cAMP regulated phosphoprotein 19

Overview
NamecAMP regulated phosphoprotein 19
Smed IDSMED30015654
Length (bp)982
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of cAMP regulated phosphoprotein 19 (SMED30015654) t-SNE clustered cells

Violin plots show distribution of expression levels for cAMP regulated phosphoprotein 19 (SMED30015654) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of cAMP regulated phosphoprotein 19 (SMED30015654) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for cAMP regulated phosphoprotein 19 (SMED30015654) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30015654

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 3

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
intestinal phagocyteSMED30015654SMESG000068156.1 SMESG000064685.1 SMESG000043474.1 SMESG000010609.1 SMESG000076470.1 SMESG000073857.1 SMESG000062429.1 SMESG000060487.1 SMESG000058575.1 SMESG000053533.1 SMESG000020635.1 SMESG000015751.1 SMESG000005260.1 Contig233GPL15192PMID:23079596
Forsthoefel et al., 2012
FACS sorted cell population asexual adult cDNA to DNA expression microarray evidence
intestinal phagocyteSMED30015654SMESG000071252.1 Contig233GPL15192PMID:23079596
Forsthoefel et al., 2012
FACS sorted cell population asexual adult cDNA to DNA expression microarray evidence
parenchymal cellSMED30015654SMESG000071252.1 dd_Smed_v4_2636_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of cAMP regulated phosphoprotein 19 vs. Ensembl Human
Match: ARPP19 (cAMP regulated phosphoprotein 19 [Source:HGNC Symbol;Acc:HGNC:16967])

HSP 1 Score: 50.0618 bits (118), Expect = 9.370e-8
Identity = 26/55 (47.27%), Postives = 35/55 (63.64%), Query Frame = 3
Query:  129 QEQEFVAKYPDIANK--ASKILQKRLNKNVKYFDSGDYNVAKDKVLKQKLQTNMP 287
            +E +  A+YP +  K   S  L+KRL K  KYFDSGDYN+AK K+  ++L T  P
Sbjct:   12 EEAKLKARYPHLGQKPGGSDFLRKRLQKGQKYFDSGDYNMAKAKMKNKQLPTAAP 66          
BLAST of cAMP regulated phosphoprotein 19 vs. Ensembl Human
Match: ARPP19 (cAMP regulated phosphoprotein 19 [Source:HGNC Symbol;Acc:HGNC:16967])

HSP 1 Score: 50.8322 bits (120), Expect = 1.023e-7
Identity = 26/55 (47.27%), Postives = 35/55 (63.64%), Query Frame = 3
Query:  129 QEQEFVAKYPDIANK--ASKILQKRLNKNVKYFDSGDYNVAKDKVLKQKLQTNMP 287
            +E +  A+YP +  K   S  L+KRL K  KYFDSGDYN+AK K+  ++L T  P
Sbjct:   12 EEAKLKARYPHLGQKPGGSDFLRKRLQKGQKYFDSGDYNMAKAKMKNKQLPTAAP 66          
BLAST of cAMP regulated phosphoprotein 19 vs. Ensembl Human
Match: ARPP19 (cAMP regulated phosphoprotein 19 [Source:HGNC Symbol;Acc:HGNC:16967])

HSP 1 Score: 50.8322 bits (120), Expect = 1.023e-7
Identity = 26/55 (47.27%), Postives = 35/55 (63.64%), Query Frame = 3
Query:  129 QEQEFVAKYPDIANK--ASKILQKRLNKNVKYFDSGDYNVAKDKVLKQKLQTNMP 287
            +E +  A+YP +  K   S  L+KRL K  KYFDSGDYN+AK K+  ++L T  P
Sbjct:   12 EEAKLKARYPHLGQKPGGSDFLRKRLQKGQKYFDSGDYNMAKAKMKNKQLPTAAP 66          
BLAST of cAMP regulated phosphoprotein 19 vs. Ensembl Human
Match: ARPP19 (cAMP regulated phosphoprotein 19 [Source:HGNC Symbol;Acc:HGNC:16967])

HSP 1 Score: 50.8322 bits (120), Expect = 1.023e-7
Identity = 26/55 (47.27%), Postives = 35/55 (63.64%), Query Frame = 3
Query:  129 QEQEFVAKYPDIANK--ASKILQKRLNKNVKYFDSGDYNVAKDKVLKQKLQTNMP 287
            +E +  A+YP +  K   S  L+KRL K  KYFDSGDYN+AK K+  ++L T  P
Sbjct:   12 EEAKLKARYPHLGQKPGGSDFLRKRLQKGQKYFDSGDYNMAKAKMKNKQLPTAAP 66          
BLAST of cAMP regulated phosphoprotein 19 vs. Ensembl Human
Match: ARPP19 (cAMP regulated phosphoprotein 19 [Source:HGNC Symbol;Acc:HGNC:16967])

HSP 1 Score: 50.8322 bits (120), Expect = 1.023e-7
Identity = 26/55 (47.27%), Postives = 35/55 (63.64%), Query Frame = 3
Query:  129 QEQEFVAKYPDIANK--ASKILQKRLNKNVKYFDSGDYNVAKDKVLKQKLQTNMP 287
            +E +  A+YP +  K   S  L+KRL K  KYFDSGDYN+AK K+  ++L T  P
Sbjct:   12 EEAKLKARYPHLGQKPGGSDFLRKRLQKGQKYFDSGDYNMAKAKMKNKQLPTAAP 66          
BLAST of cAMP regulated phosphoprotein 19 vs. Ensembl Zebrafish
Match: arpp19a (cAMP-regulated phosphoprotein 19a [Source:ZFIN;Acc:ZDB-GENE-040426-1281])

