  NN   + +LL+    D N
Sbjct:  464 PLHLAAQNNFENVARLLVSRQADPN 488          

HSP 4 Score: 89.7373 bits (221), Expect = 1.058e-18
Identity = 51/185 (27.57%), Postives = 92/185 (49.73%), Query Frame = 3
Query:  144 PIHFACLKGDIDIVKVLIDHNCDIEVRN-RKWNQQPIHMACWDGHLEILKVLLEKNCDIESCDEWKRRPIHLACENGHTEIVKFLINLHCDIEAINDKAWRPIHFGCWKGHSDIVKVLVEQNCDIEACDHLKRRPIHLACEKGHTEIVKVLIDHHCDISACGGRFNQSPIHLARKNNFTELIQLL 695
            P+H A  +G   I K+L+ +   +E+   + W   P+H+A + GHLEI+ +L E + ++ +       P+HLA  +G   +V  L+    D  A     W P+H    +     V  L+E + ++ A + +   P HLA  KG+T I+KVL++    +    G  + +P+ LA ++    ++  L
Sbjct:  563 PLHTAAARGKYLICKMLLRYGASLELPTHQGWT--PLHLAAYKGHLEIIHLLAESHANMGALGAVNWTPLHLAARHGEEAVVSALLQCGADPNAAEQSGWTPLHLAVQRSTFLSVINLLEHHANVHARNKVGWTPAHLAALKGNTAILKVLVEAGAQLDVQDG-VSCTPLQLALRSRKQGIMSFL 744          

HSP 5 Score: 84.3445 bits (207), Expect = 6.155e-17
Identity = 45/182 (24.73%), Postives = 86/182 (47.25%), Query Frame = 3
Query:  144 PIHFACLKGDIDIVKVLIDHNCDIEVRNRKWNQQPIHMACWDGHLEILKVLLEKNCDIESCDEWKRRPIHLACENGHTEIVKFLINLHCDIEAINDKAWRPIHFGCWKGHSDIVKVLVEQNCDIEACDHLKRRPIHLACEKGHTEIVKVLIDHHCDISACGGRFNQSPIHLARKNNFTELIQ 689
            P+HF   +G ++ V++L+ H  D++ +       P+ +A  D   ++  +LL    D    DE    P+H A +NG     + L++    ++A   + W P+H        ++ ++LV +  D    +   + P+H+A   GH  +VK+L     ++ A   R  ++P+HLA +      IQ
Sbjct:  365 PLHFLVAQGSVEQVRLLLAHEVDVDCQTAS-GYTPLLIAAQDQQPDLCALLLAHGADANRVDEDGWAPLHFAAQNGDDGTARLLLDHGACVDAQEREGWTPLHLAAQNNFENVARLLVSRQADPNLHEAEGKTPLHVAAYFGHVSLVKLLTSQGAELDA-QQRNLRTPLHLAVERGKVRAIQ 544          

HSP 6 Score: 55.8398 bits (133), Expect = 1.817e-7
Identity = 32/122 (26.23%), Postives = 53/122 (43.44%), Query Frame = 3
Query:  330 EWKRRPIHLACENGHTEIVKFLINLHCDIEAINDKAWRPIHFGCWKGHSDIVKVLVEQNCDIEACDHLKRRPIHLACEKGHTEIVKVLIDHHCDISACGGRFNQSPIHLARKNNFTELIQLL 695
            E K  P+H     G  E V+ L+    D++      + P+         D+  +L+    D    D     P+H A + G     ++L+DH   + A   R   +P+HLA +NNF  + +LL
Sbjct:  360 ENKVTPLHFLVAQGSVEQVRLLLAHEVDVDCQTASGYTPLLIAAQDQQPDLCALLLAHGADANRVDEDGWAPLHFAAQNGDDGTARLLLDHGACVDA-QEREGWTPLHLAAQNNFENVARLL 480          
BLAST of SMED30015660 vs. TrEMBL
Match: A0A3D1L5H5 (ANK_REP_REGION domain-containing protein OS=Wolbachia sp. OX=956 GN=DEQ74_03040 PE=4 SV=1)

HSP 1 Score: 153.68 bits (387), Expect = 1.899e-39
Identity = 72/183 (39.34%), Postives = 111/183 (60.66%), Query Frame = 3
Query:  147 IHFACLKGDIDIVKVLIDHNCDIEVRNRKWNQQPIHMACWDGHLEILKVLLEKNCDIESCDEWKRRPIHLACENGHTEIVKFLINLHCDIEAINDKAWRPIHFGCWKGHSDIVKVLVEQNCDIEACDHLKRRPIHLACEKGHTEIVKVLIDHHCDISACGGRFNQSPIHLARKNNFTELIQLL 695
            +HFA   G  D V+VL+    D+ V + K ++ P+H A + GH +++KVLL    +I S D+  + P+H A  NGHT IVK L+    D+ A +  +  P+H    +GH+D VKVL+E+  DI A D   + P+HLA ++GHT+ VKVL++   DI A   +  Q+P+HLA KN   + +++L
Sbjct:  252 LHFAVYHGYADTVEVLLTGGADVNVAD-KNSKTPLHQAAYGGHTDMVKVLLAGGANIYSVDQNSKTPLHRAAYNGHTNIVKILLEEGADVNAADKNSKTPLHLAAERGHTDTVKVLLEEGADINAADKNSKTPLHLAAKRGHTDTVKVLLEEGADIKAVDKK-GQTPVHLAAKNGHEDTVKVL 432          

HSP 2 Score: 153.295 bits (386), Expect = 3.459e-39
Identity = 71/186 (38.17%), Postives = 114/186 (61.29%), Query Frame = 3
Query:  138 RRPIHFACLKGDIDIVKVLIDHNCDIEVRNRKWNQQPIHMACWDGHLEILKVLLEKNCDIESCDEWKRRPIHLACENGHTEIVKFLINLHCDIEAINDKAWRPIHFGCWKGHSDIVKVLVEQNCDIEACDHLKRRPIHLACEKGHTEIVKVLIDHHCDISACGGRFNQSPIHLARKNNFTELIQLL 695
            + P+H A   G  D+VKVL+    +I   ++  ++ P+H A ++GH  I+K+LLE+  D+ + D+  + P+HLA E GHT+ VK L+    DI A +  +  P+H    +GH+D VKVL+E+  DI+A D   + P+HLA + GH + VKVL+    DI A   +  Q+P+HLA KN++   +++L
Sbjct:  282 KTPLHQAAYGGHTDMVKVLLAGGANIYSVDQN-SKTPLHRAAYNGHTNIVKILLEEGADVNAADKNSKTPLHLAAERGHTDTVKVLLEEGADINAADKNSKTPLHLAAKRGHTDTVKVLLEEGADIKAVDKKGQTPVHLAAKNGHEDTVKVLLKEGADIYAVDKK-GQTPLHLAMKNDYGVTVRVL 465          

HSP 3 Score: 126.716 bits (317), Expect = 1.793e-29
Identity = 57/158 (36.08%), Postives = 94/158 (59.49%), Query Frame = 3
Query:  138 RRPIHFACLKGDIDIVKVLIDHNCDIEVRNRKWNQQPIHMACWDGHLEILKVLLEKNCDIESCDEWKRRPIHLACENGHTEIVKFLINLHCDIEAINDKAWRPIHFGCWKGHSDIVKVLVEQNCDIEACDHLKRRPIHLACEKGHTEIVKVLIDHHCD 611
            + P+H A   G  +IVK+L++   D+   + K ++ P+H+A   GH + +KVLLE+  DI + D+  + P+HLA + GHT+ VK L+    DI+A++ K   P+H     GH D VKVL+++  DI A D   + P+HLA +  +   V+VL++   +
Sbjct:  315 KTPLHRAAYNGHTNIVKILLEEGADVNAAD-KNSKTPLHLAAERGHTDTVKVLLEEGADINAADKNSKTPLHLAAKRGHTDTVKVLLEEGADIKAVDKKGQTPVHLAAKNGHEDTVKVLLKEGADIYAVDKKGQTPLHLAMKNDYGVTVRVLLEKSAE 471          

HSP 4 Score: 92.0485 bits (227), Expect = 3.291e-17
Identity = 51/205 (24.88%), Postives = 100/205 (48.78%), Query Frame = 3
Query:  144 PIHFACLKGDIDIVKVLIDHNCDIEVRNRKWNQQPIHMA---------------------CWDGHLEILKVLLEKNCDIESCDEWKRRPIHLACENGHTEIVKFLINLHCDIEAINDKAWRPIHFGCWKGHSDIVKVLVEQNCDIEACDHLKRRPIHLACEKGHTEIVKVLIDHHCDISACGGRFNQSPIHLARKNNFTELIQLL 695
            P+H A      DIVK+L+    D   +N    + P H+A                      ++ +   ++ LL K  ++ + ++     +H A  +G+ + V+ L+    D+   +  +  P+H   + GH+D+VKVL+    +I + D   + P+H A   GHT IVK+L++   D++A   + +++P+HLA +   T+ +++L
Sbjct:  164 PLHLAAKNSHADIVKMLLACGADSLQQNHDG-KTPRHLAEDNEIKQLLKKAKKELQLLIAAYNNNAGKVEDLLAKGVNVNATNKLGYTALHFAVYHGYADTVEVLLTGGADVNVADKNSKTPLHQAAYGGHTDMVKVLLAGGANIYSVDQNSKTPLHRAAYNGHTNIVKILLEEGADVNAA-DKNSKTPLHLAAERGHTDTVKVL 366          

HSP 5 Score: 90.5077 bits (223), Expect = 1.052e-16
Identity = 63/196 (32.14%), Postives = 97/196 (49.49%), Query Frame = 3
Query:  144 PIHFACLKGDIDIVKVLIDHNCDIEVRNRKWNQQPIHMACWDGHLEILKVLL-EKN----CDIESCDEWKRRPIHLACENGHTEIVKFLINLHCDIEAINDKAWRPIHFGCWKGHSDIVKVLVEQNCD---IEACDHLKRRPIHLACEKGHTEIVKVLIDHHCDISACGGRFNQ------SPIHLARKNNFTELIQ 689
            P+H A   GD+  V  L++++ D+   N       +H A   GH++ +  LL E+N    C I + +  K  P+HLA +N HTE+VK L+    DI A +     P+H     G++D V V +   C    I+A D  +  P+HLA +  H +IVK+L+       ACG    Q      +P HLA  N   +L++
Sbjct:   25 PLHLAVKSGDVVKVNALLENSVDVHAVNING-YTALHCAAERGHIDAINALLTEQNVCYLC-INAENSNKETPLHLAAKNNHTEVVKALLKKGADINAADKDEKIPLHKAAEYGYADTVSVFLTVKCIYLCIDAVDSNRDTPLHLAAKNSHADIVKMLL-------ACGADSLQQNHDGKTPRHLAEDNEIKQLLK 211          

HSP 6 Score: 75.8702 bits (185), Expect = 1.158e-11
Identity = 45/158 (28.48%), Postives = 79/158 (50.00%), Query Frame = 3
Query:  246 PIHMACWDGHLEILKVLLEKNCDIESCDEWKRRPIHLACENGHTEIVKFLINLH-----CDIEAINDKAWRPIHFGCWKGHSDIVKVLVEQNCDIEACDHLKRRPIHLACEKGHTEIVKVLIDHHCDISACGGRFNQ---SPIHLARKNNFTELIQLL 695
            P+H+A   G +  +  LLE + D+ + +      +H A E GH + +  L+        C I A N     P+H      H+++VK L+++  DI A D  ++ P+H A E G+ + V V +   C I  C    +    +P+HLA KN+  +++++L
Sbjct:   25 PLHLAVKSGDVVKVNALLENSVDVHAVNINGYTALHCAAERGHIDAINALLTEQNVCYLC-INAENSNKETPLHLAAKNNHTEVVKALLKKGADINAADKDEKIPLHKAAEYGYADTVSVFLTVKC-IYLCIDAVDSNRDTPLHLAAKNSHADIVKML 180          

HSP 7 Score: 66.2402 bits (160), Expect = 1.567e-8
Identity = 40/132 (30.30%), Postives = 67/132 (50.76%), Query Frame = 3
Query:  315 IESCDEWKRRPIHLACENGHTEIVKFLINLHCDIEAINDKAWRPIHFGCWKGHSDIVK-VLVEQN----CDIEACDHLKRRPIHLACEKGHTEIVKVLIDHHCDISACGGRFNQSPIHLARKNNFTELIQLL 695
            + + DE    P+HLA ++G    V  L+    D+ A+N   +  +H    +GH D +  +L EQN    C I A +  K  P+HLA +  HTE+VK L+    DI+A   +  + P+H A +  + + + + 
Sbjct:   15 VRTIDEIGDTPLHLAVKSGDVVKVNALLENSVDVHAVNINGYTALHCAAERGHIDAINALLTEQNVCYLC-INAENSNKETPLHLAAKNNHTEVVKALLKKGADINAA-DKDEKIPLHKAAEYGYADTVSVF 144          
BLAST of SMED30015660 vs. TrEMBL
Match: A0A1X7T5B0 (ANK_REP_REGION domain-containing protein OS=Amphimedon queenslandica OX=400682 PE=4 SV=1)

HSP 1 Score: 151.754 bits (382), Expect = 6.693e-38
Identity = 81/196 (41.33%), Postives = 125/196 (63.78%), Query Frame = 3
Query:  132 WDRRPIHFACLKGDIDIVK-VLIDHNCDIEVRNRKWNQQPIHMACWDGHLEILKVLLE-KNCDIESCDEWKRRPIHLACENGHTEIVKFL-INLHCDIEAINDKAWRPIHFGCWKGHSDIVKVLVEQ-NCDIEACDHLKRRPIHLACEKGHTEIVK-VLIDHHCDISACGGRFNQSPIHLARKNNFTELIQLLTIH 704
            ++ RP+H AC  G+IDIV  ++ID +CD+  + R +   P+H AC  GH EI+K+L     C+ E+ D    RP+H  CE+G+ +IV++L I+ HCD+ A     + P+H+ C KGH +IVK+L     C+IEA D+ + RP+H ACE G+ +IV  ++ID HCD++A  G  N +P+  A K    E++++LT H
Sbjct:  364 FNDRPLHKACESGNIDIVHHLVIDKHCDVNAKGR-YGYTPLHFACEKGHFEIVKILTNHPQCNTEAEDNSNDRPLHEVCESGNVDIVRYLVIDKHCDVNAKGRNGYAPLHYACEKGHFEIVKILTNHPQCNIEAEDNSQYRPLHKACESGNVDIVHHLVIDKHCDVNAKAGWSNYTPLDYACKKGHFEIVKILTNH 558          

HSP 2 Score: 143.665 bits (361), Expect = 5.394e-35
Identity = 79/198 (39.90%), Postives = 123/198 (62.12%), Query Frame = 3
Query:  135 DRRPIHFACLKGDIDIVK-VLIDHNCDIEVRNRKWNQQPIHMACWDGHLEILKVLLEK---NCDIESCDEWKRRPIHLACENGHTEIVKFL-INLHCDIEAINDKAWRPIHFGCWKGHSDIVKVLVEQ-NCDIEACD-HLKRRPIHLACEKGHTEIV-KVLIDHHCDISACGGRFNQSPIHLARKNNFTELIQLLTIH 704
            D RP+H AC  G++DIV+ ++ID +CD+  + R     P+H AC  GH E++K+L      N + E    +  RP+H ACE+G+ +IV+ L I+ HCD+ A     + P+HF C KGH ++VK+L     C+ EA D +   RP+H ACE G+ +IV  ++ID HCD++A  GR+  +P+H A +    E++++LT H
Sbjct:  226 DDRPLHKACESGNVDIVRHLVIDKHCDVNAKGRNG-YTPLHFACEKGHFEVVKILTNHPQCNTEAEGSYLFNDRPLHKACESGNVDIVRHLVIDKHCDVNAKGRNGYTPLHFACEKGHFEVVKILTNHPQCNTEAEDSYFNDRPLHKACESGNIDIVHHLVIDKHCDVNA-KGRYGYTPLHFACEKGHFEIVKILTNH 421          

HSP 3 Score: 142.895 bits (359), Expect = 1.088e-34
Identity = 80/193 (41.45%), Postives = 119/193 (61.66%), Query Frame = 3
Query:  141 RPIHFACLKGDIDIV-KVLIDHNCDIEVRNRKWNQQPIHMACWDGHLEILKVLLE-KNCDIESCDEWKRRPIHLACENGHTEIV-KFLINLHCDIEAINDKAWRPIHFGCWKGHSDIVKVLVEQ-NCDIEACDHLKRRPIHLACEKGHTEIVK-VLIDHHCDISACGGRFNQSPIHLARKNNFTELIQLLTIH 704
            RP+H AC  G++DIV  ++ID +CD+  + R     P+H AC  GH E++KVL     C  E+ D    RP+H ACE+G+ +IV   +I+ HCD+ A     + P+HF C KGH ++VKVL     C  EA D+   RP+H ACE G+ +IV+ ++ID HCD++A  GR   +P+H A +    E++++LT H
Sbjct:   92 RPLHKACESGNVDIVCHLVIDKHCDVNAKGRNG-YTPLHFACEKGHFEVVKVLTNHPQCITEAEDNTDDRPLHKACESGNVDIVCHLVIDKHCDVNAKGRNGYTPLHFACEKGHFEVVKVLTNHPQCITEAEDNTDDRPLHKACESGNVDIVRHLVIDKHCDVNA-KGRNGYTPLHFACEKGHFEVVKILTNH 282          

HSP 4 Score: 141.739 bits (356), Expect = 2.833e-34
Identity = 79/197 (40.10%), Postives = 119/197 (60.41%), Query Frame = 3
Query:  135 DRRPIHFACLKGDIDIV-KVLIDHNCDIEVRNRKWNQQPIHMACWDGHLEILKVLLE-KNCDIESCDEWKRRPIHLACENGHTEIVKFL-INLHCDIEAINDKAWRPIHFGCWKGHSDIVKVLVEQ---NCDIEACDHLKRRPIHLACEKGHTEIVK-VLIDHHCDISACGGRFNQSPIHLARKNNFTELIQLLTIH 704
            D RP+H AC  G++DIV  ++ID +CD+  + R     P+H AC  GH E++KVL     C  E+ D    RP+H ACE+G+ +IV+ L I+ HCD+ A     + P+HF C KGH ++VK+L      N + E       RP+H ACE G+ +IV+ ++ID HCD++A  GR   +P+H A +    E++++LT H
Sbjct:  158 DDRPLHKACESGNVDIVCHLVIDKHCDVNAKGRNG-YTPLHFACEKGHFEVVKVLTNHPQCITEAEDNTDDRPLHKACESGNVDIVRHLVIDKHCDVNAKGRNGYTPLHFACEKGHFEVVKILTNHPQCNTEAEGSYLFNDRPLHKACESGNVDIVRHLVIDKHCDVNA-KGRNGYTPLHFACEKGHFEVVKILTNH 352          

HSP 5 Score: 118.627 bits (296), Expect = 3.914e-26
Identity = 69/165 (41.82%), Postives = 104/165 (63.03%), Query Frame = 3
Query:  144 PIHFACLKGDIDIVKVLIDH-NCDIEVRNRKWNQQPIHMACWDGHLEILK-VLLEKNCDIESCDEWKR-RPIHLACENGHTEIVKFLIN-LHCDIEAINDKAWRPIHFGCWKGHSDIVKVLV-EQNCDIEACDHLKRRPIHLACEKGHTEIVKVLIDH-HCDISA 620
            P+H+AC KG  +IVK+L +H  C+IE  +     +P+H AC  G+++I+  ++++K+CD+ +   W    P+  AC+ GH EIVK L N   C+ EA N+  +RP+H  C  G  DIV+ LV +++CD+ A       P+H ACEKGH EIVK+L +H  C+I A
Sbjct:  470 PLHYACEKGHFEIVKILTNHPQCNIEAEDNSQ-YRPLHKACESGNVDIVHHLVIDKHCDVNAKAGWSNYTPLDYACKKGHFEIVKILTNHPQCNTEAENNSQYRPLHEACELGSVDIVRHLVIDKHCDVNAKGRSDYTPLHCACEKGHFEIVKILTNHPQCNIEA 633          

HSP 6 Score: 101.293 bits (251), Expect = 3.155e-20
Identity = 67/217 (30.88%), Postives = 110/217 (50.69%), Query Frame = 3
Query:  168 GDIDIVKVLIDHNCDIEVRNRKWNQQPIHMACWDGHLEILK-VLLEKNCDIESCDEWKRRPIHLACENGHTEIVKFLIN-----------------------------------LHCDIEAINDKAWRPIHFGCWKGHSDIVKVLVEQ-NCDIEACDHLKRRPIHLACEKGHTEIV-KVLIDHHCDISACGGRFNQSPIHLARKNNFTELIQLLTIH 704
             ++D++K+L +H  D         ++ +  AC  G+++ ++ ++++K+CD+ + +     P+H ACE GH EIVK L N                                    HCD+ A     + P+HF C KGH ++VKVL     C  EA D+   RP+H ACE G+ +IV  ++ID HCD++A  GR   +P+H A +    E++++LT H
Sbjct:    8 AELDVMKLLNNHYED---------RRSLINACKSGNVDFVRHLVIDKHCDVNAKERIGYTPLHYACEMGHFEIVKILTNHPQCNAEAEDNSNDRPLHKACESGNVDIVCHLVIDKHCDVNAKGRNGYTPLHFACEKGHFEVVKVLTNHPQCITEAEDNTDDRPLHKACESGNVDIVCHLVIDKHCDVNA-KGRNGYTPLHFACEKGHFEVVKVLTNH 214          

HSP 7 Score: 71.2478 bits (173), Expect = 5.720e-11
Identity = 37/87 (42.53%), Postives = 57/87 (65.52%), Query Frame = 3
Query:  141 RPIHFACLKGDIDIVK-VLIDHNCDIEVRNRKWNQQPIHMACWDGHLEILKVLLE-KNCDIESCDEWKRRPIHLACENGHTEIVKFL 395
            RP+H AC  G +DIV+ ++ID +CD+  + R  +  P+H AC  GH EI+K+L     C+IE+ D  + RP+H  CE+G+ +IV+ L
Sbjct:  572 RPLHEACELGSVDIVRHLVIDKHCDVNAKGRS-DYTPLHCACEKGHFEIVKILTNHPQCNIEAEDNSQYRPLHKVCESGNVDIVRHL 657          

HSP 8 Score: 25.0238 bits (53), Expect = 5.720e-11
Identity = 13/30 (43.33%), Postives = 22/30 (73.33%), Query Frame = 2
Query:    2 PIHLAFDNNHREIVK-LLIEENCDVNAIGG 88
            P+H A ++ + +IV  L+I+++CDVNA  G
Sbjct:  504 PLHKACESGNVDIVHHLVIDKHCDVNAKAG 533          
BLAST of SMED30015660 vs. TrEMBL
Match: A0A1X7T5X6 (Uncharacterized protein OS=Amphimedon queenslandica OX=400682 PE=4 SV=1)

HSP 1 Score: 149.828 bits (377), Expect = 9.065e-37
Identity = 82/197 (41.62%), Postives = 127/197 (64.47%), Query Frame = 3
Query:  132 WDRRPIHFACLKGDIDIVK-VLIDHNCDIEVRNRKWN-QQPIHMACWDGHLEILKVLLE-KNCDIESCDEWKRRPIHLACENGHTEIVKFL-INLHCDIEAINDKAWRPIHFGCWKGHSDIVKVLVEQ-NCDIEACDHLKRRPIHLACEKGHTEIVK-VLIDHHCDISACGGRFNQSPIHLARKNNFTELIQLLTIH 704
            W+ RP+H AC  G++DIV+ ++ID +CD+      WN   P+H AC  GH EI+K+L     C++E+   +  RP+H ACE+G+ +IV+ L IN HCD+ A +   + P+H+ C KGH + VK+L     C+IEA D+   RP+H ACE G+ +IV+ ++ID HCD++A  GR   +P+H A +    E++++LT H
Sbjct:  281 WNNRPLHKACESGNVDIVRHLVIDKHCDVNAIG--WNGYTPLHYACEKGHFEIVKILTNHSQCNLEAEGSFNDRPLHKACESGNVDIVRHLVINKHCDVNAKDRIGYTPLHYACEKGHFETVKILTNHPQCNIEAEDNWNNRPLHKACESGNVDIVRHLVIDKHCDVNA-KGRNGYTPLHYACEKGHFEIVKILTNH 474          

HSP 2 Score: 147.902 bits (372), Expect = 4.152e-36
Identity = 81/197 (41.12%), Postives = 126/197 (63.96%), Query Frame = 3
Query:  132 WDRRPIHFACLKGDIDIVK-VLIDHNCDIEVRNRKWN-QQPIHMACWDGHLEILKVLLE-KNCDIESCDEWKRRPIHLACENGHTEIVKFL-INLHCDIEAINDKAWRPIHFGCWKGHSDIVKVLVEQ-NCDIEACDHLKRRPIHLACEKGHTEIVK-VLIDHHCDISACGGRFNQSPIHLARKNNFTELIQLLTIH 704
            W+ RP+H AC  G++DIV+ ++ID +CD+      WN   P+H AC  GH EI+K+L     C++E+   +  RP+H ACE+G+ +IV+ L I+ HCD+ A +   + P+H+ C KGH + VK+L     C+IEA D+   RP+H ACE G+ +IV+ ++ID HCD++A  GR   +P+H A +    E+++ LT H
Sbjct:  621 WNNRPLHKACESGNVDIVRHLVIDKHCDVNAIG--WNGYTPLHYACEKGHFEIVKILTNHSQCNLEAEGSFNDRPLHKACESGNVDIVRHLVIDKHCDVNAKDRIGYTPLHYACEKGHFETVKILTNHPQCNIEAEDNWNNRPLHKACESGNVDIVRHLVIDKHCDVNA-KGRNGYTPLHYACEKGHFEIVKFLTNH 814          

HSP 3 Score: 145.591 bits (366), Expect = 2.841e-35
Identity = 79/194 (40.72%), Postives = 124/194 (63.92%), Query Frame = 3
Query:  141 RPIHFACLKGDIDIVK-VLIDHNCDIEVRNRKWNQQPIHMACWDGHLEILKVLLE-KNCDIESCDEWKRRPIHLACENGHTEIVKFL-INLHCDIEAINDKAWRPIHFGCWKGHSDIVKVLVEQ-NCDIEACDHLKRRPIHLACEKGHTEIVK-VLIDHHCDISACGGRFNQSPIHLARKNNFTELIQLLTIHE 707
            RP+H AC  G++DIV+ ++ID +CD+  + R     P+H AC  GH EI+K+L     C++E+   +  RP+H ACE+G+ +IV+ L IN HCD+ A +   + P+H+ C KGH + VK+L     C+IEA D+   RP+H ACE G+ +IV+ ++ID HCD++A G     +P+H A +    E++++LT H 
Sbjct:  488 RPLHNACESGNVDIVRHLVIDKHCDVNAKGR-IGYTPLHYACEKGHFEIVKILTNHSQCNLEAEGSFNDRPLHKACESGNVDIVRHLVINKHCDVNAKDRIGYTPLHYACEKGHFETVKILTNHPQCNIEAKDNWNNRPLHKACESGNVDIVRHLVIDKHCDVNAIGWN-GYTPLHYACEKGHFEIVKILTNHS 679          

HSP 4 Score: 142.51 bits (358), Expect = 3.287e-34
Identity = 80/198 (40.40%), Postives = 125/198 (63.13%), Query Frame = 3
Query:  132 WDRRPIHFACLKGDIDIVK-VLIDHNCDIEVRNRKWN-QQPIHMACWDGHLEILKVLLE-KNCDIESCDEWKRRPIHLACENGHTEIVKFL-INLHCDIEAINDKAWRPIHFGCWKGHSDIVKVLVEQ-NCDIEACDHLKRRPIHLACEKGHTEIVK-VLIDHHCDISACGGRFNQSPIHLARKNNFTELIQLLTIHE 707
            ++ RP+H AC  G++DIV+ ++ID +CD+      WN   P+H AC  GH EI+K+L     C++E+   +  RP+H ACE+G+ +IV  L I+ HCD+ A     + P+H+ C KGH +IVK+L     C+IEA D+   RP+H ACE G+ +IV+ ++ID HCD++A G     +P+H A +    E++++LT H 
Sbjct:  145 FNDRPLHKACESGNVDIVRHLVIDKHCDVNAIG--WNGYTPLHYACEKGHFEIVKILTNHSQCNLEAEGNFNDRPLHKACESGNVDIVHHLVIDKHCDVNAKGKDGYTPLHYACEKGHFEIVKILTNHPQCNIEAEDNWNNRPLHKACESGNVDIVRHLVIDKHCDVNAIGWN-GYTPLHYACEKGHFEIVKILTNHS 339          

HSP 5 Score: 141.354 bits (355), Expect = 6.298e-34
Identity = 78/193 (40.41%), Postives = 123/193 (63.73%), Query Frame = 3
Query:  141 RPIHFACLKGDIDIV-KVLIDHNCDIEVRNRKWNQQPIHMACWDGHLEILKVLLE-KNCDIESCDEWKRRPIHLACENGHTEIVKFL-INLHCDIEAINDKAWRPIHFGCWKGHSDIVKVLVEQN-CDIEACDHLKRRPIHLACEKGHTEIV-KVLIDHHCDISACGGRFNQSPIHLARKNNFTELIQLLTIH 704
            RP+H AC  G++DIV  ++ID +C++  + R     P+H AC  GH EI+K+L     C+IE    +  RP+H ACE+G+ +IV+ L I+ HCD+ AI    + P+H+ C KGH +IVK+L   + C++EA  +   RP+H ACE G+ +IV  ++ID HCD++A  G+   +P+H A +    E++++LT H
Sbjct:   80 RPLHKACESGNVDIVCHLVIDKHCNVNAKGRNG-YTPLHYACEKGHFEIVKILTNHPQCNIEVEGSFNDRPLHKACESGNVDIVRHLVIDKHCDVNAIGWNGYTPLHYACEKGHFEIVKILTNHSQCNLEAEGNFNDRPLHKACESGNVDIVHHLVIDKHCDVNA-KGKDGYTPLHYACEKGHFEIVKILTNH 270          

HSP 6 Score: 138.658 bits (348), Expect = 5.460e-33
Identity = 78/193 (40.41%), Postives = 124/193 (64.25%), Query Frame = 3
Query:  144 PIHFACLKGDIDIVKVLIDH-NCDIEVRNRKWNQQPIHMACWDGHLEILK-VLLEKNCDIESCDEWKRRPIHLACENGHTEIVKFLIN-LHCDIEAINDKAWRPIHFGCWKGHSDIVKVLV-EQNCDIEACDHLKRRPIHLACEKGHTEIVKVLIDH-HCDISACGGRFNQSPIHLARKNNFTELIQLLTIHE 707
            P+H+AC KG  + VK+L +H  C+IE  +  WN +P+H AC  G+++I++ ++++K+CD+ +       P+H ACE GH EIVK L N   C+IEA +    RP+H  C  G+ DIV+ LV +++CD+ A   +   P+H ACEKGH EIVK+L +H  C++ A  G FN  P+H A ++   ++++ L I++
Sbjct:  387 PLHYACEKGHFETVKILTNHPQCNIEAEDN-WNNRPLHKACESGNVDIVRHLVIDKHCDVNAKGRNGYTPLHYACEKGHFEIVKILTNHPQCNIEAEDYSKDRPLHNACESGNVDIVRHLVIDKHCDVNAKGRIGYTPLHYACEKGHFEIVKILTNHSQCNLEA-EGSFNDRPLHKACESGNVDIVRHLVINK 577          

HSP 7 Score: 134.806 bits (338), Expect = 1.418e-31
Identity = 79/229 (34.50%), Postives = 127/229 (55.46%), Query Frame = 3
Query:  132 WDRRPIHFACLKGDIDIVK-VLIDHNCDIEVRNRKWNQQPIHMACWDGHLEILKVLLE-KNCDIESCDEWKRRPIHLACENGHTEIVKFL-INLHCDIEAINDKAWRPIHFGCWKGHSDIVKVL-----------------------------------VEQNCDIEACDHLKRRPIHLACEKGHTEIVKVLIDH-HCDISACGGRFNQSPIHLARKNNFTELIQLLTI 701
            ++ RP+H AC  G++DIV+ ++I+ +CD+  ++R     P+H AC  GH E +K+L     C+IE+ D W  RP+H ACE+G+ +IV+ L I+ HCD+ AI    + P+H+ C KGH +IVK+L                                   ++++CD+ A D +   P+H ACEKGH E VK+L +H  C+I A    +N  P+H A ++   ++++ L I
Sbjct:  553 FNDRPLHKACESGNVDIVRHLVINKHCDVNAKDR-IGYTPLHYACEKGHFETVKILTNHPQCNIEAKDNWNNRPLHKACESGNVDIVRHLVIDKHCDVNAIGWNGYTPLHYACEKGHFEIVKILTNHSQCNLEAEGSFNDRPLHKACESGNVDIVRHLVIDKHCDVNAKDRIGYTPLHYACEKGHFETVKILTNHPQCNIEA-EDNWNNRPLHKACESGNVDIVRHLVI 779          

HSP 8 Score: 134.42 bits (337), Expect = 1.888e-31
Identity = 81/229 (35.37%), Postives = 125/229 (54.59%), Query Frame = 3
Query:  132 WDRRPIHFACLKGDIDIVK-VLIDHNCDIEVRNRKWNQQPIHMACWDGHLEILKVLLE-KNCDIESCDEWKRRPIHLACENGHTEIVKFL-INLHCDIEAINDKAWRPIHFGCWKGHSDIVKVL-----------------------------------VEQNCDIEACDHLKRRPIHLACEKGHTEIVKVLIDH-HCDISACGGRFNQSPIHLARKNNFTELIQLLTI 701
            ++ RP+H AC  G++DIV  ++ID +CD+  +  K    P+H AC  GH EI+K+L     C+IE+ D W  RP+H ACE+G+ +IV+ L I+ HCD+ AI    + P+H+ C KGH +IVK+L                                   + ++CD+ A D +   P+H ACEKGH E VK+L +H  C+I A    +N  P+H A ++   ++++ L I
Sbjct:  213 FNDRPLHKACESGNVDIVHHLVIDKHCDVNAKG-KDGYTPLHYACEKGHFEIVKILTNHPQCNIEAEDNWNNRPLHKACESGNVDIVRHLVIDKHCDVNAIGWNGYTPLHYACEKGHFEIVKILTNHSQCNLEAEGSFNDRPLHKACESGNVDIVRHLVINKHCDVNAKDRIGYTPLHYACEKGHFETVKILTNHPQCNIEA-EDNWNNRPLHKACESGNVDIVRHLVI 439          

HSP 9 Score: 134.035 bits (336), Expect = 2.514e-31
Identity = 77/191 (40.31%), Postives = 122/191 (63.87%), Query Frame = 3
Query:  144 PIHFACLKGDIDIVKVLIDHN-CDIEVRNRKWNQQPIHMACWDGHLEILK-VLLEKNCDIESCDEWKRRPIHLACENGHTEIVKFLIN-LHCDIEAINDKAWRPIHFGCWKGHSDIVKVLV-EQNCDIEACDHLKRRPIHLACEKGHTEIVKVLIDH-HCDISACGGRFNQSPIHLARKNNFTELIQLLTI 701
            P+H+AC KG  +IVK+L +H+ C++E     +N +P+H AC  G+++I++ +++ K+CD+ + D     P+H ACE GH E VK L N   C+IEA ++   RP+H  C  G+ DIV+ LV +++CD+ A       P+H ACEKGH EIVK+L +H  C++ A  G FN  P+H A ++   ++++ L I
Sbjct:  523 PLHYACEKGHFEIVKILTNHSQCNLEAEG-SFNDRPLHKACESGNVDIVRHLVINKHCDVNAKDRIGYTPLHYACEKGHFETVKILTNHPQCNIEAKDNWNNRPLHKACESGNVDIVRHLVIDKHCDVNAIGWNGYTPLHYACEKGHFEIVKILTNHSQCNLEA-EGSFNDRPLHKACESGNVDIVRHLVI 711          

HSP 10 Score: 132.109 bits (331), Expect = 1.214e-30
Identity = 77/193 (39.90%), Postives = 125/193 (64.77%), Query Frame = 3
Query:  144 PIHFACLKGDIDIVKVLIDHN-CDIEVRNRKWNQQPIHMACWDGHLEILK-VLLEKNCDIESCDEWKRRPIHLACENGHTEIVKFLIN-LHCDIEAINDKAWRPIHFGCWKGHSDIVKVLV-EQNCDIEACDHLKRRPIHLACEKGHTEIVKVLIDH-HCDISACGGRFNQSPIHLARKNNFTELIQLLTIHE 707
            P+H+AC KG  +IVK+L +H+ C++E     +N +P+H AC  G+++I+  ++++K+CD+ +  +    P+H ACE GH EIVK L N   C+IEA ++   RP+H  C  G+ DIV+ LV +++CD+ A       P+H ACEKGH EIVK+L +H  C++ A  G FN  P+H A ++   ++++ L I++
Sbjct:  183 PLHYACEKGHFEIVKILTNHSQCNLEAEGN-FNDRPLHKACESGNVDIVHHLVIDKHCDVNAKGKDGYTPLHYACEKGHFEIVKILTNHPQCNIEAEDNWNNRPLHKACESGNVDIVRHLVIDKHCDVNAIGWNGYTPLHYACEKGHFEIVKILTNHSQCNLEA-EGSFNDRPLHKACESGNVDIVRHLVINK 373          

HSP 11 Score: 131.724 bits (330), Expect = 1.647e-30
Identity = 76/200 (38.00%), Postives = 122/200 (61.00%), Query Frame = 3
Query:  123 YF*WDRRPIHFACLKGDIDIVK-VLIDHNCDIEVRNRKWNQQPIHMACWDGHLEILKVLLE-KNCDIESCDEWKRRPIHLACENGHTEIV-KFLINLHCDIEAINDKAWRPIHFGCWKGHSDIVKVLVEQ-NCDIEACDHLKRRPIHLACEKGHTEIVK-VLIDHHCDISACGGRFNQSPIHLARKNNFTELIQLLTIHE 707
            YF  DRR + +AC   ++DIV+ ++ID +CD+  + R     P+H AC +G  EI+++L +   C+IE  D    RP+H ACE+G+ +IV   +I+ HC++ A     + P+H+ C KGH +IVK+L     C+IE       RP+H ACE G+ +IV+ ++ID HCD++A G     +P+H A +    E++++LT H 
Sbjct:    7 YF-EDRRSLVYACKFRNVDIVRHLVIDKHCDVNAKGRNG-YTPLHYACEEGCFEIVRILTDHPQCNIEVEDNSNDRPLHKACESGNVDIVCHLVIDKHCNVNAKGRNGYTPLHYACEKGHFEIVKILTNHPQCNIEVEGSFNDRPLHKACESGNVDIVRHLVIDKHCDVNAIGWN-GYTPLHYACEKGHFEIVKILTNHS 203          

HSP 12 Score: 127.487 bits (319), Expect = 4.174e-29
Identity = 77/194 (39.69%), Postives = 120/194 (61.86%), Query Frame = 3
Query:  144 PIHFACLKGDIDIVKVLIDHN-CDIEVRNRKWNQQPIHMACWDGHLEILK-VLLEKNCDIESCDEWKRRPIHLACENGHTEIVKFLIN-LHCDIEAINDKAWRPIHFGCWKGHSDIVKVLV-EQNCDIEACDHLKRRPIHLACEKGHTEIVKVLIDH-HCDISA---CGGRFNQSPIHLARKNNFTELIQLLTI 701
            P+H+AC KG  +IVK+L +H+ C++E     +N +P+H AC  G+++I++ ++++K+CD+ + D     P+H ACE GH E VK L N   C+IEA ++   RP+H  C  G+ DIV+ LV +++CD+ A       P+H ACEKGH EIVK L +H  C+  A   C  R    P+H A K+   ++++ L I
Sbjct:  659 PLHYACEKGHFEIVKILTNHSQCNLEAEG-SFNDRPLHKACESGNVDIVRHLVIDKHCDVNAKDRIGYTPLHYACEKGHFETVKILTNHPQCNIEAEDNWNNRPLHKACESGNVDIVRHLVIDKHCDVNAKGRNGYTPLHYACEKGHFEIVKFLTNHPQCNTKAEDVCDDR----PLHKACKSRNVDIVRYLVI 847          

HSP 13 Score: 126.716 bits (317), Expect = 6.983e-29
Identity = 76/191 (39.79%), Postives = 118/191 (61.78%), Query Frame = 3
Query:  144 PIHFACLKGDIDIVKVLIDH-NCDIEVRNRKWNQQPIHMACWDGHLEIL-KVLLEKNCDIESCDEWKRRPIHLACENGHTEIVKFLIN-LHCDIEAINDKAWRPIHFGCWKGHSDIVKVLV-EQNCDIEACDHLKRRPIHLACEKGHTEIVKVLIDH-HCDISACGGRFNQSPIHLARKNNFTELIQLLTI 701
            P+H+AC +G  +IV++L DH  C+IEV +   N +P+H AC  G+++I+  ++++K+C++ +       P+H ACE GH EIVK L N   C+IE       RP+H  C  G+ DIV+ LV +++CD+ A       P+H ACEKGH EIVK+L +H  C++ A  G FN  P+H A ++   +++  L I
Sbjct:   47 PLHYACEEGCFEIVRILTDHPQCNIEVEDNS-NDRPLHKACESGNVDIVCHLVIDKHCNVNAKGRNGYTPLHYACEKGHFEIVKILTNHPQCNIEVEGSFNDRPLHKACESGNVDIVRHLVIDKHCDVNAIGWNGYTPLHYACEKGHFEIVKILTNHSQCNLEA-EGNFNDRPLHKACESGNVDIVHHLVI 235          

