Acetylcholine receptor subunit alpha-like

Overview
NameAcetylcholine receptor subunit alpha-like
Smed IDSMED30015649
Uniprot Best hitAcetylcholine receptor subunit alpha-L1 OS=Schistocerca gregaria OX=7010 PE=2 SV=1 (E=7.94206e-114)
Length (bp)1659
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Acetylcholine receptor subunit alpha-like (SMED30015649) t-SNE clustered cells

Violin plots show distribution of expression levels for Acetylcholine receptor subunit alpha-like (SMED30015649) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Acetylcholine receptor subunit alpha-like (SMED30015649) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Acetylcholine receptor subunit alpha-like (SMED30015649) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30015649

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 3

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
headSMED30015649SMESG000056721.1 dd_Smed_v6_11955_0_1dd_Smed_v6PMID:28171748
Stückemann et al., 2017
whole organism asexual adult RNA-sequencing evidence
epidermisSMED30015649SMESG000056721.1 dd_Smed_v4_11955_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
ventral epidermisSMED30015649SMESG000056721.1 dd_Smed_v4_11955_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Acetylcholine receptor subunit alpha-like vs. Ensembl Human
Match: CHRNA3 (cholinergic receptor nicotinic alpha 3 subunit [Source:HGNC Symbol;Acc:HGNC:1957])

HSP 1 Score: 327.405 bits (838), Expect = 1.962e-105
Identity = 185/500 (37.00%), Postives = 282/500 (56.40%), Query Frame = 2
Query:   83 VTTAYSAARNLYDDLFNKAHNYPKLL-PVVNLETPVIVYMNLSLSQILEVNVKDQIIVLNVWVYQEWNDNRFSWDPSDYGGLTEIQIPSSMIWLPDLVLYNNAGGDWDLSGMSGSKVKVKHDGTIIWKPPVILKSQCEMDVTYFPFDIQTCPLKMGTWTHHGLLIDLRHWAQKVSDLSNERIKYDNCESKIDYAIDLTDYLQSYEWDLLSVTANRNIKKYPCCPEPYLDVTFHIKIRRMTLFYGLNLIFPCLSISFLTIMVFYLPTYSTQKITLCISVFLALNIFILVVFDLTPSTSRSVPLIVKYLLFTMFMVTFSIVASIAVLNFSFRQPETDKLSDNMKKIFLKTLPTYLKM-RSVEFKENSEIPTSFGSTKSTNYADYSMYDLTWLKWNKGYTEMMNSKCGTAQ-------NFS---------------------SAKRNLALESLRSIKYNLLLKTRHNEVRNEWMYMGIVIDRLFLIVFTVIVTLGSLIIFLMP 1492