HSP 1 Score: 53.1434 bits (126), Expect = 1.503e-8
Identity = 26/51 (50.98%), Postives = 36/51 (70.59%), Query Frame = 3
Query:  126 LQEQEFVAKYPDIANK--ASKILQKRLNKNVKYFDSGDYNVAKDKVLKQKL 272
            ++E +  AKYP + NK   S +L+KRL K  KYFDSGDYN+AK K+  ++L
Sbjct:   26 MEEAKLKAKYPHLGNKPGGSDLLRKRLQKGPKYFDSGDYNMAKAKIKNKQL 76          
BLAST of cAMP regulated phosphoprotein 19 vs. Ensembl Zebrafish
Match: arpp19a (cAMP-regulated phosphoprotein 19a [Source:ZFIN;Acc:ZDB-GENE-040426-1281])

HSP 1 Score: 53.1434 bits (126), Expect = 1.503e-8
Identity = 26/51 (50.98%), Postives = 36/51 (70.59%), Query Frame = 3
Query:  126 LQEQEFVAKYPDIANK--ASKILQKRLNKNVKYFDSGDYNVAKDKVLKQKL 272
            ++E +  AKYP + NK   S +L+KRL K  KYFDSGDYN+AK K+  ++L
Sbjct:   26 MEEAKLKAKYPHLGNKPGGSDLLRKRLQKGPKYFDSGDYNMAKAKIKNKQL 76          
BLAST of cAMP regulated phosphoprotein 19 vs. Ensembl Zebrafish
Match: ensab (endosulfine alpha b [Source:ZFIN;Acc:ZDB-GENE-060526-294])

HSP 1 Score: 49.2914 bits (116), Expect = 3.954e-7
Identity = 25/50 (50.00%), Postives = 33/50 (66.00%), Query Frame = 3
Query:  129 QEQEFVAKYPDIANK--ASKILQKRLNKNVKYFDSGDYNVAKDKVLKQKL 272
            +E +  AKYP++  K   S  L KRL K  KYFDSGDYN+AK K+  ++L
Sbjct:   32 EEAKLKAKYPNLGQKPGGSDFLMKRLQKGQKYFDSGDYNMAKAKMKNKQL 81          
BLAST of cAMP regulated phosphoprotein 19 vs. Ensembl Zebrafish
Match: ensab (endosulfine alpha b [Source:ZFIN;Acc:ZDB-GENE-060526-294])

HSP 1 Score: 49.2914 bits (116), Expect = 3.954e-7
Identity = 25/50 (50.00%), Postives = 33/50 (66.00%), Query Frame = 3
Query:  129 QEQEFVAKYPDIANK--ASKILQKRLNKNVKYFDSGDYNVAKDKVLKQKL 272
            +E +  AKYP++  K   S  L KRL K  KYFDSGDYN+AK K+  ++L
Sbjct:   32 EEAKLKAKYPNLGQKPGGSDFLMKRLQKGQKYFDSGDYNMAKAKMKNKQL 81          
BLAST of cAMP regulated phosphoprotein 19 vs. Ensembl Zebrafish
Match: ensaa (endosulfine alpha a [Source:NCBI gene;Acc:569530])

HSP 1 Score: 48.521 bits (114), Expect = 5.968e-7
Identity = 24/45 (53.33%), Postives = 30/45 (66.67%), Query Frame = 3
Query:  129 QEQEFVAKYPDIANK--ASKILQKRLNKNVKYFDSGDYNVAKDKV 257
            +E +  AKYP + +K   S  L KRL K  KYFDSGDYN+AK K+
Sbjct:   29 EEAKLKAKYPSLGHKPGGSDFLMKRLQKGQKYFDSGDYNMAKAKM 73          
BLAST of cAMP regulated phosphoprotein 19 vs. Ensembl Xenopus
Match: eefsec (eukaryotic elongation factor, selenocysteine-tRNA-specific [Source:Xenbase;Acc:XB-GENE-1010963])

HSP 1 Score: 51.6026 bits (122), Expect = 7.838e-8
Identity = 27/55 (49.09%), Postives = 35/55 (63.64%), Query Frame = 3
Query:  129 QEQEFVAKYPDIANK--ASKILQKRLNKNVKYFDSGDYNVAKDKVLKQKLQTNMP 287
            +EQ+  AKYP++  K   S  L KRL K  KYFDSGDYN+AK K+  ++L    P
Sbjct:   33 EEQKLKAKYPNLGQKPGGSDFLMKRLQKGQKYFDSGDYNMAKAKMKNKQLPCAGP 87          
BLAST of cAMP regulated phosphoprotein 19 vs. Ensembl Mouse
Match: Arpp19 (cAMP-regulated phosphoprotein 19 [Source:MGI Symbol;Acc:MGI:1891691])

HSP 1 Score: 48.9062 bits (115), Expect = 3.329e-7
Identity = 25/55 (45.45%), Postives = 34/55 (61.82%), Query Frame = 3
Query:  129 QEQEFVAKYPDIANK--ASKILQKRLNKNVKYFDSGDYNVAKDKVLKQKLQTNMP 287
            +E +  A+YP +  K   S  L+KRL K  KYFDSGDYN+AK K+  ++L    P
Sbjct:   12 EEAKLKARYPHLGQKPGGSDFLRKRLQKGQKYFDSGDYNMAKAKMKNKQLPAAAP 66          
BLAST of cAMP regulated phosphoprotein 19 vs. Ensembl Mouse
Match: Arpp19 (cAMP-regulated phosphoprotein 19 [Source:MGI Symbol;Acc:MGI:1891691])