HSP 14 Score: 118.627 bits (296), Expect = 5.111e-26
Identity = 80/237 (33.76%), Postives = 121/237 (51.05%), Query Frame = 3
Query:  132 WDRRPIHFACLKGDIDIVK-VLIDHNCDIEVRNRKWNQQPIHMACWDGHLEILKVLLE-KNCDIESCDEWKRRPIHLACENGHTEIVKFL-INLHCDIEAINDKAWRPIHFGCWKGHSDIVKVLVEQ-NCDIEACDHLKRR----------------------------------PIHLACEKGHTEIVKVLIDH-HCDISACGGRFNQSPIHLA---------RKNNFTELIQLLT 698
            W+ RP+H AC  G++DIV+ ++ID +CD+  + R     P+H AC  GH EI+K L     C+ ++ D    RP+H AC++ + +IV++L I+ H D+ A     + P+H+ C KGH +IVK+L     C+ EA D    R                                  P+H ACEKGH EIVK+L +H  C+I A     N+ P+HLA          K++FT ++  L+
Sbjct:  757 WNNRPLHKACESGNVDIVRHLVIDKHCDVNAKGRNG-YTPLHYACEKGHFEIVKFLTNHPQCNTKAEDVCDDRPLHKACKSRNVDIVRYLVIDKHRDVNAKGRDGYTPLHYACEKGHFEIVKILTNHPQCNTEAEDVYDDRSLHKACEFGRLDIVRYLVIDKHRDVNAKGRNGYTPLHYACEKGHFEIVKILTNHPQCNIEA-ENNDNKWPLHLAIRSRSSYPSAKSHFTSIVNYLS 991          
BLAST of SMED30015660 vs. TrEMBL
Match: A0A182GGY8 (ANK_REP_REGION domain-containing protein OS=Aedes albopictus OX=7160 GN=RP20_CCG009719 PE=4 SV=1)

HSP 1 Score: 149.058 bits (375), Expect = 1.547e-36
Identity = 68/184 (36.96%), Postives = 118/184 (64.13%), Query Frame = 3
Query:  144 PIHFACLKGDIDIVKVLIDHNCDIEVRNRKWNQQPIHMACWDGHLEILKVLLEKNCDIESCDEWKRRPIHLACENGHTEIVKFLINLHCDIEAINDKAWRPIHFGCWKGHSDIVKVLVEQNCDIEACDHLKRRPIHLACEKGHTEIVKVLIDHHCDISACGGRFNQSPIHLARKNNFTELIQLL 695
            P+H AC  G  ++V++LI    +IE  N+ +N  P+H+A W+GH +++++L+ +  +IE+  +    P+HLAC NGH E+V+ LI    +IEA+    W P+H  C  GH+++V++LV++  +I+A    K  P+HLAC+ GH E+V++LI    +I A   +   +P+HLA +N   E++++L
Sbjct: 1501 PLHLACQDGHKEVVEILIREEANIEALNQ-YNYTPLHIASWNGHEKVVEILIREKANIEALGQENWTPLHLACRNGHKEVVEILIRGKANIEALTQDNWTPLHKACQNGHAEVVEILVKEKANIDALAEKKFTPLHLACQNGHKEVVEILIGEKANIDALTEK-KSTPLHLACQNGHKEVVEIL 1682          

HSP 2 Score: 148.288 bits (373), Expect = 2.994e-36
Identity = 69/184 (37.50%), Postives = 121/184 (65.76%), Query Frame = 3
Query:  144 PIHFACLKGDIDIVKVLIDHNCDIEVRNRKWNQQPIHMACWDGHLEILKVLLEKNCDIESCDEWKRRPIHLACENGHTEIVKFLINLHCDIEAINDKAWRPIHFGCWKGHSDIVKVLVEQNCDIEACDHLKRRPIHLACEKGHTEIVKVLIDHHCDISACGGRFNQSPIHLARKNNFTELIQLL 695
            P+HFAC  G  ++V++LI    +IE  N+  N  P+H+AC +GH E++++L+++N +I++  E K  P+HLAC  GH E V+ LI    +I+A+++  + P+H  C  GH+++V++LV++  +I+A    K  P+HLAC+ GH E+V++LI    +I A   +   +P+HLA +N   E++++L
Sbjct: 1237 PLHFACQNGRKEVVEILIREKANIEALNQH-NWTPLHLACQNGHKEVVEILIKENANIDALTEHKYTPLHLACARGHKEAVQILIGEKANIDALDENKFTPLHKACQNGHAEVVEILVKEKANIDALAEKKFTPLHLACQNGHKEVVEILIGEKANIDALTEK-KSTPLHLACQNGHKEVVEIL 1418          

HSP 3 Score: 145.976 bits (367), Expect = 2.088e-35
Identity = 65/184 (35.33%), Postives = 118/184 (64.13%), Query Frame = 3
Query:  144 PIHFACLKGDIDIVKVLIDHNCDIEVRNRKWNQQPIHMACWDGHLEILKVLLEKNCDIESCDEWKRRPIHLACENGHTEIVKFLINLHCDIEAINDKAWRPIHFGCWKGHSDIVKVLVEQNCDIEACDHLKRRPIHLACEKGHTEIVKVLIDHHCDISACGGRFNQSPIHLARKNNFTELIQLL 695
            P+H AC  G  ++V++L+    +I+    K    P+H+AC +GH E++++L+ +  +I++  E K  P+HLAC+NGH E+V+ L+    +IEA+N   W P+H  C KGH ++VK+L+ +  +I+A    K  P+HLAC++GH E+V++ +  + +I+A       +P++LA +N  TE+ +++
Sbjct: 1600 PLHKACQNGHAEVVEILVKEKANIDALAEK-KFTPLHLACQNGHKEVVEILIGEKANIDALTEKKSTPLHLACQNGHKEVVEILVGEKANIEALNQDNWTPLHLACEKGHKEVVKILIGEKANIDALTQKKNTPLHLACQRGHKEVVEIFLRKNANIAALDDE-KCTPLNLASQNGHTEVEKIM 1781          

HSP 4 Score: 145.591 bits (366), Expect = 2.809e-35
Identity = 70/184 (38.04%), Postives = 117/184 (63.59%), Query Frame = 3
Query:  144 PIHFACLKGDIDIVKVLIDHNCDIEVRNRKWNQQPIHMACWDGHLEILKVLLEKNCDIESCDEWKRRPIHLACENGHTEIVKFLINLHCDIEAINDKAWRPIHFGCWKGHSDIVKVLVEQNCDIEACDHLKRRPIHLACEKGHTEIVKVLIDHHCDISACGGRFNQSPIHLARKNNFTELIQLL 695
            P+H AC  G  ++V++LI    +IE   +  N  P+H AC +GH E++++L+++  +I++  E K  P+HLAC+NGH E+V+ LI    +I+A+ +K   P+H  C  GH ++V++LV +  +IEA +     P+HLACEKGH E+VK+LI    +I A   + N +P+HLA +    E++++ 
Sbjct: 1567 PLHLACRNGHKEVVEILIRGKANIEALTQD-NWTPLHKACQNGHAEVVEILVKEKANIDALAEKKFTPLHLACQNGHKEVVEILIGEKANIDALTEKKSTPLHLACQNGHKEVVEILVGEKANIEALNQDNWTPLHLACEKGHKEVVKILIGEKANIDALTQKKN-TPLHLACQRGHKEVVEIF 1748          

HSP 5 Score: 142.51 bits (358), Expect = 6.457e-35
Identity = 68/188 (36.17%), Postives = 118/188 (62.77%), Query Frame = 3
Query:  144 PIHFACLKGDIDIVKVLIDHNCDIEVRNRKWNQQPIHMACWDGHLEILKVLLEKNCDIESCDEWKRRPIHLACENGHTEIVKFLINLHCDIEAINDKAWRPIHFGCWKGHSDIVKVLVEQNCDIEACDHLKRRPIHLACEKGHTEIVKVLIDHHCDISACGGRFNQSPIHLARKNNFTELIQLLTIHE 707
            P+H AC  G  ++V++L+    +I+    K    P+H+AC +GH E++++L+ +  +I++  E K  P+HLAC+NGH E+V+ LI    +IEA+N   W P+HF C  GH ++V++L+ +  +IEA +     P+HL+C  GH E+V++LI    +I A   + N +P+HLA ++   E++++L   E
Sbjct: 1336 PLHKACQNGHAEVVEILVKEKANIDALAEK-KFTPLHLACQNGHKEVVEILIGEKANIDALTEKKSTPLHLACQNGHKEVVEILIRGKANIEALNQVNWTPLHFACHNGHKEVVEILIREKVNIEALNQDNWTPLHLSCRHGHKEVVEILIREKVNIEAL-NQDNWTPLHLACQDGHKEVVEILIREE 1521          

HSP 6 Score: 34.6538 bits (78), Expect = 6.457e-35
Identity = 13/27 (48.15%), Postives = 23/27 (85.19%), Query Frame = 2
Query:    2 PIHLAFDNNHREIVKLLIEENCDVNAI 82
            P+HLA  N H+E+V++LI+EN +++A+
Sbjct: 1270 PLHLACQNGHKEVVEILIKENANIDAL 1296          

HSP 7 Score: 143.665 bits (361), Expect = 1.375e-34
Identity = 65/184 (35.33%), Postives = 114/184 (61.96%), Query Frame = 3
Query:  144 PIHFACLKGDIDIVKVLIDHNCDIEVRNRKWNQQPIHMACWDGHLEILKVLLEKNCDIESCDEWKRRPIHLACENGHTEIVKFLINLHCDIEAINDKAWRPIHFGCWKGHSDIVKVLVEQNCDIEACDHLKRRPIHLACEKGHTEIVKVLIDHHCDISACGGRFNQSPIHLARKNNFTELIQLL 695
            P+H AC  G  ++V++LI    +I+    K    P+H+AC +GH E++++L+    +IE+ ++    P+H AC NGH E+V+ LI    +IEA+N   W P+H  C  GH ++V++L+ +  +IEA +     P+HLAC+ GH E+V++LI    +I A   ++N +P+H+A  N   +++++L
Sbjct: 1369 PLHLACQNGHKEVVEILIGEKANIDALTEK-KSTPLHLACQNGHKEVVEILIRGKANIEALNQVNWTPLHFACHNGHKEVVEILIREKVNIEALNQDNWTPLHLSCRHGHKEVVEILIREKVNIEALNQDNWTPLHLACQDGHKEVVEILIREEANIEAL-NQYNYTPLHIASWNGHEKVVEIL 1550          

HSP 8 Score: 139.813 bits (351), Expect = 2.074e-33
Identity = 66/184 (35.87%), Postives = 115/184 (62.50%), Query Frame = 3
Query:  144 PIHFACLKGDIDIVKVLIDHNCDIEVRNRKWNQQPIHMACWDGHLEILKVLLEKNCDIESCDEWKRRPIHLACENGHTEIVKFLINLHCDIEAINDKAWRPIHFGCWKGHSDIVKVLVEQNCDIEACDHLKRRPIHLACEKGHTEIVKVLIDHHCDISACGGRFNQSPIHLARKNNFTELIQLL 695
            P+H AC  G  ++V++LI    +IE  N+  N  P+H AC +GH E++++L+ +  +IE+ ++    P+HL+C +GH E+V+ LI    +IEA+N   W P+H  C  GH ++V++L+ +  +IEA +     P+H+A   GH ++V++LI    +I A G   N +P+HLA +N   E++++L
Sbjct: 1402 PLHLACQNGHKEVVEILIRGKANIEALNQ-VNWTPLHFACHNGHKEVVEILIREKVNIEALNQDNWTPLHLSCRHGHKEVVEILIREKVNIEALNQDNWTPLHLACQDGHKEVVEILIREEANIEALNQYNYTPLHIASWNGHEKVVEILIREKANIEALGQE-NWTPLHLACRNGHKEVVEIL 1583          

HSP 9 Score: 32.3426 bits (72), Expect = 2.074e-33
Identity = 13/30 (43.33%), Postives = 22/30 (73.33%), Query Frame = 2
Query:    2 PIHLAFDNNHREIVKLLIEENCDVNAIGGK 91
            P+HLA  N H+E+V++LI E  +++A+  K
Sbjct: 1369 PLHLACQNGHKEVVEILIGEKANIDALTEK 1398          

HSP 10 Score: 140.198 bits (352), Expect = 2.199e-33
Identity = 65/184 (35.33%), Postives = 115/184 (62.50%), Query Frame = 3
Query:  144 PIHFACLKGDIDIVKVLIDHNCDIEVRNRKWNQQPIHMACWDGHLEILKVLLEKNCDIESCDEWKRRPIHLACENGHTEIVKFLINLHCDIEAINDKAWRPIHFGCWKGHSDIVKVLVEQNCDIEACDHLKRRPIHLACEKGHTEIVKVLIDHHCDISACGGRFNQSPIHLARKNNFTELIQLL 695
            P+H AC  G  ++V++LI  N +I+    +    P+H+AC  GH E +++L+ +  +I++ DE K  P+H AC+NGH E+V+ L+    +I+A+ +K + P+H  C  GH ++V++L+ +  +I+A    K  P+HLAC+ GH E+V++LI    +I A   + N +P+H A  N   E++++L
Sbjct: 1270 PLHLACQNGHKEVVEILIKENANIDALT-EHKYTPLHLACARGHKEAVQILIGEKANIDALDENKFTPLHKACQNGHAEVVEILVKEKANIDALAEKKFTPLHLACQNGHKEVVEILIGEKANIDALTEKKSTPLHLACQNGHKEVVEILIRGKANIEAL-NQVNWTPLHFACHNGHKEVVEIL 1451          

HSP 11 Score: 139.428 bits (350), Expect = 3.512e-33
Identity = 67/184 (36.41%), Postives = 115/184 (62.50%), Query Frame = 3
Query:  144 PIHFACLKGDIDIVKVLIDHNCDIEVRNRKWNQQPIHMACWDGHLEILKVLLEKNCDIESCDEWKRRPIHLACENGHTEIVKFLINLHCDIEAINDKAWRPIHFGCWKGHSDIVKVLVEQNCDIEACDHLKRRPIHLACEKGHTEIVKVLIDHHCDISACGGRFNQSPIHLARKNNFTELIQLL 695
            P+HFAC  G  ++V++LI    +IE  N+  N  P+H++C  GH E++++L+ +  +IE+ ++    P+HLAC++GH E+V+ LI    +IEA+N   + P+H   W GH  +V++L+ +  +IEA       P+HLAC  GH E+V++LI    +I A   + N +P+H A +N   E++++L
Sbjct: 1435 PLHFACHNGHKEVVEILIREKVNIEALNQD-NWTPLHLSCRHGHKEVVEILIREKVNIEALNQDNWTPLHLACQDGHKEVVEILIREEANIEALNQYNYTPLHIASWNGHEKVVEILIREKANIEALGQENWTPLHLACRNGHKEVVEILIRGKANIEAL-TQDNWTPLHKACQNGHAEVVEIL 1616          

HSP 12 Score: 138.272 bits (347), Expect = 9.306e-33
Identity = 63/184 (34.24%), Postives = 114/184 (61.96%), Query Frame = 3
Query:  144 PIHFACLKGDIDIVKVLIDHNCDIEVRNRKWNQQPIHMACWDGHLEILKVLLEKNCDIESCDEWKRRPIHLACENGHTEIVKFLINLHCDIEAINDKAWRPIHFGCWKGHSDIVKVLVEQNCDIEACDHLKRRPIHLACEKGHTEIVKVLIDHHCDISACGGRFNQSPIHLARKNNFTELIQLL 695
            P+H +C  G  ++V++LI    +IE  N+  N  P+H+AC DGH E++++L+ +  +IE+ +++   P+H+A  NGH ++V+ LI    +IEA+  + W P+H  C  GH ++V++L+    +IEA       P+H AC+ GH E+V++L+    +I A   +   +P+HLA +N   E++++L
Sbjct: 1468 PLHLSCRHGHKEVVEILIREKVNIEALNQD-NWTPLHLACQDGHKEVVEILIREEANIEALNQYNYTPLHIASWNGHEKVVEILIREKANIEALGQENWTPLHLACRNGHKEVVEILIRGKANIEALTQDNWTPLHKACQNGHAEVVEILVKEKANIDALAEK-KFTPLHLACQNGHKEVVEIL 1649          

HSP 13 Score: 136.732 bits (343), Expect = 2.791e-32
Identity = 62/184 (33.70%), Postives = 117/184 (63.59%), Query Frame = 3
Query:  144 PIHFACLKGDIDIVKVLIDHNCDIEVRNRKWNQQPIHMACWDGHLEILKVLLEKNCDIESCDEWKRRPIHLACENGHTEIVKFLINLHCDIEAINDKAWRPIHFGCWKGHSDIVKVLVEQNCDIEACDHLKRRPIHLACEKGHTEIVKVLIDHHCDISACGGRFNQSPIHLARKNNFTELIQLL 695
            P+H+AC+ G  ++V++LI    +I+    K    P+H AC +G  E++++L+ +  +IE+ ++    P+HLAC+NGH E+V+ LI  + +I+A+ +  + P+H  C +GH + V++L+ +  +I+A D  K  P+H AC+ GH E+V++L+    +I A   +   +P+HLA +N   E++++L
Sbjct: 1204 PLHWACISGVKEVVEILIGGKANIDAL-AKNKSTPLHFACQNGRKEVVEILIREKANIEALNQHNWTPLHLACQNGHKEVVEILIKENANIDALTEHKYTPLHLACARGHKEAVQILIGEKANIDALDENKFTPLHKACQNGHAEVVEILVKEKANIDALAEK-KFTPLHLACQNGHKEVVEIL 1385          

HSP 14 Score: 134.035 bits (336), Expect = 2.760e-31
Identity = 62/188 (32.98%), Postives = 116/188 (61.70%), Query Frame = 3
Query:  132 WDRRPIHFACLKGDIDIVKVLIDHNCDIEVRNRKWNQQPIHMACWDGHLEILKVLLEKNCDIESCDEWKRRPIHLACENGHTEIVKFLINLHCDIEAINDKAWRPIHFGCWKGHSDIVKVLVEQNCDIEACDHLKRRPIHLACEKGHTEIVKVLIDHHCDISACGGRFNQSPIHLARKNNFTELIQLL 695
            ++  P+H A   G   +V++LI    +IE   ++ N  P+H+AC +GH E++++L+    +IE+  +    P+H AC+NGH E+V+ L+    +I+A+ +K + P+H  C  GH ++V++L+ +  +I+A    K  P+HLAC+ GH E+V++L+    +I A   + N +P+HLA +    E++++L
Sbjct: 1530 YNYTPLHIASWNGHEKVVEILIREKANIEALGQE-NWTPLHLACRNGHKEVVEILIRGKANIEALTQDNWTPLHKACQNGHAEVVEILVKEKANIDALAEKKFTPLHLACQNGHKEVVEILIGEKANIDALTEKKSTPLHLACQNGHKEVVEILVGEKANIEAL-NQDNWTPLHLACEKGHKEVVKIL 1715          

HSP 15 Score: 124.405 bits (311), Expect = 4.911e-28
Identity = 61/184 (33.15%), Postives = 109/184 (59.24%), Query Frame = 3
Query:  147 IHFACLKGDIDIVKVLIDHNCDIEVRNRKWNQQPIHMACWDGHLEILKVLLEKNCDIESCDEWKRRPIHLACENGHTEIVKFLINLHCDIEAINDKAWRPIHFGCWKGHSDIVKVLVEQNCDIEACDHLKRRPIHLACEKGHTEIVKVLIDHHCDISACG-GRFNQSPIHLARKNNFTELIQLL 695
            +H +   G   IV++L+D+  ++   +      P+H AC  G  E++++L+    +I++  + K  P+H AC+NG  E+V+ LI    +IEA+N   W P+H  C  GH ++V++L+++N +I+A    K  P+HLAC +GH E V++LI    +I A    +F  +P+H A +N   E++++L
Sbjct: 1172 LHISASSGHRPIVELLLDNGANVNAADTN-EYTPLHWACISGVKEVVEILIGGKANIDALAKNKSTPLHFACQNGRKEVVEILIREKANIEALNQHNWTPLHLACQNGHKEVVEILIKENANIDALTEHKYTPLHLACARGHKEAVQILIGEKANIDALDENKF--TPLHKACQNGHAEVVEIL 1352          

HSP 16 Score: 92.0485 bits (227), Expect = 3.157e-19
Identity = 39/120 (32.50%), Postives = 76/120 (63.33%), Query Frame = 3
Query:  144 PIHFACLKGDIDIVKVLIDHNCDIEVRNRKWNQQPIHMACWDGHLEILKVLLEKNCDIESCDEWKRRPIHLACENGHTEIVKFLINLHCDIEAINDKAWRPIHFGCWKGHSDIVKVLVEQ 503
            P+H AC  G  ++V++L+    +IE  N+  N  P+H+AC  GH E++K+L+ +  +I++  + K  P+HLAC+ GH E+V+  +  + +I A++D+   P++     GH+++ K++ E+
Sbjct: 1666 PLHLACQNGHKEVVEILVGEKANIEALNQD-NWTPLHLACEKGHKEVVKILIGEKANIDALTQKKNTPLHLACQRGHKEVVEIFLRKNANIAALDDEKCTPLNLASQNGHTEVEKIMKEK 1784          

HSP 17 Score: 32.3426 bits (72), Expect = 3.157e-19
Identity = 13/30 (43.33%), Postives = 22/30 (73.33%), Query Frame = 2
Query:    2 PIHLAFDNNHREIVKLLIEENCDVNAIGGK 91
            P+HLA  N H+E+V++LI E  +++A+  K
Sbjct: 1633 PLHLACQNGHKEVVEILIGEKANIDALTEK 1662          

HSP 18 Score: 87.0409 bits (214), Expect = 3.123e-15
Identity = 42/149 (28.19%), Postives = 84/149 (56.38%), Query Frame = 3
Query:  249 IHMACWDGHLEILKVLLEKNCDIESCDEWKRRPIHLACENGHTEIVKFLINLHCDIEAINDKAWRPIHFGCWKGHSDIVKVLVEQNCDIEACDHLKRRPIHLACEKGHTEIVKVLIDHHCDISACGGRFNQSPIHLARKNNFTELIQLL 695
            +H+A  DG +E +K L+    ++ +        +H++  +GH  IV+ L++   ++ A +   + P+H+ C  G  ++V++L+    +I+A    K  P+H AC+ G  E+V++LI    +I A   + N +P+HLA +N   E++++L
Sbjct: 1139 MHIAAGDGIIEEVKRLINNGANVNAPSVAGYTALHISASSGHRPIVELLLDNGANVNAADTNEYTPLHWACISGVKEVVEILIGGKANIDALAKNKSTPLHFACQNGRKEVVEILIREKANIEAL-NQHNWTPLHLACQNGHKEVVEIL 1286          
BLAST of SMED30015660 vs. TrEMBL
Match: A0A1X7T1N6 (ANK_REP_REGION domain-containing protein OS=Amphimedon queenslandica OX=400682 PE=4 SV=1)

HSP 1 Score: 148.673 bits (374), Expect = 2.379e-36
Identity = 80/193 (41.45%), Postives = 122/193 (63.21%), Query Frame = 3
Query:  141 RPIHFACLKGDIDIVK-VLIDHNCDIEVRNRKWNQQPIHMACWDGHLEILKVLLE-KNCDIESCDEWKRRPIHLACENGHTEIVKFL-INLHCDIEAINDKAWRPIHFGCWKGHSDIVKVLVEQ-NCDIEACDHLKRRPIHLACEKGHTEIV-KVLIDHHCDISACGGRFNQSPIHLARKNNFTELIQLLTIH 704
            RP+H AC  G++DIV  ++ID +CD+  +    N  P+H AC  GH EI+K+L +   C+ E+      RP+H ACE+G+ +IV+ L I+ HCD+ A     + P+H+ C KGH +IVK+L     C+IEA D+ + RP+H ACE G+ +IV  ++ID HCD +A  G  N +P+H A +    E++++LT H
Sbjct:  232 RPLHKACESGNVDIVHHLVIDKHCDVNAKAGWSNYTPLHCACEKGHFEIVKILTDHPQCNTEAKSNTNDRPLHKACESGNIDIVRHLVIDKHCDVNAKGRNGYTPLHYACEKGHFEIVKILTHHPQCNIEAEDNSQYRPLHKACESGNVDIVHHLVIDKHCDFNAKAGWSNYTPLHCACEKGHFEIVKILTDH 424          

HSP 2 Score: 133.65 bits (335), Expect = 3.405e-31
Identity = 76/191 (39.79%), Postives = 118/191 (61.78%), Query Frame = 3
Query:  141 RPIHFACLKGDIDIVK-VLIDHNCDIEVRNRKWNQQPIHMACWDGHLEILKVLLE-KNCDIESCDEWKRRPIHLACENGHTEIVKFL-INLHCDIEAINDKAWRPIHFGCWKGHSDIVKVLVEQ-NCDIEACDHLKRRPIHLACEKGHTEIV-KVLIDHHCDISACGGRFNQSPIHLARKNNFTELIQLLT 698
            RP+H AC  G+IDIV+ ++ID +C +  + R     P+H AC  GH E++K+L     C+ E+ +  + RP+H ACE G  +IV+ L I+ HCD+ A     + P+H  C KGH +IVK+L     C+ EA ++ + RP+H ACE G  +IV  ++ID HCD +A  GR + +P+H A +    E++++LT
Sbjct:  438 RPLHKACESGNIDIVRHLVIDKHCGVNAKGRNG-YTPLHYACEKGHFEVVKILTNHPQCNTEAENNSQYRPLHEACELGSVDIVRHLVIDKHCDVNAKGRSDYTPLHCACEKGHFEIVKILTNHPQCNTEAENNSQYRPLHKACELGSVDIVHHLVIDKHCDANA-KGRSDYTPLHCACEKGHFEIVKILT 626          

HSP 3 Score: 130.568 bits (327), Expect = 3.770e-30
Identity = 74/180 (41.11%), Postives = 111/180 (61.67%), Query Frame = 3
Query:  144 PIHFACLKGDIDIVKVLIDH-NCDIEVRNRKWNQQPIHMACWDGHLEILK-VLLEKNCDIESCDEWKRRPIHLACENGHTEIVKFLIN-LHCDIEAINDKAWRPIHFGCWKGHSDIVK-VLVEQNCDIEACDHLKRRPIHLACEKGHTEIVKVLIDH-HCDISACGGRFNQSPIHLARKN 668
            P+H+AC KG  ++VK+L +H  C+ E  N     +P+H AC  G ++I++ ++++K+CD+ +       P+H ACE GH EIVK L N   C+ EA N+  +RP+H  C  G  DIV  ++++++CD  A       P+H ACEKGH EIVK+L D   C+I A   ++N  PIHLA K+
Sbjct:  473 PLHYACEKGHFEVVKILTNHPQCNTEAENNSQ-YRPLHEACELGSVDIVRHLVIDKHCDVNAKGRSDYTPLHCACEKGHFEIVKILTNHPQCNTEAENNSQYRPLHKACELGSVDIVHHLVIDKHCDANAKGRSDYTPLHCACEKGHFEIVKILTDQPQCNIEA-EDKYNDRPIHLALKD 650          

HSP 4 Score: 109.768 bits (273), Expect = 4.435e-23
Identity = 73/211 (34.60%), Postives = 113/211 (53.55%), Query Frame = 3
Query:  144 PIHFACLKGDIDIVKVLIDH-NCDIEVRNRKWNQQPIHMACWDGHLEILKVLLEKNCD------IESCDEWKRRPIHL--------------ACENGHTEIVKFL-INLHCDIEAINDKAWRPIHFGCWKGHSDIVKVLVEQ-NCDIEACDHLKRRPIHLACEKGHTEIVK-VLIDHHCDISACGGRFNQSPIHLARKNNFTELIQLLTIH 704
            P+H AC  G + IV+ LI    C+IE ++ + NQ P+H A   GH EI+ +L +K         + S  +     I                ACE+G+ +I+  L I+ HCD+ A     + P+H  C KGH +IVK+L +   C+ EA  +   RP+H ACE G+ +IV  ++ID HCD++A  G  N +P+H A +    E++++LT H
Sbjct:   78 PLHKACYNGSLSIVEYLISKPQCNIEAKDNEGNQ-PLHYAACQGHKEIVSILGKKVSGDGLSKCMTSAKQLAEPDIMELLNDCFLDRISLINACESGNVDILHHLVIDKHCDVNAKGRSDYTPLHCACEKGHFEIVKILTDHPQCNTEAESNSNDRPLHKACESGNVDIVHHLVIDKHCDVNAKAGWSNYTPLHCACEKGHFEIVKILTDH 287          

HSP 5 Score: 78.9518 bits (193), Expect = 5.840e-13
Identity = 51/141 (36.17%), Postives = 78/141 (55.32%), Query Frame = 3
Query:  135 DRRPIHFACLKGDIDIVKVLIDH-NCDIEVRNRKWNQQPIHMACWDGHLEIL-KVLLEKNCDIESCDEWKRRPIHLACENGHTEIVKFLINL-HCDIEAINDKAWRPIHFGCW-KGHSDIVKVLVE-QNCDIEACDHLKRR 542
            D  P+H AC KG  +IVK+L +H  C+ E  N     +P+H AC  G ++I+  ++++K+CD  +       P+H ACE GH EIVK L +   C+IEA +    RPIH     K + +IV  LV+ + C+ +      R+
Sbjct:  538 DYTPLHCACEKGHFEIVKILTNHPQCNTEAENNSQ-YRPLHKACELGSVDIVHHLVIDKHCDANAKGRSDYTPLHCACEKGHFEIVKILTDQPQCNIEAEDKYNDRPIHLALKDKTYMNIVNYLVQVKGCNTQGISTYDRK 677          

HSP 6 Score: 24.2534 bits (51), Expect = 5.840e-13
Identity = 13/29 (44.83%), Postives = 21/29 (72.41%), Query Frame = 2
Query:    2 PIHLAFDNNHREIVK-LLIEENCDVNAIG 85
            P+H A +    +IV+ L+I+++CDVNA G
Sbjct:  507 PLHEACELGSVDIVRHLVIDKHCDVNAKG 535          
BLAST of SMED30015660 vs. Ensembl Cavefish
Match: ripk4 (receptor interacting serine/threonine kinase 4 [Source:NCBI gene;Acc:103022568])

HSP 1 Score: 108.612 bits (270), Expect = 4.872e-26
Identity = 63/224 (28.12%), Postives = 107/224 (47.77%), Query Frame = 3
Query:  138 RRPIHFACLKGDIDIVKVLIDHNCDIEVRNR-KWNQQPIHMACWDGHLEILKVLLEK---NCDIESCD------------EWK-------------------RRPIHLACENGHTEIVKFLINLHCDIEAINDKAWRPIHFGCWKGHSDIVKVLVEQNCDIEACDHLKRRPIHLACEKGHTEIVKVLIDHHCDISACGGRFNQSPIHLARKNNFTELIQLLTIH 704
            R PIH AC  G  ++V+VL+    D   R + +W    +H+A W GHL I+K+L+++   N D ++ D            +++                     P+H+A E GHT   + L+    DI++   +   P+H   WKGH   V++L+E+  +    +HL R P HLA E GH ++++ L+    +  A       +P+H+A +  + + I LL  H
Sbjct:  525 RTPIHVACHHGRENVVRVLLSRGADAHARGKDEWTA--LHLAAWQGHLGIVKLLVKQAGVNVDGQTVDGRAPLHLASQRGQYRVARVLVDLGADVSITSACLSTPLHVAAETGHTSTSRLLLKHGADIQSRTAQGLTPLHLAAWKGHQATVRMLLEEGANPHDTEHLLRTPCHLAAEGGHCQVMEELLQRWPEAVATPDESGLTPLHIAVRGGYRDAICLLLSH 746          

HSP 2 Score: 100.523 bits (249), Expect = 2.805e-23
Identity = 57/191 (29.84%), Postives = 96/191 (50.26%), Query Frame = 3
Query:  144 PIHFACLKGDIDIVKVLIDHNCDIEVRNRKWNQ-QPIHMACWDGHLEILKVLLEKNCDIESCDEWKRRPIHLACENGHTEIVKFLINLHCDIEAINDKAWRPIHFGCWKGHSDIVKVLVEQ---NCDIEACDHLKRRPIHLACEKGHTEIVKVLIDHHCDISACGGRFNQSPIHLARKNNFTELIQLLTIH 704
            P+H A  K    + ++L+       V  +  +Q  P+H A  +G   + ++LL++   +   D   R PIH+AC +G   +V+ L++   D  A     W  +H   W+GH  IVK+LV+Q   N D +  D   R P+HLA ++G   + +VL+D   D+S      + +P+H+A +   T   +LL  H
Sbjct:  460 PLHLAVEKRLKSVAEILLGRKS-TNVNAKDEDQYTPLHFAAQNGDEALTRLLLDRAATMNEADAQGRTPIHVACHHGRENVVRVLLSRGADAHARGKDEWTALHLAAWQGHLGIVKLLVKQAGVNVDGQTVD--GRAPLHLASQRGQYRVARVLVDLGADVSITSACLS-TPLHVAAETGHTSTSRLLLKH 646          

HSP 3 Score: 66.6254 bits (161), Expect = 7.021e-12
Identity = 40/149 (26.85%), Postives = 69/149 (46.31%), Query Frame = 3
Query:  252 HMACWDGHLEILKVLLEKNCDIESCDEWKRRPIHLACENGHTEIVKFLINL-HCDIEAINDKAWRPIHFGCWKGHSDIVKVLVEQNCDIEACDHLKRRPIHLACEKGHTEIVKVLIDHHCDISACGGRFNQSPIHLARKNNFTELIQLL 695
            H A    + E +K LL  NC     D     P+HLA E     + + L+     ++ A ++  + P+HF    G   + ++L+++   +   D   R PIH+AC  G   +V+VL+    D  A  G+   + +HLA       +++LL
Sbjct:  429 HYAVSLANEEAVKFLLLNNCSANLPDSRGSTPLHLAVEKRLKSVAEILLGRKSTNVNAKDEDQYTPLHFAAQNGDEALTRLLLDRAATMNEADAQGRTPIHVACHHGRENVVRVLLSRGADAHA-RGKDEWTALHLAAWQGHLGIVKLL 576          
BLAST of SMED30015660 vs. Ensembl Cavefish
Match: ripk4 (receptor interacting serine/threonine kinase 4 [Source:NCBI gene;Acc:103022568])

HSP 1 Score: 108.227 bits (269), Expect = 5.197e-26
Identity = 63/224 (28.12%), Postives = 107/224 (47.77%), Query Frame = 3
Query:  138 RRPIHFACLKGDIDIVKVLIDHNCDIEVRNR-KWNQQPIHMACWDGHLEILKVLLEK---NCDIESCD------------EWK-------------------RRPIHLACENGHTEIVKFLINLHCDIEAINDKAWRPIHFGCWKGHSDIVKVLVEQNCDIEACDHLKRRPIHLACEKGHTEIVKVLIDHHCDISACGGRFNQSPIHLARKNNFTELIQLLTIH 704
            R PIH AC  G  ++V+VL+    D   R + +W    +H+A W GHL I+K+L+++   N D ++ D            +++                     P+H+A E GHT   + L+    DI++   +   P+H   WKGH   V++L+E+  +    +HL R P HLA E GH ++++ L+    +  A       +P+H+A +  + + I LL  H
Sbjct:  534 RTPIHVACHHGRENVVRVLLSRGADAHARGKDEWTA--LHLAAWQGHLGIVKLLVKQAGVNVDGQTVDGRAPLHLASQRGQYRVARVLVDLGADVSITSACLSTPLHVAAETGHTSTSRLLLKHGADIQSRTAQGLTPLHLAAWKGHQATVRMLLEEGANPHDTEHLLRTPCHLAAEGGHCQVMEELLQRWPEAVATPDESGLTPLHIAVRGGYRDAICLLLSH 755          

HSP 2 Score: 100.138 bits (248), Expect = 3.134e-23
Identity = 57/191 (29.84%), Postives = 96/191 (50.26%), Query Frame = 3
Query:  144 PIHFACLKGDIDIVKVLIDHNCDIEVRNRKWNQ-QPIHMACWDGHLEILKVLLEKNCDIESCDEWKRRPIHLACENGHTEIVKFLINLHCDIEAINDKAWRPIHFGCWKGHSDIVKVLVEQ---NCDIEACDHLKRRPIHLACEKGHTEIVKVLIDHHCDISACGGRFNQSPIHLARKNNFTELIQLLTIH 704
            P+H A  K    + ++L+       V  +  +Q  P+H A  +G   + ++LL++   +   D   R PIH+AC +G   +V+ L++   D  A     W  +H   W+GH  IVK+LV+Q   N D +  D   R P+HLA ++G   + +VL+D   D+S      + +P+H+A +   T   +LL  H
Sbjct:  469 PLHLAVEKRLKSVAEILLGRKS-TNVNAKDEDQYTPLHFAAQNGDEALTRLLLDRAATMNEADAQGRTPIHVACHHGRENVVRVLLSRGADAHARGKDEWTALHLAAWQGHLGIVKLLVKQAGVNVDGQTVD--GRAPLHLASQRGQYRVARVLVDLGADVSITSACLS-TPLHVAAETGHTSTSRLLLKH 655          

HSP 3 Score: 66.2402 bits (160), Expect = 9.461e-12
Identity = 40/149 (26.85%), Postives = 69/149 (46.31%), Query Frame = 3
Query:  252 HMACWDGHLEILKVLLEKNCDIESCDEWKRRPIHLACENGHTEIVKFLINL-HCDIEAINDKAWRPIHFGCWKGHSDIVKVLVEQNCDIEACDHLKRRPIHLACEKGHTEIVKVLIDHHCDISACGGRFNQSPIHLARKNNFTELIQLL 695
            H A    + E +K LL  NC     D     P+HLA E     + + L+     ++ A ++  + P+HF    G   + ++L+++   +   D   R PIH+AC  G   +V+VL+    D  A  G+   + +HLA       +++LL
Sbjct:  438 HYAVSLANEEAVKFLLLNNCSANLPDSRGSTPLHLAVEKRLKSVAEILLGRKSTNVNAKDEDQYTPLHFAAQNGDEALTRLLLDRAATMNEADAQGRTPIHVACHHGRENVVRVLLSRGADAHA-RGKDEWTALHLAAWQGHLGIVKLL 585          
BLAST of SMED30015660 vs. Ensembl Cavefish
Match: ank1a (ankyrin 1, erythrocytic a [Source:ZFIN;Acc:ZDB-GENE-041010-44])

HSP 1 Score: 97.8265 bits (242), Expect = 2.064e-22
Identity = 50/184 (27.17%), Postives = 96/184 (52.17%), Query Frame = 3
Query:  144 PIHFACLKGDIDIVKVLIDHNCDIEVRNRKWNQQPIHMACWDGHLEILKVLLEKNCDIESCDEWKRRPIHLACENGHTEIVKFLINLHCDIEAINDKAWRPIHFGCWKGHSDIVKVLVEQNCDIEACDHLKRRPIHLACEKGHTEIVKVLIDHHCDISACGGRFNQSPIHLARKNNFTELIQLL 695
            P+H AC K  + ++ +L+ H+  +E         P+H+A + GHL I+K+LL+K     + +     P+H+A   GH E+ +FL+     ++A        +H     GH ++VK+L+E   +  +       P+H+A  +GHT+ V++L+D +   +    +   +P+H+A K    ++ +LL
Sbjct:  346 PLHIACKKNHLRVMDLLLKHSASLEAVTES-GLTPLHVASFMGHLNIVKILLQKGASPNASNVKVETPLHMASRAGHCEVAEFLLQNAAPVDAKAKDDQTSLHCAARMGHKELVKLLLEHKANPNSTTTAGHTPLHIAAREGHTQTVRILLDMNAQQTKMTKK-GFTPLHVAAKYGKVDVAELL 527          

HSP 2 Score: 87.0409 bits (214), Expect = 1.073e-18
Identity = 52/191 (27.23%), Postives = 99/191 (51.83%), Query Frame = 3
Query:  144 PIHFACLKGDIDIVKVLIDHNCDIEVRNRKWNQQPIHMACWDGHLEILKVLLEKNCDIESCDEWKRRPIHLACENGHTEIVKFLINLHCDIEAINDKAWRPIHFGCWKGHSDIVKVLVEQNCDIE--ACDHLKRRPIHLACEKGHTEIVKVLIDHHC--DISACGGRFNQSPIHLARKNNFTELIQLLTIH 704
            P+H A    ++++ ++L++   ++    +     P+H+A   G++ ++++LL++   I++  + +  P+H A  NGH  I++ L++    I+A       PIH      H D V+ L++ N +I+    DHL   P+H+A   GH  + KVL+D     +  A  G    +P+H+A K N   ++ LL  H
Sbjct:  181 PLHIAAHYENLNVAQLLLNRGANVNFTPKN-GITPLHIASRRGNVIMVRLLLDRGATIDAKTKDELTPLHCAARNGHVRIIEILLDQGAPIQAKTKNGLSPIHMAAQGDHMDCVRQLLQYNAEIDDITLDHLT--PLHVAAHCGHHRMAKVLLDKGAKPNTRALNGF---TPLHIACKKNHLRVMDLLLKH 365          

HSP 3 Score: 83.9593 bits (206), Expect = 1.153e-17
Identity = 44/180 (24.44%), Postives = 89/180 (49.44%), Query Frame = 3
Query:  144 PIHFACLKGDIDIVKVLIDHNCDIEVRNRKWNQQPIHMACWDGHLEILKVLLEKNCDIESCDEWKRRPIHLACENGHTEIVKFLINLHCDIEAINDKAWRPIHFGCWKGHSDIVKVLVEQNCDIEACDHLKRRPIHLACEKGHTEIVKVLIDHHCDISACGGRFNQSPIHLARKNNFTEL 683
            P+H A   G  ++ + L+ +   ++ + +  +Q  +H A   GH E++K+LLE   +  S       P+H+A   GHT+ V+ L++++     +  K + P+H     G  D+ ++L+E+  +  A       P+H+A    + ++V +L+       +   R   +P+H+A K N  E+
Sbjct:  412 PLHMASRAGHCEVAEFLLQNAAPVDAKAKD-DQTSLHCAARMGHKELVKLLLEHKANPNSTTTAGHTPLHIAAREGHTQTVRILLDMNAQQTKMTKKGFTPLHVAAKYGKVDVAELLLERGANPNAAGKNGLTPLHVAVHHNNLDVVNLLVSKGGSPHS-AARNGYTPLHIASKQNQVEV 589          

HSP 4 Score: 24.6386 bits (52), Expect = 1.153e-17
Identity = 8/27 (29.63%), Postives = 17/27 (62.96%), Query Frame = 2
Query:    2 PIHLAFDNNHREIVKLLIEENCDVNAI 82
            P+H+A   NH  ++ LL++ +  + A+
Sbjct:  346 PLHIACKKNHLRVMDLLLKHSASLEAV 372          