            V  A  A   L++ LF    +Y +++ PV N+  PVI++  +S+SQ+++V+  +QI+  N+W+ Q WND +  W+PSDYGG   +++P+  IW PD+VLYNNA GD+ +     +K  +K+ G + W PP I KS C++DVTYFPFD Q C +K G+W++    IDL                       I  +++L DY +S EW ++     ++  KY CC E Y D+T+ + IRR+ LFY +NLI PCL ISFLT++VFYLP+   +K+TLCISV L+L +F+LV+ +  PSTS  +PLI +YLLFTM  VT SIV ++ VLN  +R P T  +   +K +FL  LP  + M R    + N++ P      + +N   +S  +    K  +GY    +  CG          NFS                     S +   A++S++ I  N+  +    E++++W Y+ +VIDR+FL VFT++  LG+  +FL P
Sbjct:   28 VARASEAEHRLFERLF---EDYNEIIRPVANVSDPVIIHFEVSMSQLVKVDEVNQIMETNLWLKQIWNDYKLKWNPSDYGGAEFMRVPAQKIWKPDIVLYNNAVGDFQVD--DKTKALLKYTGEVTWIPPAIFKSSCKIDVTYFPFDYQNCTMKFGSWSYDKAKIDL---------------------VLIGSSMNLKDYWESGEWAIIKAPGYKHDIKYNCCEEIYPDITYSLYIRRLPLFYTINLIIPCLLISFLTVLVFYLPSDCGEKVTLCISVLLSLTVFLLVITETIPSTSLVIPLIGEYLLFTMIFVTLSIVITVFVLNVHYRTPTTHTMPSWVKTVFLNLLPRVMFMTRPTSNEGNAQKPRPLYGAELSNLNCFSRAESKGCK--EGYP-CQDGMCGYCHHRRIKISNFSANLTRSSSSESVDAVLSLSALSPEIKEAIQSVKYIAENMKAQNEAKEIQDDWKYVAMVIDRIFLWVFTLVCILGTAGLFLQP 498          
BLAST of Acetylcholine receptor subunit alpha-like vs. Ensembl Human
Match: CHRNA3 (cholinergic receptor nicotinic alpha 3 subunit [Source:HGNC Symbol;Acc:HGNC:1957])

HSP 1 Score: 327.405 bits (838), Expect = 1.962e-105
Identity = 185/500 (37.00%), Postives = 282/500 (56.40%), Query Frame = 2
Query:   83 VTTAYSAARNLYDDLFNKAHNYPKLL-PVVNLETPVIVYMNLSLSQILEVNVKDQIIVLNVWVYQEWNDNRFSWDPSDYGGLTEIQIPSSMIWLPDLVLYNNAGGDWDLSGMSGSKVKVKHDGTIIWKPPVILKSQCEMDVTYFPFDIQTCPLKMGTWTHHGLLIDLRHWAQKVSDLSNERIKYDNCESKIDYAIDLTDYLQSYEWDLLSVTANRNIKKYPCCPEPYLDVTFHIKIRRMTLFYGLNLIFPCLSISFLTIMVFYLPTYSTQKITLCISVFLALNIFILVVFDLTPSTSRSVPLIVKYLLFTMFMVTFSIVASIAVLNFSFRQPETDKLSDNMKKIFLKTLPTYLKM-RSVEFKENSEIPTSFGSTKSTNYADYSMYDLTWLKWNKGYTEMMNSKCGTAQ-------NFS---------------------SAKRNLALESLRSIKYNLLLKTRHNEVRNEWMYMGIVIDRLFLIVFTVIVTLGSLIIFLMP 1492
            V  A  A   L++ LF    +Y +++ PV N+  PVI++  +S+SQ+++V+  +QI+  N+W+ Q WND +  W+PSDYGG   +++P+  IW PD+VLYNNA GD+ +     +K  +K+ G + W PP I KS C++DVTYFPFD Q C +K G+W++    IDL                       I  +++L DY +S EW ++     ++  KY CC E Y D+T+ + IRR+ LFY +NLI PCL ISFLT++VFYLP+   +K+TLCISV L+L +F+LV+ +  PSTS  +PLI +YLLFTM  VT SIV ++ VLN  +R P T  +   +K +FL  LP  + M R    + N++ P      + +N   +S  +    K  +GY    +  CG          NFS                     S +   A++S++ I  N+  +    E++++W Y+ +VIDR+FL VFT++  LG+  +FL P