HSP 1 Score: 48.9062 bits (115), Expect = 3.329e-7
Identity = 25/55 (45.45%), Postives = 34/55 (61.82%), Query Frame = 3
Query:  129 QEQEFVAKYPDIANK--ASKILQKRLNKNVKYFDSGDYNVAKDKVLKQKLQTNMP 287
            +E +  A+YP +  K   S  L+KRL K  KYFDSGDYN+AK K+  ++L    P
Sbjct:   12 EEAKLKARYPHLGQKPGGSDFLRKRLQKGQKYFDSGDYNMAKAKMKNKQLPAAAP 66          
BLAST of cAMP regulated phosphoprotein 19 vs. Ensembl Mouse
Match: Arpp19 (cAMP-regulated phosphoprotein 19 [Source:MGI Symbol;Acc:MGI:1891691])

HSP 1 Score: 48.9062 bits (115), Expect = 3.329e-7
Identity = 25/55 (45.45%), Postives = 34/55 (61.82%), Query Frame = 3
Query:  129 QEQEFVAKYPDIANK--ASKILQKRLNKNVKYFDSGDYNVAKDKVLKQKLQTNMP 287
            +E +  A+YP +  K   S  L+KRL K  KYFDSGDYN+AK K+  ++L    P
Sbjct:   12 EEAKLKARYPHLGQKPGGSDFLRKRLQKGQKYFDSGDYNMAKAKMKNKQLPAAAP 66          
BLAST of cAMP regulated phosphoprotein 19 vs. Ensembl Mouse
Match: Arpp19 (cAMP-regulated phosphoprotein 19 [Source:MGI Symbol;Acc:MGI:1891691])

HSP 1 Score: 49.2914 bits (116), Expect = 3.875e-7
Identity = 25/55 (45.45%), Postives = 34/55 (61.82%), Query Frame = 3
Query:  129 QEQEFVAKYPDIANK--ASKILQKRLNKNVKYFDSGDYNVAKDKVLKQKLQTNMP 287
            +E +  A+YP +  K   S  L+KRL K  KYFDSGDYN+AK K+  ++L    P
Sbjct:   28 EEAKLKARYPHLGQKPGGSDFLRKRLQKGQKYFDSGDYNMAKAKMKNKQLPAAAP 82          
BLAST of cAMP regulated phosphoprotein 19 vs. Ensembl Mouse
Match: Arpp19 (cAMP-regulated phosphoprotein 19 [Source:MGI Symbol;Acc:MGI:1891691])

HSP 1 Score: 49.2914 bits (116), Expect = 3.875e-7
Identity = 25/55 (45.45%), Postives = 34/55 (61.82%), Query Frame = 3
Query:  129 QEQEFVAKYPDIANK--ASKILQKRLNKNVKYFDSGDYNVAKDKVLKQKLQTNMP 287
            +E +  A+YP +  K   S  L+KRL K  KYFDSGDYN+AK K+  ++L    P
Sbjct:   28 EEAKLKARYPHLGQKPGGSDFLRKRLQKGQKYFDSGDYNMAKAKMKNKQLPAAAP 82          
BLAST of cAMP regulated phosphoprotein 19 vs. UniProt/SwissProt
Match: sp|Q7ZXH9|ENSA_XENLA (Alpha-endosulfine OS=Xenopus laevis OX=8355 GN=ensa PE=1 SV=1)

HSP 1 Score: 52.7582 bits (125), Expect = 2.122e-7
Identity = 27/55 (49.09%), Postives = 35/55 (63.64%), Query Frame = 3
Query:  129 QEQEFVAKYPDIANK--ASKILQKRLNKNVKYFDSGDYNVAKDKVLKQKLQTNMP 287
            +EQ+  AKYP++  K   S  L KRL K  KYFDSGDYN+AK K+  ++L    P
Sbjct:   33 EEQKLKAKYPNLGQKPGGSDFLMKRLQKGQKYFDSGDYNMAKAKIKNKQLPCAGP 87          
BLAST of cAMP regulated phosphoprotein 19 vs. UniProt/SwissProt
Match: sp|Q28GU6|ARP19_XENTR (cAMP-regulated phosphoprotein 19 OS=Xenopus tropicalis OX=8364 GN=arpp19 PE=3 SV=1)

HSP 1 Score: 51.9878 bits (123), Expect = 3.180e-7
Identity = 27/55 (49.09%), Postives = 36/55 (65.45%), Query Frame = 3
Query:  129 QEQEFVAKYPDIANK--ASKILQKRLNKNVKYFDSGDYNVAKDKVLKQKLQTNMP 287
            +E +  A+YP++  K   S  L+KRL K  KYFDSGDYNVAK K+  ++L T  P
Sbjct:   33 EEIKLKARYPNLGPKPGGSDFLRKRLQKGQKYFDSGDYNVAKAKMKNKQLSTAAP 87          
BLAST of cAMP regulated phosphoprotein 19 vs. UniProt/SwissProt
Match: sp|Q6NVR1|ENSA_XENTR (Alpha-endosulfine OS=Xenopus tropicalis OX=8364 GN=ensa PE=2 SV=1)

HSP 1 Score: 51.6026 bits (122), Expect = 4.152e-7
Identity = 27/55 (49.09%), Postives = 35/55 (63.64%), Query Frame = 3
Query:  129 QEQEFVAKYPDIANK--ASKILQKRLNKNVKYFDSGDYNVAKDKVLKQKLQTNMP 287
            +EQ+  AKYP++  K   S  L KRL K  KYFDSGDYN+AK K+  ++L    P
Sbjct:   33 EEQKLKAKYPNLGQKPGGSDFLMKRLQKGQKYFDSGDYNMAKAKMKNKQLPCAGP 87          
BLAST of cAMP regulated phosphoprotein 19 vs. UniProt/SwissProt
Match: sp|Q5ZIF8|ENSA_CHICK (Alpha-endosulfine OS=Gallus gallus OX=9031 GN=ENSA PE=3 SV=1)