HSP 5 Score: 79.7221 bits (195), Expect = 3.486e-16
Identity = 42/189 (22.22%), Postives = 91/189 (48.15%), Query Frame = 3
Query:  144 PIHFACLKGDIDIVKVLIDHNCDIEVRNRKWNQQPIHMACWDGHLEILKVLLEKNCDIESCDEWKRRPIHLACENGHTEIVKFLINLHCDIEAINDKAWRPIHFGCWKGHSDIVKVLVEQNCDIEACDHLKRRPIHLACEKGHTEIVKVLIDHHC---DISACGGRFNQSPIHLARKNNFTELIQLLTI 701
            P+H A  +  +++   L+ +       + +    P+H+A  +G  +++ +L+ K  ++   ++    P+HL  + GH  I   L+     + A     + P+H  C  G+  +VK L++Q  ++         P+H A ++GHT+IV +L+ H     +I+  G     S + +A++  +  +I +L +
Sbjct:  577 PLHIASKQNQVEVASSLLQYGASANAESLQ-GVTPLHLAAQEGRADMVSLLISKQANVNLGNKSGLTPLHLVAQEGHVGIADILVKQGASVYAATRMGYTPLHVACHYGNIKMVKFLLQQQANVNGKTRAGYTPLHQAAQQGHTDIVTLLLKHGAQPNEITTNG----TSALAIAKRLGYISVIDVLKL 760          

HSP 6 Score: 72.0182 bits (175), Expect = 3.843e-14
Identity = 38/184 (20.65%), Postives = 85/184 (46.20%), Query Frame = 3
Query:  144 PIHFACLKGDIDIVKVLIDHNCDIEVRNRKWNQQPIHMACWDGHLEILKVLLEKNCDIESCDEWKRRPIHLACENGHTEIVKFLINLHCDIEAINDKAWRPIHFGCWKGHSDIVKVLVEQNCDIEACDHLKRRPIHLACEKGHTEIVKVLIDHHCDISACGGRFNQSPIHLARKNNFTELIQLL 695
            P+H A   G +D+ ++L++   +     +     P+H+A    +L+++ +L+ K     S       P+H+A +    E+   L+       A + +   P+H    +G +D+V +L+ +  ++   +     P+HL  ++GH  I  +L+     + A   R   +P+H+A      ++++ L
Sbjct:  511 PLHVAAKYGKVDVAELLLERGANPNAAGKN-GLTPLHVAVHHNNLDVVNLLVSKGGSPHSAARNGYTPLHIASKQNQVEVASSLLQYGASANAESLQGVTPLHLAAQEGRADMVSLLISKQANVNLGNKSGLTPLHLVAQEGHVGIADILVKQGASVYA-ATRMGYTPLHVACHYGNIKMVKFL 692          

HSP 7 Score: 24.6386 bits (52), Expect = 3.843e-14
Identity = 10/25 (40.00%), Postives = 16/25 (64.00%), Query Frame = 2
Query:    5 IHLAFDNNHREIVKLLIEENCDVNA 79
            +H A    H+E+VKLL+E   + N+
Sbjct:  446 LHCAARMGHKELVKLLLEHKANPNS 470          

HSP 8 Score: 68.5514 bits (166), Expect = 9.478e-13
Identity = 40/187 (21.39%), Postives = 86/187 (45.99%), Query Frame = 3
Query:  135 DRRPIHFACLKGDIDIVKVLIDHNCDIEVRNRKWNQQPIHMACWDGHLEILKVLLEKNCDIESCDEWKRRPIHLACENGHTEIVKFLINLHCDIEAINDKAWRPIHFGCWKGHSDIVKVLVEQNCDIEACDHLKRRPIHLACEKGHTEIVKVLIDHHCDISACGGRFNQSPIHLARKNNFTELIQLL 695
            D+  +H A   G  ++VK+L++H  +           P+H+A  +GH + +++LL+ N       +    P+H+A + G  ++ + L+    +  A       P+H      + D+V +LV +     +       P+H+A ++   E+   L+ +    +A   +   +P+HLA +    +++ LL
Sbjct:  442 DQTSLHCAARMGHKELVKLLLEHKANPNSTTTA-GHTPLHIAAREGHTQTVRILLDMNAQQTKMTKKGFTPLHVAAKYGKVDVAELLLERGANPNAAGKNGLTPLHVAVHHNNLDVVNLLVSKGGSPHSAARNGYTPLHIASKQNQVEVASSLLQYGASANAESLQ-GVTPLHLAAQEGRADMVSLL 626          

HSP 9 Score: 23.483 bits (49), Expect = 9.478e-13
Identity = 10/26 (38.46%), Postives = 16/26 (61.54%), Query Frame = 2
Query:    2 PIHLAFDNNHREIVKLLIEENCDVNA 79
            P+H+A    H  IVK+L+++    NA
Sbjct:  379 PLHVASFMGHLNIVKILLQKGASPNA 404          

HSP 10 Score: 60.4622 bits (145), Expect = 8.284e-10
Identity = 43/193 (22.28%), Postives = 88/193 (45.60%), Query Frame = 3
Query:  147 IHFACLKGDIDIVKVLIDHNCDIEVRNRKWNQQPIHMACWDGHLEILKVLLEKNCDIESCDEWKRR----------PIHLACENGHTEIVKFLINLHCDIEAINDKAWRPIHFGCWKGHSDIVKVLVEQNCDIEACDHLKRRPIHLACEKGHTEIVKVLIDHHCDISACGGRFNQSPIHLARKNNFTELIQLL 695
            +H A L G   +V  L+++  ++  +++K    P++MA  + HLE++K LLE   +     E K            P++L+    H       I L      I    + P+H      + ++ ++L+ +  ++         P+H+A  +G+  +V++L+D    I A   +   +P+H A +N    +I++L
Sbjct:   80 LHIAALAGQEQVVTELVNYGANVNAQSQK-GFTPLYMAAQENHLEVVKFLLENGANQSIPTEVKPSAVSLANSYSFPLYLSTNASH-------ITLKNVCSFITATGFTPLHIAAHYENLNVAQLLLNRGANVNFTPKNGITPLHIASRRGNVIMVRLLLDRGATIDA-KTKDELTPLHCAARNGHVRIIEIL 263          

HSP 11 Score: 50.0618 bits (118), Expect = 1.660e-6
Identity = 42/186 (22.58%), Postives = 82/186 (44.09%), Query Frame = 3
Query:  156 ACLKGDIDIVKVLIDHNCDIEVRNRKWNQQPIHMACWDGHLEILKVLLEKNCDIESCDEWKRRPIHLACENGHTEIVKFLINLHCDIEAINDKAWRPIHFGCWKGHSDIVKVLVEQNCDIEACDHLKRRPIHLACEKG-----HTEIVKVLIDHHCD-ISACGGRFNQSPIHLARKNNFTELIQLL 695
            A   G++D     I +  DI   N+      +H+A  +GH++++  LL     +E+  +     +H+A   G  ++V  L+N   ++ A + K + P++    + H ++VK L+E   +      +K   + LA          T    + + + C  I+A G     +P+H+A       + QLL
Sbjct:   17 AARSGNLDKALDHIKNGIDINTANQN-GLNGLHLASKEGHVKMVLELLHNGVVLETTTKKGNTALHIAALAGQEQVVTELVNYGANVNAQSQKGFTPLYMAAQENHLEVVKFLLENGANQSIPTEVKPSAVSLANSYSFPLYLSTNASHITLKNVCSFITATGF----TPLHIAAHYENLNVAQLL 197          
BLAST of SMED30015660 vs. Ensembl Cavefish
Match: ANKRD28 (ankyrin repeat domain 28 [Source:HGNC Symbol;Acc:HGNC:29024])

HSP 1 Score: 97.8265 bits (242), Expect = 2.075e-22
Identity = 51/188 (27.13%), Postives = 94/188 (50.00%), Query Frame = 3
Query:  135 DRRPIHFACLKGDIDIVKVLIDHNCDIEVRNRKWNQQPIHMACWDGHLEILKVLLEKNCDIESCDEWKRRPIHLACENGHTEIVKFLINLHCDIEAINDKAWRPIHFGCWKGHSDI-VKVLVEQNCDIEACDHLKRRPIHLACEKGHTEIVKVLIDHHCDISACGGRFNQSPIHLARKNNFTELIQLL 695
            DRR IH+A   G +++V++L+ H  ++  +++K    P+H A   G + ++K LL+   DI   + +   P+H+AC NG   +V  LI    ++  +N+K + P+HF        + +++LV    D+       + P+H+A   G     + +I    +I  C  +   SP+H+A +     LI  L
Sbjct:   19 DRRAIHWAAYMGHMEVVRLLVSHGTEVTCKDKKA-YTPLHAAASSGMISVVKYLLDLGVDINEPNAYGNTPLHVACYNGQDVVVNELIEAGANVNQVNEKGFAPLHFTAASRQGALCLELLVGNGADVNIKSKDGKTPLHMAAIHGRFSRSQAVIQSGAEID-CEDKNGNSPLHIAARYGHELLINTL 204          

HSP 2 Score: 82.8037 bits (203), Expect = 2.692e-17
Identity = 48/159 (30.19%), Postives = 80/159 (50.31%), Query Frame = 3
Query:  144 PIHFACLKGDIDIVKVLIDHNCDIEVRNRKWNQQPIHMACWDGHLEILKVLL---EKNCDIESCDEWKRRPIHLACENGHTEIVKFLINLHCDIEAINDKAWRPIHFGCWKGHSDIVKVLVEQNCDIEACDHLKRRPIHLACEKGHT---EIVKVLIDH 602
            P+  A  KG ++ V VLI     I +++    + PIH A  +GHLE L++L+   + +  ++  D   + P+ LA  NGHT+ V FL++    +EA +      +H G   GH   V+ L++ +  +   D   R  +HLA   GH      V V++D+
Sbjct:  414 PLDLAAFKGHVECVDVLITQGASILLKDYSQKRTPIHAAAMNGHLECLRLLIGNADPHAAVDVQDGSGQTPLMLAVLNGHTDCVYFLLSKGASVEAKDKWGRTALHRGAVTGHEACVEALLQHSASLPVRDSRGRTAMHLAAACGHIGSLNTVPVIMDN 572          

HSP 3 Score: 78.9518 bits (193), Expect = 5.402e-16
Identity = 38/161 (23.60%), Postives = 84/161 (52.17%), Query Frame = 3
Query:  180 IVKVLIDHNCDIEVRNRKWNQQPIHMACWDGHLEILKVLLEKNCDIESCDEWKRRPIHLACENGHTEIVKFLINLHCDIEAINDKAWRPIHFGCWKGHSDIVKVLVEQNCDIEACDHLKRRPIHLACEKGHTEI-VKVLIDHHCDISACGGRFNQSPIHLA 659
            +VK+L+    +I   ++K +++ IH A + GH+E++++L+    ++   D+    P+H A  +G   +VK+L++L  DI   N     P+H  C+ G   +V  L+E   ++   +     P+H         + +++L+ +  D++    +  ++P+H+A
Sbjct:    1 MVKLLLSRGANINAFDKK-DRRAIHWAAYMGHMEVVRLLVSHGTEVTCKDKKAYTPLHAAASSGMISVVKYLLDLGVDINEPNAYGNTPLHVACYNGQDVVVNELIEAGANVNQVNEKGFAPLHFTAASRQGALCLELLVGNGADVN-IKSKDGKTPLHMA 159          

HSP 4 Score: 72.0182 bits (175), Expect = 1.144e-13
Identity = 51/191 (26.70%), Postives = 90/191 (47.12%), Query Frame = 3
Query:  144 PIHFACLKGDIDIVKVLIDHNCDIEVRNRKWNQQPIHMACW---DGHLEILKVLLEKNCDIESCDEWKRRPIHLACENGHTEIVKFLINLHCDIEAINDKAWRPIHFGCWKGHSDIVKVLVEQ-NCDIEACDHLKRRPIHLACEKGHTEIVKVLIDHHCD---ISACGGRFNQSPIHLARKNNFTELIQLL 695
            P+H+AC  G    V+ L++     ++    ++  P+H A     +G  E+L   L     + + D   R P+H A    H E ++ L+  +  + AI+     P+      G ++ V+VLV +   D+   D  K   +HLAC KGH     ++++   D   I+A      Q+P+H+A +N  T ++Q L
Sbjct:  577 PLHWACYNGHDTCVEALLEQEVFHKMEGNSFS--PLHCAVISDNEGAAELLIDTLGPAI-VNATDSKSRTPLHAAAYTDHVECLQLLLGHNAQVNAIDALGKTPLMMAAENGQTNAVEVLVSRAKADLTLQDANKNSALHLACSKGHETSALLILEKVSDRNLINATNAAL-QTPLHVAARNGLTVVVQEL 763          

HSP 5 Score: 70.8626 bits (172), Expect = 2.224e-13
Identity = 43/165 (26.06%), Postives = 78/165 (47.27%), Query Frame = 3
Query:  141 RPIHFACLKGDIDIVKVLIDH-NCDIEVRNRKWNQQPIHMACWDGHLEILKVLLEKNCDIESCDEWKRRPIHLACENGHTEIVKFLIN-LHCDIEAINDKAWRPIHFGCWKGHSDIVKVLVEQNCD---IEACDHLKRRPIHLACEKGHTEIVKVLIDHHCDISA 620
             P+H A +  +    ++LID     I       ++ P+H A +  H+E L++LL  N  + + D   + P+ +A ENG T  V+ L++    D+   +      +H  C KGH     +++E+  D   I A +   + P+H+A   G T +V+ L+     + A
Sbjct:  608 SPLHCAVISDNEGAAELLIDTLGPAIVNATDSKSRTPLHAAAYTDHVECLQLLLGHNAQVNAIDALGKTPLMMAAENGQTNAVEVLVSRAKADLTLQDANKNSALHLACSKGHETSALLILEKVSDRNLINATNAALQTPLHVAARNGLTVVVQELLGKGASVLA 772          

HSP 6 Score: 57.7658 bits (138), Expect = 5.436e-9
Identity = 37/146 (25.34%), Postives = 64/146 (43.84%), Query Frame = 3
Query:  135 DRRPIHFACLKGDIDIVKVLIDHNCDIEVRNRKWNQQPIHMACWDGHLEILKVLLEK-NCDIESCDEWKRRPIHLACENGHTEIVKFLINLHCD---IEAINDKAWRPIHFGCWKGHSDIVKVLVEQNCDIEACDHLKRRPIHLAC 560
             R P+H A     ++ +++L+ HN  +   +    + P+ MA  +G    ++VL+ +   D+   D  K   +HLAC  GH      ++    D   I A N     P+H     G + +V+ L+ +   + A D     P  LAC
Sbjct:  641 SRTPLHAAAYTDHVECLQLLLGHNAQVNAID-ALGKTPLMMAAENGQTNAVEVLVSRAKADLTLQDANKNSALHLACSKGHETSALLILEKVSDRNLINATNAALQTPLHVAARNGLTVVVQELLGKGASVLAVDENGYTPA-LAC 784          

HSP 7 Score: 55.4546 bits (132), Expect = 6.744e-9
Identity = 29/136 (21.32%), Postives = 61/136 (44.85%), Query Frame = 3
Query:  144 PIHF-ACLKGDIDIVKVLIDHNCDIEVRNRKWNQQPIHMACWDGHLEILKVLLEKNCDIESCDEWKRRPIHLACENGHTEIVKFLINLHCDIEAINDKAWRPIHFGCWKGHSDIVKVLVEQNCDIEACDHLKRRPI 548
            P+HF A  +     +++L+ +  D+ ++++   + P+HMA   G     + +++   +I+  D+    P+H+A   GH  ++  LI    +          P+H     G SD  + L+    D++  D   R  +
Sbjct:  121 PLHFTAASRQGALCLELLVGNGADVNIKSKD-GKTPLHMAAIHGRFSRSQAVIQSGAEIDCEDKNGNSPLHIAARYGHELLINTLITNGANTAKRGIHGMFPLHLAALSGFSDCCRKLLSSGFDVDTPDDFGRTSL 255          

HSP 8 Score: 23.0978 bits (48), Expect = 6.744e-9
Identity = 11/30 (36.67%), Postives = 16/30 (53.33%), Query Frame = 2
Query:    2 PIHLAFDNNHREIVKLLIEENCDVNAIGGK 91
            P+H+A  N    +V  LIE   +VN +  K
Sbjct:   88 PLHVACYNGQDVVVNELIEAGANVNQVNEK 117          

HSP 9 Score: 54.299 bits (129), Expect = 6.821e-8
Identity = 53/206 (25.73%), Postives = 84/206 (40.78%), Query Frame = 3
Query:  126 F*WDRRPIHFACLKGDIDIVKVLIDHNC---DIEVRNRKWNQQPIHMACW-DGHLEILKVLLEKNCDIESCDEWKRRPIHLACENGH---TEIVKFLINLHCDIEA-----INDKAWR----PIHFGCWKGHSDIVKVLVEQNCDIEACDHLKRRPIHLACEKGHTEIVKVLIDHHCDISACGGRFNQSPIHLARKNNFTELIQLL 695
            F     P+H+A    +   +  L+       D++VR       P+H A   D   + L+ LL  + +    D+     +H A   GH    E++     L   +E      +ND   +    P+H   + GH   ++VLV+   D++        P+ LA  KGH E V VLI     I        ++PIH A  N   E ++LL
Sbjct:  263 FFLSLTPLHYAAANCNYQCLFALVGSGASVNDMDVRG----CTPLHYAAASDTDAKCLEYLLRNDANPGIRDKQGYNAVHYASAYGHRLCLELITSETPLDVLMETSGTDILNDTDGQTPISPLHLAAYHGHHPALEVLVQSLLDLDVRTVQGHTPLDLAAFKGHVECVDVLITQGASILLKDYSQKRTPIHAAAMNGHLECLRLL 464          
BLAST of SMED30015660 vs. Ensembl Cavefish
Match: ankk1 (ankyrin repeat and kinase domain containing 1 [Source:NCBI gene;Acc:103036669])

HSP 1 Score: 97.0561 bits (240), Expect = 3.143e-22
Identity = 50/172 (29.07%), Postives = 86/172 (50.00%), Query Frame = 3
Query:  144 PIHFACLKGDIDIVKVLIDHNCDIEVRNRKWNQQPIHMACWDGHLEILKVLLEKNCDIESCDEWKRRPIHLACENGHTEIVKFLINLHCDIEAINDKAWRPIHFGCWKGHSDIVKVLVEQNCDIEACDHLKRRPIHLACEKGHTEIVKVLIDHHCDISACGGRFNQSPIHLA 659
            P+H A   G   +V++L+     ++ +     +  +HMAC  G+L I K+LL K  D    D  +   +HLA E GH  + + L+    D+  +N   +  +HF   +G + I ++L+    +     + K  P+HLA  KGH E V +L ++   + A  G+   +P+HLA
Sbjct:  460 PLHLAAQNGHEGVVRLLLPRLVSVDEQEETSGRTSLHMACMYGYLNIAKLLLAKGADPNMTDSDQATALHLAAEEGHFRVARLLVTKGADVNRVNGSNYSALHFAALRGCTGICRLLMNHGANPNFTTNQKWTPMHLAALKGHPETVLILEENKGSMDA-RGQGGWTPLHLA 630          

HSP 2 Score: 96.2857 bits (238), Expect = 4.003e-22
Identity = 56/185 (30.27%), Postives = 97/185 (52.43%), Query Frame = 3
Query:  147 IHFACLKGDIDIVKVLIDHNCDIE-VRNRKWNQQPIHMACWDGHLEILKVLLEKNCDIESCDEWKRRPIHLACENGHTEIVKFLINLHCDIEAINDKAWRPIHFGCWKGHSDIVKVLVEQNCDIEACDHLKRRPIHLACEKGHTEIVKVLIDHHCDISACGGRFNQSPIHLA-RKNNFTELIQLL 695
            +HFA L+G   I ++L++H  +     N+KW   P+H+A   GH E + +L E    +++  +    P+HLAC +   E+V  L+    +     D +W P+H  C KG       L+ ++ D+ A ++ K  P+HLA + G   IVK L+ +  +  A   R  Q+ + LA ++ N  +++QLL
Sbjct:  561 LHFAALRGCTGICRLLMNHGANPNFTTNQKWT--PMHLAALKGHPETVLILEENKGSMDARGQGGWTPLHLACHHMQEEVVAVLLTAGANPNLKEDGSWTPLHLACNKGAFPSTLQLIAKHADVNAQNNSKDTPLHLAVQAGSAPIVKALLMNGVEKHAINSR-GQTALALAQQQQNNEDIVQLL 742          

HSP 3 Score: 27.335 bits (59), Expect = 4.003e-22
Identity = 10/28 (35.71%), Postives = 17/28 (60.71%), Query Frame = 2
Query:    5 IHLAFDNNHREIVKLLIEENCDVNAIGG 88
            +HLA +  H  + +LL+ +  DVN + G
Sbjct:  528 LHLAAEEGHFRVARLLVTKGADVNRVNG 555          

HSP 4 Score: 88.1965 bits (217), Expect = 3.621e-19
Identity = 51/190 (26.84%), Postives = 89/190 (46.84%), Query Frame = 3
Query:  138 RRPIHFACLKGDIDIVKVLIDHNCDIEVRNRKWNQQPIHMACWDGHLEILKVLLEKNCDIESCDEWKRRPIHLACENGHTEIVKFLINLHCDIEAINDKAWRPIHFGCWKGHSDIVKVLVEQNCDIEACDHLKRRPIHLACEKGHTEIVKVLIDHHCDISACGGRFNQSPIHLA-RKNNFTELIQLLTIH 704
            R  +H AC+ G ++I K+L+    D  + +       +H+A  +GH  + ++L+ K  D+   +      +H A   G T I + L+N   +     ++ W P+H    KGH + V +L E    ++A       P+HLAC     E+V VL+    + +      + +P+HLA  K  F   +QL+  H
Sbjct:  492 RTSLHMACMYGYLNIAKLLLAKGADPNMTDSD-QATALHLAAEEGHFRVARLLVTKGADVNRVNGSNYSALHFAALRGCTGICRLLMNHGANPNFTTNQKWTPMHLAALKGHPETVLILEENKGSMDARGQGGWTPLHLACHHMQEEVVAVLLTAGANPN-LKEDGSWTPLHLACNKGAFPSTLQLIAKH 679          

HSP 5 Score: 68.5514 bits (166), Expect = 1.361e-12
Identity = 44/152 (28.95%), Postives = 74/152 (48.68%), Query Frame = 3
Query:  144 PIHFACLKGDIDIVKVLIDHNCDIEVRNRK-WNQQPIHMACWDGHLEILKVLLEKNCDIESCDEWKRRPIHLACENGHTEIVKFLINLHCDIEAINDKAWRPIHFGCWKGHSDIVKVLVEQNCDIEACDHLKRRPIHLACEKGHTE-IVKVL 593
            P+H A LKG  + V +L ++   ++ R +  W   P+H+AC     E++ VLL    +    ++    P+HLAC  G       LI  H D+ A N+    P+H     G + IVK L+    +  A +   +  + LA ++ + E IV++L
Sbjct:  593 PMHLAALKGHPETVLILEENKGSMDARGQGGWT--PLHLACHHMQEEVVAVLLTAGANPNLKEDGSWTPLHLACNKGAFPSTLQLIAKHADVNAQNNSKDTPLHLAVQAGSAPIVKALLMNGVEKHAINSRGQTALALAQQQQNNEDIVQLL 742          

HSP 6 Score: 67.3958 bits (163), Expect = 3.606e-12
Identity = 40/188 (21.28%), Postives = 88/188 (46.81%), Query Frame = 3
Query:  135 DRRPIHFACLKGDIDIVKVLIDHNCDIEVRNRKWNQQPIHMACWDGHLEILKVLLEKNCDIESCDEWKRRPIHLACENGHTEIVKFLINLHCDIEAINDKAWRPIHFGCWKGHSDIVKVLVEQNCDIEACDHLK-RRPIHLACEKGHTEIVKVLIDHHCDISACGGRFNQSPIHLARKNNFTELIQLL 695
            D   +H A   GD++ V+++++    +  ++ +    P+ +A    + +I  +L++   D+   D     P+H A + G+   V+ L++     +A +   W P+H     GH  +V++L+ +   ++  +    R  +H+AC  G+  I K+L+    D +        + +HLA +     + +LL
Sbjct:  358 DNSLLHHAAASGDVESVQMVLNMGALVNCQSVR-GYTPLIVALLRTYYDICALLIDHGADVNLGDHDLWTPLHFAVQAGNDRAVRMLLDHKATADAKDKDGWTPLHLAAQNGHEGVVRLLLPRLVSVDEQEETSGRTSLHMACMYGYLNIAKLLLAKGADPNMTDSD-QATALHLAAEEGHFRVARLL 543          
BLAST of SMED30015660 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000000095.1 (pep scaffold:Pmarinus_7.0:GL477582:20897:60453:1 gene:ENSPMAG00000000080.1 transcript:ENSPMAT00000000095.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 101.679 bits (252), Expect = 2.220e-24
Identity = 47/173 (27.17%), Postives = 84/173 (48.55%), Query Frame = 3
Query:  144 PIHFACLKGDIDIVKVLIDHNCDIEVRNRKWNQQPIHMACWDGHLEILKVLLEKNCDIESCDEWKRRPIHLACENGHTEIVKFLINLHCDIEAINDKAWRPIHFGCWKGHSDIVKVLVEQNCDIEACDHLKRRPIHLACEKGHTEIVKVLIDHHCDISA-CGGRFNQSPIHLA 659
            PIH A   G +++V++L+ +       N +  + P+HMA   G LE++K LL+    +       + P+H+A   G  EIV+ L+    D  A       P++F   +GH D+  +L+E   DI         P+H+A + G  E+  +L++ +        G+   +P+H+A
Sbjct:  406 PIHVASFMGHLNVVQLLLQNGASSNATNVRG-ETPLHMASRAGQLEVVKTLLQSGARVGVKAREDQTPLHIASRLGKAEIVQLLLQRGSDPNAPTASGSTPLYFASREGHGDVASLLLENGADISPVTKKGFTPLHIASKYGRLEVATLLLEKYASADPKVAGQNGLTPLHVA 577          

HSP 2 Score: 86.2705 bits (212), Expect = 3.020e-19
Identity = 47/184 (25.54%), Postives = 94/184 (51.09%), Query Frame = 3
Query:  144 PIHFACLKGDIDIVKVLIDHNCDIEVRNRKWNQQPIHMACWDGHLEILKVLLEKNCDIESCDEWKRRPIHLACENGHTEIVKFLINLHCDIEAINDKAWRPIHFGCWKGHSDIVKVLVEQNCDIEACDHLKRRPIHLACEKGHTEIVKVLIDHHCDISACGGRFNQSPIHLARKNNFTELIQLL 695
            P+H A  +G+ ++VK+L+D    I+ + R     P+H A   GH +++++LLE++  I +  +    P+H+A +  H   V+ L+     ++ +      P+H     GH  + K+L+++  +  A       P+H+AC+K   +++++L+ H   I         +PIH+A       ++QLL
Sbjct:  241 PLHVAAKRGNNNMVKLLLDRGAKIDTKTRDG-LTPLHCAARSGHEKVIEMLLERDAPILAKTKNGLSPLHMATQGEHLACVQLLLGRQAPVDDVTLDYLTPLHVAAHCGHYRVAKLLLDRGGEPNARALNGFTPLHIACKKNRIKVMELLLKHGASIHTT-TESGLTPIHVASFMGHLNVVQLL 422          

HSP 3 Score: 85.5001 bits (210), Expect = 5.979e-19
Identity = 48/185 (25.95%), Postives = 86/185 (46.49%), Query Frame = 3
Query:  144 PIHFACLKGDIDIVKVLIDHNCDIEVRNRKWNQ-QPIHMACWDGHLEILKVLLEKNCDIESCDEWKRRPIHLACENGHTEIVKFLINLHCDIEAINDKAWRPIHFGCWKGHSDIVKVLVEQNCDIEACDHLKRRPIHLACEKGHTEIVKVLIDHHCDISACGGRFNQSPIHLARKNNFTELIQLL 695
            P+H A   G   + K+L+D     E   R  N   P+H+AC    ++++++LL+    I +  E    PIH+A   GH  +V+ L+       A N +   P+H     G  ++VK L++    +       + P+H+A   G  EIV++L+    D +A       +P++ A +    ++  LL
Sbjct:  340 PLHVAAHCGHYRVAKLLLDRGG--EPNARALNGFTPLHIACKKNRIKVMELLLKHGASIHTTTESGLTPIHVASFMGHLNVVQLLLQNGASSNATNVRGETPLHMASRAGQLEVVKTLLQSGARVGVKAREDQTPLHIASRLGKAEIVQLLLQRGSDPNAPTAS-GSTPLYFASREGHGDVASLL 521          

HSP 4 Score: 79.337 bits (194), Expect = 6.963e-17
Identity = 48/212 (22.64%), Postives = 96/212 (45.28%), Query Frame = 3
Query:  147 IHFACLKGDIDIVKVLIDHNCDIEVRNRKWNQQPIHMACWDGHLEILKVLLEKNCDIESCDEWKRRPIHLACENGHTEIVKFLIN-----------LHC------------------DIEAINDKAWRPIHFGCWKGHSDIVKVLVEQNCDIEACDHLKRRPIHLACEKGHTEIVKVLIDHHCDISACGGRFNQSPIHLARKNNFTELIQLL 695
            +H A L G  DIV+VL++   +I  +++     P++MA  + HLEI+K LL+   +     E    P+ +A + GH ++V  L+            LH                   + +  +   + P+H     G+ ++  +L+     ++        P+H+A ++G+  +VK+L+D    I     R   +P+H A ++   ++I++L
Sbjct:   81 LHIAALAGQTDIVRVLVEFGANINAQSQNG-FTPLYMAAQENHLEIVKFLLDNGANQSVATEDGFTPLAVALQQGHEQVVGLLLESDTKGKVRLPALHIAARKDDTNAAALLLQHEHNADVTSKSGFTPLHIAAHYGNMNVATLLLNLGAAVDFTARNGITPLHVAAKRGNNNMVKLLLDRGAKID-TKTRDGLTPLHCAARSGHEKVIEML 290          

HSP 5 Score: 79.337 bits (194), Expect = 8.309e-17
Identity = 42/173 (24.28%), Postives = 88/173 (50.87%), Query Frame = 3
Query:  147 IHFACLKGDIDIVKVLIDHNCDIEVRNRKWNQQPIHMACWDGHLEILKVLLEKNCDIESCDEWKRRPIHLACENGHTEIVKFLINLHCDIEAINDKAWRPIHFGCWKGHSDIVKVLVEQNCDIEACDHLKRRPIHLACEKGHTEIVKVLI--DHHCDISACGGRFNQSPIHLA 659
            +H A  +G +D+V  L+    +I+   +  N   +H+A   G  +I++VL+E   +I +  +    P+++A +  H EIVKFL++   +     +  + P+     +GH  +V +L+E +        ++   +H+A  K  T    +L+  +H+ D+++  G    +P+H+A
Sbjct:   48 LHLASKEGHVDVVTELLKREAEIDTATKVGNTA-LHIAALAGQTDIVRVLVEFGANINAQSQNGFTPLYMAAQENHLEIVKFLLDNGANQSVATEDGFTPLAVALQQGHEQVVGLLLESDTK----GKVRLPALHIAARKDDTNAAALLLQHEHNADVTSKSGF---TPLHIA 212          

HSP 6 Score: 78.1814 bits (191), Expect = 1.700e-16
Identity = 45/188 (23.94%), Postives = 81/188 (43.09%), Query Frame = 3
Query:  144 PIHFACLKGDIDIVKVLIDHNCDIEVRNRKWNQQPIHMACWDGHLEILKVLLEKNCDIESCDEWKRRPIHLACENGHTEIVKFLINLHCDIEAINDKAWRPIHFGCWKGHSDIVKVLVEQNCDIEACDHLKRRPIHLACEKGHTEIVKVLIDHHCDISACGGRFNQSPIHLARKNNFTELIQLLTIHE 707
            P+H A       +  +L+D          K    P+H+A     LE+ KVLLE   +     +    P+HLA + GH ++V  L+  H  I          +H    +   ++ ++L +   D+     L   P+H+A   G+ ++V  L+ +   ++A   R   +P+H A +   T ++  L  HE
Sbjct:  573 PLHVATHYDHQKVALLLLDKGASPH-STAKNGYTPLHIAAKKNQLEVGKVLLELGAETNMLTQQGVAPLHLAAQEGHADMVALLLGRHASISLATKGGLTAMHLAAQEDKVNVAEILTKHKADVNTTTKLCYTPLHVASHYGNIKMVNFLLRNRALVNAK-TRNGYTPLHQAAQQGHTHVVNALLQHE 758          

HSP 7 Score: 76.2554 bits (186), Expect = 7.171e-16
Identity = 37/153 (24.18%), Postives = 79/153 (51.63%), Query Frame = 3
Query:  249 IHMACWDGHLEILKVLLEKNCDIESCDEWKRRPIHLACENGHTEIVKFLINLHCDIEAINDKAWRPIHFGCWKGHSDIVKVLVEQNCDIEACDHLKRRPIHLACEKGHTEIVKVLIDHHCDISACGGRFNQSPIHLARKNNFTELIQLLTIHE 707
            +H+A  +GH++++  LL++  +I++  +     +H+A   G T+IV+ L+    +I A +   + P++    + H +IVK L++   +          P+ +A ++GH ++V +L++     S   G+     +H+A + + T    LL  HE
Sbjct:   48 LHLASKEGHVDVVTELLKREAEIDTATKVGNTALHIAALAGQTDIVRVLVEFGANINAQSQNGFTPLYMAAQENHLEIVKFLLDNGANQSVATEDGFTPLAVALQQGHEQVVGLLLE-----SDTKGKVRLPALHIAARKDDTNAAALLLQHE 195          

HSP 8 Score: 74.7146 bits (182), Expect = 2.460e-15
Identity = 44/147 (29.93%), Postives = 76/147 (51.70%), Query Frame = 3
Query:  258 ACWDGHLEILKVLLEKNCDIESCDEWKRRPIHLACENGHTEIVKFLINLHCDIEAINDKAWRPIHFGCWKGHSDIVKVLVEQNCDIEACDHLKRRPIHLACEKGHTEIVKVLIDHHCDIS-ACGGRFNQSPIHLARKNNFTELIQLL 695
            A  +G+LE L   L+   DI +C++     +HLA + GH ++V  L+    +I+         +H     G +DIV+VLVE   +I A       P+++A ++ H EIVK L+D+  + S A    F  +P+ +A +    +++ LL
Sbjct:   18 AARNGNLERLMDHLKGGMDINTCNQNGLNALHLASKEGHVDVVTELLKREAEIDTATKVGNTALHIAALAGQTDIVRVLVEFGANINAQSQNGFTPLYMAAQENHLEIVKFLLDNGANQSVATEDGF--TPLAVALQQGHEQVVGLL 162          

HSP 9 Score: 72.7886 bits (177), Expect = 1.175e-14
Identity = 47/215 (21.86%), Postives = 94/215 (43.72%), Query Frame = 3
Query:  144 PIHFACLKGDIDIVKVLIDHNCDIEVRNRKWNQQPIHMACWDGHLEILKVLLEK-------------------------------NCDIESCDEWKRRPIHLACENGHTEIVKFLINLHCDIEAINDKAWRPIHFGCWKGHSDIVKVLVEQNCDIEACDHLKRRPIHLACEKGHTEIVKVLIDHHCDISACGGRFNQSPIHLARKNNFTELIQLL 695
            P++ A  +  ++IVK L+D+  +  V        P+ +A   GH +++ +LLE                                N D+ S   +   P+H+A   G+  +   L+NL   ++        P+H    +G++++VK+L+++   I+        P+H A   GH +++++L++    I A   +   SP+H+A +      +QLL
Sbjct:  113 PLYMAAQENHLEIVKFLLDNGANQSVATEDG-FTPLAVALQQGHEQVVGLLLESDTKGKVRLPALHIAARKDDTNAAALLLQHEHNADVTSKSGFT--PLHIAAHYGNMNVATLLLNLGAAVDFTARNGITPLHVAAKRGNNNMVKLLLDRGAKIDTKTRDGLTPLHCAARSGHEKVIEMLLERDAPILAK-TKNGLSPLHMATQGEHLACVQLL 323          

HSP 10 Score: 69.707 bits (169), Expect = 3.811e-14
Identity = 42/177 (23.73%), Postives = 83/177 (46.89%), Query Frame = 3
Query:  138 RRP-IHFACLKGDIDIVKVLI--DHNCDIEVRNRKWNQQPIHMACWDGHLEILKVLLEKNCDIESCDEWKRRPIHLACENGHTEIVKFLINLHCDIEAINDKAWRPIHFGCWKGHSDIVKVLVEQNCDIEACDHLKRRPIHLACEKGHTEIVKVLIDHHCDISACGGRFNQSPIHLA 659
            R P +H A  K D +   +L+  +HN D+     K    P+H+A   G++ +  +LL     ++        P+H+A + G+  +VK L++    I+        P+H     GH  ++++L+E++  I A       P+H+A +  H   V++L+     +      +  +P+H+A
Sbjct:  172 RLPALHIAARKDDTNAAALLLQHEHNADV---TSKSGFTPLHIAAHYGNMNVATLLLNLGAAVDFTARNGITPLHVAAKRGNNNMVKLLLDRGAKIDTKTRDGLTPLHCAARSGHEKVIEMLLERDAPILAKTKNGLSPLHMATQGEHLACVQLLLGRQAPVDDVTLDY-LTPLHVA 344          

HSP 11 Score: 24.2534 bits (51), Expect = 3.811e-14
Identity = 9/23 (39.13%), Postives = 15/23 (65.22%), Query Frame = 2
Query:    2 PIHLAFDNNHREIVKLLIEENCD 70
            P+++A   NH EIVK L++   +
Sbjct:  113 PLYMAAQENHLEIVKFLLDNGAN 135          

HSP 12 Score: 62.3882 bits (150), Expect = 3.469e-11
Identity = 31/150 (20.67%), Postives = 67/150 (44.67%), Query Frame = 3
Query:  144 PIHFACLKGDIDIVKVLIDHNCDIEVRNRKWNQQPIHMACWDGHLEILKVLLEKNCDIESCDEWKRRPIHLACENGHTEIVKFLINLHCDIEAINDKAWRPIHFGCWKGHSDIVKVLVEQNCDIEACDHLKRRPIHLACEKGHTEIVKVL 593
            P+H A  +G  D+V +L+  +  I +   K     +H+A  +  + + ++L +   D+ +  +    P+H+A   G+ ++V FL+     + A     + P+H    +GH+ +V  L++               + +A   G+  +V  L
Sbjct:  639 PLHLAAQEGHADMVALLLGRHASISLAT-KGGLTAMHLAAQEDKVNVAEILTKHKADVNTTTKLCYTPLHVASHYGNIKMVNFLLRNRALVNAKTRNGYTPLHQAAQQGHTHVVNALLQHEASPNELTANGNTALAIARRLGYISVVDTL 787          
BLAST of SMED30015660 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000003991.1 (pep scaffold:Pmarinus_7.0:GL484476:255315:281660:1 gene:ENSPMAG00000003623.1 transcript:ENSPMAT00000003991.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 96.2857 bits (238), Expect = 1.367e-22
Identity = 54/175 (30.86%), Postives = 88/175 (50.29%), Query Frame = 3
Query:  144 PIHFACLKGDIDIVKVLIDHNCDIEVRNRKWNQQPIHMACWDGHLEILKVLLEKNCDIESCDEWKRRPIHLACENGHTEIVKFLINLHCDIEAINDKAWRPIHFGCWKGHSDIVKVLVEQNCDIEACDHLKRRPIHLACEKGHTEIVKVLIDHHCDISACGGRFNQSPIHLARKN 668
            P+H AC       V+ L+ H+ D+  R++ W Q P+H+A  +  ++  + ++         D   R  +H A  NGH+E+V FL+    +I A + K  R IH+  + GH+++VKVLV    D+   D     P+H A   G   +VK+L+D   DI      F  + +H+A  N
Sbjct:   75 PLHRACASRSEAAVQTLLKHSADVNARDKNW-QTPLHVAAANRAVKCAEAIIPMLSSSNVSDRAGRTALHHAAFNGHSEMVNFLVAKGANINAFDKKDRRAIHWAAYMGHTEVVKVLVAHGADVRCKDKKGYSPLHAASSSGQIGVVKLLLDLGVDIDD-PNSFGNTALHVACYN 247          

HSP 2 Score: 95.9005 bits (237), Expect = 1.937e-22
Identity = 57/187 (30.48%), Postives = 100/187 (53.48%), Query Frame = 3
Query:  138 RRPIHFACLKGDIDIVKVLIDHNCDIEVRNRKWNQQPIHMACWDGHLEILKVLLEKNCDIESCDEWKRRPIHLACENGHTEIVKFLINLHCDIEAINDKAWR-PIHFGCWKGHSDIVKVLVEQNCDIEACDHLKRRPIHLACEKGHTEIVKVLIDHHCDISACGGRFNQSPIHLARKNNFTELIQLL 695
            R P+H A   G+ +I+++L+     +  ++ KW   P+H AC       ++ LL+ + D+ + D+  + P+H+A  N   +  + +I +      ++D+A R  +H   + GHS++V  LV +  +I A D   RR IH A   GHTE+VKVL+ H  D+  C  +   SP+H A  +    +++LL
Sbjct:   40 RTPLHAAAYLGEAEIIELLVLSGARVNSKDNKW-LTPLHRACASRSEAAVQTLLKHSADVNARDKNWQTPLHVAAANRAVKCAEAIIPM-LSSSNVSDRAGRTALHHAAFNGHSEMVNFLVAKGANINAFDKKDRRAIHWAAYMGHTEVVKVLVAHGADVR-CKDKKGYSPLHAASSSGQIGVVKLL 223          

HSP 3 Score: 94.7449 bits (234), Expect = 5.353e-22
Identity = 53/188 (28.19%), Postives = 95/188 (50.53%), Query Frame = 3
Query:  135 DRRPIHFACLKGDIDIVKVLIDHNCDIEVRNRKWNQQPIHMACWDGHLEILKVLLEKNCDIESCDEWKRRPIHLACENGHTEIVKFLINLHCDIEAINDKAWRPIHFGCWKGHSDI-VKVLVEQNCDIEACDHLKRRPIHLACEKGHTEIVKVLIDHHCDISACGGRFNQSPIHLARKNNFTELIQLL 695
            DRR IH+A   G  ++VKVL+ H  D+  +++K    P+H A   G + ++K+LL+   DI+  + +    +H+AC NG   +V  LI+   ++   N++ + P+HF     H  + +++LV    D+       + P+H+    G     + LI +  +I  C  R   +P+H+A +     LI  L
Sbjct:  171 DRRAIHWAAYMGHTEVVKVLVAHGADVRCKDKK-GYSPLHAASSSGQIGVVKLLLDLGVDIDDPNSFGNTALHVACYNGQDVVVNELIDCGANVNQANERGFTPLHFAAASTHGALCLELLVNNGADVNVQSKDGKSPLHMTAVHGRFTRSQTLIQNGGEID-CEDRDGNTPLHIAARYGHELLINTL 356          