Sbjct:   28 VARASEAEHRLFERLF---EDYNEIIRPVANVSDPVIIHFEVSMSQLVKVDEVNQIMETNLWLKQIWNDYKLKWNPSDYGGAEFMRVPAQKIWKPDIVLYNNAVGDFQVD--DKTKALLKYTGEVTWIPPAIFKSSCKIDVTYFPFDYQNCTMKFGSWSYDKAKIDL---------------------VLIGSSMNLKDYWESGEWAIIKAPGYKHDIKYNCCEEIYPDITYSLYIRRLPLFYTINLIIPCLLISFLTVLVFYLPSDCGEKVTLCISVLLSLTVFLLVITETIPSTSLVIPLIGEYLLFTMIFVTLSIVITVFVLNVHYRTPTTHTMPSWVKTVFLNLLPRVMFMTRPTSNEGNAQKPRPLYGAELSNLNCFSRAESKGCK--EGYP-CQDGMCGYCHHRRIKISNFSANLTRSSSSESVDAVLSLSALSPEIKEAIQSVKYIAENMKAQNEAKEIQDDWKYVAMVIDRIFLWVFTLVCILGTAGLFLQP 498          
BLAST of Acetylcholine receptor subunit alpha-like vs. Ensembl Human
Match: CHRNA6 (cholinergic receptor nicotinic alpha 6 subunit [Source:HGNC Symbol;Acc:HGNC:15963])

HSP 1 Score: 311.997 bits (798), Expect = 1.019e-99
Identity = 174/514 (33.85%), Postives = 271/514 (52.72%), Query Frame = 2
Query:   50 FLLSFVAIKICVTTAY-------SAARNLYDDLFNKAHNYPKLLPVVNLETPVIVYMNLSLSQILEVNVKDQIIVLNVWVYQEWNDNRFSWDPSDYGGLTEIQIPSSMIWLPDLVLYNNAGGDWDLSGMSGSKVKVKHDGTIIWKPPVILKSQCEMDVTYFPFDIQTCPLKMGTWTHHGLLIDLRHWAQKVSDLSNERIKYDNCESKIDYAIDLTDYLQSYEWDLLSVTANRNIKKYPCCPEPYLDVTFHIKIRRMTLFYGLNLIFPCLSISFLTIMVFYLPTYSTQKITLCISVFLALNIFILVVFDLTPSTSRSVPLIVKYLLFTMFMVTFSIVASIAVLNFSFRQPETDKLSDNMKKIFLKTLPTYLKMR----SVEFKENSEIPTSFGSTKSTNYADYSMYDLTWLKWNKGYTEMMNS--KCGTAQNFSSAKRNLA--------------------LESLRSIKYNLLLKTRHNEVRNEWMYMGIVIDRLFLIVFTVIVTLGSLIIFLMP 1492
            FL   + + +CV T +       +    L+  LF+  + +  + PV N+  PV V+  ++++Q+  V+  +QI+  N+W+   WND +  WDP +Y G+  +++P+  IW PD+VLYNNA GD+ + G   +K  +K++G I W PP I KS C MD+T+FPFD Q C LK G+WT+    IDL     KV                     D+ D+ ++ EW+++  +  ++  KY CC E Y D+T+   IRR+ +FY +NLI PCL ISFLT++VFYLP+   +K+TLCISV L+L +F+LV+ +  PSTS  VPL+ +YLLFTM  VT SIV ++ VLN  +R P T  +   +K +FLK LP  L MR          +  +P       +                + G    +     C  +   +++KR L+                    + S++ I  N+       EV ++W Y+ +V+DR+FL VF ++   G+  +FL P
Sbjct:    9 FLHGGLCLWLCVFTPFFKGCVGCATEERLFHKLFSHYNQF--IRPVENVSDPVTVHFEVAITQLANVDEVNQIMETNLWLRHIWNDYKLRWDPMEYDGIETLRVPADKIWKPDIVLYNNAVGDFQVEG--KTKALLKYNGMITWTPPAIFKSSCPMDITFFPFDHQNCSLKFGSWTYDKAEIDLLIIGSKV---------------------DMNDFWENSEWEIIDASGYKHDIKYNCCEEIYTDITYSFYIRRLPMFYTINLIIPCLFISFLTVLVFYLPSDCGEKVTLCISVLLSLTVFLLVITETIPSTSLVVPLVGEYLLFTMIFVTLSIVVTVFVLNIHYRTPTTHTMPRWVKTVFLKLLPQVLLMRWPLDKTRGTGSDAVPRGLARRPAKGKLA-----------SHGEPRHLKECFHCHKSNELATSKRRLSHQPLQWVVENSEHSPEVEDVINSVQFIAENMKSHNETKEVEDDWKYVAMVVDRVFLWVFIIVCVFGTAGLFLQP 486          