HSP 1 Score: 51.2174 bits (121), Expect = 4.789e-7
Identity = 27/55 (49.09%), Postives = 35/55 (63.64%), Query Frame = 3
Query:  129 QEQEFVAKYPDIANK--ASKILQKRLNKNVKYFDSGDYNVAKDKVLKQKLQTNMP 287
            +E +  AKYP++  K   S  L KRL K  KYFDSGDYN+AK K+  ++L T  P
Sbjct:   33 EEAKLKAKYPNLGQKPGGSDFLMKRLQKGQKYFDSGDYNMAKAKMKNKQLPTAGP 87          
BLAST of cAMP regulated phosphoprotein 19 vs. UniProt/SwissProt
Match: sp|B5G1C4|ARP19_TAEGU (cAMP-regulated phosphoprotein 19 OS=Taeniopygia guttata OX=59729 GN=ARPP19 PE=3 SV=2)

HSP 1 Score: 51.2174 bits (121), Expect = 5.220e-7
Identity = 26/55 (47.27%), Postives = 35/55 (63.64%), Query Frame = 3
Query:  129 QEQEFVAKYPDIANK--ASKILQKRLNKNVKYFDSGDYNVAKDKVLKQKLQTNMP 287
            +E +  A+YP +  K   S  L+KRL K  KYFDSGDYN+AK K+  ++L T  P
Sbjct:   28 EEAKLKARYPHLGQKPGGSDFLRKRLQKGQKYFDSGDYNMAKAKMKNKQLPTAAP 82          
BLAST of cAMP regulated phosphoprotein 19 vs. TrEMBL
Match: A0A0R3U2V1 (Uncharacterized protein OS=Mesocestoides corti OX=53468 GN=MCOS_LOCUS831 PE=3 SV=2)

HSP 1 Score: 85.5001 bits (210), Expect = 1.731e-16
Identity = 55/150 (36.67%), Postives = 76/150 (50.67%), Query Frame = 3
Query:  126 LQEQEFVAKYPDIANKASKILQKRLNKNVKYFDSGDYNVAKDKVLKQKLQTNMPHSISNNESLSQPGTFDSLDNNLNLPQYRKXXXXXXXXXXXXXXEAIGVDEMLKQSTGDTIPTPDNVPAVVRKKSFLQQT----SHLSRSDSHSFEG 563
            ++E++  AKYP++  K   ILQKRLN+NVKYFDSGDYN+AK +               NN   S   T + L ++ +                      + V+ M  Q TGDTIPTP+NVPAV +K + LQQ     +HLS   + +  G
Sbjct:   18 IEEEKLRAKYPNLVTKGPSILQKRLNRNVKYFDSGDYNMAKARC--------------NNPQKSGALTANPLTSSAS--------------------PVLPVEVMAAQQTGDTIPTPENVPAVRKKAAELQQELQNQTHLSAPGAVNATG 133          
BLAST of cAMP regulated phosphoprotein 19 vs. TrEMBL
Match: A0A0R3TNZ0 (Uncharacterized protein OS=Rodentolepis nana OX=102285 GN=HNAJ_LOCUS9139 PE=3 SV=1)

HSP 1 Score: 79.337 bits (194), Expect = 4.050e-14
Identity = 52/131 (39.69%), Postives = 65/131 (49.62%), Query Frame = 3
Query:  126 LQEQEFVAKYPDIANKASKILQKRLNKNVKYFDSGDYNVAKDKVLKQKLQTNMPHSISNNESLSQPGTFDSLDNNLNLPQYRKXXXXXXXXXXXXXXEAIGVDEMLKQSTGDTIPTPDNVPAVVRKKSFLQ 518
            + E++  AKYP+I  ++  ILQKRLNKNVKYFDSGDYN+AK +               NN   SQ            +P+                   + VD +  Q TGDTIPTPDNVPAV +K   LQ
Sbjct:   17 IAEEKLKAKYPNIGVQSQLILQKRLNKNVKYFDSGDYNMAKARC--------------NN---SQKAGMLKAQTASAIPE-------------------LPVDVIAAQQTGDTIPTPDNVPAVRKKAVELQ 111          
BLAST of cAMP regulated phosphoprotein 19 vs. TrEMBL
Match: A0A0R3SUQ3 (Uncharacterized protein OS=Hymenolepis diminuta OX=6216 GN=HDID_LOCUS9241 PE=3 SV=1)

HSP 1 Score: 78.5666 bits (192), Expect = 9.432e-14
Identity = 52/132 (39.39%), Postives = 65/132 (49.24%), Query Frame = 3
Query:  126 LQEQEFVAKYPDIANKASKILQKRLNKNVKYFDSGDYNVAKDKVLKQKLQTNMPHSISNNESLSQPGTFDSLDNNLNLPQYRKXXXXXXXXXXXXXXEAIGVDEMLKQSTGDTIPTPDNVPAVVRKKSFLQQ 521
            + E++  AKYP+I  ++  ILQKRLNKNVKYFDSGDYN+AK +               NN   SQ            +P+                   +  D +  Q TGDTIPTPDNVPAV +K   LQQ
Sbjct:   17 IAEEKLKAKYPNIGAQSQLILQKRLNKNVKYFDSGDYNMAKARC--------------NN---SQKAGMLKAQPASAIPE-------------------LPADVIAAQQTGDTIPTPDNVPAVRKKAVELQQ 112          
BLAST of cAMP regulated phosphoprotein 19 vs. TrEMBL
Match: A0A0R3X6A5 (Uncharacterized protein OS=Hydatigena taeniaeformis OX=6205 GN=TTAC_LOCUS9015 PE=3 SV=1)