HSP 4 Score: 89.3521 bits (220), Expect = 2.925e-20
Identity = 52/183 (28.42%), Postives = 93/183 (50.82%), Query Frame = 3
Query:  144 PIHFACLKGDIDIVKVLIDHNCDIEVRNRKWNQQPIHMACWDGHLEILKVLLEK---NCDIESCDEWKRRPIHLACENGHTEIVKFLINLHCDIEAINDKAWRPIHFGCWKGHSDIVKVLVEQNCDIEACDHLKRRPIHLACEKGHTEIVKVLIDHHCDISACGGRFNQSPIHLARKNNFTEL 683
            P+  A L+G  D V+VLI H   + ++     +  +H A  +GH+E L++L+E    N  +++ D  ++ P+ LA  NGHT+    L++    I A ++K    +H G   GH + V +L++++ D+   +   R P+H+A   GH  I+  L+             + +PI L  +N +T L
Sbjct:  619 PLGLAALRGHTDCVRVLIQHGASVLLKEGPDRRTALHSAATNGHVECLRLLVENADSNEAVDASDANEQTPVMLAVGNGHTDCASLLLSKGASINAKDNKGCTALHRGAATGHEECVDLLLQRSVDVSLRERRGRAPLHMAAACGHMGILSALVQ--------AAMASGAPIPLTDRNGYTPL 793          

HSP 5 Score: 78.5666 bits (192), Expect = 1.514e-16
Identity = 44/174 (25.29%), Postives = 88/174 (50.57%), Query Frame = 3
Query:  138 RRPIHFACLKGDIDIVKVLIDHNCDIEVRNRKWNQQPIHMACWDGHLEILKVLLEKNCDIESCDEWKRRPIHLACENGHTEIVKFLINLHCDIEAINDKAWRPIHFGCWKGHSDIVKVLVEQNCDIEACDHLKRRPIHLACEKGHTEI-VKVLIDHHCDISACGGRFNQSPIHL 656
            R  +H A   G  ++V  L+    +I   ++K +++ IH A + GH E++KVL+    D+   D+    P+H A  +G   +VK L++L  DI+  N      +H  C+ G   +V  L++   ++   +     P+H A    H  + +++L+++  D++    +  +SP+H+
Sbjct:  139 RTALHHAAFNGHSEMVNFLVAKGANINAFDKK-DRRAIHWAAYMGHTEVVKVLVAHGADVRCKDKKGYSPLHAASSSGQIGVVKLLLDLGVDIDDPNSFGNTALHVACYNGQDVVVNELIDCGANVNQANERGFTPLHFAAASTHGALCLELLVNNGADVNV-QSKDGKSPLHM 310          

HSP 6 Score: 64.6994 bits (156), Expect = 6.000e-12
Identity = 47/195 (24.10%), Postives = 85/195 (43.59%), Query Frame = 3
Query:  135 DRRPIHFACLKGDIDIVKVLIDHNCDIEVRNRKWNQQPIHMACWDGHLEILKVLLEKNCDIESCDEWKRRPIHLACENGHTEIVKFLINLH----CDIEAINDKAWRPIHFGCWKGHSDIVKVLVEQNCDIEACDHLKRRPIHLACEKGHTEIVKVLIDHH-CDISACGGRFNQSPIHLARKNNFTELIQLLTIH 704
            ++ P+  A   G  D   +L+     I  ++ K     +H     GH E + +LL+++ D+   +   R P+H+A   GH  I+  L+         I   +   + P+H+ C+ GH   V++L+E +   +  +     P+H A    +    ++LID     I  C     + P+H A   +  E +QLL  H
Sbjct:  686 EQTPVMLAVGNGHTDCASLLLSKGASINAKDNK-GCTALHRGAATGHEECVDLLLQRSVDVSLRERRGRAPLHMAAACGHMGILSALVQAAMASGAPIPLTDRNGYTPLHWACYNGHDGCVELLLELDV-FQKQEGNAFSPLHCAVLNDNESCAEMLIDTFGAKIINCPDAKGRMPLHAAAFTDHVECLQLLLSH 878          

HSP 7 Score: 62.3882 bits (150), Expect = 3.793e-11
Identity = 48/188 (25.53%), Postives = 85/188 (45.21%), Query Frame = 3
Query:  144 PIHFACLKGDIDIVKVLIDHNCDIEVRNRKWNQQPIHMACWDGHLEILKVLLEKNCDIESCDEWKRRPIHLACENGHTEIVKFLINLHCDIEAINDKAWR-PIHFGCWKGHSDIVKVLVEQNCDIEACDHLKRRPIHLACEKGHTEIVKVLIDHHCDISACGGRFNQSPIHLARKNNFTELIQLLTIH 704
            P+  A   GD D V+ LI    ++   + +  + P+H A + G  EI+++L+     + S D     P+H AC +     V+ L+    D+ A  DK W+ P+H           + ++         D   R  +H A   GH+E+V  L+    +I+A   + ++  IH A     TE++++L  H
Sbjct:    9 PLIQAIFNGDPDEVRSLIYKKEEVNAVDDE-KRTPLHAAAYLGEAEIIELLVLSGARVNSKDNKWLTPLHRACASRSEAAVQTLLKHSADVNA-RDKNWQTPLHVAAANRAVKCAEAIIPMLSSSNVSDRAGRTALHHAAFNGHSEMVNFLVAKGANINAFDKK-DRRAIHWAAYMGHTEVVKVLVAH 193          

HSP 8 Score: 58.151 bits (139), Expect = 8.558e-10
Identity = 36/153 (23.53%), Postives = 74/153 (48.37%), Query Frame = 3
Query:  237 NQQPIHMACWDGHLEILKVLLEKNCDIESCDEWKRRPIHLACENGHTEIVKFLINLHCDIEAINDKAWRPIHFGCWKGHSDIVKVLVEQNCDIEACDHLKRRPIHLACEKGHTEIVKVLIDHHCDISACGGRFNQSPIHLARKNNFTELIQLL 695
            +Q P+  A ++G  + ++ L+ K  ++ + D+ KR P+H A   G  EI++ L+     + + ++K   P+H  C       V+ L++ + D+ A D   + P+H+A      +  + +I      S    R  ++ +H A  N  +E++  L
Sbjct:    6 SQAPLIQAIFNGDPDEVRSLIYKKEEVNAVDDEKRTPLHAAAYLGEAEIIELLVLSGARVNSKDNKWLTPLHRACASRSEAAVQTLLKHSADVNARDKNWQTPLHVAAANRAVKCAEAIIP-MLSSSNVSDRAGRTALHHAAFNGHSEMVNFL 157          

HSP 9 Score: 57.7658 bits (138), Expect = 1.054e-9
Identity = 45/169 (26.63%), Postives = 79/169 (46.75%), Query Frame = 3
Query:  144 PIHFACLKGDIDIVKVLIDH------NCDIEVRNRKWNQQPIHMACWDGHLEILKVLLEKNCDIESCDEWKRRPIHLACENGHTEIVKFLIN-LHCDIEAINDKAWRPIHFGCWKGH---SDIVKVLVEQNCDIEACDHLKRRPIHLACEKGHTEIVKVLIDHHCDISA 620
            P+H A L  +    ++LID       NC  + + R     P+H A +  H+E L++LL  N  +   D   + P+ +ACENG    V+ L+N    D++  +      +H  C + H   + ++   ++    I A +   + P+HLA   G   +V+VL++    I A
Sbjct:  824 PLHCAVLNDNESCAEMLIDTFGAKIINCP-DAKGR----MPLHAAAFTDHVECLQLLLSHNALVNVTDMAGKSPLMMACENGQATAVEVLVNSTKTDLKLQDANRNTALHLACSRSHETCALLILDKLDDLNLINATNAALQTPLHLAARSGMATVVQVLLNKGASILA 987          

HSP 10 Score: 56.9954 bits (136), Expect = 1.749e-9
Identity = 41/152 (26.97%), Postives = 72/152 (47.37%), Query Frame = 3
Query:  249 IHMACWDGHLEILKVLLEKNCDIESCDEWKRRPIHLACENGHTEIVKFLINLHCDIEAINDKAWRPI---HFGCWKGHSDIVKVLVEQNCDIEACDHLKRRPIHLACEKGHTEIVKVLIDHHCDISACGGRFNQSPIHLARKNNFTELIQLL 695
            +H  C +  +  L+ LL K+ D    D+    P+H A   GH   ++ L+      ++ + K+  PI   H   + GH   ++VL+    D++  +     P+ LA  +GHT+ V+VLI H   +    G   ++ +H A  N   E ++LL
Sbjct:  520 VHSTCSEAQI-CLEHLLRKDADPGIQDKQGYTPVHYAAAYGHRVCLELLLEQPGAFQS-DGKSGHPISPLHLAAYHGHHGALEVLIRSLVDLDVREGNGYTPLGLAALRGHTDCVRVLIQHGASVLLKEGPDRRTALHSAATNGHVECLRLL 669          

HSP 11 Score: 53.5286 bits (127), Expect = 2.391e-8
Identity = 42/194 (21.65%), Postives = 80/194 (41.24%), Query Frame = 3
Query:  144 PIHFACLKGDIDI-VKVLIDHNCDIEVRNRKWNQQPIHMACWDGHLEILKVLLEKNCDIESCDEWKRRPIHLACENGHTEIVKFLINLHCDIEAINDKAWRPIHFGCWKGHSDIVKVL------------------VEQNCDIEACDHLKRRPIHLACEKGHTEIVKVLIDHHCDISACGGRFNQSPIHLARKN 668
            P+HFA       + +++L+++  D+ V+++   + P+HM    G     + L++   +I+  D     P+H+A   GH  ++  LI    D          P+H     G SD  + L                  +    +I+  D   R  +H A   G+ E + +L+    D++    RF ++ +H A  N
Sbjct:  273 PLHFAAASTHGALCLELLVNNGADVNVQSKD-GKSPLHMTAVHGRFTRSQTLIQNGGEIDCEDRDGNTPLHIAARYGHELLINTLITNGADTAKRGIHGMFPLHLAALSGFSDCCRKLLSAGQKYSIVSSFSNEHVLSAGFEIDTPDEFGRTCLHAAASGGNVECLNLLLSTGADMNK-KDRFERTALHYAAAN 464          

HSP 12 Score: 51.9878 bits (123), Expect = 8.557e-8
Identity = 38/145 (26.21%), Postives = 66/145 (45.52%), Query Frame = 3
Query:  138 RRPIHFACLKGDIDIVKVLIDHNCDIEVRNRKWNQQPIHMACWDGHLEILKVLLEKN-CDIESCDEWKRRPIHLACENGHTEIV---KFLINLHCDIEAINDKAWRPIHFGCWKGHSDIVKVLVEQNCDIEACDHLKRRPIHLAC 560
            R P+H A     ++ +++L+ HN  + V +    + P+ MAC +G    ++VL+     D++  D  +   +HLAC   H          ++    I A N     P+H     G + +V+VL+ +   I A DH    P  L+C
Sbjct:  857 RMPLHAAAFTDHVECLQLLLSHNALVNVTDMA-GKSPLMMACENGQATAVEVLVNSTKTDLKLQDANRNTALHLACSRSHETCALLILDKLDDLNLINATNAALQTPLHLAARSGMATVVQVLLNKGASILAVDHNGYTPA-LSC 999          
BLAST of SMED30015660 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000000093.1 (pep scaffold:Pmarinus_7.0:GL477582:20502:66045:1 gene:ENSPMAG00000000080.1 transcript:ENSPMAT00000000093.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 88.1965 bits (217), Expect = 8.876e-20
Identity = 49/184 (26.63%), Postives = 89/184 (48.37%), Query Frame = 3
Query:  144 PIHFACLKGDIDIVKVLIDHNCDIEVRNRKWNQQPIHMACWDGHLEILKVLLEKNCDIESCDEWKRRPIHLACENGHTEIVKFLINLHCDIEAINDKAWRPIHFGCWKGHSDIVKVLVEQNCDIEACDHLKRRPIHLACEKGHTEIVKVLIDHHCDISACGGRFNQSPIHLARKNNFTELIQLL 695
            PIH A   G +++V++L+ +       N +  + P+HMA   G LE++K LL+    +       + P+H+A   G  EIV+ L+    D  A       P++F   +GH D+  +L+E   DI         P+H+A + G  E+  +L++ +       G+   +P+H+A   +  ++  LL
Sbjct:  413 PIHVASFMGHLNVVQLLLQNGASSNATNVR-GETPLHMASRAGQLEVVKTLLQSGARVGVKAREDQTPLHIASRLGKAEIVQLLLQRGSDPNAPTASGSTPLYFASREGHGDVASLLLENGADISPVTKKGFTPLHIASKYGRLEVATLLLEKYASADP-KGKNGLTPLHVATHYDHQKVALLL 594          

HSP 2 Score: 83.9593 bits (206), Expect = 1.891e-18
Identity = 47/184 (25.54%), Postives = 94/184 (51.09%), Query Frame = 3
Query:  144 PIHFACLKGDIDIVKVLIDHNCDIEVRNRKWNQQPIHMACWDGHLEILKVLLEKNCDIESCDEWKRRPIHLACENGHTEIVKFLINLHCDIEAINDKAWRPIHFGCWKGHSDIVKVLVEQNCDIEACDHLKRRPIHLACEKGHTEIVKVLIDHHCDISACGGRFNQSPIHLARKNNFTELIQLL 695
            P+H A  +G+ ++VK+L+D    I+ + R     P+H A   GH +++++LLE++  I +  +    P+H+A +  H   V+ L+     ++ +      P+H     GH  + K+L+++  +  A       P+H+AC+K   +++++L+ H   I         +PIH+A       ++QLL
Sbjct:  248 PLHVAAKRGNNNMVKLLLDRGAKIDTKTRD-GLTPLHCAARSGHEKVIEMLLERDAPILAKTKNGLSPLHMATQGEHLACVQLLLGRQAPVDDVTLDYLTPLHVAAHCGHYRVAKLLLDRGGEPNARALNGFTPLHIACKKNRIKVMELLLKHGASIHTT-TESGLTPIHVASFMGHLNVVQLL 429          

HSP 3 Score: 82.0333 bits (201), Expect = 1.093e-17
Identity = 48/188 (25.53%), Postives = 92/188 (48.94%), Query Frame = 3
Query:  144 PIHFACLKGDIDIVKVLIDHNCDIEVRNRKWNQQPIHMACWDGHLEILKVLLEKNCDIESCDEWKRRPIHLACENGHTEIVKFLINLHCDIEAINDKAWRPIHFGCWKGHSDIVKVLVEQNCDIEACDHLKRRPIHLACEKGHTEIVKVLIDHHCDISACGGRFNQSPIHLARKNNFTELIQLLTIHE 707
            P++FA  +G  D+  +L+++  DI    +K    P+H+A   G LE+  +LLEK    +   +    P+H+A    H ++   L++      +     + P+H    K   ++ KVL+E   +          P+HLA ++GH ++V +L+  H  IS    +   + +HLA + +   + ++LT H+
Sbjct:  512 PLYFASREGHGDVASLLLENGADISPVTKK-GFTPLHIASKYGRLEVATLLLEKYASADPKGKNGLTPLHVATHYDHQKVALLLLDKGASPHSTAKNGYTPLHIAAKKNQLEVGKVLLELGAETNMLTQQGVAPLHLAAQEGHADMVALLLGRHASIS-LATKGGLTAMHLAAQEDKVNVAEILTKHK 697          

HSP 4 Score: 81.2629 bits (199), Expect = 1.557e-17
Identity = 45/184 (24.46%), Postives = 90/184 (48.91%), Query Frame = 3
Query:  144 PIHFACLKGDIDIVKVLIDHNCDIEVRNRKWNQQPIHMACWDGHLEILKVLLEKNCDIESCDEWKRRPIHLACENGHTEIVKFLINLHCDIEAINDKAWRPIHFGCWKGHSDIVKVLVEQNCDIEACDHLKRRPIHLACEKGHTEIVKVLIDHHCDISACGGRFNQSPIHLARKNNFTELIQLL 695
            P+H A   G +++VK L+     + V+ R+ +Q P+H+A   G  EI+++LL++  D  +       P++ A   GH ++   L+    DI  +  K + P+H     G  ++  +L+E+    +        P+H+A    H ++  +L+D      +   +   +P+H+A K N  E+ ++L
Sbjct:  446 PLHMASRAGQLEVVKTLLQSGARVGVKARE-DQTPLHIASRLGKAEIVQLLLQRGSDPNAPTASGSTPLYFASREGHGDVASLLLENGADISPVTKKGFTPLHIASKYGRLEVATLLLEKYASADPKGKNGLTPLHVATHYDHQKVALLLLDKGASPHST-AKNGYTPLHIAAKKNQLEVGKVL 627          

HSP 5 Score: 76.6406 bits (187), Expect = 6.422e-16
Identity = 46/184 (25.00%), Postives = 85/184 (46.20%), Query Frame = 3
Query:  144 PIHFACLKGDIDIVKVLIDHNCDIEVRNRKWNQQPIHMACWDGHLEILKVLLEKNCDIESCDEWKRRPIHLACENGHTEIVKFLINLHCDIEAINDKAWRPIHFGCWKGHSDIVKVLVEQNCDIEACDHLKRRPIHLACEKGHTEIVKVLIDHHCDISACGGRFNQSPIHLARKNNFTELIQLL 695
            P+H A   G   + K+L+D   +   R       P+H+AC    ++++++LL+    I +  E    PIH+A   GH  +V+ L+       A N +   P+H     G  ++VK L++    +       + P+H+A   G  EIV++L+    D +A       +P++ A +    ++  LL
Sbjct:  347 PLHVAAHCGHYRVAKLLLDRGGEPNARALN-GFTPLHIACKKNRIKVMELLLKHGASIHTTTESGLTPIHVASFMGHLNVVQLLLQNGASSNATNVRGETPLHMASRAGQLEVVKTLLQSGARVGVKAREDQTPLHIASRLGKAEIVQLLLQRGSDPNAPTAS-GSTPLYFASREGHGDVASLL 528          

HSP 6 Score: 75.8702 bits (185), Expect = 9.749e-16
Identity = 46/217 (21.20%), Postives = 94/217 (43.32%), Query Frame = 3
Query:  144 PIHFACLKGDIDIVKVLIDHNCDIEVRNRKWNQQPIHMACWDGHLEILKVLLEKNCDIES--------------CDEWKR-------------------RPIHLACENGHTEIVKFLINLHCDIEAINDKAWRPIHFGCWKGHSDIVKVLVEQNCDIEACDHLKRRPIHLACEKGHTEIVKVLIDHHCDISACGGRFNQSPIHLARKNNFTELIQLL 695
            P+H A   G   ++++L++ +  I  + +     P+HMA    HL  +++LL +   ++               C  ++                     P+H+AC+    ++++ L+     I    +    PIH   + GH ++V++L++      A +     P+H+A   G  E+VK L+     +     R +Q+P+H+A +    E++QLL
Sbjct:  281 PLHCAARSGHEKVIEMLLERDAPILAKTKN-GLSPLHMATQGEHLACVQLLLGRQAPVDDVTLDYLTPLHVAAHCGHYRVAKLLLDRGGEPNARALNGFTPLHIACKKNRIKVMELLLKHGASIHTTTESGLTPIHVASFMGHLNVVQLLLQNGASSNATNVRGETPLHMASRAGQLEVVKTLLQSGARVGV-KAREDQTPLHIASRLGKAEIVQLL 495          

HSP 7 Score: 72.0182 bits (175), Expect = 2.028e-14
Identity = 45/188 (23.94%), Postives = 81/188 (43.09%), Query Frame = 3
Query:  144 PIHFACLKGDIDIVKVLIDHNCDIEVRNRKWNQQPIHMACWDGHLEILKVLLEKNCDIESCDEWKRRPIHLACENGHTEIVKFLINLHCDIEAINDKAWRPIHFGCWKGHSDIVKVLVEQNCDIEACDHLKRRPIHLACEKGHTEIVKVLIDHHCDISACGGRFNQSPIHLARKNNFTELIQLLTIHE 707
            P+H A       +  +L+D          K    P+H+A     LE+ KVLLE   +     +    P+HLA + GH ++V  L+  H  I          +H    +   ++ ++L +   D+     L   P+H+A   G+ ++V  L+ +   ++A   R   +P+H A +   T ++  L  HE
Sbjct:  578 PLHVATHYDHQKVALLLLDKGASPH-STAKNGYTPLHIAAKKNQLEVGKVLLELGAETNMLTQQGVAPLHLAAQEGHADMVALLLGRHASISLATKGGLTAMHLAAQEDKVNVAEILTKHKADVNTTTKLCYTPLHVASHYGNIKMVNFLLRNRALVNA-KTRNGYTPLHQAAQQGHTHVVNALLQHE 763          

HSP 8 Score: 71.633 bits (174), Expect = 2.907e-14
Identity = 43/175 (24.57%), Postives = 87/175 (49.71%), Query Frame = 3
Query:  192 LIDH---NCDIEVRNRKWNQQPIHMACWDGHLEILKVLLEKNCDIESCDEWKRRPIHLACENGHTEIVKFLINLHCDIEAINDKAWRPIHFGCWKGHSDIVKVLVEQNCDIEACDHLKRRPIHLACEKGHTEIVKVLIDHHCDISACGGRFNQSPIHLARKNNFTELIQLLTIHE 707
            L+DH     DI   N+      +H+A  +GH++++  LL++  +I++  +     +H+A   G T+IV+ L+    +I A +   + P++    + H +IVK L++   +          P+ +A ++GH ++V +L++     S   G+     +H+A + + T    LL  HE
Sbjct:   26 LMDHLKGGMDINTCNQN-GLNALHLASKEGHVDVVTELLKREAEIDTATKVGNTALHIAALAGQTDIVRVLVEFGANINAQSQNGFTPLYMAAQENHLEIVKFLLDNGANQSVATEDGFTPLAVALQQGHEQVVGLLLE-----SDTKGKVRLPALHIAARKDDTNAAALLLQHE 194          

HSP 9 Score: 68.5514 bits (166), Expect = 3.017e-13
Identity = 44/147 (29.93%), Postives = 76/147 (51.70%), Query Frame = 3
Query:  258 ACWDGHLEILKVLLEKNCDIESCDEWKRRPIHLACENGHTEIVKFLINLHCDIEAINDKAWRPIHFGCWKGHSDIVKVLVEQNCDIEACDHLKRRPIHLACEKGHTEIVKVLIDHHCDIS-ACGGRFNQSPIHLARKNNFTELIQLL 695
            A  +G+LE L   L+   DI +C++     +HLA + GH ++V  L+    +I+         +H     G +DIV+VLVE   +I A       P+++A ++ H EIVK L+D+  + S A    F  +P+ +A +    +++ LL
Sbjct:   17 AARNGNLERLMDHLKGGMDINTCNQNGLNALHLASKEGHVDVVTELLKREAEIDTATKVGNTALHIAALAGQTDIVRVLVEFGANINAQSQNGFTPLYMAAQENHLEIVKFLLDNGANQSVATEDGF--TPLAVALQQGHEQVVGLL 161          

HSP 10 Score: 67.781 bits (164), Expect = 4.734e-13
Identity = 49/220 (22.27%), Postives = 97/220 (44.09%), Query Frame = 3
Query:  147 IHFACLKGDIDIVKVLIDHNCDIEVRNRKWNQQPIHMACWDGHLEILKVLLEKNCDIESCDEWKRRPIHLACENGHTEIVKFLIN-----------LH--------------------CDIEA------INDKAWRPIHFGCWKGHSDIVKVLVEQNCDIEACDHLKRRPIHLACEKGHTEIVKVLIDHHCDISACGGRFNQSPIHLARKNNFTELIQLL 695
            +H A L G  DIV+VL++   +I  +++     P++MA  + HLEI+K LL+   +     E    P+ +A + GH ++V  L+            LH                     D+ +        +  + P+H     G+ ++  +L+     ++        P+H+A ++G+  +VK+L+D    I     R   +P+H A ++   ++I++L
Sbjct:   80 LHIAALAGQTDIVRVLVEFGANINAQSQN-GFTPLYMAAQENHLEIVKFLLDNGANQSVATEDGFTPLAVALQQGHEQVVGLLLESDTKGKVRLPALHIAARKDDTNAAALLLQHEHNADVTSKMMLNQTTESGFTPLHIAAHYGNMNVATLLLNLGAAVDFTARNGITPLHVAAKRGNNNMVKLLLDRGAKIDT-KTRDGLTPLHCAARSGHEKVIEML 297          

HSP 11 Score: 67.3958 bits (163), Expect = 8.065e-13
Identity = 43/179 (24.02%), Postives = 89/179 (49.72%), Query Frame = 3
Query:  147 IHFACLKGDIDIVKVLIDHNCDIEVRNRKWNQQPIHMACWDGHLEILKVLLEKNCDIESCDEWKRRPIHLACENGHTEIVKFLINLHCDIEAINDKAWRPIHFGCWKGHSDIVKVLVEQNCDIEACDHLKRRPIHLACEKGHTEIVKVLI--DHHCDISACGGRFNQ------SPIHLA 659
            +H A  +G +D+V  L+    +I+   +  N   +H+A   G  +I++VL+E   +I +  +    P+++A +  H EIVKFL++   +     +  + P+     +GH  +V +L+E +        ++   +H+A  K  T    +L+  +H+ D+++     NQ      +P+H+A
Sbjct:   47 LHLASKEGHVDVVTELLKREAEIDTATKVGN-TALHIAALAGQTDIVRVLVEFGANINAQSQNGFTPLYMAAQENHLEIVKFLLDNGANQSVATEDGFTPLAVALQQGHEQVVGLLLESDTK----GKVRLPALHIAARKDDTNAAALLLQHEHNADVTS-KMMLNQTTESGFTPLHIA 219          

HSP 12 Score: 63.5438 bits (153), Expect = 2.655e-12
Identity = 51/232 (21.98%), Postives = 96/232 (41.38%), Query Frame = 3
Query:  147 IHFACLKGDIDIVKVLIDHNCDIEVRNRKWNQQ-------PIHMACWDGHLEILKVLLEKNCDIESCDEWKRRPIHLACENGHTEIVKFLINLHCDIEAINDKAWRPIHFGCWKGHSDIVKVLVEQNCDIEA--------------CDHLK-------------------RRPIHLACEKGHTEIVKVLIDHHCDISACGGRFNQ------SPIHLARKNNFTELIQLLTIH 704
            +H A  K D +   +L+ H  + +V ++    Q       P+H+A   G++ +  +LL     ++        P+H+A + G+  +VK L++    I+        P+H     GH  ++++L+E++  I A               +HL                      P+H+A   GH  + K+L+D        GG  N       +P+H+A K N  ++++LL  H
Sbjct:  175 LHIAARKDDTNAAALLLQHEHNADVTSKMMLNQTTESGFTPLHIAAHYGNMNVATLLLNLGAAVDFTARNGITPLHVAAKRGNNNMVKLLLDRGAKIDTKTRDGLTPLHCAARSGHEKVIEMLLERDAPILAKTKNGLSPLHMATQGEHLACVQLLLGRQAPVDDVTLDYLTPLHVAAHCGHYRVAKLLLDR-------GGEPNARALNGFTPLHIACKKNRIKVMELLLKH 399          

HSP 13 Score: 24.6386 bits (52), Expect = 2.655e-12
Identity = 9/23 (39.13%), Postives = 15/23 (65.22%), Query Frame = 2
Query:    2 PIHLAFDNNHREIVKLLIEENCD 70
            P+++A   NH EIVK L++   +
Sbjct:  112 PLYMAAQENHLEIVKFLLDNGAN 134          

HSP 14 Score: 64.3142 bits (155), Expect = 7.076e-12
Identity = 48/221 (21.72%), Postives = 94/221 (42.53%), Query Frame = 3
Query:  144 PIHFACLKGDIDIVKVLIDHNCDIEVRNRKWNQQPIHMACWDGHLEILKVLLEK-------------------------------NCDIES------CDEWKRRPIHLACENGHTEIVKFLINLHCDIEAINDKAWRPIHFGCWKGHSDIVKVLVEQNCDIEACDHLKRRPIHLACEKGHTEIVKVLIDHHCDISACGGRFNQSPIHLARKNNFTELIQLL 695
            P++ A  +  ++IVK L+D+  +  V        P+ +A   GH +++ +LLE                                N D+ S        E    P+H+A   G+  +   L+NL   ++        P+H    +G++++VK+L+++   I+        P+H A   GH +++++L++    I A   +   SP+H+A +      +QLL
Sbjct:  112 PLYMAAQENHLEIVKFLLDNGANQSVATED-GFTPLAVALQQGHEQVVGLLLESDTKGKVRLPALHIAARKDDTNAAALLLQHEHNADVTSKMMLNQTTESGFTPLHIAAHYGNMNVATLLLNLGAAVDFTARNGITPLHVAAKRGNNNMVKLLLDRGAKIDTKTRDGLTPLHCAARSGHEKVIEMLLERDAPILA-KTKNGLSPLHMATQGEHLACVQLL 330          
BLAST of SMED30015660 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000002048.1 (pep scaffold:Pmarinus_7.0:GL477431:30859:73495:1 gene:ENSPMAG00000001850.1 transcript:ENSPMAT00000002048.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 85.5001 bits (210), Expect = 6.243e-19
Identity = 54/159 (33.96%), Postives = 84/159 (52.83%), Query Frame = 3
Query:  153 FACLKGDIDIVKVLIDHNCDIEVRNRKWNQQPIHMACWDGHLEILKVLLEKNCDIESCDE-WKRRPIHLACENGHTEIVKFLINLHCDIEAINDKAWRPIHFGCWKGHSDIVKVLVEQNCDIEA--CDHLKRRPIHLACEKGHTEIVKVLIDHHCDISA 620
             AC  G  D+V VLI    +IE R++K    P+ +A   GH+ ++++LL+   DIE+  E  K  P+ LAC  G  E+V+ LI    + E  N   + P+      G+ +I+K+L+    +I +     L   P+ LA   GHT  VK+L+D   DI+A
Sbjct:  939 LACAGGHEDLVTVLIARGANIEHRDKK-GFTPLILAATAGHVNVVELLLDNGADIEAQSERTKDTPLSLACSGGRQEVVELLIARGANKEHRNVSDYTPLSLAASGGYVNIIKILLNAGAEINSRTGSKLGISPLMLAAMNGHTAAVKLLLDMGSDINA 1096          

HSP 2 Score: 82.0333 bits (201), Expect = 1.170e-17
Identity = 43/184 (23.37%), Postives = 88/184 (47.83%), Query Frame = 3
Query:  144 PIHFACLKGDIDIVKVLIDHNCDIEVRNRKWNQQPIHMACWDGHLEILKVLLEKNCDIESCDEWKRRPIHLACENGHTEIVKFLINLHCDIEAINDKAWRPIHFGCWKGHSDIVKVLVEQNCDIEACDHLKRRPIHLACEKGHTEIVKVLIDHHCDISACGGRFNQSPIHLARKNNFTELIQLL 695
            P+  A   G +++ ++L++    I   + ++ +  + +AC+ GHLE+++ LLE   D E   +     +  AC +GH E+ + L+     +    D    P+      GH ++  +L+E+  ++E  +     P+  A  +GH E+V +L+    +I+A      ++ + LA    F E+   L
Sbjct:  236 PLMEAASGGHVEVARLLLERGAGINTHSNEFKESALTLACYKGHLEMVRFLLEAGADQEHKTDEMHTALMEACMDGHVEVARLLLESGAQVNMPADSFESPLTLAACGGHVELAALLIERGANLEEVNDEGYTPLMEAAREGHEEMVALLLAQGANINAQTEETQETALTLACCGGFLEVADFL 419          

HSP 3 Score: 76.2554 bits (186), Expect = 1.087e-16
Identity = 43/150 (28.67%), Postives = 78/150 (52.00%), Query Frame = 3
Query:  153 FACLKGDIDIVKVLIDHNCDIEVRNRKWNQQPIHMACWDGHLEILKVLLEKNCDIESCDEWKRR--PIHLACENGHTEIVKFLINLHCDIEAINDKAWRPIHFGCWKGHSDIVKVLVEQNCDIEACDHLKRRPIHLACEKGHTEIVKVLI 596
             AC +G  ++V +L++   ++E R  K    P+  A   G+ E+ +VLLE+  D+ +      R   + +A + GH +  + +I+    I+  N K   P+      GH D+V++LV    D++A D+ K  P+  A  KGH ++V+ L+
Sbjct: 1108 LACFQGRHEVVSLLVERKANVEHR-AKTGLTPLMEAASGGYAEVGRVLLERGADVNAAPVPSSRDTALTIAADKGHYKFCELVISRGAHIDVRNKKGNTPLWLAANGGHLDVVQLLVNSGADVDAADNRKITPLMAAFRKGHVKVVRYLV 1256          

HSP 4 Score: 26.5646 bits (57), Expect = 1.087e-16
Identity = 12/26 (46.15%), Postives = 16/26 (61.54%), Query Frame = 2
Query:    2 PIHLAFDNNHREIVKLLIEENCDVNA 79
            P+ LA  N H   VKLL++   D+NA
Sbjct: 1071 PLMLAAMNGHTAAVKLLLDMGSDINA 1096          

HSP 5 Score: 78.1814 bits (191), Expect = 2.131e-16
Identity = 46/187 (24.60%), Postives = 93/187 (49.73%), Query Frame = 3
Query:  144 PIHFACLKGDIDIVKVLIDHNCDIEVRNRKWNQQPIHMACWDGHLEILKVLLEKNCDIESCDEWKRRPIHLACENGHTEIVKFLINLHCDIEAINDKAW--RPIHFGCWKGHSDIVKVLVEQNCDIEACDHLKRR-PIHLACEKGHTEIVKVLIDHHCDISACGGRFNQSPIHLARKNNFTELIQLL 695
            P+  A   G +++V++L+D+  DIE ++ +    P+ +AC  G  E++++L+ +  + E  +     P+ LA   G+  I+K L+N   +I +         P+      GH+  VK+L++   DI A     R   + LAC +G  E+V +L++   ++     +   +P+  A    + E+ ++L
Sbjct:  969 PLILAATAGHVNVVELLLDNGADIEAQSERTKDTPLSLACSGGRQEVVELLIARGANKEHRNVSDYTPLSLAASGGYVNIIKILLNAGAEINSRTGSKLGISPLMLAAMNGHTAAVKLLLDMGSDINAQIETNRNTALTLACFQGRHEVVSLLVERKANVEH-RAKTGLTPLMEAASGGYAEVGRVL 1154          

HSP 6 Score: 77.0258 bits (188), Expect = 4.734e-16
Identity = 47/170 (27.65%), Postives = 88/170 (51.76%), Query Frame = 3
Query:  192 LIDHNCDIEVRNRKWNQQPIHMACWDGHLEILKVLLEKNCDIESCDEWKRRPIHLACENGHTEIVKFLINLHCDIEAINDKAW-RPIHFGCWKGHSDIVKVLVEQNCDIEACDHLKRRPIHLACEKGHTEIVKVLIDHHCDI-SACGGRFNQSPIHLARKNNFTELIQLL 695
            L+D +C   +     +   + +AC  GH +++ VL+ +  +IE  D+    P+ LA   GH  +V+ L++   DIEA +++    P+   C  G  ++V++L+ +  + E  +     P+ LA   G+  I+K+L++   +I S  G +   SP+ LA  N  T  ++LL
Sbjct:  921 LVDIDC---IHTESNHDTALTLACAGGHEDLVTVLIARGANIEHRDKKGFTPLILAATAGHVNVVELLLDNGADIEAQSERTKDTPLSLACSGGRQEVVELLIARGANKEHRNVSDYTPLSLAASGGYVNIIKILLNAGAEINSRTGSKLGISPLMLAAMNGHTAAVKLL 1087          

HSP 7 Score: 76.2554 bits (186), Expect = 1.022e-15
Identity = 45/188 (23.94%), Postives = 86/188 (45.74%), Query Frame = 3
Query:  144 PIHFACLKGDIDIVKVLIDHNCDIEVRNRKWNQQPIHMACWDGHLEILKVLLEKNCDIE-SCDEWKRRPIHLACENGHTEIVKFLINLHCDIEAINDKAWRPIHFGCWKGHSDIVKVLVEQNCDIEACDHLKRRPIHLACEKGHTEIVKVLIDHHCDISACGGRFNQSPIHLARKNNFTELIQLLTIH 704
            P+  A  +G  ++V +L+    +I  +  +  +  + +AC  G LE+   L++   D+E  C      P+  A + GH E+VK+L+    ++ A        + + C  GH+D+  +L++   D+E      R P+  A   GH   V+ LI    D++      + + + LA       +++LL  H
Sbjct:  369 PLMEAAREGHEEMVALLLAQGANINAQTEETQETALTLACCGGFLEVADFLIKAGADLELGCST----PLMEAAQEGHLELVKYLLAAGANVHATTATGDTALTYACENGHTDVADLLLQAGADLEHESEGGRTPLMKAARAGHVCTVQFLISKGADVNRATANNDHTVLSLACAGGHLSVVELLLAH 552          

HSP 8 Score: 71.633 bits (174), Expect = 2.850e-14
Identity = 45/188 (23.94%), Postives = 89/188 (47.34%), Query Frame = 3
Query:  135 DRRPIHFACLKGDIDIVKVLIDHNCDIEVRNRKWNQQPIHMACWDGHLEILKVLLEKNCDIESCD-EWKRRPIHLACENGHTEIVKFLINLHCDIEAINDKAWRPIHFGCWKGHSDIVKVLVEQNCDIEACDHLKRRPIHLACEKGHTEIVKVLIDHHCDISACGGRFNQSPIHLARKNNFTELIQLL 695
            D R +  AC  GD++ V+ L+     +     +  +  + +AC  G+ E+ +VLL  + ++E    +    P+  A   G  +IV+ L+    D+ A +      + + C  G+ D+V+VL+E   ++E  +     P+  A   GH E+ ++L++    I+     F +S + LA      E+++ L
Sbjct:  100 DNRSLAEACSDGDVNAVRKLLGEGRSVHETTEE-GESLLCLACSAGYYELAQVLLAMHANVEDRGVKGDITPLMAAASGGFVDIVRLLLAHGADVNAQSSTGNTALTYACAGGYVDVVRVLLEAGANLEDHNESGHTPLMEAASGGHVEVARLLLERGAGINTHSNEFKESALTLACYKGHLEMVRFL 286          

HSP 9 Score: 70.8626 bits (172), Expect = 6.474e-14
Identity = 42/154 (27.27%), Postives = 72/154 (46.75%), Query Frame = 3
Query:  153 FACLKGDIDIVKVLIDHNCDIEVRNRKWNQQPIHMACWDGHLEILKVLLEKNCDIESCDEWKRRPIHLACENGHTEIVKFLINLHCDIEAINDKAWRPIHFGCWKGHSDIVKVLVEQNCDI-EACDHLKRRPIHLACEKGHTEIVKVLIDHHCD 611
             AC  G +++   LI    D+E+        P+  A  +GHLE++K LL    ++ +        +  ACENGHT++   L+    D+E  ++    P+      GH   V+ L+ +  D+  A  +     + LAC  GH  +V++L+ H  D
Sbjct:  406 LACCGGFLEVADFLIKAGADLELGC----STPLMEAAQEGHLELVKYLLAAGANVHATTATGDTALTYACENGHTDVADLLLQAGADLEHESEGGRTPLMKAARAGHVCTVQFLISKGADVNRATANNDHTVLSLACAGGHLSVVELLLAHGAD 555          

HSP 10 Score: 57.3806 bits (137), Expect = 5.622e-10
Identity = 43/156 (27.56%), Postives = 71/156 (45.51%), Query Frame = 3
Query:  144 PIHFACLKGDIDIVKVLIDHNCDIEVRNRKWNQQPIHMACWDGHLEILKVLLEKNCDIESCDEWKRRPIHLACENGHTEIVKFLINLHCDI-EAINDKAWRPIHFGCWKGHSDIVKVLVEQNCDIEACDHLKRRPIHL--ACEKGHTEIVKVLIDH 602
            P+  A  +G +++VK L+    ++           +  AC +GH ++  +LL+   D+E   E  R P+  A   GH   V+FLI+   D+  A  +     +   C  GH  +V++L+    D      LK     L  A + GHT +V  LID+
Sbjct:  433 PLMEAAQEGHLELVKYLLAAGANVHATTAT-GDTALTYACENGHTDVADLLLQAGADLEHESEGGRTPLMKAARAGHVCTVQFLISKGADVNRATANNDHTVLSLACAGGHLSVVELLLAHGADPN--HRLKDGSTMLIEAAKGGHTSVVCYLIDY 585          

HSP 11 Score: 22.3274 bits (46), Expect = 5.622e-10
Identity = 9/26 (34.62%), Postives = 15/26 (57.69%), Query Frame = 2
Query:    2 PIHLAFDNNHREIVKLLIEENCDVNA 79
            P+  A    H E+V LL+ +  ++NA
Sbjct:  369 PLMEAAREGHEEMVALLLAQGANINA 394          
BLAST of SMED30015660 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000007954.1 (pep scaffold:Pmarinus_7.0:GL479092:583:36301:1 gene:ENSPMAG00000007165.1 transcript:ENSPMAT00000007954.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 85.1149 bits (209), Expect = 8.954e-19
Identity = 48/188 (25.53%), Postives = 96/188 (51.06%), Query Frame = 3
Query:  135 DRRPIHFACLKGDIDIVKVLIDHNCDIEVRNRKWNQQPIHMACWDGHLEILKVLLEKNCDIESCDEWKRRPIHLACENGHTEIVKFLINLHCDIEAINDKAWRPIHFGCWKGHSDI-VKVLVEQNCDIEACDHLKRRPIHLACEKGHTEIVKVLIDHHCDISACGGRFNQSPIHLARKNNFTELIQLL 695
            +RR +H+A   G  ++VK+L+ +  D+  +++K    P+H A   GH+ ++++LL    ++   + +    +H+AC NG   +V  L++   D    N++ +  +HF     H  I +++LV  + D+ A  +  + P+H+    G     + LI +  +I  CG +   +P+H+A +     LI  L
Sbjct:   80 ERRAVHWAGYMGHTEVVKMLLSNGADVNWKDKK-GYTPLHAAAASGHVTVVRLLLSLKAEMNEFNGFGNTALHVACHNGQDAVVSELLDAGADAGHRNERGFTALHFAAASTHGAICLELLVNHHADVNAQSYDGKSPLHMTAIHGRFTRSQTLIQNGGEID-CGDKEGNTPLHIAARYGHELLINTL 265          