BLAST of Acetylcholine receptor subunit alpha-like vs. Ensembl Human
Match: CHRNA3 (cholinergic receptor nicotinic alpha 3 subunit [Source:HGNC Symbol;Acc:HGNC:1957])

HSP 1 Score: 295.434 bits (755), Expect = 2.122e-93
Identity = 163/424 (38.44%), Postives = 244/424 (57.55%), Query Frame = 2
Query:   83 VTTAYSAARNLYDDLFNKAHNYPKLL-PVVNLETPVIVYMNLSLSQILEVNVKDQIIVLNVWVYQEWNDNRFSWDPSDYGGLTEIQIPSSMIWLPDLVLYNNAGGDWDLSGMSGSKVKVKHDGTIIWKPPVILKSQCEMDVTYFPFDIQTCPLKMGTWTHHGLLIDLRHWAQKVSDLSNERIKYDNCESKIDYAIDLTDYLQSYEWDLLSVTANRNIKKYPCCPEPYLDVTFHIKIRRMTLFYGLNLIFPCLSISFLTIMVFYLPTYSTQKITLCISVFLALNIFILVVFDLTPSTSRSVPLIVKYLLFTMFMVTFSIVASIAVLNFSFRQPETDKLSDNMKKIFLKTLPTYLKM-RSVEFKENSEIPTSFGSTKSTNYADYSMYDLTWLKWNKGYTEMMNSKCGTAQNFSSAKRNLALESLRS 1348
            V  A  A   L++ LF    +Y +++ PV N+  PVI++  +S+SQ+++V+  +QI+  N+W+ Q WND +  W+PSDYGG   +++P+  IW PD+VLYNNA GD+ +     +K  +K+ G + W PP I KS C++DVTYFPFD Q C +K G+W++    IDL                       I  +++L DY +S EW ++     ++  KY CC E Y D+T+ + IRR+ LFY +NLI PCL ISFLT++VFYLP+   +K+TLCISV L+L +F+LV+ +  PSTS  +PLI +YLLFTM  VT SIV ++ VLN  +R P T  +   +K +FL  LP  + M R    + N++ P      + +N   +S  +    K  +GY    +  CG   +      N +    RS
Sbjct:   28 VARASEAEHRLFERLF---EDYNEIIRPVANVSDPVIIHFEVSMSQLVKVDEVNQIMETNLWLKQIWNDYKLKWNPSDYGGAEFMRVPAQKIWKPDIVLYNNAVGDFQVD--DKTKALLKYTGEVTWIPPAIFKSSCKIDVTYFPFDYQNCTMKFGSWSYDKAKIDL---------------------VLIGSSMNLKDYWESGEWAIIKAPGYKHDIKYNCCEEIYPDITYSLYIRRLPLFYTINLIIPCLLISFLTVLVFYLPSDCGEKVTLCISVLLSLTVFLLVITETIPSTSLVIPLIGEYLLFTMIFVTLSIVITVFVLNVHYRTPTTHTMPSWVKTVFLNLLPRVMFMTRPTSNEGNAQKPRPLYGAELSNLNCFSRAESKGCK--EGYP-CQDGMCGYCHHRRIKISNFSANLTRS 422          
BLAST of Acetylcholine receptor subunit alpha-like vs. Ensembl Human
Match: CHRNA6 (cholinergic receptor nicotinic alpha 6 subunit [Source:HGNC Symbol;Acc:HGNC:15963])

HSP 1 Score: 293.123 bits (749), Expect = 1.242e-92
Identity = 170/514 (33.07%), Postives = 262/514 (50.97%), Query Frame = 2