HSP 1 Score: 77.7962 bits (190), Expect = 1.546e-13
Identity = 56/157 (35.67%), Postives = 76/157 (48.41%), Query Frame = 3
Query:  126 LQEQEFVAKYPDIANKASKILQKRLNKNVKYFDSGDYNVAKDKVLKQKLQTNMPHSISNNESLSQPGTFDSLDNNLNLPQYRKXXXXXXXXXXXXXXEAIGVDEMLKQSTGDTIPTPDNVPAVVRKKSF-----LQQTSHLSRSDSHSFEGDKPIQH 581
            + E++  AKYP++  +   ILQKRLN+NVKYFDSGDYN+AK +               NN                     +K+       +S +TI  +  D +  Q TGDTIPTP+NVPA VRKK+      LQ  SHL+ + +    G     H
Sbjct:   18 IAEEKLRAKYPNLVAQGPSILQKRLNRNVKYFDSGDYNMAKARC--------------NNS--------------------QKAGMLKANPTSSSTIPEVPADVIAAQQTGDTIPTPENVPA-VRKKAVELQHELQHQSHLATTVTSVTSGAVTTTH 139          
BLAST of cAMP regulated phosphoprotein 19 vs. TrEMBL
Match: A0A183TEJ4 (Uncharacterized protein OS=Schistocephalus solidus OX=70667 GN=SSLN_LOCUS14892 PE=3 SV=1)

HSP 1 Score: 74.7146 bits (182), Expect = 8.791e-13
Identity = 49/141 (34.75%), Postives = 70/141 (49.65%), Query Frame = 3
Query:  105 MSHSEMNLQEQEFVAKYPDIANKASKILQKRLNKNVKYFDSGDYNVAKDKVLKQKLQTNMPHSISNNESLSQPGTFDSLDNNLNLPQYRKXXXXXXXXXXXXXXEAIGVDEMLKQSTGDTIPTPDNVPAVVRKKSFLQQTS 527
            M  +   ++E++  +KYP++  K   +LQKRLNKN+KYFDSGDYN+AK K+  + L ++           + P    + D +   P+                            STGDTIPTPDNVPA VRKK+    T+
Sbjct:    1 MKKTAEQIEEEKLRSKYPNLI-KGPCLLQKRLNKNIKYFDSGDYNMAKAKLPSKSLASS-----------ANPTATTAADLSAATPEV---------------------------STGDTIPTPDNVPA-VRKKALQAMTA 101          
BLAST of cAMP regulated phosphoprotein 19 vs. Ensembl Cavefish
Match: ensab (endosulfine alpha b [Source:ZFIN;Acc:ZDB-GENE-060526-294])

HSP 1 Score: 49.6766 bits (117), Expect = 1.843e-7
Identity = 32/83 (38.55%), Postives = 46/83 (55.42%), Query Frame = 3
Query:  129 QEQEFVAKYPDIANK--ASKILQKRLNKNVKYFDSGDYNVAKDKVLKQKLQTNMPHSISNNESLSQPGTFDSLDNNLNLPQYR 371
            +E +  AKYP++  K   S  L KRL K  KYFDSGDYN+AK K+  ++L    P +    +S+    T D +    +LPQ +
Sbjct:   25 EEAKLKAKYPNLGQKPGGSDFLMKRLQKGQKYFDSGDYNMAKAKMKNKQL----PAATGPEKSIV---TGDHIPTPQDLPQRK 100          
BLAST of cAMP regulated phosphoprotein 19 vs. Ensembl Cavefish
Match: ensab (endosulfine alpha b [Source:ZFIN;Acc:ZDB-GENE-060526-294])

HSP 1 Score: 49.6766 bits (117), Expect = 2.180e-7
Identity = 32/83 (38.55%), Postives = 46/83 (55.42%), Query Frame = 3
Query:  129 QEQEFVAKYPDIANK--ASKILQKRLNKNVKYFDSGDYNVAKDKVLKQKLQTNMPHSISNNESLSQPGTFDSLDNNLNLPQYR 371
            +E +  AKYP++  K   S  L KRL K  KYFDSGDYN+AK K+  ++L    P +    +S+    T D +    +LPQ +
Sbjct:   26 EEAKLKAKYPNLGQKPGGSDFLMKRLQKGQKYFDSGDYNMAKAKMKNKQL----PAATGPEKSIV---TGDHIPTPQDLPQRK 101          
BLAST of cAMP regulated phosphoprotein 19 vs. Ensembl Cavefish
Match: ensab (endosulfine alpha b [Source:ZFIN;Acc:ZDB-GENE-060526-294])

HSP 1 Score: 49.2914 bits (116), Expect = 2.227e-7
Identity = 32/83 (38.55%), Postives = 46/83 (55.42%), Query Frame = 3
Query:  129 QEQEFVAKYPDIANK--ASKILQKRLNKNVKYFDSGDYNVAKDKVLKQKLQTNMPHSISNNESLSQPGTFDSLDNNLNLPQYR 371
            +E +  AKYP++  K   S  L KRL K  KYFDSGDYN+AK K+  ++L    P +    +S+    T D +    +LPQ +
Sbjct:   19 EEAKLKAKYPNLGQKPGGSDFLMKRLQKGQKYFDSGDYNMAKAKMKNKQL----PAATGPEKSIV---TGDHIPTPQDLPQRK 94          
BLAST of cAMP regulated phosphoprotein 19 vs. Ensembl Cavefish
Match: ensab (endosulfine alpha b [Source:ZFIN;Acc:ZDB-GENE-060526-294])

HSP 1 Score: 49.2914 bits (116), Expect = 2.529e-7
Identity = 32/83 (38.55%), Postives = 46/83 (55.42%), Query Frame = 3
Query:  129 QEQEFVAKYPDIANK--ASKILQKRLNKNVKYFDSGDYNVAKDKVLKQKLQTNMPHSISNNESLSQPGTFDSLDNNLNLPQYR 371
            +E +  AKYP++  K   S  L KRL K  KYFDSGDYN+AK K+  ++L    P +    +S+    T D +    +LPQ +
Sbjct:   27 EEAKLKAKYPNLGQKPGGSDFLMKRLQKGQKYFDSGDYNMAKAKMKNKQL----PAATGPEKSIV---TGDHIPTPQDLPQRK 102          
BLAST of cAMP regulated phosphoprotein 19 vs. Ensembl Cavefish
Match: ensab (endosulfine alpha b [Source:ZFIN;Acc:ZDB-GENE-060526-294])