HSP 2 Score: 81.2629 bits (199), Expect = 1.543e-17
Identity = 43/156 (27.56%), Postives = 80/156 (51.28%), Query Frame = 3
Query:  144 PIHFACLKGDIDIVKVLIDHNCDIEVRNRKWNQQPIHMACWDGHLEILKVLLEKNCDIESCDEWKRRPIHLACENGHTEIVKFLINLHCDIEAINDKAWRPIHFGCWKGHSDIVKVLVEQNCDIEACDHLKRRPIHLACEKGHTEIVKVLIDHHCD 611
            P+H A     I     LI    ++ V +R   +  +H A ++G+LE++ +L+ K  ++ + D+ +RR +H A   GHTE+VK L++   D+   + K + P+H     GH  +V++L+    ++   +      +H+AC  G   +V  L+D   D
Sbjct:   17 PLHVASANRAIKCADALIPLLSNVNVSDRA-GRTALHHAAFNGNLEMVNLLISKGANVNAMDKRERRAVHWAGYMGHTEVVKMLLSNGADVNWKDKKGYTPLHAAAASGHVTVVRLLLSLKAEMNEFNGFGNTALHVACHNGQDAVVSELLDAGAD 171          

HSP 3 Score: 78.9518 bits (193), Expect = 1.174e-16
Identity = 41/156 (26.28%), Postives = 81/156 (51.92%), Query Frame = 3
Query:  201 HNCDIEVRNRKWNQQPIHMACWDGHLEILKVLLEKNCDIESCDEWKRRPIHLACENGHTEIVKFLINLHCDIEAINDKAWRPIHFGCWKGHSDIVKVLVEQNCDIEACDHLKRRPIHLACEKGHTEIVKVLIDHHCDISACGGRFNQSPIHLARKN 668
            H  D+  R++ W Q P+H+A  +  ++    L+    ++   D   R  +H A  NG+ E+V  LI+   ++ A++ +  R +H+  + GH+++VK+L+    D+   D     P+H A   GH  +V++L+    +++   G F  + +H+A  N
Sbjct:    3 HAADVNARDKNW-QTPLHVASANRAIKCADALIPLLSNVNVSDRAGRTALHHAAFNGNLEMVNLLISKGANVNAMDKRERRAVHWAGYMGHTEVVKMLLSNGADVNWKDKKGYTPLHAAAASGHVTVVRLLLSLKAEMNEFNG-FGNTALHVACHN 156          

HSP 4 Score: 63.1586 bits (152), Expect = 1.686e-11
Identity = 38/157 (24.20%), Postives = 72/157 (45.86%), Query Frame = 3
Query:  147 IHFACLKGDIDI-VKVLIDHNCDIEVRNRKWNQQPIHMACWDGHLEILKVLLEKNCDIESCDEWKRRPIHLACENGHTEIVKFLINLHCDIEAINDKAWRPIHFGCWKGHSDIVKVLVEQNCDIEACDHLKRRPIHLACEKGHTEIVKVLIDHHCDI 614
            +HFA       I +++L++H+ D+  ++    + P+HM    G     + L++   +I+  D+    P+H+A   GH  ++  LI+   D          P+H     G SD  + L+    D++A D   R  +H A   G+ E + +L+    D+
Sbjct:  183 LHFAAASTHGAICLELLVNHHADVNAQSYD-GKSPLHMTAIHGRFTRSQTLIQNGGEIDCGDKEGNTPLHIAARYGHELLINTLISNGADAARRGSHGMFPLHLAALSGFSDCCRKLLTPGFDVDAVDEFGRTCLHAAAAGGNAECINLLLSSGADL 338          

HSP 5 Score: 60.8474 bits (146), Expect = 1.154e-10
Identity = 44/156 (28.21%), Postives = 76/156 (48.72%), Query Frame = 3
Query:  246 PIHMACWDGHLEILKVLLEK-NCDIESCDEWK-RRPIHLACENGHTEIVKFLINLHCDIEAINDKAWRPIHFGCWKGHSDIVKVLVEQN-CDIEACDHLKRRPIHLACEKGHTEIVKVLIDHHCDISA---CGGRFNQSPIHLARKNNFTELIQLL 695
            P+H A  + +    ++L++     I  C + K R P+H A    + E  + L++    ++A + +   P+  G  +G S IV+ LV     D+   D  K   +HLAC KGH E   +L+    ++ A   C  R   +P+HLA +N  + ++Q L
Sbjct:  688 PLHCAVMNDNESCAEMLIDAMGAKIVMCQDGKGRTPLHAAAFADNVECAQLLLSHGARVDATDRRGRTPLMTGALQGQSGIVEYLVNNTKGDLSLTDDKKNTALHLACGKGH-ETCALLLLEKVEVVALIDCPNRNQHTPLHLAARNGLSTVVQDL 842          

HSP 6 Score: 58.9214 bits (141), Expect = 4.080e-10
Identity = 36/134 (26.87%), Postives = 73/134 (54.48%), Query Frame = 3
Query:  297 LEKNCDIESCDEWKRRPIHLACENGHTEIVKFLINLHCDIEAINDKAWR-PIHFGCWKGHSDIVKVLVEQNCDIEACDHLKRRPIHLACEKGHTEIVKVLIDHHCDISACGGRFNQSPIHLARKNNFTELIQLL 695
            L    D+ + D+  + P+H+A  N   +    LI L  ++  ++D+A R  +H   + G+ ++V +L+ +  ++ A D  +RR +H A   GHTE+VK+L+ +  D++    +   +P+H A  +    +++LL
Sbjct:    1 LRHAADVNARDKNWQTPLHVASANRAIKCADALIPLLSNVN-VSDRAGRTALHHAAFNGNLEMVNLLISKGANVNAMDKRERRAVHWAGYMGHTEVVKMLLSNGADVN-WKDKKGYTPLHAAAASGHVTVVRLL 132          

HSP 7 Score: 48.521 bits (114), Expect = 1.228e-6
Identity = 40/126 (31.75%), Postives = 61/126 (48.41%), Query Frame = 3
Query:  246 PIHMACWDGHLEILKVLLEKNCDIESCDEWKRRPIHLACENGHTEIVKFLI-NLHCDIEAINDKAWR-PIHFGCWKGHSDIVKVLVEQNCDIEACDHLK------RRPIHLACEKGHTEIVKVLID 599
            P+H+A + GH + L+VLL    + +  D   R P+ LA   GHTE V+ L+ N  C   +    A R P+H     G S + ++L      I+    +       R P+ LA   GHT+ V +L+D
Sbjct:  462 PLHLAAYHGHHQALEVLLRFVGEADLRDGHGRAPLELAAARGHTECVETLLANGACAGASSGTAAKRCPLHSA---GGSAVAELLTIGKSRIKILGSINLFVRTDRTPLMLAVTNGHTDCVLLLMD 584          
BLAST of SMED30015660 vs. Ensembl Yeast
Match: AKR1 (Palmitoyl transferase involved in protein palmitoylation; acts as a negative regulator of pheromone response pathway; required for endocytosis of pheromone receptors; involved in cell shape control; contains ankyrin repeats; AKR1 has a paralog, AKR2, that arose from the whole genome duplication; any of several human homologs encoding DHHC-type zinc fingers (ZDHHC) can complement temperature sensitivity of yeast akr1 null mutant [Source:SGD;Acc:S000002672])

HSP 1 Score: 57.7658 bits (138), Expect = 7.105e-10
Identity = 37/161 (22.98%), Postives = 70/161 (43.48%), Query Frame = 3
Query:  147 IHFACLKGDIDIVKVLIDHNCDIEVRNRKWNQQPIHMACWDGHLEILKVLLEKNCDIESCDEWKRRPIHLACENGHTEIVKF-LINL----HCDIEAINDKAWRPIHFGCWKGHSDIVKVLVEQNCDIEACDHLKRRPIHLACEKGHTEIVKVLIDHHCDI 614
            +H+A +   + +V  L+    D+  R    +  P+H A   G++ I+  LL+   D    D+     +HL+  + +  +V + L N+      DI+  + K    + +  ++G S  V  L++    I+  D     P+H    KG   ++K LI    D 
Sbjct:  113 LHWASINNRLSVVDFLVSQGADVNARAGALHATPLHWAARYGYVYIVDFLLKHGADPTMTDDQGFNLLHLSVNSSNIMLVLYVLFNVVSKGLLDIDCRDPKGRTSLLWAAYQGDSLTVAELLKFGASIKIADTEGFTPLHWGTVKGQPHVLKYLIQDGADF 273          
BLAST of SMED30015660 vs. Ensembl Yeast
Match: NAS6 (Evolutionarily conserved 19S regulatory particle assembly-chaperone; proteasome-interacting protein involved in the assembly of the base subcomplex of the 19S proteasomal regulatory particle (RP); ortholog of human oncoprotein gankyrin, also known as p28, which interacts with the Rb tumor suppressor and CDK4/6 [Source:SGD;Acc:S000003464])

HSP 1 Score: 53.9138 bits (128), Expect = 4.132e-9
Identity = 43/190 (22.63%), Postives = 84/190 (44.21%), Query Frame = 3
Query:  144 PIHFACLKGDIDIVKVLIDHNCDIEVRNRKWNQQPIHMACWDGHLEILKVLLEKNCDI---ESCDEWKRRPIHLACENGHTEIVKFLIN--LHCDIEAINDKAWRPIHFGCWKGHSDIVKVLVEQNCDIEACDHLKRRPIHLACEKGHTEIVKVLIDHHCDISACGGRFNQSPIHLARKNNFTELIQLLT 698
            P+H AC++ +   V+ L+     + ++  +  + P+H +      EI   LL K  ++   +  D+    P H+AC  G+ E+VK L +  L  D+  I ++    +H    K   ++ + L+E    +   D   + P+H A   G  +++++L         CG    +S ++   K  +T L   L 
Sbjct:    5 PLHQACMENEFFKVQELLHSKPSLLLQKDQDGRIPLHWSVSFQAHEITSFLLSKMENVNLDDYPDDSGWTPFHIACSVGNLEVVKSLYDRPLKPDLNKITNQGVTCLHLAVGKKWFEVSQFLIENGASVRIKDKFNQIPLHRAASVGSLKLIELL---------CG--LGKSAVNWQDKQGWTPLFHALA 183          

HSP 2 Score: 53.5286 bits (127), Expect = 6.376e-9
Identity = 34/123 (27.64%), Postives = 59/123 (47.97%), Query Frame = 3
Query:  144 PIHFACLKGDIDIVKVLIDHNCDIEVRNRKWNQQP--IHMACWDGHLEILKVLLEKNCDIESCDEWKRRPIHLACENGHTEIVKFLINLHCDIEAINDK-AWRPIHFGCWKGHSDIVKVLVEQ 503
            P H AC  G++++VK L D     ++ N+  NQ    +H+A      E+ + L+E    +   D++ + P+H A   G  ++++ L  L        DK  W P+     +GH D   +LVE+
Sbjct:   75 PFHIACSVGNLEVVKSLYDRPLKPDL-NKITNQGVTCLHLAVGKKWFEVSQFLIENGASVRIKDKFNQIPLHRAASVGSLKLIELLCGLGKSAVNWQDKQGWTPLFHALAEGHGDAAVLLVEK 196          
BLAST of SMED30015660 vs. Ensembl Yeast
Match: HOS4 (Subunit of the Set3 complex; complex is a meiotic-specific repressor of sporulation specific genes that contains deacetylase activity; potential Cdc28p substrate [Source:SGD;Acc:S000001374])

HSP 1 Score: 51.2174 bits (121), Expect = 9.035e-8
Identity = 34/103 (33.01%), Postives = 54/103 (52.43%), Query Frame = 3
Query:  138 RRPIHFACLKGDIDIVKVLIDHN-CDIEVRNRKWNQQPIHMACWDGHLEILKVLLEKNCD--IESCDEWKRRPIHLACENGHTEIVKFLINLHCDIEAINDKA 437
            R  +  AC KG  D+VK +I+    DI  ++   N   +H A   GH+EI+++L+E   D  I+S + +   P+  A  NGH ++VK+L+    D    N K 
Sbjct:  331 RTRLQIACDKGKYDVVKKMIEEGGYDINDQDNAGNTA-LHEAALQGHIEIVELLIENGADVNIKSIEMFGDTPLIDASANGHLDVVKYLLKNGADPTIRNAKG 432          
BLAST of SMED30015660 vs. Ensembl Yeast
Match: MGA2 (ER membrane protein involved in regulation of OLE1 transcription; inactive ER form dimerizes and one subunit is then activated by ubiquitin/proteasome-dependent processing followed by nuclear targeting; MGA2 has a paralog, SPT23, that arose from the whole genome duplication [Source:SGD;Acc:S000001472])

HSP 1 Score: 46.595 bits (109), Expect = 2.693e-6
Identity = 24/73 (32.88%), Postives = 36/73 (49.32%), Query Frame = 3
Query:  297 LEKNCDIESCDEWKRRPIHLACENGHTEIVKFLINLHCDIEAINDKAWRPIHFGCWKGHSDIVKVLVEQNCDI 515
            L  N +I  CD   R  +HLAC   ++ +V  LI     +  I+     P+HF C  G   I+K+L+  NC +
Sbjct:  707 LNINSNISICDSLGRTLLHLACLKNYSSLVYTLIKKGARVNDIDSFGLTPLHFACISGDPKIIKMLL--NCKV 777          
BLAST of SMED30015660 vs. Ensembl Yeast
Match: GDE1 (Glycerophosphocholine (GroPCho) phosphodiesterase; hydrolyzes GroPCho to choline and glycerolphosphate, for use as a phosphate source and as a precursor for phosphocholine synthesis; may interact with ribosomes [Source:SGD;Acc:S000006031])

HSP 1 Score: 46.595 bits (109), Expect = 2.905e-6
Identity = 35/134 (26.12%), Postives = 63/134 (47.01%), Query Frame = 3
Query:  327 DEWKRRPIHLACENGHTEIVKFLINLHC-----------DIEAIND-KAWRPIHFGCWKGHSDIVKVLVEQ---NCDIEACDHLKRRPIHLACEKGHTEIVKVLI-DHHCDISACGGRFNQSPIHLARKNNFTE 680
            D +KR P+H +C+ G +E+ K +I L             D+ A  D ++  P+H      H    +VL++    N  +++   L     HLA E  +  ++ VL+     DI+      +++P++LA + NF E
Sbjct:  425 DNYKRTPLHYSCQYGLSEVTKLIIKLMKEWNIWNEIPIDDVSAFGDAESLTPLHLCVLGAHPKTTEVLLQSLDPNVKLKSSSLL-----HLATEWNNYPLLHVLLSSKRFDINYQDNELHETPLYLACRLNFFE 553          
BLAST of SMED30015660 vs. Ensembl Nematostella
Match: EDO38725 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SC11])

HSP 1 Score: 74.7146 bits (182), Expect = 6.118e-16
Identity = 43/159 (27.04%), Postives = 72/159 (45.28%), Query Frame = 3
Query:  144 PIHFACLKGDIDIVKVLIDHNCDIEVRNRKWNQQPIHMACWDGHLEILKVLLEKNCDIESCDEWKRRPIHLACENGHTEIVKFLINLHCDIEAINDKAWRPIHFGCWKGHSDIVKVLVEQNCDIEACDHLKRRPIHLACEKGHTEIVKVLIDHHCDISA 620
            P+H AC KG +++ ++L++    ++ +N K  + P+HMA   G  + LK LL K   I+  D   R P   A   G TE    L+         ++    P+H  C  G +  V+ L          D   +  +H+A   G  ++V  L+ +  DI+A
Sbjct:   39 PLHVACKKGSMEVGRLLVEKGAALDKKNDK-GETPLHMAACIGSFDALKFLLSKGVAIDERDFSHRTPFLSAVAAGRTENAMLLLE-------KDENQKSPLHLACAAGRALHVEALTRAGLSTNERDEEGQSALHMAALSGFRKVVTQLLRYGADINA 189          

HSP 2 Score: 56.6102 bits (135), Expect = 1.175e-9
Identity = 38/153 (24.84%), Postives = 73/153 (47.71%), Query Frame = 3
Query:  240 QQPIHMACWDGHLEILKVLLEKNCDIESCDEWKRRPIHLACENGHTEIVKFLINLHCDIEAINDKAWRPIHFGCWKGHSDIVKVLVEQNCDIEACDHLKRRPIHLACEKGHTEIVKVLIDHHCDISACGGRFNQSPIHLARKNNFTELI-QLL 695
              P+H+AC  G +E+ ++L+EK   ++  ++    P+H+A   G  + +KFL++    I+  +     P       G ++   +L+E+       D  ++ P+HLAC  G    V+ L       +       QS +H+A  + F +++ QLL
Sbjct:   37 STPLHVACKKGSMEVGRLLVEKGAALDKKNDKGETPLHMAACIGSFDALKFLLSKGVAIDERDFSHRTPFLSAVAAGRTENAMLLLEK-------DENQKSPLHLACAAGRALHVEALTRAGLSTNERDEE-GQSALHMAALSGFRKVVTQLL 181          
BLAST of SMED30015660 vs. Ensembl Nematostella
Match: EDO28178 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7T774])

HSP 1 Score: 73.1738 bits (178), Expect = 1.562e-15
Identity = 35/120 (29.17%), Postives = 63/120 (52.50%), Query Frame = 3
Query:  162 LKGDIDIVKVLIDHNCDIEVRNRKWNQQPIHMACWDGHLEILKVLLEKNCDIESCDEWKRRPIHLACENGHTEIVKFLINLHCDIEAINDKAWR-PIHFGCWKGHSDIVKVLVEQNCDIE 518
            L G + +  +L+DH  +I V +      P+  ACW GH +++++LL ++ +IE   +    P+  A   GHT++   L+     +   +      P+   CWKGH D+VK+L++   +IE
Sbjct:   62 LAGHVKVATMLLDHGAEINVESDSNKDSPLTFACWKGHCDVVELLLARSANIEHRTKEGFTPLMFAALGGHTDVAAKLLEQGAKVNIPSGSNNDIPLTSACWKGHHDVVKLLLKYTSNIE 181          

HSP 2 Score: 63.1586 bits (152), Expect = 6.244e-12
Identity = 35/128 (27.34%), Postives = 63/128 (49.22%), Query Frame = 3
Query:  237 NQQPIHMACWDGHLEILKVLLEKNCDIE-SCDEWKRRPIHLACENGHTEIVKFLINLHCDIEAINDKAWRPIHFGCWKGHSDIVKVLVEQNCDIEACDHLKRR-PIHLACEKGHTEIVKVLIDHHCDI 614
            N + +      GH+++  +LL+   +I    D  K  P+  AC  GH ++V+ L+    +IE    + + P+ F    GH+D+   L+EQ   +          P+  AC KGH ++VK+L+ +  +I
Sbjct:   53 NNKTMSRDALAGHVKVATMLLDHGAEINVESDSNKDSPLTFACWKGHCDVVELLLARSANIEHRTKEGFTPLMFAALGGHTDVAAKLLEQGAKVNIPSGSNNDIPLTSACWKGHHDVVKLLLKYTSNI 180          

HSP 3 Score: 50.8322 bits (120), Expect = 1.054e-7
Identity = 30/106 (28.30%), Postives = 50/106 (47.17%), Query Frame = 3
Query:  144 PIHFACLKGDIDIVKVLIDHNCDIEVRNRKWNQQPIHMACWDGHLEILKVLLEKNCDIE-SCDEWKRRPIHLACENGHTEIVKFLINLHCDIEAINDKAWRPIHFG 458
            P+ FAC KG  D+V++L+  + +IE R ++    P+  A   GH ++   LLE+   +          P+  AC  GH ++VK L+    +IE        P+   
Sbjct:   90 PLTFACWKGHCDVVELLLARSANIEHRTKE-GFTPLMFAALGGHTDVAAKLLEQGAKVNIPSGSNNDIPLTSACWKGHHDVVKLLLKYTSNIEHRTKDGCTPLMLA 194          
BLAST of SMED30015660 vs. Ensembl Nematostella
Match: EDO38702 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SC57])

HSP 1 Score: 75.485 bits (184), Expect = 1.942e-15
Identity = 42/145 (28.97%), Postives = 78/145 (53.79%), Query Frame = 3
Query:  186 KVLIDHNCDIEVRNRKWNQQPIHMACWDGHLEILKVLLEKN-CDIESCDEWKRRPIHLACENGHTEIVKFLINLHCDIEAINDKAWRPIHFGCWKGHSDIVKVLVEQNCDIEACDHLKRRPIHLACEKGHTEIVKVLIDHHCDIS 617
            ++L+D+   I+ +N + +  PIH A   G +  +  LL+++   I   D     P+HLA  +GH  +VK L+     I+A N   W P+     +G  ++  +L++++  ++  D  K  P+HLA  +GH E+VK+L+    +I+
Sbjct:  267 QLLLDNGACIDSKNDE-DITPIHYAAKFGRVRTVCALLKRDPAIINDEDGASNTPLHLAALHGHAAVVKELLYRGGAIDARNATLWTPLDCAAARGMVEVANILLDEDAPVDPTDKAKTTPLHLASREGHVEMVKLLLSRKANIT 410          

HSP 2 Score: 72.4034 bits (176), Expect = 1.948e-14
Identity = 40/156 (25.64%), Postives = 72/156 (46.15%), Query Frame = 3
Query:  135 DRRPIHFACLKGDIDIVKVLIDHNCDIEVRNRKWNQQPIHMACWDGHLEILKVLLEKNCDIESCDEWKRRPIHLACENGHTEIVKFLINLHCDIEAINDKAWRPIHFGCWKGHSDIVKVLVEQNCDIEACDHLKRRPIHLACEKGHTEIVKVLIDH 602
            D  PIH+A   G +  V  L+  +  I       +  P+H+A   GH  ++K LL +   I++ +     P+  A   G  E+   L++    ++  +     P+H    +GH ++VK+L+ +  +I   D   R  + +A E  H E+   +IDH
Sbjct:  283 DITPIHYAAKFGRVRTVCALLKRDPAIINDEDGASNTPLHLAALHGHAAVVKELLYRGGAIDARNATLWTPLDCAAARGMVEVANILLDEDAPVDPTDKAKTTPLHLASREGHVEMVKLLLSRKANITLTDSAGRNCLDIAIESSHKEVAVAIIDH 438          

HSP 3 Score: 57.7658 bits (138), Expect = 1.698e-9
Identity = 42/168 (25.00%), Postives = 76/168 (45.24%), Query Frame = 3
Query:  231 KWNQQPIHMACWDGHLEILKVLLEKNCDIESCDEWKRRPIHLACENGHTEIVKFLINLHCDIEAINDKAWRPIHFGCWKGHSDIVKVLVEQNCDIEACDHLKRRPIHLACEKGHTEIVKVLIDHHCDISACGGRFNQS---PIHLARKNNFTELIQLLTIHE*KYLRF 725
            K    P+H+AC  G + + K L+E   D+ S DE +  P+H AC  G+  + K L                 +      G S + K++ +Q       D  ++  +HLA E GH ++ K+ ++   +++A     N++    I +AR+  F     ++ + + KYL F
Sbjct:    2 KTQMTPLHVACSHGCIPVAKCLVEAGADLRSLDEEQMTPLHFACMEGNLGVAKLLF----------------VAAELRGGWSTVSKMVTDQ-------DREEQTALHLAVEGGHGDLAKLCLEKGANVNAVKESKNKTFHKTIVVARECIFV----MIKVSKLKYLSF 142          

HSP 4 Score: 52.373 bits (124), Expect = 9.674e-8
Identity = 46/203 (22.66%), Postives = 81/203 (39.90%), Query Frame = 3
Query:  144 PIHFACLKGDIDIVKVLIDHNCDIEVRNRKWNQQPIHMACWDGHLEILKVLL----------EKNCDIESCDEWKRRPIHLACENGHTEIVKFLINLHCDIEAINDKAWRPIH----------FGCWKGHS---------------------DIVKV---LVEQNCDIEACDHLKRRPIHLACEKGHTEIVKVLIDHHCDISA 620
            P+H AC  G I + K L++   D+   + +    P+H AC +G+L + K+L             +  +   D  ++  +HLA E GH ++ K  +    ++ A+ +   +  H          F   K                        D+V +   ++     IE  D  K  P+ +A EK H + V+ L+ H  DI+A
Sbjct:    7 PLHVACSHGCIPVAKCLVEAGADLRSLDEE-QMTPLHFACMEGNLGVAKLLFVAAELRGGWSTVSKMVTDQDREEQTALHLAVEGGHGDLAKLCLEKGANVNAVKESKNKTFHKTIVVARECIFVMIKVSKLKYLSFCKSEKIKREILLYFFDVVIIICYIIRFRACIECRDKDKDTPLMIAAEKNHVDTVRTLLQHGADIAA 208          
BLAST of SMED30015660 vs. Ensembl Nematostella
Match: EDO46099 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RR35])

HSP 1 Score: 70.4774 bits (171), Expect = 5.151e-15
Identity = 43/152 (28.29%), Postives = 73/152 (48.03%), Query Frame = 3
Query:  249 IHMACWDGHLEILKVLLEKNCDIESCDEWKRRPIHLACENGHTEIVKFLINLHCDIEAINDKAWR---PIHFGCWKGHSD-IVKVLVEQNCDIEACDHLKRRPIHLACEKGHTEIVKVLIDHHCDISACGGRFNQSPIHLARKNNFTELIQL 692
            +H A   G+ + +++LL+    +     +  RPIH A  NGHTE V+ L+       A   K  R   P+H+    GH D  V++L+E+  D+EA      R IH+A + G  +++  L+D   DI +       + +H+A +     +  L
Sbjct:    1 LHYAARYGNEKCIELLLKSGAKLNVPQRYGWRPIHEAAMNGHTECVRMLLRYGSHANAKTGKTIRNMTPLHYAARMGHLDCAVRMLMERGIDLEAVYRDGWRLIHVASDNGRVKVLVTLLDAGVDIESKTYERRLTAVHVAARQGQVTMTTL 152          

HSP 2 Score: 64.6994 bits (156), Expect = 6.658e-13
Identity = 39/153 (25.49%), Postives = 72/153 (47.06%), Query Frame = 3
Query:  147 IHFACLKGDIDIVKVLIDHNCDIEVRNRKWNQQPIHMACWDGHLEILKVLLEKNCDIESCDEWKRR---PIHLACENGHTE-IVKFLINLHCDIEAINDKAWRPIHFGCWKGHSDIVKVLVEQNCDIEACDHLKR-RPIHLACEKGHTEIVKV 590
            +H+A   G+   +++L+     + V  R +  +PIH A  +GH E +++LL       +      R   P+H A   GH +  V+ L+    D+EA+    WR IH     G   ++  L++   DIE+  + +R   +H+A  +G   +  +
Sbjct:    1 LHYAARYGNEKCIELLLKSGAKLNVPQR-YGWRPIHEAAMNGHTECVRMLLRYGSHANAKTGKTIRNMTPLHYAARMGHLDCAVRMLMERGIDLEAVYRDGWRLIHVASDNGRVKVLVTLLDAGVDIESKTYERRLTAVHVAARQGQVTMTTL 152          
BLAST of SMED30015660 vs. Ensembl Nematostella
Match: EDO39113 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SB41])

HSP 1 Score: 70.8626 bits (172), Expect = 7.979e-15
Identity = 41/154 (26.62%), Postives = 77/154 (50.00%), Query Frame = 3
Query:  144 PIHFACLKGDIDIVKVLIDHNCDIEVRNRKWNQQ--PIHMACWDGHLEILKVLLEKNCDIESCDEWKRRPIHLACENGHTEIVKFLI-NLHCDIEAINDKAWRPIHFGCWKGHSDIVKVLVEQNCDIEACDHLKRRPIHLACEKGHTEIVKVLI 596
            P+H+A     +DIV++L+D   D++VR     Q+  PI  A     +E  +VLL    D+   + + +  +H A   GH+++V+ L+ +   D+  ++      +H     G + I+K L+    +I A D+      HLA  +G  E+++ L+
Sbjct:   32 PLHYATTTNHVDIVQMLLDAGADVDVRGSPSIQRIPPIICAAKFNAIESCRVLLRAGADVNITNCYGQTALHHATRRGHSKMVELLLRDGQMDVNVVDRDNTTSLHVAAMIGSNPIIKTLLFCGANITAKDNDGFTAFHLAAREGEEEVLQTLL 185          

HSP 2 Score: 51.2174 bits (121), Expect = 6.876e-8
Identity = 45/184 (24.46%), Postives = 79/184 (42.93%), Query Frame = 3
Query:  156 ACLKGDIDIVKVLIDHNCDIEVRNRKWNQQPIHMACWDGHLEILKVLLEKNCDIE---SCDEWKRRPIHLACENGHTEIVKFLINLHCDIEAINDKAWRPIHFGCWKGHSDIVKVLV-EQNCDIEACDHLKRRPIHLACEKGHTEIVKVLIDHHCDISACGGRFNQSPIHLARKNNFTELIQLL 695
            AC  G  D V+ L+  N             P+H A    H++I+++LL+   D++   S    +  PI  A +    E  + L+    D+   N      +H    +GHS +V++L+ +   D+   D      +H+A   G   I+K L+    +I+A       +  HLA +    E++Q L
Sbjct:    2 ACRDGRKDCVRKLLRGNLTNLNTLDADGFSPLHYATTTNHVDIVQMLLDAGADVDVRGSPSIQRIPPIICAAKFNAIESCRVLLRAGADVNITNCYGQTALHHATRRGHSKMVELLLRDGQMDVNVVDRDNTTSLHVAAMIGSNPIIKTLLFCGANITAKDND-GFTAFHLAAREGEEEVLQTL 184          
BLAST of SMED30015660 vs. Ensembl Medaka
Match: ripk4 (receptor interacting serine/threonine kinase 4 [Source:NCBI gene;Acc:101174941])

HSP 1 Score: 104.375 bits (259), Expect = 1.038e-24
Identity = 57/193 (29.53%), Postives = 100/193 (51.81%), Query Frame = 3
Query:  138 RRPIHFACLKGDIDIVKVLIDHNCDIEVRNRKWNQQPIHMACWDGHLEILKVLLEK-NCDIESCDEWKRRPIHLACENGHTEIVKFLINLHCDIEAINDKAWRPIHFGCWKGHSDIVKVLVEQNCDIEACDHLKRRPIHLACEKGHTEIVKVLIDHHCDISACGGRFNQ---SPIHLARKNNFTELIQLLTIH 704
            R P H AC  G  ++++VL+    D++++ +  N   +H A W GHL I+K+L+++   D++      R  +HLA + G   + + LI L   +   +     P+H     GH+   ++L++   D+ A +     P+HLAC++GH   VK+LI    D S    R +Q   +P HLA  +   E+++ L +H
Sbjct:  543 RTPAHVACQHGQENVIRVLLSRGADVQIKGKD-NWTALHFAAWQGHLGIVKLLVKQAGADVDGQTSDGRTSLHLASQRGQYRVARILIELGASVHLTSVGLNTPLHVAAETGHTSTSRLLIKHKADMHAQNTQGLTPLHLACQRGHLATVKMLIAEGADPS----RPSQTLCTPCHLAAGSGHCEVLKELLLH 730          

HSP 2 Score: 92.4337 bits (228), Expect = 1.500e-20
Identity = 51/190 (26.84%), Postives = 95/190 (50.00%), Query Frame = 3
Query:  144 PIHFACLKGDIDIVKVLIDHNCDIEVRNRKWNQ-QPIHMACWDGHLEILKVLLEKNCDIESCDEWKRRPIHLACENGHTEIVKFLINLHCDIEAINDKAWRPIHFGCWKGHSDIVKVLVEQ-NCDIEACDHLKRRPIHLACEKGHTEIVKVLIDHHCDISACGGRFNQSPIHLARKNNFTELIQLLTIHE 707
            P+H A  K    + ++L+     + V  +  +Q   +H A  +G   I ++LL++   I   D   R P H+AC++G   +++ L++   D++      W  +HF  W+GH  IVK+LV+Q   D++      R  +HLA ++G   + ++LI+    +       N +P+H+A +   T   +LL  H+
Sbjct:  478 PLHLATEKHQKPLAELLLGRRS-MNVNAKDEDQFTALHWAAQNGDEAIARLLLDRGAAINETDGQGRTPAHVACQHGQENVIRVLLSRGADVQIKGKDNWTALHFAAWQGHLGIVKLLVKQAGADVDGQTSDGRTSLHLASQRGQYRVARILIELGASVHLTSVGLN-TPLHVAAETGHTSTSRLLIKHK 665          
BLAST of SMED30015660 vs. Ensembl Medaka
Match: ank1a (ankyrin-1 [Source:NCBI gene;Acc:101174837])

HSP 1 Score: 100.908 bits (250), Expect = 1.963e-23
Identity = 56/188 (29.79%), Postives = 97/188 (51.60%), Query Frame = 3
Query:  144 PIHFACLKGDIDIVKVLIDHNCDIEVRNRKWNQQPIHMACWDGHLEILKVLLEKNCDIESCDEWKRRPIHLACENGHTEIVKFLINLHCDIEAINDKAWRPIHFGCWKGHSDIVKVLVEQNCDIEACDHLKRRPIHLACEKGHTEIVKVLIDHHCDISACGGRFNQSPIHLARKNNFTELIQLLTIHE 707
            PIH A     +D VK L+ +N +I+      +  P+H+A   GH  + KVLL+K     S       P+H+AC+  H  ++  L+     IEA+ +    P+H   + GH +IVK+L+++     A +     P+H+A   GH E+ + L+ +   + A   + +Q+P+H A +    EL++LL  H+
Sbjct:  246 PIHMAAQGDHMDCVKQLLQYNAEIDDITLD-HLTPLHVAAHCGHHRMAKVLLDKGAKPNSRALNGFTPLHIACKKNHLRVMDLLLKHSASIEAVTESGLTPLHVASFMGHLNIVKILLQKGASPSASNVKVETPLHMASRSGHFEVAEFLLQNAAPVDA-KAKDDQTPLHCAARMGHKELVKLLLEHK 431          

HSP 2 Score: 100.138 bits (248), Expect = 3.426e-23
Identity = 51/184 (27.72%), Postives = 96/184 (52.17%), Query Frame = 3
Query:  144 PIHFACLKGDIDIVKVLIDHNCDIEVRNRKWNQQPIHMACWDGHLEILKVLLEKNCDIESCDEWKRRPIHLACENGHTEIVKFLINLHCDIEAINDKAWRPIHFGCWKGHSDIVKVLVEQNCDIEACDHLKRRPIHLACEKGHTEIVKVLIDHHCDISACGGRFNQSPIHLARKNNFTELIQLL 695
            P+H AC K  + ++ +L+ H+  IE         P+H+A + GHL I+K+LL+K     + +     P+H+A  +GH E+ +FL+     ++A       P+H     GH ++VK+L+E   +  +       P+H+A  +GH + V++L+D     +    +   +P+H+A K    ++ +LL
Sbjct:  312 PLHIACKKNHLRVMDLLLKHSASIEAVTES-GLTPLHVASFMGHLNIVKILLQKGASPSASNVKVETPLHMASRSGHFEVAEFLLQNAAPVDAKAKDDQTPLHCAARMGHKELVKLLLEHKANPNSTTTAGHSPLHIAAREGHVQTVRLLLDMEAQQTKMTKK-GFTPLHVASKYGKVDVAELL 493          

HSP 3 Score: 95.1301 bits (235), Expect = 1.758e-21
Identity = 55/185 (29.73%), Postives = 94/185 (50.81%), Query Frame = 3
Query:  144 PIHFACLKGDIDIVKVLIDHNCDIEVRNRKWNQ-QPIHMACWDGHLEILKVLLEKNCDIESCDEWKRRPIHLACENGHTEIVKFLINLHCDIEAINDKAWRPIHFGCWKGHSDIVKVLVEQNCDIEACDHLKRRPIHLACEKGHTEIVKVLIDHHCDISACGGRFNQSPIHLARKNNFTELIQLL 695
            P+H A   G   + KVL+D     +  +R  N   P+H+AC   HL ++ +LL+ +  IE+  E    P+H+A   GH  IVK L+       A N K   P+H     GH ++ + L++    ++A     + P+H A   GH E+VK+L++H  + ++       SP+H+A +    + ++LL
Sbjct:  279 PLHVAAHCGHHRMAKVLLDKGA--KPNSRALNGFTPLHIACKKNHLRVMDLLLKHSASIEAVTESGLTPLHVASFMGHLNIVKILLQKGASPSASNVKVETPLHMASRSGHFEVAEFLLQNAAPVDAKAKDDQTPLHCAARMGHKELVKLLLEHKANPNSTTTA-GHSPLHIAAREGHVQTVRLL 460          

HSP 4 Score: 83.5741 bits (205), Expect = 6.119e-18
Identity = 45/187 (24.06%), Postives = 89/187 (47.59%), Query Frame = 3
Query:  144 PIHFACLKGDIDIVKVLIDHNCDIEVRNRKWNQQPIHMACWDGHLEILKVLLEKNCDIESCDEWKRRPIHLACENGHTEIVKFLINLHCDIEAINDKAWRPIHFGCWKGHSDIVKVLVEQNCDIEACDHLKRRPIHLACEKGHTEIVKVLIDHHCDISACGGRFNQSPIHLARKNNFTELIQLLTIH 704
            P+H A   G  ++ + L+ +   ++ + +  +Q P+H A   GH E++K+LLE   +  S       P+H+A   GH + V+ L+++      +  K + P+H     G  D+ ++L+E+  +  A       P+H+A    + ++V +L+       +   R   + +H+A K N  E+   L  H
Sbjct:  378 PLHMASRSGHFEVAEFLLQNAAPVDAKAKD-DQTPLHCAARMGHKELVKLLLEHKANPNSTTTAGHSPLHIAAREGHVQTVRLLLDMEAQQTKMTKKGFTPLHVASKYGKVDVAELLLERGANPNAAGKNGLTPLHVAVHHNNLDVVNLLVSKGGSPHS-AARNGYTALHIAAKQNQVEVANSLLQH 562          

HSP 5 Score: 25.7942 bits (55), Expect = 6.119e-18
Identity = 8/27 (29.63%), Postives = 17/27 (62.96%), Query Frame = 2
Query:    2 PIHLAFDNNHREIVKLLIEENCDVNAI 82
            P+H+A   NH  ++ LL++ +  + A+
Sbjct:  312 PLHIACKKNHLRVMDLLLKHSASIEAV 338          

HSP 6 Score: 74.7146 bits (182), Expect = 2.288e-15
Identity = 57/205 (27.80%), Postives = 92/205 (44.88%), Query Frame = 3
Query:  144 PIHFACLKGDIDIVKVLIDHNCDIEVRNRKWNQ----------QPIHMACWDGHLEILKVLLEKNCDIESCDEWKRRPIHLACENGHTEIVKFLINLHCDIEAINDKAWRPIHFGCWKGHSDIVKVLVEQNCDIE--ACDHLKRRPIHLACEKGHTEIVKVLIDHHCDISACGGRFNQ------SPIHLARKNNFTELIQLLTIH 704
            P+  A  +G  ++V +LI +    +VR                 P+H+A    +L + ++LL +  + E        P+H A  NGH  I++ L++    I+A       PIH      H D VK L++ N +I+    DHL   P+H+A   GH  + KVL+D        G + N       +P+H+A K N   ++ LL  H
Sbjct:  142 PLAVALQQGHENVVALLISYGTKGKVRLPALTDFCFFLSVTGFTPLHIAAHYENLNVAQLLLNRGANDE------LTPLHCAARNGHFRIIEILLDNGAPIQAKTKNGLSPIHMAAQGDHMDCVKQLLQYNAEIDDITLDHLT--PLHVAAHCGHHRMAKVLLDK-------GAKPNSRALNGFTPLHIACKKNHLRVMDLLLKH 331          

HSP 7 Score: 25.7942 bits (55), Expect = 2.288e-15
Identity = 9/23 (39.13%), Postives = 15/23 (65.22%), Query Frame = 2
Query:    2 PIHLAFDNNHREIVKLLIEENCD 70
            P+++A   NH E+VK L+E   +
Sbjct:  109 PLYMAAQENHLEVVKFLLENGAN 131          

HSP 8 Score: 73.559 bits (179), Expect = 3.194e-14
Identity = 39/159 (24.53%), Postives = 73/159 (45.91%), Query Frame = 3
Query:  144 PIHFACLKGDIDIVKVLIDHNCDIEVRNRKWNQQPIHMACWDGHLEILKVLLEKNCDIESCDEWKRRPIHLACENGHTEIVKFLINLHCDIEAINDKAWRPIHFGCWKGHSDIVKVLVEQNCDIEACDHLKRRPIHLACEKGHTEIVKVLIDHHCDISA 620
            P+H A    ++D+V +L+          R      +H+A     +E+   LL+      +       P+HLA + G  +IV  LI+   ++   N     P+H    +GH  I  +LV+Q   + A   +   P+H+AC  G+ ++VK L+    ++++
Sbjct:  510 PLHVAVHHNNLDVVNLLVSKGGSPHSAARN-GYTALHIAAKQNQVEVANSLLQHGASANAESLQGVTPLHLASQEGRPDIVSLLISKQANVNLGNKSGLTPLHLVAQEGHVGIADILVKQGASVYAATRMGYTPLHVACHYGNIKMVKFLLQQQANVNS 667          

HSP 9 Score: 63.929 bits (154), Expect = 8.019e-13
Identity = 38/187 (20.32%), Postives = 89/187 (47.59%), Query Frame = 3
Query:  144 PIHFACLKGDIDIVKVLIDHNCDIEVRNRKWNQQ---PIHMACWDGHLEILKVLLEKNCDIESCDEWKRRPIHLACENGHTEIVKFLINLHCDIEAINDKAWRPIHFGCWKGHSDIVKVLVEQNCDIEACDHLKRRPIHLACEKGHTEIVKVLIDHHCDISACGGRFNQSPIHLARKNNFTELIQLL 695
            P+H A  +G +  V++L+D    +E +  K  ++   P+H+A   G +++ ++LLE+  +  +  +    P+H+A  + + ++V  L++      +     +  +H    +   ++   L++      A       P+HLA ++G  +IV +LI    +++  G +   +P+HL  +     +  +L
Sbjct:  444 PLHIAAREGHVQTVRLLLD----MEAQQTKMTKKGFTPLHVASKYGKVDVAELLLERGANPNAAGKNGLTPLHVAVHHNNLDVVNLLVSKGGSPHSAARNGYTALHIAAKQNQVEVANSLLQHGASANAESLQGVTPLHLASQEGRPDIVSLLISKQANVN-LGNKSGLTPLHLVAQEGHVGIADIL 625          