Query:   50 FLLSFVAIKICVTTAY-------SAARNLYDDLFNKAHNYPKLLPVVNLETPVIVYMNLSLSQILEVNVKDQIIVLNVWVYQEWNDNRFSWDPSDYGGLTEIQIPSSMIWLPDLVLYNNAGGDWDLSGMSGSKVKVKHDGTIIWKPPVILKSQCEMDVTYFPFDIQTCPLKMGTWTHHGLLIDLRHWAQKVSDLSNERIKYDNCESKIDYAIDLTDYLQSYEWDLLSVTANRNIKKYPCCPEPYLDVTFHIKIRRMTLFYGLNLIFPCLSISFLTIMVFYLPTYSTQKITLCISVFLALNIFILVVFDLTPSTSRSVPLIVKYLLFTMFMVTFSIVASIAVLNFSFRQPETDKLSDNMKKIFLKTLPTYLKMR----SVEFKENSEIPTSFGSTKSTNYADYSMYDLTWLKWNKGYTEMMNS--KCGTAQNFSSAKRNLA--------------------LESLRSIKYNLLLKTRHNEVRNEWMYMGIVIDRLFLIVFTVIVTLGSLIIFLMP 1492
            FL   + + +CV T +       +    L+  LF+  + +  + PV N+  PV V+  ++++Q+  V                WND +  WDP +Y G+  +++P+  IW PD+VLYNNA GD+ + G +  K  +K++G I W PP I KS C MD+T+FPFD Q C LK G+WT+    IDL     KV                     D+ D+ ++ EW+++  +  ++  KY CC E Y D+T+   IRR+ +FY +NLI PCL ISFLT++VFYLP+   +K+TLCISV L+L +F+LV+ +  PSTS  VPL+ +YLLFTM  VT SIV ++ VLN  +R P T  +   +K +FLK LP  L MR          +  +P       +                + G    +     C  +   +++KR L+                    + S++ I  N+       EV ++W Y+ +V+DR+FL VF ++   G+  +FL P
Sbjct:    9 FLHGGLCLWLCVFTPFFKGCVGCATEERLFHKLFSHYNQF--IRPVENVSDPVTVHFEVAITQLANVI---------------WNDYKLRWDPMEYDGIETLRVPADKIWKPDIVLYNNAVGDFQVEGKT--KALLKYNGMITWTPPAIFKSSCPMDITFFPFDHQNCSLKFGSWTYDKAEIDLLIIGSKV---------------------DMNDFWENSEWEIIDASGYKHDIKYNCCEEIYTDITYSFYIRRLPMFYTINLIIPCLFISFLTVLVFYLPSDCGEKVTLCISVLLSLTVFLLVITETIPSTSLVVPLVGEYLLFTMIFVTLSIVVTVFVLNIHYRTPTTHTMPRWVKTVFLKLLPQVLLMRWPLDKTRGTGSDAVPRGLARRPAKGKLA-----------SHGEPRHLKECFHCHKSNELATSKRRLSHQPLQWVVENSEHSPEVEDVINSVQFIAENMKSHNETKEVEDDWKYVAMVVDRVFLWVFIIVCVFGTAGLFLQP 471          
BLAST of Acetylcholine receptor subunit alpha-like vs. Ensembl Celegans
Match: unc-63 (Acetylcholine receptor subunit alpha-type unc-63 [Source:UniProtKB/Swiss-Prot;Acc:Q9N587])

HSP 1 Score: 334.339 bits (856), Expect = 1.307e-108
Identity = 192/493 (38.95%), Postives = 294/493 (59.63%), Query Frame = 2
Query:   86 TTAYSAARNLYDDLFNKAHNYPKLL-PVVNLETPVIVYMNLSLSQILEVNVKDQIIVLNVWVYQEWNDNRFSWDPSDYGGLTEIQIPSSMIWLPDLVLYNNAGGDWDLSGMSGSKVKVKHDGTIIWKPPVILKSQCEMDVTYFPFDIQTCPLKMGTWTHHGLLIDLRHWAQKVSDLSNERIKYDNCESK-----IDYAIDLTDYLQSYEWDLLSVTANRNIKKYPCCPEPYLDVTFHIKIRRMTLFYGLNLIFPCLSISFLTIMVFYLPTYSTQKITLCISVFLALNIFILVVFDLTPSTSRSVPLIVKYLLFTMFMVTFSIVASIAVLNFSFRQPETDKLSDNMKKIFLKTLPTYLKM-RSVEFKENSEIPTSFGSTKSTNYADYSMYDLTWLKWNKGYTEMMNSKCGTAQNFSS-------AKRNLALESLRSIKYNLLLKTRHNEVRNEWMYMGIVIDRLFLIVFTVIVTLGSLIIFLMPPQLWSQQLVL 1522