HSP 1 Score: 48.9062 bits (115), Expect = 2.922e-7
Identity = 32/83 (38.55%), Postives = 46/83 (55.42%), Query Frame = 3
Query:  129 QEQEFVAKYPDIANK--ASKILQKRLNKNVKYFDSGDYNVAKDKVLKQKLQTNMPHSISNNESLSQPGTFDSLDNNLNLPQYR 371
            +E +  AKYP++  K   S  L KRL K  KYFDSGDYN+AK K+  ++L    P +    +S+    T D +    +LPQ +
Sbjct:   22 EEAKLKAKYPNLGQKPGGSDFLMKRLQKGQKYFDSGDYNMAKAKMKNKQL----PAATGPEKSIV---TGDHIPTPQDLPQRK 97          
BLAST of cAMP regulated phosphoprotein 19 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000002208.1 (pep scaffold:Pmarinus_7.0:GL491052:3795:4888:-1 gene:ENSPMAG00000002007.1 transcript:ENSPMAT00000002208.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 48.1358 bits (113), Expect = 8.477e-8
Identity = 25/52 (48.08%), Postives = 34/52 (65.38%), Query Frame = 3
Query:  126 LQEQEFVAKYPDIAN---KASKILQKRLNKNVKYFDSGDYNVAKDKVLKQKL 272
            ++E +  AKYP+I       S  L+KRL K  KYFDSGDYN+AK K+  ++L
Sbjct:    5 VEEAKLRAKYPNIVPHQPGGSHFLRKRLQKGQKYFDSGDYNMAKAKMKNKQL 56          
BLAST of cAMP regulated phosphoprotein 19 vs. Ensembl Nematostella
Match: EDO32409 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SV53])

HSP 1 Score: 46.595 bits (109), Expect = 8.946e-7
Identity = 19/42 (45.24%), Postives = 30/42 (71.43%), Query Frame = 3
Query:  129 QEQEFVAKYPDIANKASKILQKRLNKNVKYFDSGDYNVAKDK 254
            +E++F  K+P+     + +++KRL K VKYFDSGDY +AK +
Sbjct:   15 EEEKFKRKFPNKKPMTTDVMRKRLQKGVKYFDSGDYMMAKSR 56          
BLAST of cAMP regulated phosphoprotein 19 vs. Ensembl Medaka
Match: ENSA (alpha-endosulfine [Source:NCBI gene;Acc:101165668])

HSP 1 Score: 49.2914 bits (116), Expect = 3.017e-7
Identity = 26/58 (44.83%), Postives = 35/58 (60.34%), Query Frame = 3
Query:  120 MNLQEQEFVAKYPDIANK--ASKILQKRLNKNVKYFDSGDYNVAKDKVLKQKLQTNMP 287
            + ++E +  AKYP +  K   S  L KRL K  KYFDSGDYN+AK K+  ++L    P
Sbjct:   29 VKVEEAKLKAKYPGLGQKPGGSDFLMKRLQKGQKYFDSGDYNMAKAKMKNKQLPVAGP 86          
BLAST of cAMP regulated phosphoprotein 19 vs. Ensembl Medaka
Match: ARPP19 (cAMP-regulated phosphoprotein 19 [Source:NCBI gene;Acc:101168529])

HSP 1 Score: 46.2098 bits (108), Expect = 3.196e-6
Identity = 21/40 (52.50%), Postives = 30/40 (75.00%), Query Frame = 3
Query:  129 QEQEFVAKYPDIANKASKILQKRLNKNVKYFDSGDYNVAK 248
            +E +  A+YP++ +K   +L+KRL K  KYFDSGDYN+AK
Sbjct:   33 EEAKLKARYPNLGHKPD-MLRKRLQKGQKYFDSGDYNMAK 71          
BLAST of cAMP regulated phosphoprotein 19 vs. Planmine SMEST
Match: SMESG000071252.1 (SMESG000071252.1)

HSP 1 Score: 295.819 bits (756), Expect = 1.058e-101
Identity = 159/159 (100.00%), Postives = 159/159 (100.00%), Query Frame = 3
Query:  105 MSHSEMNLQEQEFVAKYPDIANKASKILQKRLNKNVKYFDSGDYNVAKDKVLKQKLQTNMPHSISNNESLSQPGTFDSLDNNLNLPQYRKXXXXXXXXXXXXXXEAIGVDEMLKQSTGDTIPTPDNVPAVVRKKSFLQQTSHLSRSDSHSFEGDKPIQH 581
            MSHSEMNLQEQEFVAKYPDIANKASKILQKRLNKNVKYFDSGDYNVAKDKVLKQKLQTNMPHSISNNESLSQPGTFDSLDNNLNLPQYRKSLSTSNTDSSINTIEAIGVDEMLKQSTGDTIPTPDNVPAVVRKKSFLQQTSHLSRSDSHSFEGDKPIQH
Sbjct:    1 MSHSEMNLQEQEFVAKYPDIANKASKILQKRLNKNVKYFDSGDYNVAKDKVLKQKLQTNMPHSISNNESLSQPGTFDSLDNNLNLPQYRKSLSTSNTDSSINTIEAIGVDEMLKQSTGDTIPTPDNVPAVVRKKSFLQQTSHLSRSDSHSFEGDKPIQH 159          
BLAST of cAMP regulated phosphoprotein 19 vs. Planmine SMEST
Match: SMESG000071252.1 (SMESG000071252.1)