HSP 10 Score: 28.1054 bits (61), Expect = 8.019e-13
Identity = 11/26 (42.31%), Postives = 17/26 (65.38%), Query Frame = 2
Query:    2 PIHLAFDNNHREIVKLLIEENCDVNA 79
            P+H A    H+E+VKLL+E   + N+
Sbjct:  411 PLHCAARMGHKELVKLLLEHKANPNS 436          

HSP 11 Score: 68.5514 bits (166), Expect = 1.891e-12
Identity = 40/187 (21.39%), Postives = 86/187 (45.99%), Query Frame = 3
Query:  135 DRRPIHFACLKGDIDIVKVLIDHNCDIEVRNRKWNQQPIHMACWDGHLEILKVLLEKNCDIESCDEWKRRPIHLACENGHTEIVKFLINLHCDIEAINDKAWRPIHFGCWKGHSDIVKVLVEQNCDIEACDHLKRRPIHLACEKGHTEIVKVLIDHHCDISACGGRFNQSPIHLARKNNFTELIQLL 695
            D+ P+H A   G  ++VK+L++H  +           P+H+A  +GH++ +++LL+         +    P+H+A + G  ++ + L+    +  A       P+H      + D+V +LV +     +        +H+A ++   E+   L+ H    +A   +   +P+HLA +    +++ LL
Sbjct:  408 DQTPLHCAARMGHKELVKLLLEHKANPNSTTTA-GHSPLHIAAREGHVQTVRLLLDMEAQQTKMTKKGFTPLHVASKYGKVDVAELLLERGANPNAAGKNGLTPLHVAVHHNNLDVVNLLVSKGGSPHSAARNGYTALHIAAKQNQVEVANSLLQHGASANAESLQ-GVTPLHLASQEGRPDIVSLL 592          

HSP 12 Score: 59.3066 bits (142), Expect = 1.925e-9
Identity = 35/149 (23.49%), Postives = 72/149 (48.32%), Query Frame = 3
Query:  156 ACLKGDIDIVKVLIDHNCDIEVRNRKWNQQPIHMACWDGHLEILKVLLEKNCDIESCDEWKRRPIHLACENGHTEIVKFLINLHCDIEAINDKAWRPIHFGCWKGHSDIVKVLVEQNCDIEACDHLKRRPIHLACEKGHTEIVKVLIDH 602
            A   G++D     I +  DI   N+      +H+A  +GH++++  LL     +E+  +     +H+A   G  ++V  L+N   ++ A + K + P++    + H ++VK L+E   +          P+ +A ++GH  +V +LI +
Sbjct:   14 AARSGNLDKALEHIKNGIDINTANQN-GLNALHLASKEGHVKMVLELLHNGIVLETTTKKGNTALHIAALAGQEQVVTELVNYGTNVNAQSQKGFTPLYMAAQENHLEVVKFLLENGANQSIPTEDGFTPLAVALQQGHENVVALLISY 161          
BLAST of SMED30015660 vs. Ensembl Medaka
Match: ank1b (ankyrin-1 [Source:NCBI gene;Acc:101157380])

HSP 1 Score: 95.1301 bits (235), Expect = 2.104e-21
Identity = 53/188 (28.19%), Postives = 95/188 (50.53%), Query Frame = 3
Query:  144 PIHFACLKGDIDIVKVLIDHNCDIEVRNRKWNQQPIHMACWDGHLEILKVLLEKNCDIESCDEWKRRPIHLACENGHTEIVKFLINLHCDIEAINDKAWRPIHFGCWKGHSDIVKVLVEQNCDIEACDHLKRRPIHLACEKGHTEIVKVLIDHHCDISACGGRFNQSPIHLARKNNFTELIQLLTIHE 707
            PIH A     +D V+ L+ +N +I+      +  P+H+A   GH  + KVLL+K     +       P+H+AC+  H   +  L+     +EA+ +    P+H   + GH +IVK L+++     A +     P+H+A   GH E+ + L+ +   + A   + +Q+P+H A +    EL++LL  H+
Sbjct:  306 PIHMAAQGDHMDCVRQLLQYNAEIDDITLD-HLTPLHVAAHCGHHRMAKVLLDKGAKANARALNGFTPLHIACKKNHMRSMDLLLKHSASLEAVTESGLTPLHVAAFMGHLNIVKNLLQRGASPNASNVKVETPLHMASRAGHCEVAQFLLQNAAQVDA-RAKDDQTPLHCAARMGHKELVKLLLDHK 491          

HSP 2 Score: 92.0485 bits (227), Expect = 2.226e-20
Identity = 54/186 (29.03%), Postives = 89/186 (47.85%), Query Frame = 3
Query:  144 PIHFACLKGDIDIVKVLIDHNCDIEVRNRKWNQQPIHMACWDGHLEILKVLLEKNCDIESCDEWKRRPIHLACENGHTEIVKFLINLHCDIEAINDKAWRPIHFGCWKGHSDIVKVLVEQNCDIEACDHLKRRPIHLACEKGHTEIVKVLIDHHC--DISACGGRFNQSPIHLARKNNFTELIQLL 695
            P+H A   G   + KVL+D       R       P+H+AC   H+  + +LL+ +  +E+  E    P+H+A   GH  IVK L+       A N K   P+H     GH ++ + L++    ++A     + P+H A   GH E+VK+L+DH    D +   G    +P+H+A +      I++L
Sbjct:  339 PLHVAAHCGHHRMAKVLLDKGAKANARALN-GFTPLHIACKKNHMRSMDLLLKHSASLEAVTESGLTPLHVAAFMGHLNIVKNLLQRGASPNASNVKVETPLHMASRAGHCEVAQFLLQNAAQVDARAKDDQTPLHCAARMGHKELVKLLLDHKANPDSATTAG---HTPLHIAAREGHIHTIRIL 520          

HSP 3 Score: 91.6633 bits (226), Expect = 3.121e-20
Identity = 50/184 (27.17%), Postives = 91/184 (49.46%), Query Frame = 3
Query:  144 PIHFACLKGDIDIVKVLIDHNCDIEVRNRKWNQQPIHMACWDGHLEILKVLLEKNCDIESCDEWKRRPIHLACENGHTEIVKFLINLHCDIEAINDKAWRPIHFGCWKGHSDIVKVLVEQNCDIEACDHLKRRPIHLACEKGHTEIVKVLIDHHCDISACGGRFNQSPIHLARKNNFTELIQLL 695
            P+H A   G + I+++L++H   I+ + +     PIHMA    H++ ++ LL+ N +I+        P+H+A   GH  + K L++      A     + P+H  C K H   + +L++ +  +EA       P+H+A   GH  IVK L+      +A   +  ++P+H+A +    E+ Q L
Sbjct:  273 PLHCAARNGHVRIIEILLEHGAPIQAKTKN-GLSPIHMAAQGDHMDCVRQLLQYNAEIDDITLDHLTPLHVAAHCGHHRMAKVLLDKGAKANARALNGFTPLHIACKKNHMRSMDLLLKHSASLEAVTESGLTPLHVAAFMGHLNIVKNLLQRGASPNASNVKV-ETPLHMASRAGHCEVAQFL 454          

HSP 4 Score: 90.8929 bits (224), Expect = 6.250e-20
Identity = 48/187 (25.67%), Postives = 94/187 (50.27%), Query Frame = 3
Query:  144 PIHFACLKGDIDIVKVLIDHNCDIEVRNRKWNQQPIHMACWDGHLEILKVLLEKNCDIESCDEWKRRPIHLACENGHTEIVKFLINLHCDIEAINDKAWRPIHFGCWKGHSDIVKVLVEQNCDIEACDHLKRRPIHLACEKGHTEIVKVLID---HHCDISACGGRFNQSPIHLARKNNFTELIQLL 695
            P+H AC K  +  + +L+ H+  +E         P+H+A + GHL I+K LL++     + +     P+H+A   GH E+ +FL+     ++A       P+H     GH ++VK+L++   + ++       P+H+A  +GH   +++L+D       ++  G     +P+H+A K    ++ +LL
Sbjct:  372 PLHIACKKNHMRSMDLLLKHSASLEAVTES-GLTPLHVAAFMGHLNIVKNLLQRGASPNASNVKVETPLHMASRAGHCEVAQFLLQNAAQVDARAKDDQTPLHCAARMGHKELVKLLLDHKANPDSATTAGHTPLHIAAREGHIHTIRILLDAGAQQVKMTKKGF----TPLHVASKYGKVDVAELL 553          

HSP 5 Score: 85.5001 bits (210), Expect = 3.881e-18
Identity = 52/195 (26.67%), Postives = 96/195 (49.23%), Query Frame = 3
Query:  144 PIHFACLKGDIDIVKVLIDHNCDIEVRNRKWNQQPIHMACWDGHLEILKVLLEKNCDIESCDEWKRRPIHLACENGHTEIVKFLINLHCDIEAINDKAWRPIHFGCWKGHSDIVKVLVEQNCDIE--ACDHLKRRPIHLACEKGHTEIVKVLIDHHCDISACGGRFNQ------SPIHLARKNNFTELIQLLTIH 704
            P+H A    ++ + ++L++   ++    +     P+H+A   G++ ++++LL++   I++  + +  P+H A  NGH  I++ L+     I+A       PIH      H D V+ L++ N +I+    DHL   P+H+A   GH  + KVL+D        G + N       +P+H+A K N    + LL  H
Sbjct:  207 PLHIAAHYENMSVAQLLLNRGANVNFTPKN-GITPLHIASRRGNVMMVRLLLDRGAQIDAQTKDELTPLHCAARNGHVRIIEILLEHGAPIQAKTKNGLSPIHMAAQGDHMDCVRQLLQYNAEIDDITLDHLT--PLHVAAHCGHHRMAKVLLDK-------GAKANARALNGFTPLHIACKKNHMRSMDLLLKH 391          

HSP 6 Score: 84.7297 bits (208), Expect = 5.909e-18
Identity = 45/184 (24.46%), Postives = 90/184 (48.91%), Query Frame = 3
Query:  144 PIHFACLKGDIDIVKVLIDHNCDIEVRNRKWNQQPIHMACWDGHLEILKVLLEKNCDIESCDEWKRRPIHLACENGHTEIVKFLINLHCDIEAINDKAWRPIHFGCWKGHSDIVKVLVEQNCDIEACDHLKRRPIHLACEKGHTEIVKVLIDHHCDISACGGRFNQSPIHLARKNNFTELIQLL 695
            P+H A   G  ++ + L+ +   ++ R +  +Q P+H A   GH E++K+LL+   + +S       P+H+A   GH   ++ L++       +  K + P+H     G  D+ ++L+E+  +  A       P+H+A    + ++VK+L+       +   R   +P+H+A K N  E+  +L
Sbjct:  438 PLHMASRAGHCEVAQFLLQNAAQVDARAKD-DQTPLHCAARMGHKELVKLLLDHKANPDSATTAGHTPLHIAAREGHIHTIRILLDAGAQQVKMTKKGFTPLHVASKYGKVDVAELLLERGANPNAAGKNGLTPLHVAVHHNNLDVVKLLVSKGGSAHST-ARNGYTPLHIAAKQNQIEVASVL 619          

HSP 7 Score: 84.7297 bits (208), Expect = 5.909e-18
Identity = 46/189 (24.34%), Postives = 96/189 (50.79%), Query Frame = 3
Query:  144 PIHFACLKGDIDIVKVLIDHNCDIEVRNRKWNQQPIHMACWDGHLEILKVLLEKNCDIESCDEWKRRPIHLACENGHTEIVKFLINLHCDIEAINDKAWRPIHFGCWKGHSDIVKVLVEQNCDIEACDHLKRRPIHLACEKGHTEIVKVLIDHHC---DISACGGRFNQSPIHLARKNNFTELIQLLTI 701
            P+H A  +  I++  VL+ +       + +    P+H+A  +G  +++ +L+ K  ++   ++    P+HL  + GH  I   L+     + A +   + P+H  C  G+  +VK L++Q   + A   +   P+H A ++GHT+IV +L+ H     +I++ G     SP+ +A++  +  +I +L +
Sbjct:  603 PLHIAAKQNQIEVASVLLQNGASPNCESLQ-GITPLHLASQEGRPDMVAMLISKQANVNLGNKNGLTPLHLVAQEGHVGIADTLVKQGASVYAASRMGYTPLHVACHYGNIKMVKFLLQQQAHVNAKTRMGYTPLHQAAQQGHTDIVTLLLKHGALPNEITSNG----TSPLGIAKRLGYISVIDVLKL 786          

HSP 8 Score: 75.0998 bits (183), Expect = 9.876e-15
Identity = 42/187 (22.46%), Postives = 88/187 (47.06%), Query Frame = 3
Query:  135 DRRPIHFACLKGDIDIVKVLIDHNCDIEVRNRKWNQQPIHMACWDGHLEILKVLLEKNCDIESCDEWKRRPIHLACENGHTEIVKFLINLHCDIEAINDKAWRPIHFGCWKGHSDIVKVLVEQNCDIEACDHLKRRPIHLACEKGHTEIVKVLIDHHCDISACGGRFNQSPIHLARKNNFTELIQLL 695
            D+ P+H A   G  ++VK+L+DH  + +         P+H+A  +GH+  +++LL+         +    P+H+A + G  ++ + L+    +  A       P+H      + D+VK+LV +     +       P+H+A ++   E+  VL+ +    + C      +P+HLA +    +++ +L
Sbjct:  468 DQTPLHCAARMGHKELVKLLLDHKANPDSATTA-GHTPLHIAAREGHIHTIRILLDAGAQQVKMTKKGFTPLHVASKYGKVDVAELLLERGANPNAAGKNGLTPLHVAVHHNNLDVVKLLVSKGGSAHSTARNGYTPLHIAAKQNQIEVASVLLQNGASPN-CESLQGITPLHLASQEGRPDMVAML 652          

HSP 9 Score: 65.4698 bits (158), Expect = 1.185e-12
Identity = 41/184 (22.28%), Postives = 89/184 (48.37%), Query Frame = 3
Query:  144 PIHFACLKGDIDIVKVLIDHNCDIEVRNRKWNQQPIHMACWDGHLEILKVLLEKNCDIESCDEWKRRPIHLACENGHTEIVKFLINLHCDIEAINDKAWRPIHFGCWKGHSDIVKVLVEQNCDIEACDHLKRRPIHLACEKGHTEIVKVLIDHHCDISACGGRFNQSPIHLARKNNFTELIQLL 695
            P+  A  +G  ++V +LI++    +VR        +H+A  +       VLL+ + + +   +    P+H+A    +  + + L+N   ++         P+H    +G+  +V++L+++   I+A    +  P+H A   GH  I+++L++H   I A   +   SPIH+A + +  + ++ L
Sbjct:  145 PLAVALQQGHENVVALLINYGTKGKVR-----LPALHIAARNDDTRTAAVLLQNDPNPDVLSKTGFTPLHIAAHYENMSVAQLLLNRGANVNFTPKNGITPLHIASRRGNVMMVRLLLDRGAQIDAQTKDELTPLHCAARNGHVRIIEILLEHGAPIQA-KTKNGLSPIHMAAQGDHMDCVRQL 322          

HSP 10 Score: 25.7942 bits (55), Expect = 1.185e-12
Identity = 9/23 (39.13%), Postives = 15/23 (65.22%), Query Frame = 2
Query:    2 PIHLAFDNNHREIVKLLIEENCD 70
            P+++A   NH E+VK L+E   +
Sbjct:  112 PLYMAAQENHLEVVKFLLENGAN 134          

HSP 11 Score: 63.929 bits (154), Expect = 6.421e-11
Identity = 40/180 (22.22%), Postives = 87/180 (48.33%), Query Frame = 3
Query:  156 ACLKGDIDIVKVLIDHNCDIEVRNRKWNQQPIHMACWDGHLEILKVLLEKNCDIESCDEWKRRPIHLACENGHTEIVKFLINLHCDIEAINDKAWRPIHFGCWKGHSDIVKVLVEQNCDIEACDHLKRRPIHLACEKGHTEIVKVLIDHHCDISACGGRFNQSPIHLARKNNFTELIQLL 695
            A   G++D     I +  +I + N+      +H+A  +GH++++  LL    ++E+  +     +H+A   G  ++V  L+N   ++ A + K + P++    + H ++VK L+E   +          P+ +A ++GH  +V +LI++        G+     +H+A +N+ T    +L
Sbjct:   17 AARSGNLDKALDHIKNGININIANQN-GLNGLHLASKEGHVKMVLELLHSGIELEATTKKGNTALHIAALAGQEKVVAELVNYGANVNAQSHKGFSPLYMAAQENHLEVVKFLLENGANQSLPTEDGFTPLAVALQQGHENVVALLINY-----GTKGKVRLPALHIAARNDDTRTAAVL 190          
BLAST of SMED30015660 vs. Ensembl Medaka
Match: ankrd28b (ankyrin repeat domain 28 [Source:NCBI gene;Acc:101159131])

HSP 1 Score: 94.7449 bits (234), Expect = 2.153e-21
Identity = 54/187 (28.88%), Postives = 102/187 (54.55%), Query Frame = 3
Query:  138 RRPIHFACLKGDIDIVKVLIDHNCDIEVRNRKWNQQPIHMACWDGHLEILKVLLEKNCDIESCDEWKRRPIHLACENGHTEIVKFLINLHCDIEAINDKAWR-PIHFGCWKGHSDIVKVLVEQNCDIEACDHLKRRPIHLACEKGHTEIVKVLIDHHCDISACGGRFNQSPIHLARKNNFTELIQLL 695
            R P+H A   GD +I+++LI     +  ++ KW   P+H A      E ++VLL+ + D+ + D+  + P+H+A  N      + L+ L  ++  ++D+A R  +H   + GH ++V++L+ +  +I A D   RR IH A   GH E+VK+L  H  +++ C  + + +P+H A  +    +++ L
Sbjct:   42 RTPLHAAAYLGDAEIIELLILSGARVNAKDNKW-LTPLHRAVASCSEEAVQVLLKHSADVNARDKNWQTPLHIAAANKAVRCAEALVPLLSNVN-VSDRAGRTALHHAAFSGHLEMVRLLLSRGSNINAFDKKDRRAIHWAAYMGHIEVVKLLASHGAEVT-CKDKKSYTPLHAAASSGMISVVKFL 225          

HSP 2 Score: 92.0485 bits (227), Expect = 1.802e-20
Identity = 52/188 (27.66%), Postives = 95/188 (50.53%), Query Frame = 3
Query:  135 DRRPIHFACLKGDIDIVKVLIDHNCDIEVRNRKWNQQPIHMACWDGHLEILKVLLEKNCDIESCDEWKRRPIHLACENGHTEIVKFLINLHCDIEAINDKAWRPIHFGCWKGHSDI-VKVLVEQNCDIEACDHLKRRPIHLACEKGHTEIVKVLIDHHCDISACGGRFNQSPIHLARKNNFTELIQLL 695
            DRR IH+A   G I++VK+L  H  ++  +++K +  P+H A   G + ++K LL+   DI   + +   P+H+AC NG   +V  LI     +  +N+K + P+HF     H  + +++LV    D+       + P+H+    G     + +I++  +I  C  +   +P+H+A +     LI  L
Sbjct:  173 DRRAIHWAAYMGHIEVVKLLASHGAEVTCKDKK-SYTPLHAAASSGMISVVKFLLDLGVDINEPNAYGNTPLHVACYNGQDVVVNELIECGAHVNQVNEKGFAPLHFTAASRHGALCLELLVCNGADVNIKSKDGKTPLHMTAIHGRFSRSQAIIENGAEID-CEDKNGNTPLHIAARYGHELLINTL 358          

HSP 3 Score: 90.8929 bits (224), Expect = 4.740e-20
Identity = 50/175 (28.57%), Postives = 89/175 (50.86%), Query Frame = 3
Query:  144 PIHFACLKGDIDIVKVLIDHNCDIEVRNRKWNQQPIHMACWDGHLEILKVLLEKNCDIESCDEWKRRPIHLACENGHTEIVKFLINLHCDIEAINDKAWRPIHFGCWKGHSDIVKVLVEQNCDIEACDHLKRRPIHLACEKGHTEIVKVLIDHHCDISACGGRFNQSPIHLARKN 668
            P+H A      + V+VL+ H+ D+  R++ W Q P+H+A  +  +   + L+    ++   D   R  +H A  +GH E+V+ L++   +I A + K  R IH+  + GH ++VK+L     ++   D     P+H A   G   +VK L+D   DI+     +  +P+H+A  N
Sbjct:   77 PLHRAVASCSEEAVQVLLKHSADVNARDKNW-QTPLHIAAANKAVRCAEALVPLLSNVNVSDRAGRTALHHAAFSGHLEMVRLLLSRGSNINAFDKKDRRAIHWAAYMGHIEVVKLLASHGAEVTCKDKKSYTPLHAAASSGMISVVKFLLDLGVDINEPNA-YGNTPLHVACYN 249          

HSP 4 Score: 79.7221 bits (195), Expect = 2.930e-16
Identity = 43/174 (24.71%), Postives = 89/174 (51.15%), Query Frame = 3
Query:  138 RRPIHFACLKGDIDIVKVLIDHNCDIEVRNRKWNQQPIHMACWDGHLEILKVLLEKNCDIESCDEWKRRPIHLACENGHTEIVKFLINLHCDIEAINDKAWRPIHFGCWKGHSDIVKVLVEQNCDIEACDHLKRRPIHLACEKGHTEI-VKVLIDHHCDISACGGRFNQSPIHL 656
            R  +H A   G +++V++L+    +I   ++K +++ IH A + GH+E++K+L     ++   D+    P+H A  +G   +VKFL++L  DI   N     P+H  C+ G   +V  L+E    +   +     P+H      H  + +++L+ +  D++    +  ++P+H+
Sbjct:  141 RTALHHAAFSGHLEMVRLLLSRGSNINAFDKK-DRRAIHWAAYMGHIEVVKLLASHGAEVTCKDKKSYTPLHAAASSGMISVVKFLLDLGVDINEPNAYGNTPLHVACYNGQDVVVNELIECGAHVNQVNEKGFAPLHFTAASRHGALCLELLVCNGADVN-IKSKDGKTPLHM 312          

HSP 5 Score: 67.3958 bits (163), Expect = 3.816e-12
Identity = 62/241 (25.73%), Postives = 95/241 (39.42%), Query Frame = 3
Query:  144 PIHFACLKGDIDIVKVLIDHNCDIEVRNRKWNQQPIHMACWDGHLEILKVLLEKNCDIESCD-EWKRRPIHLACEN----------------------------------GHTEIVKFLINLHCDIEAINDKAWRPIHFGCWKGHSDIVKVLVEQNCDIEACDHLKRRPIHLACEKGH-------------TEIVKVLIDHHCDISACGGRFNQSPIHLARKNNFTELIQLLTIHE*KYLR 722
            P+H A   G    ++VL+    D++VRN +  + P+ +A + GH+E + VL+ +   I   D   KR PIH A +N                                  GHT+ V  L+N    +EA +      +H G   GH + ++ L++ N      D   R P+HLA   GH              E + VL D H            +P+H A  N   ++  LL I    +LR
Sbjct:  549 PLHLAAYHGHHQAMEVLVQSLLDLDVRNSQ-GRTPLDLAAFKGHVECVDVLINQGASILVKDFTLKRTPIHAAGKNCKKEKTKLPGLCNLRLKNMRNANGLTPLMLAVLSGHTDCVYSLLNKGASVEAKDKWGRTALHRGAVTGHEECMEALLQHNASFLVRDCRGRTPVHLAAACGHIGVLGGLLHAAQSVETLPVLTDSH----------GYTPLHWACYNGKYQMDLLLDISFFAFLR 778          

HSP 6 Score: 63.5438 bits (153), Expect = 7.143e-11
Identity = 36/124 (29.03%), Postives = 64/124 (51.61%), Query Frame = 3
Query:  237 NQQPIHMACWDGHLEILKVLLEKNCDIESCDEWKRRPIHLACENGHTEIVKFLI-NLHCDIEAINDKAWRPIHFGCWKGHSDIVKVLVEQNCD---IEACDHLKRRPIHLACEKGHTEIVKVLI 596
            N+ P+H A +  H+E L++LL  N  + + D   + P+ +A ENG T  V+ L+ +   D+   +      +H  C KGH     +++E+  D   I A +   + P+H+A   G T +V+ L+
Sbjct:  805 NRTPLHAAAFTDHVECLQLLLSHNAQVNTVDAAGKSPLMMAAENGQTNAVELLVSSAKADLTIQDAVKNTALHLACSKGHETSALLILEKISDRNLINATNAALQTPLHVAARNGLTVVVQELL 928          

HSP 7 Score: 62.3882 bits (150), Expect = 1.795e-10
Identity = 52/193 (26.94%), Postives = 87/193 (45.08%), Query Frame = 3
Query:  144 PIHFACLKGDIDIVKVLIDHNCDIEVRNRKWNQQPIHMACWDGHLEILKVLLEKNCDIESCDEWKRRPIHLACENGHTEIVKFLINLHCDIEAI----NDKAWRPIHFGCWKGHSDIVKVLVEQNCDIEACDHLKRRPIHLACEKGHTEIVKVLIDH--HCDISACGGRFNQSPIHLARKNNFTELIQLLTIH 704
            P+  A L G  D V  L++    +E ++ KW +  +H     GH E ++ LL+ N      D   R P+HLA   GH  ++  L++    +E +    +   + P+H+ C+ G   +  +L     DI     L+ R    A E        +LID      ++A  G+ N++P+H A   +  E +QLL  H
Sbjct:  650 PLMLAVLSGHTDCVYSLLNKGASVEAKD-KWGRTALHRGAVTGHEECMEALLQHNASFLVRDCRGRTPVHLAAACGHIGVLGGLLHAAQSVETLPVLTDSHGYTPLHWACYNGKYQMDLLL-----DISFFAFLRIRDNEGAAE--------MLIDTLGPTIVNAKDGK-NRTPLHAAAFTDHVECLQLLLSH 827          

HSP 8 Score: 61.6178 bits (148), Expect = 3.100e-10
Identity = 50/216 (23.15%), Postives = 93/216 (43.06%), Query Frame = 3
Query:  138 RRPIHFACLKGDIDIVKVLIDHNCDIE---VRNRKWNQQPIHMACWDGHLEILKVLLEKN-----------------------CDIESCDEWKRRPIHLACENGHTEIVKFLINLHCDIEAINDKAWRPIHFGCWKGHSDIVKVLVEQ-NCDIEACDHLKRRPIHLACEKGHTEIVKVLIDHHCD---ISACGGRFNQSPIHLARKNNFTELIQLL 695
            R P+H A   G I ++  L+     +E   V        P+H AC++G  + + +LL+ +                         + + D   R P+H A    H E ++ L++ +  +  ++     P+      G ++ V++LV     D+   D +K   +HLAC KGH     ++++   D   I+A      Q+P+H+A +N  T ++Q L
Sbjct:  714 RTPVHLAAACGHIGVLGGLLHAAQSVETLPVLTDSHGYTPLHWACYNGKYQ-MDLLLDISFFAFLRIRDNEGAAEMLIDTLGPTIVNAKDGKNRTPLHAAAFTDHVECLQLLLSHNAQVNTVDAAGKSPLMMAAENGQTNAVELLVSSAKADLTIQDAVKNTALHLACSKGHETSALLILEKISDRNLINATNAAL-QTPLHVAARNGLTVVVQEL 927          

HSP 9 Score: 60.4622 bits (145), Expect = 6.597e-10
Identity = 42/181 (23.20%), Postives = 77/181 (42.54%), Query Frame = 3
Query:  132 WDRRPIHFACLKGDIDIVKVLIDHNCDIEVRNRKWNQQPIHMACWDGHLEILKVLLEKNCDIES----CDEWKRRPIHLACENGHTEI-----VKFLINLHCD-----------------IEAINDKAWRPIHFGCWKGHSDIVKVLVEQNCDIEACDHLKRRPIHLACEKGHTEIVKVLI 596
            W R  +H   + G  + ++ L+ HN    VR+ +  + P+H+A   GH+ +L  LL     +E+     D     P+H AC NG  ++     + F   L                    + A + K   P+H   +  H + +++L+  N  +   D   + P+ +A E G T  V++L+
Sbjct:  679 WGRTALHRGAVTGHEECMEALLQHNASFLVRDCR-GRTPVHLAAACGHIGVLGGLLHAAQSVETLPVLTDSHGYTPLHWACYNGKYQMDLLLDISFFAFLRIRDNEGAAEMLIDTLGPTIVNAKDGKNRTPLHAAAFTDHVECLQLLLSHNAQVNTVDAAGKSPLMMAAENGQTNAVELLV 858          

HSP 10 Score: 56.225 bits (134), Expect = 1.769e-8
Identity = 50/199 (25.13%), Postives = 82/199 (41.21%), Query Frame = 3
Query:  138 RRPIHFACLKGDIDIVKVLIDHNCDIEVRNRKWNQQPIHMACW-DGHLEILKVLLEKNCDIESCDEWKRRPIHLACENGHTEIVKFLINLH---------CDIEAINDKAWR----PIHFGCWKGHSDIVKVLVEQNCDIEACDHLKRRPIHLACEKGHTEIVKVLIDHHCDISACGGRFNQSPIHLARKNNFTELIQL 692
            R P+H+A    +   +  L+     +   + +    P+H A   D   + L+ LL  + +    D      +H A   GH   ++ + N              + +ND   R    P+H   + GH   ++VLV+   D++  +   R P+ LA  KGH E V VLI+    I        ++PIH A KN   E  +L
Sbjct:  434 RTPLHYAAANCNYQCLFALVGSGASVNDLDER-GCTPLHYAAASDTDGKCLEYLLRNDANPGIRDNQGYNAVHYASAYGHRLCLELVRNAFPPCYPLMETSGTDILNDSDVRAPVSPLHLAAYHGHHQAMEVLVQSLLDLDVRNSQGRTPLDLAAFKGHVECVDVLINQGASILVKDFTLKRTPIHAAGKNCKKEKTKL 631          

HSP 11 Score: 55.8398 bits (133), Expect = 2.493e-8
Identity = 34/141 (24.11%), Postives = 63/141 (44.68%), Query Frame = 3
Query:  144 PIHF-ACLKGDIDIVKVLIDHNCDIEVRNRKWNQQPIHMACWDGHLEILKVLLEKNCDIESCDEWKRRPIHLACENGHTEIVKFLINLHCDIEAINDKAWRPIHFGCWKGHSDIVKVLVEQNCDIEACDHLKRRPIHLACE 563
            P+HF A  +     +++L+ +  D+ ++++   + P+HM    G     + ++E   +I+  D+    P+H+A   GH  ++  LI    D          P+H     G SD  + L+    DI+  D   R  +H A E
Sbjct:  275 PLHFTAASRHGALCLELLVCNGADVNIKSKD-GKTPLHMTAIHGRFSRSQAIIENGAEIDCEDKNGNTPLHIAARYGHELLINTLITNRADTAKRGIHGMFPLHLAALSGFSDCCRKLLSSGFDIDTPDDFGRTCLHAAAE 414          

HSP 12 Score: 54.299 bits (129), Expect = 6.541e-8
Identity = 37/153 (24.18%), Postives = 75/153 (49.02%), Query Frame = 3
Query:  237 NQQPIHMACWDGHLEILKVLLEKNCDIESCDEWKRRPIHLACENGHTEIVKFLINLHCDIEAINDKAWRPIHFGCWKGHSDIVKVLVEQNCDIEACDHLKRRPIHLACEKGHTEIVKVLIDHHCDISACGGRFNQSPIHLARKNNFTELIQLL 695
            +Q P+  A ++   + ++ L+ K  D+ + D  KR P+H A   G  EI++ LI     + A ++K   P+H        + V+VL++ + D+ A D   + P+H+A         + L+    +++    R  ++ +H A  +   E+++LL
Sbjct:    8 DQPPLLKAIFNVDPDEVRSLIFKKEDVNAQDNEKRTPLHAAAYLGDAEIIELLILSGARVNAKDNKWLTPLHRAVASCSEEAVQVLLKHSADVNARDKNWQTPLHIAAANKAVRCAEALVPLLSNVNV-SDRAGRTALHHAAFSGHLEMVRLL 159          
BLAST of SMED30015660 vs. Ensembl Medaka
Match: ankrd28b (ankyrin repeat domain 28 [Source:NCBI gene;Acc:101159131])

HSP 1 Score: 94.7449 bits (234), Expect = 2.561e-21
Identity = 54/187 (28.88%), Postives = 102/187 (54.55%), Query Frame = 3
Query:  138 RRPIHFACLKGDIDIVKVLIDHNCDIEVRNRKWNQQPIHMACWDGHLEILKVLLEKNCDIESCDEWKRRPIHLACENGHTEIVKFLINLHCDIEAINDKAWR-PIHFGCWKGHSDIVKVLVEQNCDIEACDHLKRRPIHLACEKGHTEIVKVLIDHHCDISACGGRFNQSPIHLARKNNFTELIQLL 695
            R P+H A   GD +I+++LI     +  ++ KW   P+H A      E ++VLL+ + D+ + D+  + P+H+A  N      + L+ L  ++  ++D+A R  +H   + GH ++V++L+ +  +I A D   RR IH A   GH E+VK+L  H  +++ C  + + +P+H A  +    +++ L
Sbjct:   42 RTPLHAAAYLGDAEIIELLILSGARVNAKDNKW-LTPLHRAVASCSEEAVQVLLKHSADVNARDKNWQTPLHIAAANKAVRCAEALVPLLSNVN-VSDRAGRTALHHAAFSGHLEMVRLLLSRGSNINAFDKKDRRAIHWAAYMGHIEVVKLLASHGAEVT-CKDKKSYTPLHAAASSGMISVVKFL 225          

HSP 2 Score: 92.0485 bits (227), Expect = 2.246e-20
Identity = 52/188 (27.66%), Postives = 95/188 (50.53%), Query Frame = 3
Query:  135 DRRPIHFACLKGDIDIVKVLIDHNCDIEVRNRKWNQQPIHMACWDGHLEILKVLLEKNCDIESCDEWKRRPIHLACENGHTEIVKFLINLHCDIEAINDKAWRPIHFGCWKGHSDI-VKVLVEQNCDIEACDHLKRRPIHLACEKGHTEIVKVLIDHHCDISACGGRFNQSPIHLARKNNFTELIQLL 695
            DRR IH+A   G I++VK+L  H  ++  +++K +  P+H A   G + ++K LL+   DI   + +   P+H+AC NG   +V  LI     +  +N+K + P+HF     H  + +++LV    D+       + P+H+    G     + +I++  +I  C  +   +P+H+A +     LI  L
Sbjct:  173 DRRAIHWAAYMGHIEVVKLLASHGAEVTCKDKK-SYTPLHAAASSGMISVVKFLLDLGVDINEPNAYGNTPLHVACYNGQDVVVNELIECGAHVNQVNEKGFAPLHFTAASRHGALCLELLVCNGADVNIKSKDGKTPLHMTAIHGRFSRSQAIIENGAEID-CEDKNGNTPLHIAARYGHELLINTL 358          

HSP 3 Score: 90.8929 bits (224), Expect = 5.530e-20
Identity = 50/175 (28.57%), Postives = 89/175 (50.86%), Query Frame = 3
Query:  144 PIHFACLKGDIDIVKVLIDHNCDIEVRNRKWNQQPIHMACWDGHLEILKVLLEKNCDIESCDEWKRRPIHLACENGHTEIVKFLINLHCDIEAINDKAWRPIHFGCWKGHSDIVKVLVEQNCDIEACDHLKRRPIHLACEKGHTEIVKVLIDHHCDISACGGRFNQSPIHLARKN 668
            P+H A      + V+VL+ H+ D+  R++ W Q P+H+A  +  +   + L+    ++   D   R  +H A  +GH E+V+ L++   +I A + K  R IH+  + GH ++VK+L     ++   D     P+H A   G   +VK L+D   DI+     +  +P+H+A  N
Sbjct:   77 PLHRAVASCSEEAVQVLLKHSADVNARDKNW-QTPLHIAAANKAVRCAEALVPLLSNVNVSDRAGRTALHHAAFSGHLEMVRLLLSRGSNINAFDKKDRRAIHWAAYMGHIEVVKLLASHGAEVTCKDKKSYTPLHAAASSGMISVVKFLLDLGVDINEPNA-YGNTPLHVACYN 249          

HSP 4 Score: 81.6481 bits (200), Expect = 6.388e-17
Identity = 60/207 (28.99%), Postives = 93/207 (44.93%), Query Frame = 3
Query:  138 RRPIHFACLKGDIDIVKVLIDHNCDIEVRNRKWNQQPIHMACWDGHLEILKVLLEKNCDIESC----DEWKRRPIHLACENGHTEIVKFLINLHCDIEAINDKAWRPIHFGCWKGHSDIVKVLVEQNCDIEACDHLKRRPIHLACEKGH-------------TEIVKVLIDHHCDISACGGRFNQSPIHLARKNNFTELIQLLTIHE 707
            R P+  A  KG ++ V VLI+    I V++    + PIH A  +GH E L++L+  N D++S     D   + P+ LA  +GHT+ V  L+N    +EA +      +H G   GH + ++ L++ N      D   R P+HLA   GH              E + VL D H            +P+H A  N     +++L   E
Sbjct:  584 RTPLDLAAFKGHVECVDVLINQGASILVKDFTLKRTPIHAAATNGHSECLRLLI-GNADLQSAVDIQDGNGQTPLMLAVLSGHTDCVYSLLNKGASVEAKDKWGRTALHRGAVTGHEECMEALLQHNASFLVRDCRGRTPVHLAAACGHIGVLGGLLHAAQSVETLPVLTDSH----------GYTPLHWACYNGHDTCVEVLLEQE 779          

HSP 5 Score: 80.1073 bits (196), Expect = 2.397e-16
Identity = 54/193 (27.98%), Postives = 93/193 (48.19%), Query Frame = 3
Query:  144 PIHFACLKGDIDIVKVLIDHNCDIEVRNRKWNQQPIHMACWDGHLEILKVLLEKNCDIESCDEWKRRPIHLACENGHTEIVKFLINLHCDIEAI----NDKAWRPIHFGCWKGHSDIVKVLVEQNCDIEACDHLKRRPIHLACEKGHTEIVKVLIDH--HCDISACGGRFNQSPIHLARKNNFTELIQLLTIH 704
            P+  A L G  D V  L++    +E ++ KW +  +H     GH E ++ LL+ N      D   R P+HLA   GH  ++  L++    +E +    +   + P+H+ C+ GH   V+VL+EQ       +     P+H A  + +    ++LID      ++A  G+ N++P+H A   +  E +QLL  H
Sbjct:  656 PLMLAVLSGHTDCVYSLLNKGASVEAKD-KWGRTALHRGAVTGHEECMEALLQHNASFLVRDCRGRTPVHLAAACGHIGVLGGLLHAAQSVETLPVLTDSHGYTPLHWACYNGHDTCVEVLLEQEV-FHKAEGNPFSPLHCAVIRDNEGAAEMLIDTLGPTIVNAKDGK-NRTPLHAAAFTDHVECLQLLLSH 845          

HSP 6 Score: 79.337 bits (194), Expect = 3.542e-16
Identity = 43/174 (24.71%), Postives = 89/174 (51.15%), Query Frame = 3
Query:  138 RRPIHFACLKGDIDIVKVLIDHNCDIEVRNRKWNQQPIHMACWDGHLEILKVLLEKNCDIESCDEWKRRPIHLACENGHTEIVKFLINLHCDIEAINDKAWRPIHFGCWKGHSDIVKVLVEQNCDIEACDHLKRRPIHLACEKGHTEI-VKVLIDHHCDISACGGRFNQSPIHL 656
            R  +H A   G +++V++L+    +I   ++K +++ IH A + GH+E++K+L     ++   D+    P+H A  +G   +VKFL++L  DI   N     P+H  C+ G   +V  L+E    +   +     P+H      H  + +++L+ +  D++    +  ++P+H+
Sbjct:  141 RTALHHAAFSGHLEMVRLLLSRGSNINAFDKK-DRRAIHWAAYMGHIEVVKLLASHGAEVTCKDKKSYTPLHAAASSGMISVVKFLLDLGVDINEPNAYGNTPLHVACYNGQDVVVNELIECGAHVNQVNEKGFAPLHFTAASRHGALCLELLVCNGADVN-IKSKDGKTPLHM 312          

HSP 7 Score: 67.0106 bits (162), Expect = 5.428e-12
Identity = 54/227 (23.79%), Postives = 96/227 (42.29%), Query Frame = 3
Query:  138 RRPIHFACLKGDIDIVKVLIDHNCDIE---VRNRKWNQQPIHMACWDGHLEILKVLLEK--------------NCDI--------------------ESCDEWKRRPIHLACENGHTEIVKFLINLHCDIEAINDKAWRPIHFGCWKGHSDIVKVLVEQ-NCDIEACDHLKRRPIHLACEKGHTEIVKVLIDHHCD---ISACGGRFNQSPIHLARKNNFTELIQLL 695
            R P+H A   G I ++  L+     +E   V        P+H AC++GH   ++VLLE+              +C +                     + D   R P+H A    H E ++ L++ +  +  ++     P+      G ++ V++LV     D+   D +K   +HLAC KGH     ++++   D   I+A      Q+P+H+A +N  T ++Q L
Sbjct:  720 RTPVHLAAACGHIGVLGGLLHAAQSVETLPVLTDSHGYTPLHWACYNGHDTCVEVLLEQEVFHKAEGNPFSPLHCAVIRDNEGAAEMLIDTLGPTIVNAKDGKNRTPLHAAAFTDHVECLQLLLSHNAQVNTVDAAGKSPLMMAAENGQTNAVELLVSSAKADLTIQDAVKNTALHLACSKGHETSALLILEKISDRNLINATNAAL-QTPLHVAARNGLTVVVQEL 945          