            T A   A  L++DL     +Y KL+ PV      ++V   L LSQ+L+V+ K+QI+  NVW+   W D +  WDP +YGG+  + +PS  IWLPD+VLYNNA G++ ++ M+  K K+ ++GT+ W PP I KS C++DV +FPFD Q C +K G+WT+ GL +DL+H  + +     E ++  +  +K     +D  IDL+DY  S EWD+L+V   R+ K+YPCC  P++D+T+ I +RR TLFY +NLIFP + ISFLT +VFYLP+   +KI+LCIS+ ++L +F L++ ++ PSTS  +PLI KYLLFTM +VT S+V ++  LN  +R P T  +   MK++F+  LP YL M R      +S+    F S  ST    +S+     L  N   +E+++    + +  SS       +    A+ES+  I  +L  +    +V  +W Y+ +V+DR+FLI FT     G+++I    P ++     L
Sbjct:   21 THANRDANRLFEDLIA---DYNKLVRPVSENGETLVVTFKLKLSQLLDVHEKNQIMTTNVWLQHSWMDYKLRWDPVEYGGVEVLYVPSDTIWLPDVVLYNNADGNYQVTIMT--KAKLTYNGTVEWAPPAIYKSMCQIDVEFFPFDRQQCEMKFGSWTYGGLEVDLQHRDKHLEKEIEEDVEGVDGPTKEIVWVVDRGIDLSDYYPSVEWDILNVPGKRHSKRYPCCESPFIDITYEIHLRRKTLFYTVNLIFPSVGISFLTALVFYLPSDGGEKISLCISILISLTVFFLLLVEIIPSTSLVIPLIGKYLLFTMVLVTLSVVVTVVTLNVHYRSPTTHTMPKWMKRLFVDFLPKYLLMTRPQPPGHHSKPNRKFDSRAST----FSIGVNHVLGQN---SELLSPGLNSNREESSFTLPRDNSPVRSAVESVAYIADHLKNEEDDKQVIEDWKYISVVMDRIFLITFTFACAFGTVVIIARAPSIYDNTPAL 501          
BLAST of Acetylcholine receptor subunit alpha-like vs. Ensembl Celegans
Match: unc-38 (Acetylcholine receptor subunit alpha-type unc-38 [Source:UniProtKB/Swiss-Prot;Acc:Q23022])

HSP 1 Score: 323.553 bits (828), Expect = 2.566e-104
Identity = 188/499 (37.68%), Postives = 295/499 (59.12%), Query Frame = 2
Query:   77 ICVTTAYSAARNLYDDLFNKAHNYPKLLPVVNLETPVIVYMNLSLSQILEVNVKDQIIVLNVWVYQEWNDNRFSWDPSDYGGLTEIQIPSSMIWLPDLVLYNNAGGDWDLSGMSGSKVKVKHDGTIIWKPPVILKSQCEMDVTYFPFDIQTCPLKMGTWT--HHGLLIDLRHWAQKVSDLSNERIKYDNCESKIDYAIDLTDYLQSYEWDLLSVTANRNIKKYP-CCPE-PYLDVTFHIKIRRMTLFYGLNLIFPCLSISFLTIMVFYLPTYSTQKITLCISVFLALNIFILVVFDLTPSTSRSVPLIVKYLLFTMFMVTFSIVASIAVLNFSFRQPETDKLSDNMKKIFLKTLPTYLKMRSV--EFKE---------NSEIPTSFGSTKSTNYADYSMYDLTWLKWNKGYTEMMNSKCGTAQN-----FSSAKRNLALESLRSIKYNLLLKTRHNEVRNEWMYMGIVIDRLFLIVFTVIVTLGSLIIFLMPPQLWSQQ 1513