HSP 1 Score: 284.648 bits (727), Expect = 2.329e-97
Identity = 154/154 (100.00%), Postives = 154/154 (100.00%), Query Frame = 3
Query:  120 MNLQEQEFVAKYPDIANKASKILQKRLNKNVKYFDSGDYNVAKDKVLKQKLQTNMPHSISNNESLSQPGTFDSLDNNLNLPQYRKXXXXXXXXXXXXXXEAIGVDEMLKQSTGDTIPTPDNVPAVVRKKSFLQQTSHLSRSDSHSFEGDKPIQH 581
            MNLQEQEFVAKYPDIANKASKILQKRLNKNVKYFDSGDYNVAKDKVLKQKLQTNMPHSISNNESLSQPGTFDSLDNNLNLPQYRKSLSTSNTDSSINTIEAIGVDEMLKQSTGDTIPTPDNVPAVVRKKSFLQQTSHLSRSDSHSFEGDKPIQH
Sbjct:    1 MNLQEQEFVAKYPDIANKASKILQKRLNKNVKYFDSGDYNVAKDKVLKQKLQTNMPHSISNNESLSQPGTFDSLDNNLNLPQYRKSLSTSNTDSSINTIEAIGVDEMLKQSTGDTIPTPDNVPAVVRKKSFLQQTSHLSRSDSHSFEGDKPIQH 154          
BLAST of cAMP regulated phosphoprotein 19 vs. Planmine SMEST
Match: SMESG000032735.1 (SMESG000032735.1)

HSP 1 Score: 56.225 bits (134), Expect = 8.730e-10
Identity = 46/124 (37.10%), Postives = 57/124 (45.97%), Query Frame = 3
Query:  147 AKYPDIANK--ASKILQKRLNKNVKYFDSGDYNVAKDKVLKQKLQTNMPHSISNNESLSQPGTFDSLDNNLNLPQYRKXXXXXXXXXXXXXXEAIGVDEMLKQSTGDTIPTPDNVPAVVRKKSF 512
            +KYP +A K  AS++LQKRL K  KYFDSGDYNVA+ +   QK    +P   +  E LS                                         L ++TGDTI TP+ VPA VRKKS 
Sbjct:   14 SKYPQLAKKGGASQLLQKRLCKGHKYFDSGDYNVARAQ--NQKAANVLP---TQKEELS-----------------------------------------LYETTGDTIATPETVPA-VRKKSL 90          
The following BLAST results are available for this feature:
BLAST of cAMP regulated phosphoprotein 19 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ARPP199.370e-847.27cAMP regulated phosphoprotein 19 [Source:HGNC Symb... [more]
ARPP191.023e-747.27cAMP regulated phosphoprotein 19 [Source:HGNC Symb... [more]
ARPP191.023e-747.27cAMP regulated phosphoprotein 19 [Source:HGNC Symb... [more]
ARPP191.023e-747.27cAMP regulated phosphoprotein 19 [Source:HGNC Symb... [more]
ARPP191.023e-747.27cAMP regulated phosphoprotein 19 [Source:HGNC Symb... [more]
back to top
BLAST of cAMP regulated phosphoprotein 19 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of cAMP regulated phosphoprotein 19 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of cAMP regulated phosphoprotein 19 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
arpp19a1.503e-850.98cAMP-regulated phosphoprotein 19a [Source:ZFIN;Acc... [more]
arpp19a1.503e-850.98cAMP-regulated phosphoprotein 19a [Source:ZFIN;Acc... [more]
ensab3.954e-750.00endosulfine alpha b [Source:ZFIN;Acc:ZDB-GENE-0605... [more]
ensab3.954e-750.00endosulfine alpha b [Source:ZFIN;Acc:ZDB-GENE-0605... [more]
ensaa5.968e-753.33endosulfine alpha a [Source:NCBI gene;Acc:569530][more]
back to top
BLAST of cAMP regulated phosphoprotein 19 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 1
Match NameE-valueIdentityDescription
eefsec7.838e-849.09eukaryotic elongation factor, selenocysteine-tRNA-... [more]
back to top
BLAST of cAMP regulated phosphoprotein 19 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Arpp193.329e-745.45cAMP-regulated phosphoprotein 19 [Source:MGI Symbo... [more]
Arpp193.329e-745.45cAMP-regulated phosphoprotein 19 [Source:MGI Symbo... [more]
Arpp193.329e-745.45cAMP-regulated phosphoprotein 19 [Source:MGI Symbo... [more]
Arpp193.875e-745.45cAMP-regulated phosphoprotein 19 [Source:MGI Symbo... [more]
Arpp193.875e-745.45cAMP-regulated phosphoprotein 19 [Source:MGI Symbo... [more]
back to top
BLAST of cAMP regulated phosphoprotein 19 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q7ZXH9|ENSA_XENLA2.122e-749.09Alpha-endosulfine OS=Xenopus laevis OX=8355 GN=ens... [more]
sp|Q28GU6|ARP19_XENTR3.180e-749.09cAMP-regulated phosphoprotein 19 OS=Xenopus tropic... [more]
sp|Q6NVR1|ENSA_XENTR4.152e-749.09Alpha-endosulfine OS=Xenopus tropicalis OX=8364 GN... [more]
sp|Q5ZIF8|ENSA_CHICK4.789e-749.09Alpha-endosulfine OS=Gallus gallus OX=9031 GN=ENSA... [more]
sp|B5G1C4|ARP19_TAEGU5.220e-747.27cAMP-regulated phosphoprotein 19 OS=Taeniopygia gu... [more]
back to top
BLAST of cAMP regulated phosphoprotein 19 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A0R3U2V11.731e-1636.67Uncharacterized protein OS=Mesocestoides corti OX=... [more]
A0A0R3TNZ04.050e-1439.69Uncharacterized protein OS=Rodentolepis nana OX=10... [more]
A0A0R3SUQ39.432e-1439.39Uncharacterized protein OS=Hymenolepis diminuta OX... [more]
A0A0R3X6A51.546e-1335.67Uncharacterized protein OS=Hydatigena taeniaeformi... [more]
A0A183TEJ48.791e-1334.75Uncharacterized protein OS=Schistocephalus solidus... [more]
back to top
BLAST of cAMP regulated phosphoprotein 19 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ensab1.843e-738.55endosulfine alpha b [Source:ZFIN;Acc:ZDB-GENE-0605... [more]
ensab2.180e-738.55endosulfine alpha b [Source:ZFIN;Acc:ZDB-GENE-0605... [more]
ensab2.227e-738.55endosulfine alpha b [Source:ZFIN;Acc:ZDB-GENE-0605... [more]
ensab2.529e-738.55endosulfine alpha b [Source:ZFIN;Acc:ZDB-GENE-0605... [more]
ensab2.922e-738.55endosulfine alpha b [Source:ZFIN;Acc:ZDB-GENE-0605... [more]
back to top
BLAST of cAMP regulated phosphoprotein 19 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 1
Match NameE-valueIdentityDescription
ENSPMAT00000002208.18.477e-848.08pep scaffold:Pmarinus_7.0:GL491052:3795:4888:-1 ge... [more]
back to top
BLAST of cAMP regulated phosphoprotein 19 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of cAMP regulated phosphoprotein 19 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 1
Match NameE-valueIdentityDescription
EDO324098.946e-745.24Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of cAMP regulated phosphoprotein 19 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 2
Match NameE-valueIdentityDescription
ENSA3.017e-744.83alpha-endosulfine [Source:NCBI gene;Acc:101165668][more]
ARPP193.196e-652.50cAMP-regulated phosphoprotein 19 [Source:NCBI gene... [more]
back to top
BLAST of cAMP regulated phosphoprotein 19 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 3
Match NameE-valueIdentityDescription
SMESG000071252.11.058e-101100.00SMESG000071252.1[more]
SMESG000071252.12.329e-97100.00SMESG000071252.1[more]
SMESG000032735.18.730e-1037.10SMESG000032735.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30015654 ID=SMED30015654|Name=cAMP regulated phosphoprotein 19|organism=Schmidtea mediterranea sexual|type=transcript|length=982bp
ATTTTAACAAACAATAGTGTTTAAATATATTTTTAACCGCGTGTTTATAA
AACATTAAGAAACTTCCAATAATTTTTTTTGCATTACATATTTAATCTTA
TTCGATGTCTCATTCAGAGATGAACTTACAAGAACAAGAATTTGTTGCTA
AATATCCTGATATTGCTAATAAGGCCAGCAAAATATTACAGAAAAGATTA
AACAAAAATGTAAAATATTTCGATTCTGGTGATTACAATGTAGCTAAAGA
CAAAGTTTTAAAACAAAAACTTCAAACTAACATGCCTCACTCTATATCTA
ATAATGAATCGTTGTCTCAACCTGGAACTTTTGATTCTTTAGACAACAAT
CTTAATTTACCACAATATAGAAAGAGTTTAAGCACATCTAATACAGATTC
GTCAATTAATACTATCGAAGCTATAGGAGTTGATGAAATGTTGAAGCAAT
CTACAGGTGACACTATTCCTACACCAGATAATGTGCCAGCAGTCGTTCGC
AAAAAATCTTTTCTTCAGCAAACGAGCCACTTGAGTCGTTCAGATTCACA
TAGTTTTGAAGGAGATAAACCTATTCAACATTGATTGAATTTCAAACTAT
TGAACATTTTTTTGTAAAGTATTGCTTTGATTTATCTATGAAACTATTTA
ATTATTTAAATTGTCGTTTTGTTCACAAAATGCCTCACATAATTAGAACT
ATGCATTGATTTACCAAACTGCTTCGCTGCATTGCTTTCTGCAAGTAATA
ATTTAGTAATTTAAAAATAAAATTCTGTTAAATTTTTTTTTATCAGAAAA
ATTGATATCGCTGACAAATTATTATTAAATTAAACTGATCGATTTGAATG
TTTTATCTATTGGAAATCTAATTGTTACAATGCCGTTAATTTAGGTAATA
TGGTTTCATTAATTAGCCTAGATTCCATGTATGTTAAAGCCGTAAAATAA
TTGATTGGCTCATAAGTAGGTAAAATTTAAGA
back to top