HSP 8 Score: 65.855 bits (159), Expect = 1.183e-11
Identity = 43/156 (27.56%), Postives = 78/156 (50.00%), Query Frame = 3
Query:  144 PIHFACLKGDIDIVKVLIDHNCDIEVRNRKW-NQQPIHMACWDGHLEILKVLLEKNCDIESCDEWKRRPIHLACENGHTEIVKFLI-NLHCDIEAINDKAWRPIHFGCWKGHSDIVKVLVEQNCD---IEACDHLKRRPIHLACEKGHTEIVKVLI 596
            P+H A ++ +    ++LID      V  +   N+ P+H A +  H+E L++LL  N  + + D   + P+ +A ENG T  V+ L+ +   D+   +      +H  C KGH     +++E+  D   I A +   + P+H+A   G T +V+ L+
Sbjct:  791 PLHCAVIRDNEGAAEMLIDTLGPTIVNAKDGKNRTPLHAAAFTDHVECLQLLLSHNAQVNTVDAAGKSPLMMAAENGQTNAVELLVSSAKADLTIQDAVKNTALHLACSKGHETSALLILEKISDRNLINATNAALQTPLHVAARNGLTVVVQELL 946          

HSP 9 Score: 59.3066 bits (142), Expect = 1.718e-9
Identity = 52/199 (26.13%), Postives = 85/199 (42.71%), Query Frame = 3
Query:  138 RRPIHFACLKGDIDIVKVLIDHNCDIEVRNRKWNQQPIHMACW-DGHLEILKVLLEKNCDIESCDEWKRRPIHLACENGHT---EIVKFLINLHCDIEA-----INDKAWR----PIHFGCWKGHSDIVKVLVEQNCDIEACDHLKRRPIHLACEKGHTEIVKVLIDHHCDISACGGRFNQSPIHLARKNNFTELIQLL 695
            R P+H+A    +   +  L+     +   + +    P+H A   D   + L+ LL  + +    D      +H A   GH    E++     L   +E      +ND   R    P+H   + GH   ++VLV+   D++  +   R P+ LA  KGH E V VLI+    I        ++PIH A  N  +E ++LL
Sbjct:  439 RTPLHYAAANCNYQCLFALVGSGASVNDLDER-GCTPLHYAAASDTDGKCLEYLLRNDANPGIRDNQGYNAVHYASAYGHRLCLELIASETPLDVLMETSGTDILNDSDVRAPVSPLHLAAYHGHHQAMEVLVQSLLDLDVRNSQGRTPLDLAAFKGHVECVDVLINQGASILVKDFTLKRTPIHAAATNGHSECLRLL 636          

HSP 10 Score: 57.7658 bits (138), Expect = 5.580e-9
Identity = 45/186 (24.19%), Postives = 85/186 (45.70%), Query Frame = 3
Query:  144 PIHF-ACLKGDIDIVKVLIDHNCDIEVRNRKWNQQPIHMACWDGHLEILKVLLEKNCDIESCDEWKRRPIHLACENGHTEIVKFLINLHCDIEAINDKAWRPIHFGCWKGHSDIVKVLVEQNCDIEACDHLKRRPIHLACEKGHTEIVKVLIDHHCDISACGGRFNQSPIHLARKN-NFTELIQLL 695
            P+HF A  +     +++L+ +  D+ ++++   + P+HM    G     + ++E   +I+  D+    P+H+A   GH  ++  LI    D          P+H     G SD  + L+    DI+  D   R  +H A   G+ E + +L++   D +     F ++P+H A  N N+  L  L+
Sbjct:  275 PLHFTAASRHGALCLELLVCNGADVNIKSKD-GKTPLHMTAIHGRFSRSQAIIENGAEIDCEDKNGNTPLHIAARYGHELLINTLITNRADTAKRGIHGMFPLHLAALSGFSDCCRKLLSSGFDIDTPDDFGRTCLHAAAAGGNLECLNLLLNTGADFNR-KDSFGRTPLHYAAANCNYQCLFALV 458          

HSP 11 Score: 54.299 bits (129), Expect = 7.310e-8
Identity = 37/153 (24.18%), Postives = 75/153 (49.02%), Query Frame = 3
Query:  237 NQQPIHMACWDGHLEILKVLLEKNCDIESCDEWKRRPIHLACENGHTEIVKFLINLHCDIEAINDKAWRPIHFGCWKGHSDIVKVLVEQNCDIEACDHLKRRPIHLACEKGHTEIVKVLIDHHCDISACGGRFNQSPIHLARKNNFTELIQLL 695
            +Q P+  A ++   + ++ L+ K  D+ + D  KR P+H A   G  EI++ LI     + A ++K   P+H        + V+VL++ + D+ A D   + P+H+A         + L+    +++    R  ++ +H A  +   E+++LL
Sbjct:    8 DQPPLLKAIFNVDPDEVRSLIFKKEDVNAQDNEKRTPLHAAAYLGDAEIIELLILSGARVNAKDNKWLTPLHRAVASCSEEAVQVLLKHSADVNARDKNWQTPLHIAAANKAVRCAEALVPLLSNVNV-SDRAGRTALHHAAFSGHLEMVRLL 159          
BLAST of SMED30015660 vs. Planmine SMEST
Match: SMESG000018225.1 (SMESG000018225.1)

HSP 1 Score: 331.643 bits (849), Expect = 1.175e-108
Identity = 164/188 (87.23%), Postives = 172/188 (91.49%), Query Frame = 3
Query:  132 WDRRPIHFACLKGDIDIVKVLIDHNCDIEVRNRKWNQQPIHMACWDGHLEILKVLLEKNCDIESCDEWKRRPIHLACENGHTEIVKFLINLHCDIEAINDKAWRPIHFGCWKGHSDIVKVLVEQNCDIEACDHLKRRPIHLACEKGHTEIVKVLIDHHCDISACGGRFNQSPIHLARKNNFTELIQLL 695
            WDRRPIHFACLKGDIDIVKVLIDHNCDIEVRNRKWNQQPIHMACWDGHLEILKVLLEKNCDIESCDEWKRRPIHLACENGHTEIVKFLINLHCDIEAIND AWRPIHFGCWKGHSD VKVLVEQNCDIEAC H+KRRPIHLACEKGHTEIVKVLIDHHCDI A   R  + PIH++    + E+ ++L
Sbjct:  418 WDRRPIHFACLKGDIDIVKVLIDHNCDIEVRNRKWNQQPIHMACWDGHLEILKVLLEKNCDIESCDEWKRRPIHLACENGHTEIVKFLINLHCDIEAINDNAWRPIHFGCWKGHSDTVKVLVEQNCDIEACGHMKRRPIHLACEKGHTEIVKVLIDHHCDIEAQDDR-KRCPIHISCVKGYMEITKIL 604          

HSP 2 Score: 303.523 bits (776), Expect = 7.195e-98
Identity = 151/190 (79.47%), Postives = 169/190 (88.95%), Query Frame = 3
Query:  138 RRPIHFACLKGDIDIVKVLIDHNCDIEVRNRKWNQQPIHMACWDGHLEILKVLLEKNCDIESCDEWKRRPIHLACENGHTEIVKFLINLHCDIEAINDKAWRPIHFGCWKGHSDIVKVLVEQNCDIEACDHLKRRPIHLACEKGHTEIVKVLIDHHCDISACGGRFNQSPIHLARKNNFTELIQLLTIHE 707
            RRPIH AC KG  +IVKVLIDH+CDIE ++ +  + PIH++C  G++EI K+LL++ CDIE+ D+WK  PIHLACENGHTEIVK LIN HCDIEAINDKAWRPIHFGCWKGH DIVKVLVEQNCDIEACDH+KRRPIHLACEKGHTEIVKVLIDHHCDISACGGRFNQSPI+LA K NFTELIQLLT+HE
Sbjct:  553 RRPIHLACEKGHTEIVKVLIDHHCDIEAQDDR-KRCPIHISCVKGYMEITKILLDQRCDIEALDDWKMSPIHLACENGHTEIVKVLINHHCDIEAINDKAWRPIHFGCWKGHLDIVKVLVEQNCDIEACDHMKRRPIHLACEKGHTEIVKVLIDHHCDISACGGRFNQSPIYLAHKKNFTELIQLLTVHE 741          

HSP 3 Score: 200.675 bits (509), Expect = 6.236e-59
Identity = 101/188 (53.72%), Postives = 137/188 (72.87%), Query Frame = 3
Query:  135 DRRPIHFACLKGDIDIVKVLIDHNCDIEVRNRKWNQQPIHMACWDGHLEILKVLLEKNCDIESCDEWKRRPIHLACENGHTEIVKFLINLHCDIEA-INDKAWRPIHFGCWKGHSDIVKVLVEQNCDIEACDHLKRRPIHLACEKGHTEIVKVLIDHHCDISACGGRFNQSPIHLARKNNFTELIQLL 695
            +R PI+FAC +G ++IVK+LID  CDI+V   K  + PIHM C +GH +I+K+L+++NCDIE+CD+  +R IHLACENGH EI K LI+L+CDIEA    K+ RPIHF C  G  +IV+VL+ +NC+IEA D   +RPIHLACE GH EI K+LID +CDI A  G+ ++ PIH A      E++++L
Sbjct:   33 NRSPIYFACKRGHVEIVKLLIDQRCDIQVFGGKKKRHPIHMGCSEGHADIVKMLIDENCDIETCDKDGKRSIHLACENGHVEIAKILIDLNCDIEASAGKKSRRPIHFACIGGRIEIVEVLISKNCNIEAEDEDGKRPIHLACENGHVEIAKILIDLNCDIEARAGKKSRRPIHFACFGGHVEIVEVL 220          

HSP 4 Score: 199.519 bits (506), Expect = 1.428e-58
Identity = 106/190 (55.79%), Postives = 132/190 (69.47%), Query Frame = 3
Query:  132 WDRRPIHFACLKGDIDIVKVLIDHNCDIE-VRNRKWNQQPIHMACWDGHLEILKVLLEKNCDIESCDEWKRRPIHLACENGHTEIVKFLINLHCDIEAINDKAWRPIHFGCWKGHSDIVKVLVEQNCDIEACDHLKRRPIHLACEKGHTEIVKVLIDHHCDISACGGRFNQSPIHLARKNNFTELIQLLT 698
            W RRPIH AC  G  +IVK LI+ +CDIE + +  W  +PIH  CW GH + +KVL+E+NCDIE+C   KRRPIHLACE GHTEIVK LI+ HCDIEA +D+   PIH  C KG+ +I K+L++Q CDIEA D  K  PIHLACE GHTEIVKVLI+HHCDI A   +    PIH        +++++L 
Sbjct:  485 WKRRPIHLACENGHTEIVKFLINLHCDIEAINDNAW--RPIHFGCWKGHSDTVKVLVEQNCDIEACGHMKRRPIHLACEKGHTEIVKVLIDHHCDIEAQDDRKRCPIHISCVKGYMEITKILLDQRCDIEALDDWKMSPIHLACENGHTEIVKVLINHHCDIEAINDKA-WRPIHFGCWKGHLDIVKVLV 671          

HSP 5 Score: 190.66 bits (483), Expect = 3.137e-55
Identity = 101/203 (49.75%), Postives = 134/203 (66.01%), Query Frame = 3
Query:  144 PIHFACLKGDIDIVKVLIDHNCDIEVRNRKWNQ------------------QPIHMACWDGHLEILKVLLEKNCDIESCDEWKRRPIHLACENGHTEIVKFLINLHCDIEAINDKAWRPIHFGCWKGHSDIVKVLVEQNCDIEAC-DHLKRRPIHLACEKGHTEIVKVLIDHHCDISACGGRFNQSPIHLARKNNFTELIQLL 695
            PIH+ACL G+++IV++LI HNCDIE    KW +                  +PIH+ACWD  +EI+K+L+E+ CDIESCD +KRRPIHLACE GH EI K LI   CDI+A   + +RPIH      H +IVK+L+E+NCD+ A      RRPIH AC KG  +IVKVLIDH+CDI     ++NQ PIH+A  +   E++++L
Sbjct:  270 PIHYACLNGNVEIVELLIRHNCDIEAFGGKWKRFPIHFACLRDSCEISWFHRPIHVACWDDSIEIVKLLIEQKCDIESCDRFKRRPIHLACEAGHLEIAKLLITHKCDIDAKTGRNFRPIHLAFDNNHREIVKLLIEENCDVNAIGGKWDRRPIHFACLKGDIDIVKVLIDHNCDIEVRNRKWNQQPIHMACWDGHLEILKVL 472          

HSP 6 Score: 186.808 bits (473), Expect = 6.715e-54
Identity = 111/238 (46.64%), Postives = 138/238 (57.98%), Query Frame = 3
Query:  138 RRPIHFACLKGDIDIVKVLIDHNCDIEVRNRKWNQQPIHMACWDGHLEILKVLLEKNCDIESCDEWKRRPIHLACE---------------------------------NGHTEIVKFLINLHCDIEAINDK-----------------AW--RPIHFGCWKGHSDIVKVLVEQNCDIEACDHLKRRPIHLACEKGHTEIVKVLIDHHCDISACGGRFNQSPIHLARKNNFTELIQLL 695
            +RPIH AC  G ++I K+LID NCDIE R  K +++PIH AC+ GH+EI++VL+ KNC+IE+ DE   RPIHLAC+                                 NG+ EIV+ LI  +CDIEA   K                 +W  RPIH  CW    +IVK+L+EQ CDIE+CD  KRRPIHLACE GH EI K+LI H CDI A  GR N  PIHLA  NN  E+++LL
Sbjct:  168 KRPIHLACENGHVEIAKILIDLNCDIEARAGKKSRRPIHFACFGGHVEIVEVLISKNCNIEAEDEESWRPIHLACQIGNPLIVTLLLDNNCEIESRTNENMCPIHYACLNGNVEIVELLIRHNCDIEAFGGKWKRFPIHFACLRDSCEISWFHRPIHVACWDDSIEIVKLLIEQKCDIESCDRFKRRPIHLACEAGHLEIAKLLITHKCDIDAKTGR-NFRPIHLAFDNNHREIVKLL 404          

HSP 7 Score: 169.474 bits (428), Expect = 1.348e-47
Identity = 109/258 (42.25%), Postives = 137/258 (53.10%), Query Frame = 3
Query:  132 WDRRPIHFACLKGDIDIVKVLIDHNCDIEVRNRKWNQQPIHMACWDGHLEILKVLLEKNCDI----------------------------ESCD------EWKRRPIHLACENGHTEIVKFLINLHCDIEAINDK-AWRPIHFGCWKGHSDIVKVLVEQNCDIEACDHLKRRPIHLACEKGHTEIVKVLIDHHCDISACG--------------------------------GRFNQSPIHLARKNNFTELIQLLTIH 704
            W  RPIH AC    I+IVK+LI+  CDIE  +R + ++PIH+AC  GHLEI K+L+   CDI                            E+CD      +W RRPIH AC  G  +IVK LI+ +CDIE  N K   +PIH  CW GH +I+KVL+E+NCDIE+CD  KRRPIHLACE GHTEIVK LI+ HCDI A                                  G   + PIHLA +   TE++++L  H
Sbjct:  318 WFHRPIHVACWDDSIEIVKLLIEQKCDIESCDR-FKRRPIHLACEAGHLEIAKLLITHKCDIDAKTGRNFRPIHLAFDNNHREIVKLLIEENCDVNAIGGKWDRRPIHFACLKGDIDIVKVLIDHNCDIEVRNRKWNQQPIHMACWDGHLEILKVLLEKNCDIESCDEWKRRPIHLACENGHTEIVKFLINLHCDIEAINDNAWRPIHFGCWKGHSDTVKVLVEQNCDIEACGHMKRRPIHLACEKGHTEIVKVLIDH 574          

HSP 8 Score: 151.754 bits (382), Expect = 2.999e-42
Identity = 88/207 (42.51%), Postives = 125/207 (60.39%), Query Frame = 3
Query:  141 RPIHFACLKGDIDIVKVLIDHNCDIEVRNRKWNQQPIHMACWDGHLEILKVLLEKNCDIE------------------SCD-EWKRRPIHLACENGHTEIVKFLINLHCDIEAINDKAWRPIHFGCWKGHSDIVKVLVEQNCDIEACDHLKRRPIHLACEKGHTEIVKVLIDHHCDISACGGRFNQSPIHLARKNNFTELIQLLTIH 704
            RPIH AC  G+  IV +L+D+NC+IE R  + N  PIH AC +G++EI+++L+  NCDIE                  SC+  W  RPIH+AC +   EIVK LI   CDIE+ +    RPIH  C  GH +I K+L+   CDI+A      RPIHLA +  H EIVK+LI+ +CD++A GG++++ PIH A      +++++L  H
Sbjct:  236 RPIHLACQIGNPLIVTLLLDNNCEIESRTNE-NMCPIHYACLNGNVEIVELLIRHNCDIEAFGGKWKRFPIHFACLRDSCEISWFHRPIHVACWDDSIEIVKLLIEQKCDIESCDRFKRRPIHLACEAGHLEIAKLLITHKCDIDAKTGRNFRPIHLAFDNNHREIVKLLIEENCDVNAIGGKWDRRPIHFACLKGDIDIVKVLIDH 441          

HSP 9 Score: 38.891 bits (89), Expect = 2.999e-42
Identity = 18/30 (60.00%), Postives = 22/30 (73.33%), Query Frame = 2
Query:    2 PIHLAFDNNHREIVKLLIEENCDVNAIGGK 91
            PIHLA +N H EI K+LI+ NCD+ A  GK
Sbjct:  170 PIHLACENGHVEIAKILIDLNCDIEARAGK 199          

HSP 10 Score: 63.1586 bits (152), Expect = 6.295e-11
Identity = 30/30 (100.00%), Postives = 30/30 (100.00%), Query Frame = 2
Query:    2 PIHLAFDNNHREIVKLLIEENCDVNAIGGK 91
            PIHLAFDNNHREIVKLLIEENCDVNAIGGK
Sbjct:  388 PIHLAFDNNHREIVKLLIEENCDVNAIGGK 417          

HSP 11 Score: 55.8398 bits (133), Expect = 1.497e-8
Identity = 23/55 (41.82%), Postives = 36/55 (65.45%), Query Frame = 3
Query:  531 LKRRPIHLACEKGHTEIVKVLIDHHCDISACGGRFNQSPIHLARKNNFTELIQLL 695
            + R PI+ AC++GH EIVK+LID  CDI   GG+  + PIH+       +++++L
Sbjct:   32 VNRSPIYFACKRGHVEIVKLLIDQRCDIQVFGGKKKRHPIHMGCSEGHADIVKML 86          
BLAST of SMED30015660 vs. Planmine SMEST
Match: SMESG000018225.1 (SMESG000018225.1)

HSP 1 Score: 331.257 bits (848), Expect = 3.117e-108
Identity = 164/188 (87.23%), Postives = 172/188 (91.49%), Query Frame = 3
Query:  132 WDRRPIHFACLKGDIDIVKVLIDHNCDIEVRNRKWNQQPIHMACWDGHLEILKVLLEKNCDIESCDEWKRRPIHLACENGHTEIVKFLINLHCDIEAINDKAWRPIHFGCWKGHSDIVKVLVEQNCDIEACDHLKRRPIHLACEKGHTEIVKVLIDHHCDISACGGRFNQSPIHLARKNNFTELIQLL 695
            WDRRPIHFACLKGDIDIVKVLIDHNCDIEVRNRKWNQQPIHMACWDGHLEILKVLLEKNCDIESCDEWKRRPIHLACENGHTEIVKFLINLHCDIEAIND AWRPIHFGCWKGHSD VKVLVEQNCDIEAC H+KRRPIHLACEKGHTEIVKVLIDHHCDI A   R  + PIH++    + E+ ++L
Sbjct:  446 WDRRPIHFACLKGDIDIVKVLIDHNCDIEVRNRKWNQQPIHMACWDGHLEILKVLLEKNCDIESCDEWKRRPIHLACENGHTEIVKFLINLHCDIEAINDNAWRPIHFGCWKGHSDTVKVLVEQNCDIEACGHMKRRPIHLACEKGHTEIVKVLIDHHCDIEAQDDR-KRCPIHISCVKGYMEITKIL 632          

HSP 2 Score: 303.523 bits (776), Expect = 1.662e-97
Identity = 151/190 (79.47%), Postives = 169/190 (88.95%), Query Frame = 3
Query:  138 RRPIHFACLKGDIDIVKVLIDHNCDIEVRNRKWNQQPIHMACWDGHLEILKVLLEKNCDIESCDEWKRRPIHLACENGHTEIVKFLINLHCDIEAINDKAWRPIHFGCWKGHSDIVKVLVEQNCDIEACDHLKRRPIHLACEKGHTEIVKVLIDHHCDISACGGRFNQSPIHLARKNNFTELIQLLTIHE 707
            RRPIH AC KG  +IVKVLIDH+CDIE ++ +  + PIH++C  G++EI K+LL++ CDIE+ D+WK  PIHLACENGHTEIVK LIN HCDIEAINDKAWRPIHFGCWKGH DIVKVLVEQNCDIEACDH+KRRPIHLACEKGHTEIVKVLIDHHCDISACGGRFNQSPI+LA K NFTELIQLLT+HE
Sbjct:  581 RRPIHLACEKGHTEIVKVLIDHHCDIEAQDDR-KRCPIHISCVKGYMEITKILLDQRCDIEALDDWKMSPIHLACENGHTEIVKVLINHHCDIEAINDKAWRPIHFGCWKGHLDIVKVLVEQNCDIEACDHMKRRPIHLACEKGHTEIVKVLIDHHCDISACGGRFNQSPIYLAHKKNFTELIQLLTVHE 769          

HSP 3 Score: 200.29 bits (508), Expect = 1.132e-58
Identity = 101/188 (53.72%), Postives = 137/188 (72.87%), Query Frame = 3
Query:  135 DRRPIHFACLKGDIDIVKVLIDHNCDIEVRNRKWNQQPIHMACWDGHLEILKVLLEKNCDIESCDEWKRRPIHLACENGHTEIVKFLINLHCDIEA-INDKAWRPIHFGCWKGHSDIVKVLVEQNCDIEACDHLKRRPIHLACEKGHTEIVKVLIDHHCDISACGGRFNQSPIHLARKNNFTELIQLL 695
            +R PI+FAC +G ++IVK+LID  CDI+V   K  + PIHM C +GH +I+K+L+++NCDIE+CD+  +R IHLACENGH EI K LI+L+CDIEA    K+ RPIHF C  G  +IV+VL+ +NC+IEA D   +RPIHLACE GH EI K+LID +CDI A  G+ ++ PIH A      E++++L
Sbjct:   61 NRSPIYFACKRGHVEIVKLLIDQRCDIQVFGGKKKRHPIHMGCSEGHADIVKMLIDENCDIETCDKDGKRSIHLACENGHVEIAKILIDLNCDIEASAGKKSRRPIHFACIGGRIEIVEVLISKNCNIEAEDEDGKRPIHLACENGHVEIAKILIDLNCDIEARAGKKSRRPIHFACFGGHVEIVEVL 248          

HSP 4 Score: 199.519 bits (506), Expect = 1.981e-58
Identity = 106/190 (55.79%), Postives = 132/190 (69.47%), Query Frame = 3
Query:  132 WDRRPIHFACLKGDIDIVKVLIDHNCDIE-VRNRKWNQQPIHMACWDGHLEILKVLLEKNCDIESCDEWKRRPIHLACENGHTEIVKFLINLHCDIEAINDKAWRPIHFGCWKGHSDIVKVLVEQNCDIEACDHLKRRPIHLACEKGHTEIVKVLIDHHCDISACGGRFNQSPIHLARKNNFTELIQLLT 698
            W RRPIH AC  G  +IVK LI+ +CDIE + +  W  +PIH  CW GH + +KVL+E+NCDIE+C   KRRPIHLACE GHTEIVK LI+ HCDIEA +D+   PIH  C KG+ +I K+L++Q CDIEA D  K  PIHLACE GHTEIVKVLI+HHCDI A   +    PIH        +++++L 
Sbjct:  513 WKRRPIHLACENGHTEIVKFLINLHCDIEAINDNAW--RPIHFGCWKGHSDTVKVLVEQNCDIEACGHMKRRPIHLACEKGHTEIVKVLIDHHCDIEAQDDRKRCPIHISCVKGYMEITKILLDQRCDIEALDDWKMSPIHLACENGHTEIVKVLINHHCDIEAINDK-AWRPIHFGCWKGHLDIVKVLV 699          

HSP 5 Score: 190.274 bits (482), Expect = 4.687e-55
Identity = 101/203 (49.75%), Postives = 134/203 (66.01%), Query Frame = 3
Query:  144 PIHFACLKGDIDIVKVLIDHNCDIEVRNRKWNQ------------------QPIHMACWDGHLEILKVLLEKNCDIESCDEWKRRPIHLACENGHTEIVKFLINLHCDIEAINDKAWRPIHFGCWKGHSDIVKVLVEQNCDIEAC-DHLKRRPIHLACEKGHTEIVKVLIDHHCDISACGGRFNQSPIHLARKNNFTELIQLL 695
            PIH+ACL G+++IV++LI HNCDIE    KW +                  +PIH+ACWD  +EI+K+L+E+ CDIESCD +KRRPIHLACE GH EI K LI   CDI+A   + +RPIH      H +IVK+L+E+NCD+ A      RRPIH AC KG  +IVKVLIDH+CDI     ++NQ PIH+A  +   E++++L
Sbjct:  298 PIHYACLNGNVEIVELLIRHNCDIEAFGGKWKRFPIHFACLRDSCEISWFHRPIHVACWDDSIEIVKLLIEQKCDIESCDRFKRRPIHLACEAGHLEIAKLLITHKCDIDAKTGRNFRPIHLAFDNNHREIVKLLIEENCDVNAIGGKWDRRPIHFACLKGDIDIVKVLIDHNCDIEVRNRKWNQQPIHMACWDGHLEILKVL 500          

HSP 6 Score: 186.808 bits (473), Expect = 1.137e-53
Identity = 111/238 (46.64%), Postives = 138/238 (57.98%), Query Frame = 3
Query:  138 RRPIHFACLKGDIDIVKVLIDHNCDIEVRNRKWNQQPIHMACWDGHLEILKVLLEKNCDIESCDEWKRRPIHLACE---------------------------------NGHTEIVKFLINLHCDIEAINDK-----------------AW--RPIHFGCWKGHSDIVKVLVEQNCDIEACDHLKRRPIHLACEKGHTEIVKVLIDHHCDISACGGRFNQSPIHLARKNNFTELIQLL 695
            +RPIH AC  G ++I K+LID NCDIE R  K +++PIH AC+ GH+EI++VL+ KNC+IE+ DE   RPIHLAC+                                 NG+ EIV+ LI  +CDIEA   K                 +W  RPIH  CW    +IVK+L+EQ CDIE+CD  KRRPIHLACE GH EI K+LI H CDI A  GR N  PIHLA  NN  E+++LL
Sbjct:  196 KRPIHLACENGHVEIAKILIDLNCDIEARAGKKSRRPIHFACFGGHVEIVEVLISKNCNIEAEDEESWRPIHLACQIGNPLIVTLLLDNNCEIESRTNENMCPIHYACLNGNVEIVELLIRHNCDIEAFGGKWKRFPIHFACLRDSCEISWFHRPIHVACWDDSIEIVKLLIEQKCDIESCDRFKRRPIHLACEAGHLEIAKLLITHKCDIDAKTGR-NFRPIHLAFDNNHREIVKLL 432          

HSP 7 Score: 173.711 bits (439), Expect = 6.245e-49
Identity = 82/155 (52.90%), Postives = 111/155 (71.61%), Query Frame = 3
Query:  234 WNQQPIHMACWDGHLEILKVLLEKNCDIESCDEWKRRPIHLACENGHTEIVKFLINLHCDIEAINDKAWR-PIHFGCWKGHSDIVKVLVEQNCDIEACDHLKRRPIHLACEKGHTEIVKVLIDHHCDISACGGRFNQSPIHLARKNNFTELIQLL 695
            WNQ P+H+ACW+GH + +K+L+E NC+I +CDE  R PI+ AC+ GH EIVK LI+  CDI+    K  R PIH GC +GH+DIVK+L+++NCDIE CD   +R IHLACE GH EI K+LID +CDI A  G+ ++ PIH A      E++++L
Sbjct:   27 WNQCPLHLACWEGHKDTVKILIESNCNINACDEVNRSPIYFACKRGHVEIVKLLIDQRCDIQVFGGKKKRHPIHMGCSEGHADIVKMLIDENCDIETCDKDGKRSIHLACENGHVEIAKILIDLNCDIEASAGKKSRRPIHFACIGGRIEIVEVL 181          

HSP 8 Score: 169.474 bits (428), Expect = 1.819e-47
Identity = 109/258 (42.25%), Postives = 137/258 (53.10%), Query Frame = 3
Query:  132 WDRRPIHFACLKGDIDIVKVLIDHNCDIEVRNRKWNQQPIHMACWDGHLEILKVLLEKNCDI----------------------------ESCD------EWKRRPIHLACENGHTEIVKFLINLHCDIEAINDK-AWRPIHFGCWKGHSDIVKVLVEQNCDIEACDHLKRRPIHLACEKGHTEIVKVLIDHHCDISACG--------------------------------GRFNQSPIHLARKNNFTELIQLLTIH 704
            W  RPIH AC    I+IVK+LI+  CDIE  +R + ++PIH+AC  GHLEI K+L+   CDI                            E+CD      +W RRPIH AC  G  +IVK LI+ +CDIE  N K   +PIH  CW GH +I+KVL+E+NCDIE+CD  KRRPIHLACE GHTEIVK LI+ HCDI A                                  G   + PIHLA +   TE++++L  H
Sbjct:  346 WFHRPIHVACWDDSIEIVKLLIEQKCDIESCDR-FKRRPIHLACEAGHLEIAKLLITHKCDIDAKTGRNFRPIHLAFDNNHREIVKLLIEENCDVNAIGGKWDRRPIHFACLKGDIDIVKVLIDHNCDIEVRNRKWNQQPIHMACWDGHLEILKVLLEKNCDIESCDEWKRRPIHLACENGHTEIVKFLINLHCDIEAINDNAWRPIHFGCWKGHSDTVKVLVEQNCDIEACGHMKRRPIHLACEKGHTEIVKVLIDH 602          

HSP 9 Score: 151.754 bits (382), Expect = 2.541e-42
Identity = 88/207 (42.51%), Postives = 125/207 (60.39%), Query Frame = 3
Query:  141 RPIHFACLKGDIDIVKVLIDHNCDIEVRNRKWNQQPIHMACWDGHLEILKVLLEKNCDIE------------------SCD-EWKRRPIHLACENGHTEIVKFLINLHCDIEAINDKAWRPIHFGCWKGHSDIVKVLVEQNCDIEACDHLKRRPIHLACEKGHTEIVKVLIDHHCDISACGGRFNQSPIHLARKNNFTELIQLLTIH 704
            RPIH AC  G+  IV +L+D+NC+IE R  + N  PIH AC +G++EI+++L+  NCDIE                  SC+  W  RPIH+AC +   EIVK LI   CDIE+ +    RPIH  C  GH +I K+L+   CDI+A      RPIHLA +  H EIVK+LI+ +CD++A GG++++ PIH A      +++++L  H
Sbjct:  264 RPIHLACQIGNPLIVTLLLDNNCEIESRTNE-NMCPIHYACLNGNVEIVELLIRHNCDIEAFGGKWKRFPIHFACLRDSCEISWFHRPIHVACWDDSIEIVKLLIEQKCDIESCDRFKRRPIHLACEAGHLEIAKLLITHKCDIDAKTGRNFRPIHLAFDNNHREIVKLLIEENCDVNAIGGKWDRRPIHFACLKGDIDIVKVLIDH 469          

HSP 10 Score: 39.2762 bits (90), Expect = 2.541e-42
Identity = 18/30 (60.00%), Postives = 22/30 (73.33%), Query Frame = 2
Query:    2 PIHLAFDNNHREIVKLLIEENCDVNAIGGK 91
            PIHLA +N H EI K+LI+ NCD+ A  GK
Sbjct:  198 PIHLACENGHVEIAKILIDLNCDIEARAGK 227          

HSP 11 Score: 63.1586 bits (152), Expect = 5.554e-11
Identity = 30/30 (100.00%), Postives = 30/30 (100.00%), Query Frame = 2
Query:    2 PIHLAFDNNHREIVKLLIEENCDVNAIGGK 91
            PIHLAFDNNHREIVKLLIEENCDVNAIGGK
Sbjct:  416 PIHLAFDNNHREIVKLLIEENCDVNAIGGK 445          
BLAST of SMED30015660 vs. Planmine SMEST
Match: SMESG000018225.1 (SMESG000018225.1)

HSP 1 Score: 330.102 bits (845), Expect = 4.137e-108
Identity = 164/188 (87.23%), Postives = 172/188 (91.49%), Query Frame = 3
Query:  132 WDRRPIHFACLKGDIDIVKVLIDHNCDIEVRNRKWNQQPIHMACWDGHLEILKVLLEKNCDIESCDEWKRRPIHLACENGHTEIVKFLINLHCDIEAINDKAWRPIHFGCWKGHSDIVKVLVEQNCDIEACDHLKRRPIHLACEKGHTEIVKVLIDHHCDISACGGRFNQSPIHLARKNNFTELIQLL 695
            WDRRPIHFACLKGDIDIVKVLIDHNCDIEVRNRKWNQQPIHMACWDGHLEILKVLLEKNCDIESCDEWKRRPIHLACENGHTEIVKFLINLHCDIEAIND AWRPIHFGCWKGHSD VKVLVEQNCDIEAC H+KRRPIHLACEKGHTEIVKVLIDHHCDI A   R  + PIH++    + E+ ++L
Sbjct:  416 WDRRPIHFACLKGDIDIVKVLIDHNCDIEVRNRKWNQQPIHMACWDGHLEILKVLLEKNCDIESCDEWKRRPIHLACENGHTEIVKFLINLHCDIEAINDNAWRPIHFGCWKGHSDTVKVLVEQNCDIEACGHMKRRPIHLACEKGHTEIVKVLIDHHCDIEAQDDR-KRCPIHISCVKGYMEITKIL 602          

HSP 2 Score: 302.368 bits (773), Expect = 2.270e-97
Identity = 151/190 (79.47%), Postives = 169/190 (88.95%), Query Frame = 3
Query:  138 RRPIHFACLKGDIDIVKVLIDHNCDIEVRNRKWNQQPIHMACWDGHLEILKVLLEKNCDIESCDEWKRRPIHLACENGHTEIVKFLINLHCDIEAINDKAWRPIHFGCWKGHSDIVKVLVEQNCDIEACDHLKRRPIHLACEKGHTEIVKVLIDHHCDISACGGRFNQSPIHLARKNNFTELIQLLTIHE 707
            RRPIH AC KG  +IVKVLIDH+CDIE ++ +  + PIH++C  G++EI K+LL++ CDIE+ D+WK  PIHLACENGHTEIVK LIN HCDIEAINDKAWRPIHFGCWKGH DIVKVLVEQNCDIEACDH+KRRPIHLACEKGHTEIVKVLIDHHCDISACGGRFNQSPI+LA K NFTELIQLLT+HE
Sbjct:  551 RRPIHLACEKGHTEIVKVLIDHHCDIEAQDDR-KRCPIHISCVKGYMEITKILLDQRCDIEALDDWKMSPIHLACENGHTEIVKVLINHHCDIEAINDKAWRPIHFGCWKGHLDIVKVLVEQNCDIEACDHMKRRPIHLACEKGHTEIVKVLIDHHCDISACGGRFNQSPIYLAHKKNFTELIQLLTVHE 739          

HSP 3 Score: 202.601 bits (514), Expect = 1.208e-59
Identity = 101/188 (53.72%), Postives = 135/188 (71.81%), Query Frame = 3
Query:  135 DRRPIHFACLKGDIDIVKVLIDHNCDIEVRNRKWNQQPIHMACWDGHLEILKVLLEKNCDIESCDEWKRRPIHLACENGHTEIVKFLINLHCDIEAINDKAWR-PIHFGCWKGHSDIVKVLVEQNCDIEACDHLKRRPIHLACEKGHTEIVKVLIDHHCDISACGGRFNQSPIHLARKNNFTELIQLL 695
            D   IH AC  G ++IVK LIDHN DIE+R+ +WNQ P+H+ACW+GH + +K+L+E NC+I +CDE  R PI+ AC+ GH EIVK LI+  CDI+    K  R PIH GC +GH+DIVK+L+++NCDIE CD   +RPIHLACE GH EI K+LID +CDI A  G+ ++ PIH A      E++++L
Sbjct:   32 DEPLIHLACDFGHLEIVKFLIDHNVDIEIRD-EWNQCPLHLACWEGHKDTVKILIESNCNINACDEVNRSPIYFACKRGHVEIVKLLIDQRCDIQVFGGKKKRHPIHMGCSEGHADIVKMLIDENCDIETCDKDGKRPIHLACENGHVEIAKILIDLNCDIEARAGKKSRRPIHFACFGGHVEIVEVL 218          

HSP 4 Score: 198.749 bits (504), Expect = 2.712e-58
Identity = 106/190 (55.79%), Postives = 132/190 (69.47%), Query Frame = 3
Query:  132 WDRRPIHFACLKGDIDIVKVLIDHNCDIE-VRNRKWNQQPIHMACWDGHLEILKVLLEKNCDIESCDEWKRRPIHLACENGHTEIVKFLINLHCDIEAINDKAWRPIHFGCWKGHSDIVKVLVEQNCDIEACDHLKRRPIHLACEKGHTEIVKVLIDHHCDISACGGRFNQSPIHLARKNNFTELIQLLT 698
            W RRPIH AC  G  +IVK LI+ +CDIE + +  W  +PIH  CW GH + +KVL+E+NCDIE+C   KRRPIHLACE GHTEIVK LI+ HCDIEA +D+   PIH  C KG+ +I K+L++Q CDIEA D  K  PIHLACE GHTEIVKVLI+HHCDI A   +    PIH        +++++L 
Sbjct:  483 WKRRPIHLACENGHTEIVKFLINLHCDIEAINDNAW--RPIHFGCWKGHSDTVKVLVEQNCDIEACGHMKRRPIHLACEKGHTEIVKVLIDHHCDIEAQDDRKRCPIHISCVKGYMEITKILLDQRCDIEALDDWKMSPIHLACENGHTEIVKVLINHHCDIEAINDKA-WRPIHFGCWKGHLDIVKVLV 669          

HSP 5 Score: 192.2 bits (487), Expect = 7.329e-56
Identity = 104/206 (50.49%), Postives = 143/206 (69.42%), Query Frame = 3
Query:  135 DRRPIHFACLKGDIDIVKVLIDHNCDIEVRNRKWNQQPIHMACWDGHLEILKVLLEKNCDIESCDEWKRRPIHLACENGHTEIVKFLINLHCDIEA-INDKAWRPIHFGCWKGHSDIVKVLVEQNCDIEACDHLKRRPIHLACEKGHTEIVKVLIDHHCDISACGGRFNQSPIHLARKNNFTELIQLLTIHE-------*KYLRFP 728
            +R PI+FAC +G ++IVK+LID  CDI+V   K  + PIHM C +GH +I+K+L+++NCDIE+CD+  +RPIHLACENGH EI K LI+L+CDIEA    K+ RPIHF C+ GH +IV+VL+ +NC+IEA D    RPIHLAC+ G+  IV +L+D++C+I +     N  PIH A  N   E+++LL  H         K+ RFP
Sbjct:   98 NRSPIYFACKRGHVEIVKLLIDQRCDIQVFGGKKKRHPIHMGCSEGHADIVKMLIDENCDIETCDKDGKRPIHLACENGHVEIAKILIDLNCDIEARAGKKSRRPIHFACFGGHVEIVEVLISKNCNIEAEDEESWRPIHLACQIGNPLIVTLLLDNNCEIESRTNE-NMCPIHYACLNGNVEIVELLIRHNCDIEAFGGKWKRFP 302          

HSP 6 Score: 189.889 bits (481), Expect = 5.655e-55
Identity = 101/203 (49.75%), Postives = 134/203 (66.01%), Query Frame = 3
Query:  144 PIHFACLKGDIDIVKVLIDHNCDIEVRNRKWNQ------------------QPIHMACWDGHLEILKVLLEKNCDIESCDEWKRRPIHLACENGHTEIVKFLINLHCDIEAINDKAWRPIHFGCWKGHSDIVKVLVEQNCDIEAC-DHLKRRPIHLACEKGHTEIVKVLIDHHCDISACGGRFNQSPIHLARKNNFTELIQLL 695
            PIH+ACL G+++IV++LI HNCDIE    KW +                  +PIH+ACWD  +EI+K+L+E+ CDIESCD +KRRPIHLACE GH EI K LI   CDI+A   + +RPIH      H +IVK+L+E+NCD+ A      RRPIH AC KG  +IVKVLIDH+CDI     ++NQ PIH+A  +   E++++L
Sbjct:  268 PIHYACLNGNVEIVELLIRHNCDIEAFGGKWKRFPIHFACLRDSCEISWFHRPIHVACWDDSIEIVKLLIEQKCDIESCDRFKRRPIHLACEAGHLEIAKLLITHKCDIDAKTGRNFRPIHLAFDNNHREIVKLLIEENCDVNAIGGKWDRRPIHFACLKGDIDIVKVLIDHNCDIEVRNRKWNQQPIHMACWDGHLEILKVL 470          

HSP 7 Score: 186.037 bits (471), Expect = 1.606e-53
Identity = 111/238 (46.64%), Postives = 138/238 (57.98%), Query Frame = 3
Query:  138 RRPIHFACLKGDIDIVKVLIDHNCDIEVRNRKWNQQPIHMACWDGHLEILKVLLEKNCDIESCDEWKRRPIHLACE---------------------------------NGHTEIVKFLINLHCDIEAINDK-----------------AW--RPIHFGCWKGHSDIVKVLVEQNCDIEACDHLKRRPIHLACEKGHTEIVKVLIDHHCDISACGGRFNQSPIHLARKNNFTELIQLL 695
            +RPIH AC  G ++I K+LID NCDIE R  K +++PIH AC+ GH+EI++VL+ KNC+IE+ DE   RPIHLAC+                                 NG+ EIV+ LI  +CDIEA   K                 +W  RPIH  CW    +IVK+L+EQ CDIE+CD  KRRPIHLACE GH EI K+LI H CDI A  GR N  PIHLA  NN  E+++LL
Sbjct:  166 KRPIHLACENGHVEIAKILIDLNCDIEARAGKKSRRPIHFACFGGHVEIVEVLISKNCNIEAEDEESWRPIHLACQIGNPLIVTLLLDNNCEIESRTNENMCPIHYACLNGNVEIVELLIRHNCDIEAFGGKWKRFPIHFACLRDSCEISWFHRPIHVACWDDSIEIVKLLIEQKCDIESCDRFKRRPIHLACEAGHLEIAKLLITHKCDIDAKTGR-NFRPIHLAFDNNHREIVKLL 402          