protein sequence of SMED30015654-orf-1

>SMED30015654-orf-1 ID=SMED30015654-orf-1|Name=SMED30015654-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=160bp
MSHSEMNLQEQEFVAKYPDIANKASKILQKRLNKNVKYFDSGDYNVAKDK
VLKQKLQTNMPHSISNNESLSQPGTFDSLDNNLNLPQYRKSLSTSNTDSS
INTIEAIGVDEMLKQSTGDTIPTPDNVPAVVRKKSFLQQTSHLSRSDSHS
FEGDKPIQH*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: biological process
TermDefinition
GO:0032515negative regulation of phosphoprotein phosphatase activity
GO:0007049cell cycle
GO:0007067mitotic nuclear division
GO:0043086negative regulation of catalytic activity
GO:0051301cell division
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000070intestinal phagocyte
PLANA:0003116parenchymal cell
Vocabulary: INTERPRO
TermDefinition
IPR006760Endosulphine
Vocabulary: molecular function
TermDefinition
GO:0004864protein phosphatase inhibitor activity
Vocabulary: cellular component
TermDefinition
GO:0005737cytoplasm
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR006760EndosulphinePFAMPF04667Endosulfinecoord: 4..67
e-value: 1.9E-8
score: 34.3
IPR006760EndosulphinePANTHERPTHR10358ENDOSULFINEcoord: 4..141
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 138..159
NoneNo IPR availablePANTHERPTHR10358:SF6ALPHA-ENDOSULFINE-RELATEDcoord: 4..141