HSP 8 Score: 168.703 bits (426), Expect = 2.620e-47
Identity = 109/258 (42.25%), Postives = 137/258 (53.10%), Query Frame = 3
Query:  132 WDRRPIHFACLKGDIDIVKVLIDHNCDIEVRNRKWNQQPIHMACWDGHLEILKVLLEKNCDI----------------------------ESCD------EWKRRPIHLACENGHTEIVKFLINLHCDIEAINDK-AWRPIHFGCWKGHSDIVKVLVEQNCDIEACDHLKRRPIHLACEKGHTEIVKVLIDHHCDISACG--------------------------------GRFNQSPIHLARKNNFTELIQLLTIH 704
            W  RPIH AC    I+IVK+LI+  CDIE  +R + ++PIH+AC  GHLEI K+L+   CDI                            E+CD      +W RRPIH AC  G  +IVK LI+ +CDIE  N K   +PIH  CW GH +I+KVL+E+NCDIE+CD  KRRPIHLACE GHTEIVK LI+ HCDI A                                  G   + PIHLA +   TE++++L  H
Sbjct:  316 WFHRPIHVACWDDSIEIVKLLIEQKCDIESCDR-FKRRPIHLACEAGHLEIAKLLITHKCDIDAKTGRNFRPIHLAFDNNHREIVKLLIEENCDVNAIGGKWDRRPIHFACLKGDIDIVKVLIDHNCDIEVRNRKWNQQPIHMACWDGHLEILKVLLEKNCDIESCDEWKRRPIHLACENGHTEIVKFLINLHCDIEAINDNAWRPIHFGCWKGHSDTVKVLVEQNCDIEACGHMKRRPIHLACEKGHTEIVKVLIDH 572          

HSP 9 Score: 151.369 bits (381), Expect = 4.140e-42
Identity = 88/207 (42.51%), Postives = 125/207 (60.39%), Query Frame = 3
Query:  141 RPIHFACLKGDIDIVKVLIDHNCDIEVRNRKWNQQPIHMACWDGHLEILKVLLEKNCDIE------------------SCD-EWKRRPIHLACENGHTEIVKFLINLHCDIEAINDKAWRPIHFGCWKGHSDIVKVLVEQNCDIEACDHLKRRPIHLACEKGHTEIVKVLIDHHCDISACGGRFNQSPIHLARKNNFTELIQLLTIH 704
            RPIH AC  G+  IV +L+D+NC+IE R  + N  PIH AC +G++EI+++L+  NCDIE                  SC+  W  RPIH+AC +   EIVK LI   CDIE+ +    RPIH  C  GH +I K+L+   CDI+A      RPIHLA +  H EIVK+LI+ +CD++A GG++++ PIH A      +++++L  H
Sbjct:  234 RPIHLACQIGNPLIVTLLLDNNCEIESRTNE-NMCPIHYACLNGNVEIVELLIRHNCDIEAFGGKWKRFPIHFACLRDSCEISWFHRPIHVACWDDSIEIVKLLIEQKCDIESCDRFKRRPIHLACEAGHLEIAKLLITHKCDIDAKTGRNFRPIHLAFDNNHREIVKLLIEENCDVNAIGGKWDRRPIHFACLKGDIDIVKVLIDH 439          

HSP 10 Score: 38.891 bits (89), Expect = 4.140e-42
Identity = 18/30 (60.00%), Postives = 22/30 (73.33%), Query Frame = 2
Query:    2 PIHLAFDNNHREIVKLLIEENCDVNAIGGK 91
            PIHLA +N H EI K+LI+ NCD+ A  GK
Sbjct:  168 PIHLACENGHVEIAKILIDLNCDIEARAGK 197          

HSP 11 Score: 122.865 bits (307), Expect = 3.939e-31
Identity = 61/129 (47.29%), Postives = 86/129 (66.67%), Query Frame = 3
Query:  312 DIESCDEWKRRP-IHLACENGHTEIVKFLINLHCDIEAINDKAWRPIHFGCWKGHSDIVKVLVEQNCDIEACDHLKRRPIHLACEKGHTEIVKVLIDHHCDISACGGRFNQSPIHLARKNNFTELIQLL 695
            D++   E K  P IHLAC+ GH EIVKFLI+ + DIE  ++    P+H  CW+GH D VK+L+E NC+I ACD + R PI+ AC++GH EIVK+LID  CDI   GG+  + PIH+       +++++L
Sbjct:   23 DLDEYLERKDEPLIHLACDFGHLEIVKFLIDHNVDIEIRDEWNQCPLHLACWEGHKDTVKILIESNCNINACDEVNRSPIYFACKRGHVEIVKLLIDQRCDIQVFGGKKKRHPIHMGCSEGHADIVKML 151          

HSP 12 Score: 63.1586 bits (152), Expect = 6.289e-11
Identity = 30/30 (100.00%), Postives = 30/30 (100.00%), Query Frame = 2
Query:    2 PIHLAFDNNHREIVKLLIEENCDVNAIGGK 91
            PIHLAFDNNHREIVKLLIEENCDVNAIGGK
Sbjct:  386 PIHLAFDNNHREIVKLLIEENCDVNAIGGK 415          
BLAST of SMED30015660 vs. Planmine SMEST
Match: SMESG000018225.1 (SMESG000018225.1)

HSP 1 Score: 330.487 bits (846), Expect = 4.384e-108
Identity = 164/188 (87.23%), Postives = 172/188 (91.49%), Query Frame = 3
Query:  132 WDRRPIHFACLKGDIDIVKVLIDHNCDIEVRNRKWNQQPIHMACWDGHLEILKVLLEKNCDIESCDEWKRRPIHLACENGHTEIVKFLINLHCDIEAINDKAWRPIHFGCWKGHSDIVKVLVEQNCDIEACDHLKRRPIHLACEKGHTEIVKVLIDHHCDISACGGRFNQSPIHLARKNNFTELIQLL 695
            WDRRPIHFACLKGDIDIVKVLIDHNCDIEVRNRKWNQQPIHMACWDGHLEILKVLLEKNCDIESCDEWKRRPIHLACENGHTEIVKFLINLHCDIEAIND AWRPIHFGCWKGHSD VKVLVEQNCDIEAC H+KRRPIHLACEKGHTEIVKVLIDHHCDI A   R  + PIH++    + E+ ++L
Sbjct:  428 WDRRPIHFACLKGDIDIVKVLIDHNCDIEVRNRKWNQQPIHMACWDGHLEILKVLLEKNCDIESCDEWKRRPIHLACENGHTEIVKFLINLHCDIEAINDNAWRPIHFGCWKGHSDTVKVLVEQNCDIEACGHMKRRPIHLACEKGHTEIVKVLIDHHCDIEAQDDR-KRCPIHISCVKGYMEITKIL 614          

HSP 2 Score: 302.753 bits (774), Expect = 2.307e-97
Identity = 151/190 (79.47%), Postives = 169/190 (88.95%), Query Frame = 3
Query:  138 RRPIHFACLKGDIDIVKVLIDHNCDIEVRNRKWNQQPIHMACWDGHLEILKVLLEKNCDIESCDEWKRRPIHLACENGHTEIVKFLINLHCDIEAINDKAWRPIHFGCWKGHSDIVKVLVEQNCDIEACDHLKRRPIHLACEKGHTEIVKVLIDHHCDISACGGRFNQSPIHLARKNNFTELIQLLTIHE 707
            RRPIH AC KG  +IVKVLIDH+CDIE ++ +  + PIH++C  G++EI K+LL++ CDIE+ D+WK  PIHLACENGHTEIVK LIN HCDIEAINDKAWRPIHFGCWKGH DIVKVLVEQNCDIEACDH+KRRPIHLACEKGHTEIVKVLIDHHCDISACGGRFNQSPI+LA K NFTELIQLLT+HE
Sbjct:  563 RRPIHLACEKGHTEIVKVLIDHHCDIEAQDDR-KRCPIHISCVKGYMEITKILLDQRCDIEALDDWKMSPIHLACENGHTEIVKVLINHHCDIEAINDKAWRPIHFGCWKGHLDIVKVLVEQNCDIEACDHMKRRPIHLACEKGHTEIVKVLIDHHCDISACGGRFNQSPIYLAHKKNFTELIQLLTVHE 751          

HSP 3 Score: 199.904 bits (507), Expect = 1.386e-58
Identity = 101/188 (53.72%), Postives = 137/188 (72.87%), Query Frame = 3
Query:  135 DRRPIHFACLKGDIDIVKVLIDHNCDIEVRNRKWNQQPIHMACWDGHLEILKVLLEKNCDIESCDEWKRRPIHLACENGHTEIVKFLINLHCDIEA-INDKAWRPIHFGCWKGHSDIVKVLVEQNCDIEACDHLKRRPIHLACEKGHTEIVKVLIDHHCDISACGGRFNQSPIHLARKNNFTELIQLL 695
            +R PI+FAC +G ++IVK+LID  CDI+V   K  + PIHM C +GH +I+K+L+++NCDIE+CD+  +R IHLACENGH EI K LI+L+CDIEA    K+ RPIHF C  G  +IV+VL+ +NC+IEA D   +RPIHLACE GH EI K+LID +CDI A  G+ ++ PIH A      E++++L
Sbjct:   43 NRSPIYFACKRGHVEIVKLLIDQRCDIQVFGGKKKRHPIHMGCSEGHADIVKMLIDENCDIETCDKDGKRSIHLACENGHVEIAKILIDLNCDIEASAGKKSRRPIHFACIGGRIEIVEVLISKNCNIEAEDEDGKRPIHLACENGHVEIAKILIDLNCDIEARAGKKSRRPIHFACFGGHVEIVEVL 230          

HSP 4 Score: 199.134 bits (505), Expect = 2.480e-58
Identity = 106/190 (55.79%), Postives = 132/190 (69.47%), Query Frame = 3
Query:  132 WDRRPIHFACLKGDIDIVKVLIDHNCDIE-VRNRKWNQQPIHMACWDGHLEILKVLLEKNCDIESCDEWKRRPIHLACENGHTEIVKFLINLHCDIEAINDKAWRPIHFGCWKGHSDIVKVLVEQNCDIEACDHLKRRPIHLACEKGHTEIVKVLIDHHCDISACGGRFNQSPIHLARKNNFTELIQLLT 698
            W RRPIH AC  G  +IVK LI+ +CDIE + +  W  +PIH  CW GH + +KVL+E+NCDIE+C   KRRPIHLACE GHTEIVK LI+ HCDIEA +D+   PIH  C KG+ +I K+L++Q CDIEA D  K  PIHLACE GHTEIVKVLI+HHCDI A   +    PIH        +++++L 
Sbjct:  495 WKRRPIHLACENGHTEIVKFLINLHCDIEAINDNAW--RPIHFGCWKGHSDTVKVLVEQNCDIEACGHMKRRPIHLACEKGHTEIVKVLIDHHCDIEAQDDRKRCPIHISCVKGYMEITKILLDQRCDIEALDDWKMSPIHLACENGHTEIVKVLINHHCDIEAINDKA-WRPIHFGCWKGHLDIVKVLV 681          

HSP 5 Score: 189.889 bits (481), Expect = 6.116e-55
Identity = 101/203 (49.75%), Postives = 134/203 (66.01%), Query Frame = 3
Query:  144 PIHFACLKGDIDIVKVLIDHNCDIEVRNRKWNQ------------------QPIHMACWDGHLEILKVLLEKNCDIESCDEWKRRPIHLACENGHTEIVKFLINLHCDIEAINDKAWRPIHFGCWKGHSDIVKVLVEQNCDIEAC-DHLKRRPIHLACEKGHTEIVKVLIDHHCDISACGGRFNQSPIHLARKNNFTELIQLL 695
            PIH+ACL G+++IV++LI HNCDIE    KW +                  +PIH+ACWD  +EI+K+L+E+ CDIESCD +KRRPIHLACE GH EI K LI   CDI+A   + +RPIH      H +IVK+L+E+NCD+ A      RRPIH AC KG  +IVKVLIDH+CDI     ++NQ PIH+A  +   E++++L
Sbjct:  280 PIHYACLNGNVEIVELLIRHNCDIEAFGGKWKRFPIHFACLRDSCEISWFHRPIHVACWDDSIEIVKLLIEQKCDIESCDRFKRRPIHLACEAGHLEIAKLLITHKCDIDAKTGRNFRPIHLAFDNNHREIVKLLIEENCDVNAIGGKWDRRPIHFACLKGDIDIVKVLIDHNCDIEVRNRKWNQQPIHMACWDGHLEILKVL 482          

HSP 6 Score: 186.037 bits (471), Expect = 1.708e-53
Identity = 111/238 (46.64%), Postives = 138/238 (57.98%), Query Frame = 3
Query:  138 RRPIHFACLKGDIDIVKVLIDHNCDIEVRNRKWNQQPIHMACWDGHLEILKVLLEKNCDIESCDEWKRRPIHLACE---------------------------------NGHTEIVKFLINLHCDIEAINDK-----------------AW--RPIHFGCWKGHSDIVKVLVEQNCDIEACDHLKRRPIHLACEKGHTEIVKVLIDHHCDISACGGRFNQSPIHLARKNNFTELIQLL 695
            +RPIH AC  G ++I K+LID NCDIE R  K +++PIH AC+ GH+EI++VL+ KNC+IE+ DE   RPIHLAC+                                 NG+ EIV+ LI  +CDIEA   K                 +W  RPIH  CW    +IVK+L+EQ CDIE+CD  KRRPIHLACE GH EI K+LI H CDI A  GR N  PIHLA  NN  E+++LL
Sbjct:  178 KRPIHLACENGHVEIAKILIDLNCDIEARAGKKSRRPIHFACFGGHVEIVEVLISKNCNIEAEDEESWRPIHLACQIGNPLIVTLLLDNNCEIESRTNENMCPIHYACLNGNVEIVELLIRHNCDIEAFGGKWKRFPIHFACLRDSCEISWFHRPIHVACWDDSIEIVKLLIEQKCDIESCDRFKRRPIHLACEAGHLEIAKLLITHKCDIDAKTGR-NFRPIHLAFDNNHREIVKLL 414          

HSP 7 Score: 173.326 bits (438), Expect = 7.752e-49
Identity = 82/155 (52.90%), Postives = 111/155 (71.61%), Query Frame = 3
Query:  234 WNQQPIHMACWDGHLEILKVLLEKNCDIESCDEWKRRPIHLACENGHTEIVKFLINLHCDIEAINDKAWR-PIHFGCWKGHSDIVKVLVEQNCDIEACDHLKRRPIHLACEKGHTEIVKVLIDHHCDISACGGRFNQSPIHLARKNNFTELIQLL 695
            WNQ P+H+ACW+GH + +K+L+E NC+I +CDE  R PI+ AC+ GH EIVK LI+  CDI+    K  R PIH GC +GH+DIVK+L+++NCDIE CD   +R IHLACE GH EI K+LID +CDI A  G+ ++ PIH A      E++++L
Sbjct:    9 WNQCPLHLACWEGHKDTVKILIESNCNINACDEVNRSPIYFACKRGHVEIVKLLIDQRCDIQVFGGKKKRHPIHMGCSEGHADIVKMLIDENCDIETCDKDGKRSIHLACENGHVEIAKILIDLNCDIEASAGKKSRRPIHFACIGGRIEIVEVL 163          

HSP 8 Score: 169.088 bits (427), Expect = 2.544e-47
Identity = 109/258 (42.25%), Postives = 137/258 (53.10%), Query Frame = 3
Query:  132 WDRRPIHFACLKGDIDIVKVLIDHNCDIEVRNRKWNQQPIHMACWDGHLEILKVLLEKNCDI----------------------------ESCD------EWKRRPIHLACENGHTEIVKFLINLHCDIEAINDK-AWRPIHFGCWKGHSDIVKVLVEQNCDIEACDHLKRRPIHLACEKGHTEIVKVLIDHHCDISACG--------------------------------GRFNQSPIHLARKNNFTELIQLLTIH 704
            W  RPIH AC    I+IVK+LI+  CDIE  +R + ++PIH+AC  GHLEI K+L+   CDI                            E+CD      +W RRPIH AC  G  +IVK LI+ +CDIE  N K   +PIH  CW GH +I+KVL+E+NCDIE+CD  KRRPIHLACE GHTEIVK LI+ HCDI A                                  G   + PIHLA +   TE++++L  H
Sbjct:  328 WFHRPIHVACWDDSIEIVKLLIEQKCDIESCDR-FKRRPIHLACEAGHLEIAKLLITHKCDIDAKTGRNFRPIHLAFDNNHREIVKLLIEENCDVNAIGGKWDRRPIHFACLKGDIDIVKVLIDHNCDIEVRNRKWNQQPIHMACWDGHLEILKVLLEKNCDIESCDEWKRRPIHLACENGHTEIVKFLINLHCDIEAINDNAWRPIHFGCWKGHSDTVKVLVEQNCDIEACGHMKRRPIHLACEKGHTEIVKVLIDH 584          

HSP 9 Score: 151.369 bits (381), Expect = 3.687e-42
Identity = 88/207 (42.51%), Postives = 125/207 (60.39%), Query Frame = 3
Query:  141 RPIHFACLKGDIDIVKVLIDHNCDIEVRNRKWNQQPIHMACWDGHLEILKVLLEKNCDIE------------------SCD-EWKRRPIHLACENGHTEIVKFLINLHCDIEAINDKAWRPIHFGCWKGHSDIVKVLVEQNCDIEACDHLKRRPIHLACEKGHTEIVKVLIDHHCDISACGGRFNQSPIHLARKNNFTELIQLLTIH 704
            RPIH AC  G+  IV +L+D+NC+IE R  + N  PIH AC +G++EI+++L+  NCDIE                  SC+  W  RPIH+AC +   EIVK LI   CDIE+ +    RPIH  C  GH +I K+L+   CDI+A      RPIHLA +  H EIVK+LI+ +CD++A GG++++ PIH A      +++++L  H
Sbjct:  246 RPIHLACQIGNPLIVTLLLDNNCEIESRTNE-NMCPIHYACLNGNVEIVELLIRHNCDIEAFGGKWKRFPIHFACLRDSCEISWFHRPIHVACWDDSIEIVKLLIEQKCDIESCDRFKRRPIHLACEAGHLEIAKLLITHKCDIDAKTGRNFRPIHLAFDNNHREIVKLLIEENCDVNAIGGKWDRRPIHFACLKGDIDIVKVLIDH 451          

HSP 10 Score: 38.891 bits (89), Expect = 3.687e-42
Identity = 18/30 (60.00%), Postives = 22/30 (73.33%), Query Frame = 2
Query:    2 PIHLAFDNNHREIVKLLIEENCDVNAIGGK 91
            PIHLA +N H EI K+LI+ NCD+ A  GK
Sbjct:  180 PIHLACENGHVEIAKILIDLNCDIEARAGK 209          

HSP 11 Score: 63.1586 bits (152), Expect = 6.040e-11
Identity = 30/30 (100.00%), Postives = 30/30 (100.00%), Query Frame = 2
Query:    2 PIHLAFDNNHREIVKLLIEENCDVNAIGGK 91
            PIHLAFDNNHREIVKLLIEENCDVNAIGGK
Sbjct:  398 PIHLAFDNNHREIVKLLIEENCDVNAIGGK 427          
BLAST of SMED30015660 vs. Planmine SMEST
Match: SMESG000017035.1 (SMESG000017035.1)

HSP 1 Score: 330.872 bits (847), Expect = 5.064e-108
Identity = 177/240 (73.75%), Postives = 182/240 (75.83%), Query Frame = 3
Query:  132 WDRRPIHFACLKGDIDIVKVLIDHNCDIEVRNRKWNQQPIHMACWDGHLEILKVLLEKNCDIESCDEWKRRPIHLACENGHTEIVKFLINLH---------------------------------CDIEAINDKAWRPIHFGCWKGHSDIV---------------KVLVEQNCDIEACDHLKRRPIHLACEKGHTEIVKVLIDHHCDISACGGRFNQSPIHLARKNNFTELIQLLTIHE 707
            WDRRPIHFACLKGDIDIVKVLIDHNCDIEVRNRKWNQQPIHMACWDGHLEILKVLLEKNCDIESCDEWKRRPIHLACENGHTEIVK LI+ H                                 CDIEA++D    PIH  C  GH++IV               KVLVEQNCDIEACDHLKRRPIHLACEKGHTEIVKVLIDHHCDISACGGRFNQSPIHLARKNNFTELIQLLTIHE
Sbjct:  533 WDRRPIHFACLKGDIDIVKVLIDHNCDIEVRNRKWNQQPIHMACWDGHLEILKVLLEKNCDIESCDEWKRRPIHLACENGHTEIVKVLIDHHCDIEAQDKRKRCPIHISCVKGYMEITKILLDQRCDIEALDDWKMSPIHLACENGHTEIVKVLINHHCDIEAINDKVLVEQNCDIEACDHLKRRPIHLACEKGHTEIVKVLIDHHCDISACGGRFNQSPIHLARKNNFTELIQLLTIHE 772          

HSP 2 Score: 212.616 bits (540), Expect = 4.092e-63
Identity = 100/190 (52.63%), Postives = 135/190 (71.05%), Query Frame = 3
Query:  132 WDRRPIHFACLKGDIDIVKVLIDHNCDIEVRNRKWNQQPIHMACWDGHLEILKVLLEKNCDIESCDEWKRRPIHLACENGHTEIVKFLINLHCDIEAINDKAWR-PIHFGCWKGHSDIVKVLVEQNCDIEACDHLKRRPIHLACEKGHTEIVKVLIDHHCDISACGGRFNQSPIHLARKNNFTELIQLLT 698
            W RRPIH AC KG  +IVK+LID+  D E+   +WNQ P+H+ACW+GH + +K+L+E NC+I +CDE  R PI+ AC+ GH EI K LIN  CDI+    K  R PIH GC++GH+DIVK+L+++NCDIE CD   +RPIHLACE GH  I K+LID +CDI A  G+ ++ PIH A      +++++LT
Sbjct:   64 WKRRPIHSACEKGQAEIVKLLIDNKIDFEIFGGQWNQCPLHLACWEGHKDTVKILIESNCNINACDEVNRSPIYFACKRGHVEIAKLLINQRCDIQVFGGKNKRHPIHMGCFEGHADIVKMLIDENCDIETCDKDGKRPIHLACENGHVAIAKILIDLNCDIEASAGKKSRRPIHFACIGGRIDIVEVLT 253          

HSP 3 Score: 198.749 bits (504), Expect = 4.999e-58
Identity = 101/189 (53.44%), Postives = 131/189 (69.31%), Query Frame = 3
Query:  132 WDRRPIHFACLKGDIDIVKVLIDHNCDIEVRNRKWNQQPIHMACWDGHLEILKVLLEKNCDIESCDEWKRRPIHLACENGHTEIVKFLINLHCDIEAINDKAWRPIHFGCWKGHSDIVKVLVEQNCDIEAC-DHLKRRPIHLACEKGHTEIVKVLIDHHCDISACGGRFNQSPIHLARKNNFTELIQLL 695
            W R PIHFAC +G I IV VLI  NC++E     W  +PIH+ACWDG +EI+KVL+E+ CDIESCD +KRRPIHLACE G+ E+ K LI   CDI+A   + +RPIH      H +IVK+L+E+NCD+ A      RRPIH AC KG  +IVKVLIDH+CDI     ++NQ PIH+A  +   E++++L
Sbjct:  399 WKRSPIHFACSRGYIKIVIVLIRQNCNLEACEISWFHRPIHVACWDGSIEIVKVLIEQKCDIESCDRFKRRPIHLACEAGYLEVAKLLITHKCDIDAKTGRNFRPIHLAFDNNHREIVKLLIEENCDVNAIGGKWDRRPIHFACLKGDIDIVKVLIDHNCDIEVRNRKWNQQPIHMACWDGHLEILKVL 587          

HSP 4 Score: 179.874 bits (455), Expect = 2.984e-51
Identity = 111/254 (43.70%), Postives = 136/254 (53.54%), Query Frame = 3
Query:  138 RRPIHFACLKGDIDIVKVLIDHNCDIEVRNRKWNQQPIHMACWDGHLEILKVLLEKNCDIESCDEWKRRPIHLACE---------------------------------NGHTEIVKFLINLHCDIEAINDK---------------------------------AW--RPIHFGCWKGHSDIVKVLVEQNCDIEACDHLKRRPIHLACEKGHTEIVKVLIDHHCDISACGGRFNQSPIHLARKNNFTELIQLL 695
            +RPIH AC  G + I K+LID NCDIE    K +++PIH AC  GH+EIL+VL+ KNC+IE+ DE   RPIHLAC+                                 NG+ EIV+ LI  +CDIEA   K                                 +W  RPIH  CW G  +IVKVL+EQ CDIE+CD  KRRPIHLACE G+ E+ K+LI H CDI A  GR N  PIHLA  NN  E+++LL
Sbjct:  267 KRPIHLACENGHVAIAKILIDLNCDIEASAGKKSRRPIHFACIGGHVEILEVLISKNCNIEAEDEESWRPIHLACQIDNPLIVTLLLGNNCEIESRTNDNMCPIHYACLNGNVEIVELLIRHNCDIEAFGGKWKRSPIHFACSRGYIKIVIVLIRQNCNLEACEISWFHRPIHVACWDGSIEIVKVLIEQKCDIESCDRFKRRPIHLACEAGYLEVAKLLITHKCDIDAKTGR-NFRPIHLAFDNNHREIVKLL 519          

HSP 5 Score: 178.333 bits (451), Expect = 1.130e-50
Identity = 99/220 (45.00%), Postives = 134/220 (60.91%), Query Frame = 3
Query:  138 RRPIHFACLKGDIDIVKVLIDHNCDIEVRNRKWNQQPIHMACWDGHLEILKVLLEKNCDIESCDEWKRRPIHLACENGHTEIVKFLINLHCDIEA-INDKAWRPIHFGCWKGHSDIVKVLVEQNCDIEACDHLKRRPIHLACE---------------------------------KGHTEIVKVLIDHHCDISACGGRFNQSPIHLARKNNFTELIQLL 695
            +RPIH AC  G + I K+LID NCDIE    K +++PIH AC  G ++I++VL  KNC+IE+ DE  +RPIHLACENGH  I K LI+L+CDIEA    K+ RPIHF C  GH +I++VL+ +NC+IEA D    RPIHLAC+                                  G+ EIV++LI H+CDI A GG++ +SPIH A    + +++ +L
Sbjct:  200 KRPIHLACENGHVAIAKILIDLNCDIEASAGKKSRRPIHFACIGGRIDIVEVLTSKNCNIEAEDEDGKRPIHLACENGHVAIAKILIDLNCDIEASAGKKSRRPIHFACIGGHVEILEVLISKNCNIEAEDEESWRPIHLACQIDNPLIVTLLLGNNCEIESRTNDNMCPIHYACLNGNVEIVELLIRHNCDIEAFGGKWKRSPIHFACSRGYIKIVIVL 419          

HSP 6 Score: 174.481 bits (441), Expect = 2.676e-49
Identity = 86/188 (45.74%), Postives = 128/188 (68.09%), Query Frame = 3
Query:  144 PIHFACLKGDIDIVKVLIDHNCDIEVRNRKWNQQPIHMACWDGHLEILKVLLEKNCDIESCD-EWKRRPIHLACENGHTEIVKFLINLHCDIEAINDKAWRPIHFGCWKGHSDIVKVLVEQNCDIEACDHLKRRPIHLACEKGHTEIVKVLIDHHCDISACGGRFNQSPIHLARKNNFTELIQLLTIH 704
            PIH+ACL G+++IV++LI HNCDIE    KW + PIH AC  G+++I+ VL+ +NC++E+C+  W  RPIH+AC +G  EIVK LI   CDIE+ +    RPIH  C  G+ ++ K+L+   CDI+A      RPIHLA +  H EIVK+LI+ +CD++A GG++++ PIH A      +++++L  H
Sbjct:  369 PIHYACLNGNVEIVELLIRHNCDIEAFGGKWKRSPIHFACSRGYIKIVIVLIRQNCNLEACEISWFHRPIHVACWDGSIEIVKVLIEQKCDIESCDRFKRRPIHLACEAGYLEVAKLLITHKCDIDAKTGRNFRPIHLAFDNNHREIVKLLIEENCDVNAIGGKWDRRPIHFACLKGDIDIVKVLIDH 556          

HSP 7 Score: 151.754 bits (382), Expect = 3.370e-41
Identity = 75/151 (49.67%), Postives = 100/151 (66.23%), Query Frame = 3
Query:  249 IHMACWDGHLEILKVLLEKNCDIESCDEWKRRPIHLACENGHTEIVKFLINLHCDIEAINDKAWR--PIHFGCWKGHSDIVKVLVEQNCDIEACDHLKRRPIHLACEKGHTEIVKVLIDHHCDISACGGRFNQSPIHLARKNNFTELIQLL 695
            IH+AC  GHLEI+K L++ N DIE  DEWKRRPIH ACE G  EIVK LI+   D E    + W   P+H  CW+GH D VK+L+E NC+I ACD + R PI+ AC++GH EI K+LI+  CDI   GG+  + PIH+       +++++L
Sbjct:   36 IHLACDFGHLEIVKFLIDHNVDIEIRDEWKRRPIHSACEKGQAEIVKLLIDNKIDFEIFGGQ-WNQCPLHLACWEGHKDTVKILIESNCNINACDEVNRSPIYFACKRGHVEIAKLLINQRCDIQVFGGKNKRHPIHMGCFEGHADIVKML 185          

HSP 8 Score: 63.1586 bits (152), Expect = 6.037e-11
Identity = 30/30 (100.00%), Postives = 30/30 (100.00%), Query Frame = 2
Query:    2 PIHLAFDNNHREIVKLLIEENCDVNAIGGK 91
            PIHLAFDNNHREIVKLLIEENCDVNAIGGK
Sbjct:  503 PIHLAFDNNHREIVKLLIEENCDVNAIGGK 532          
The following BLAST results are available for this feature:
BLAST of SMED30015660 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
RIPK45.442e-2730.65receptor interacting serine/threonine kinase 4 [So... [more]
RIPK45.962e-2730.65receptor interacting serine/threonine kinase 4 [So... [more]
ANKRD281.094e-2229.41ankyrin repeat domain 28 [Source:HGNC Symbol;Acc:H... [more]
ANKRD281.094e-2229.41ankyrin repeat domain 28 [Source:HGNC Symbol;Acc:H... [more]
ANKK11.780e-2225.00ankyrin repeat and kinase domain containing 1 [Sou... [more]
back to top
BLAST of SMED30015660 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
trp-47.990e-2127.39TRP (Transient receptor potential) channel family ... [more]
unc-445.583e-1827.27AO49 ankyrin [Source:UniProtKB/TrEMBL;Acc:Q7JP86][more]
unc-445.583e-1827.27AO49 ankyrin [Source:UniProtKB/TrEMBL;Acc:Q7JP86][more]
unc-445.593e-1827.27AO49 ankyrin [Source:UniProtKB/TrEMBL;Acc:Q7JP86][more]
unc-445.593e-1827.27AO49 ankyrin [Source:UniProtKB/TrEMBL;Acc:Q7JP86][more]
back to top
BLAST of SMED30015660 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Ank7.072e-2227.03gene:FBgn0011747 transcript:FBtr0089172[more]
Ank7.072e-2227.03gene:FBgn0011747 transcript:FBtr0300497[more]
Ank7.072e-2227.03gene:FBgn0011747 transcript:FBtr0089171[more]
Ank7.072e-2227.03gene:FBgn0011747 transcript:FBtr0089173[more]
Patsas1.174e-2025.41gene:FBgn0029137 transcript:FBtr0474166[more]
back to top
BLAST of SMED30015660 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ripk44.351e-2529.79receptor-interacting serine-threonine kinase 4 [So... [more]
ripk44.798e-2529.79receptor-interacting serine-threonine kinase 4 [So... [more]
ripk45.208e-2529.79receptor-interacting serine-threonine kinase 4 [So... [more]
ankk13.786e-2429.65ankyrin repeat and kinase domain containing 1 [Sou... [more]
ank1b2.031e-2228.19ankyrin 1, erythrocytic b [Source:ZFIN;Acc:ZDB-GEN... [more]
back to top
BLAST of SMED30015660 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
fbxo95.597e-2327.87F-box protein 9 [Source:Xenbase;Acc:XB-GENE-100244... [more]
senp19.351e-2327.57SUMO specific peptidase 1 [Source:Xenbase;Acc:XB-G... [more]
ANKDD1A2.013e-2226.46ankyrin repeat and death domain containing 1A [Sou... [more]
ANKDD1A2.261e-2226.46ankyrin repeat and death domain containing 1A [Sou... [more]
ptprc2.938e-2129.47protein tyrosine phosphatase, receptor type C [Sou... [more]
back to top
BLAST of SMED30015660 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Ripk45.344e-2731.18receptor-interacting serine-threonine kinase 4 [So... [more]
Ankrd284.466e-2530.29ankyrin repeat domain 28 [Source:MGI Symbol;Acc:MG... [more]
Ankk14.934e-2331.21ankyrin repeat and kinase domain containing 1 [Sou... [more]
Ankrd281.274e-2228.88ankyrin repeat domain 28 [Source:MGI Symbol;Acc:MG... [more]
Ankrd281.357e-2228.88ankyrin repeat domain 28 [Source:MGI Symbol;Acc:MG... [more]
back to top
BLAST of SMED30015660 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|P57078|RIPK4_HUMAN2.614e-2630.65Receptor-interacting serine/threonine-protein kina... [more]
sp|Q9ERK0|RIPK4_MOUSE3.738e-2631.18Receptor-interacting serine/threonine-protein kina... [more]
sp|Q8BZ25|ANKK1_MOUSE3.451e-2231.21Ankyrin repeat and protein kinase domain-containin... [more]
sp|O15084|ANR28_HUMAN5.255e-2229.41Serine/threonine-protein phosphatase 6 regulatory ... [more]
sp|Q8NFD2|ANKK1_HUMAN8.546e-2225.00Ankyrin repeat and protein kinase domain-containin... [more]
back to top
BLAST of SMED30015660 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A3D1L5H51.899e-3939.34ANK_REP_REGION domain-containing protein OS=Wolbac... [more]
A0A1X7T5B06.693e-3841.33ANK_REP_REGION domain-containing protein OS=Amphim... [more]
A0A1X7T5X69.065e-3741.62Uncharacterized protein OS=Amphimedon queenslandic... [more]
A0A182GGY81.547e-3636.96ANK_REP_REGION domain-containing protein OS=Aedes ... [more]
A0A1X7T1N62.379e-3641.45ANK_REP_REGION domain-containing protein OS=Amphim... [more]
back to top
BLAST of SMED30015660 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ripk44.872e-2628.13receptor interacting serine/threonine kinase 4 [So... [more]
ripk45.197e-2628.13receptor interacting serine/threonine kinase 4 [So... [more]
ank1a2.064e-2227.17ankyrin 1, erythrocytic a [Source:ZFIN;Acc:ZDB-GEN... [more]
ANKRD282.075e-2227.13ankyrin repeat domain 28 [Source:HGNC Symbol;Acc:H... [more]
ankk13.143e-2229.07ankyrin repeat and kinase domain containing 1 [Sou... [more]
back to top
BLAST of SMED30015660 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ENSPMAT00000000095.12.220e-2427.17pep scaffold:Pmarinus_7.0:GL477582:20897:60453:1 g... [more]
ENSPMAT00000003991.11.367e-2230.86pep scaffold:Pmarinus_7.0:GL484476:255315:281660:1... [more]
ENSPMAT00000000093.18.876e-2026.63pep scaffold:Pmarinus_7.0:GL477582:20502:66045:1 g... [more]
ENSPMAT00000002048.16.243e-1933.96pep scaffold:Pmarinus_7.0:GL477431:30859:73495:1 g... [more]
ENSPMAT00000007954.18.954e-1925.53pep scaffold:Pmarinus_7.0:GL479092:583:36301:1 gen... [more]
back to top
BLAST of SMED30015660 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 5
Match NameE-valueIdentityDescription
AKR17.105e-1022.98Palmitoyl transferase involved in protein palmitoy... [more]
NAS64.132e-922.63Evolutionarily conserved 19S regulatory particle a... [more]
HOS49.035e-833.01Subunit of the Set3 complex; complex is a meiotic-... [more]
MGA22.693e-632.88ER membrane protein involved in regulation of OLE1... [more]
GDE12.905e-626.12Glycerophosphocholine (GroPCho) phosphodiesterase;... [more]
back to top
BLAST of SMED30015660 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
EDO387256.118e-1627.04Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO281781.562e-1529.17Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO387021.942e-1528.97Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO460995.151e-1528.29Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO391137.979e-1526.62Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of SMED30015660 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ripk41.038e-2429.53receptor interacting serine/threonine kinase 4 [So... [more]
ank1a1.963e-2329.79ankyrin-1 [Source:NCBI gene;Acc:101174837][more]
ank1b2.104e-2128.19ankyrin-1 [Source:NCBI gene;Acc:101157380][more]
ankrd28b2.153e-2128.88ankyrin repeat domain 28 [Source:NCBI gene;Acc:101... [more]
ankrd28b2.561e-2128.88ankyrin repeat domain 28 [Source:NCBI gene;Acc:101... [more]
back to top
BLAST of SMED30015660 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000018225.11.175e-10887.23SMESG000018225.1[more]
SMESG000018225.13.117e-10887.23SMESG000018225.1[more]
SMESG000018225.14.137e-10887.23SMESG000018225.1[more]
SMESG000018225.14.384e-10887.23SMESG000018225.1[more]
SMESG000017035.15.064e-10873.75SMESG000017035.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30015660 ID=SMED30015660|Name=SMED30015660|organism=Schmidtea mediterranea sexual|type=transcript|length=875bp
TCCAATTCATTTGGCATTTGACAATAACCATAGAGAGATTGTAAAATTAC
TTATCGAAGAGAATTGCGACGTTAACGCAATTGGGGGGAAAGTATATCTG
TTTGTAAATTGAAACGTTTTATTATTTTTAGTGGGATCGGCGCCCGATAC
ATTTTGCATGTCTTAAAGGGGACATAGACATTGTTAAAGTGCTGATCGAT
CACAATTGTGACATTGAAGTTCGTAATAGAAAGTGGAATCAGCAACCAAT
TCATATGGCATGTTGGGACGGACACCTGGAAATCCTGAAGGTTCTTTTAG
AAAAGAATTGTGATATTGAGTCATGTGATGAGTGGAAAAGGCGCCCAATA
CATTTAGCATGTGAGAACGGTCACACAGAGATTGTGAAATTCCTCATCAA
TCTTCATTGTGACATTGAAGCAATTAATGACAAAGCTTGGCGACCAATTC
ATTTTGGGTGCTGGAAAGGTCACTCGGACATTGTAAAGGTCCTCGTGGAA
CAAAATTGTGATATCGAAGCATGTGATCACCTGAAGCGACGTCCCATTCA
TTTAGCATGTGAGAAGGGTCACACAGAGATTGTTAAAGTCCTTATAGATC
ATCATTGTGATATTAGCGCTTGTGGAGGACGGTTCAATCAGAGTCCTATT
CATTTAGCGCGCAAAAATAATTTCACAGAATTAATACAACTACTTACAAT
TCATGAGTGAAAATATCTTAGATTTCCTATATTTTTAAAATATTGAATTT
ACACTTATTAACTTTTCATAATAATTGATTTTGCTTATTTTTGATAAATA
GATTTTTATGAGTTTGTAAATTTGGTTCCCAAAGTTAAGCTTTCTTGCCA
CGAAGGGTACCACCAAGTTGGATGT
back to top

protein sequence of SMED30015660-orf-1

>SMED30015660-orf-1 ID=SMED30015660-orf-1|Name=SMED30015660-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=152bp
MACWDGHLEILKVLLEKNCDIESCDEWKRRPIHLACENGHTEIVKFLINL
HCDIEAINDKAWRPIHFGCWKGHSDIVKVLVEQNCDIEACDHLKRRPIHL
ACEKGHTEIVKVLIDHHCDISACGGRFNQSPIHLARKNNFTELIQLLTIH
E*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000016pharynx
PLANA:0000018Category 4 cell
PLANA:0000020protonephridia
PLANA:0000026gut
PLANA:0000034epidermis
PLANA:0000054dorsal region of the epidermis
PLANA:0000099neuron
PLANA:0002032epidermal cell
Vocabulary: INTERPRO
TermDefinition
IPR036770Ankyrin_rpt-contain_sf
IPR020683Ankyrin_rpt-contain_dom
IPR002110Ankyrin_rpt
IPR011992EF-hand-dom_pair
Vocabulary: molecular function
TermDefinition
GO:0005515protein binding
Vocabulary: cellular component
TermDefinition
GO:0000139Golgi membrane
GO:0005634nucleus
GO:0005654nucleoplasm
GO:0005829cytosol
Vocabulary: biological process
TermDefinition
GO:0048208COPII vesicle coating
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR002110Ankyrin repeatSMARTSM00248ANK_2acoord: 93..122
e-value: 8.5E-4
score: 28.6
coord: 27..56
e-value: 0.0061
score: 25.8
coord: 60..89
e-value: 1.4
score: 17.9
coord: 1..23
e-value: 2500.0
score: 2.0
IPR002110Ankyrin repeatPROSITEPS50088ANK_REPEATcoord: 27..59
score: 10.286
IPR002110Ankyrin repeatPROSITEPS50088ANK_REPEATcoord: 93..125
score: 9.751
IPR002110Ankyrin repeatPROSITEPS50088ANK_REPEATcoord: 60..92
score: 9.698
IPR020683Ankyrin repeat-containing domainPFAMPF12796Ank_2coord: 93..147
e-value: 5.4E-7
score: 30.1
coord: 2..89
e-value: 2.1E-18
score: 66.7
IPR020683Ankyrin repeat-containing domainPROSITEPS50297ANK_REP_REGIONcoord: 1..151
score: 37.003
IPR036770Ankyrin repeat-containing domain superfamilyGENE3DG3DSA:1.25.40.20coord: 1..151
e-value: 1.4E-43
score: 150.7
IPR036770Ankyrin repeat-containing domain superfamilySUPERFAMILYSSF48403Ankyrin repeatcoord: 1..147
NoneNo IPR availablePANTHERPTHR24180FAMILY NOT NAMEDcoord: 2..122
NoneNo IPR availablePANTHERPTHR24180:SF1526S PROTEASOME REGULATORY SUBUNIT P28-RELATEDcoord: 2..122