            I +T     A+ LYDDL    + + +  P  +   P+ + + L LSQI++V+  DQI+  +VW+ Q W D + SWDP +YGG+  + +P  MIW+PD+VLYNNA  +++++    +K  + + G + W+PP I KS C++DV +FPFD Q C LK G+WT   + L ++L   + +  +  +E+   DN     D  IDL+DY  S EWD++S  A R  K YP CCP+  Y+DVT+++++RR  LFY +NL+FPC+ ISFLTI+VFYLP+ S +K+TLCIS+ +AL IF L++ ++ P+TS ++PLI KYLLFTM MVT S+V ++  LN  FR P T  + + +KK+FLK LP  L MR    +++E         + +I  S  + + +N  +                   N +  T  +     + S     A E++  I   L  K R +++  +W Y+ +V+DRLFL++F++   +G++II L  P L+  +
Sbjct:   18 IKLTEGNEDAKRLYDDLMVNYNRHRR--PSTSPNKPLTIKLKLRLSQIIDVHEIDQIMTCSVWLKQTWIDRKLSWDPVNYGGVNVLYVPYEMIWVPDIVLYNNADSNYNIT--ISTKATLHYTGEVTWEPPAIFKSMCQIDVRWFPFDEQQCHLKFGSWTFSENLLSVELNEPSLRYEEEIDEKGIIDNVTVAED-GIDLSDYYPSVEWDIMSRVAKRRAKNYPSCCPQSAYIDVTYYLQLRRKPLFYTVNLVFPCVGISFLTILVFYLPSDSGEKVTLCISILVALTIFFLLLTEIIPATSITLPLIGKYLLFTMVMVTLSVVVTVISLNLHFRTPTTHLMPNWVKKVFLKWLPKLLFMRRPIDDYEEKFDDKKKPKDGKIALSVHAHRVSNVGN-------------------NIRNATIDDTIQKMYYSPPVVKAFENICFIAELLKKKDRDDKIDEDWKYVAMVLDRLFLLIFSIACFVGTVIILLRAPTLYDTR 492          
BLAST of Acetylcholine receptor subunit alpha-like vs. Ensembl Celegans
Match: acr-12 (AcetylCholine Receptor; Nicotinic acetylcholine receptor-like subunit ACR-12 [Source:UniProtKB/TrEMBL;Acc:G5EDF1])

HSP 1 Score: 297.745 bits (761), Expect = 1.095e-93
Identity = 190/546 (34.80%), Postives = 283/546 (51.83%), Query Frame = 2
Query:   89 TAYSAARNLYDDLFNKAHNYPKLLPVVNLETPVIVYMNLSLSQILEVNVKDQIIVLNVWVYQEWNDNRFSWDPSDYGGLTEIQIPSSMIWLPDLVLYNNAGGDWDLSGMSGSKVKVKHDGTIIWKPPVILKSQCEMDVTYFPFDIQTCPLKMGTWTHHGLLIDLRHWAQ-KVSDLSNERIKYDNCESKIDYAIDLTDYLQSYEWDLLSVTANRNIKKYPCC--PEPYLDVTFHIKIRRMTLFYGLNLIFPCLSISFLTIMVFYLPTYSTQKITLCISVFLALNIFILVVFDLTPSTSRSVPLIVKYLLFTMFMVTFSIVASIAVLNFSFRQPETDKLSDNMKKIFLKTLPTYLKMRSVEFKENSEIP--TSFGSTKSTNYADYSMY-------------DLTWLKWNKGYTEMMNSK--------------------CGTAQN-----FSSAKRNLALESLRSIKYNLLLKT-------RHNEVRNE----WMYMGIVIDRLFLIVFTVIVTLGSLIIFLMPPQLWSQQLVLNSKDAAQMLANSNY 1564
            TA      LY+DL    +  P+  PV N    + V +  SL +I++V+ K+Q++  N+W+  +WND + +W P  YGGL  + IPS  IW PDLVLYNNA GD D++ ++ +   V  +G + W+PP I KS C +DVT+FP+D Q C +K GTWT+ G  +DL+   Q +V  ++    K DN    +   +DL+ + +S EWDLLS+T+ R+   Y  C  PE Y+D+T++  +RR TLF+  NLI PC  IS LT  VFYL   S  KIT  IS+ + L +F LV+ DL P TS  +P+  +YL+ TM +V  S V S+  +NF FR     K+S  ++ +FLK LP  L M   E  E ++ P   +  S   +NYA  +               DL  L+       ++N+                     C    N     F   KR  +      +  NLL +        RHNE+  E    W ++ +V+DRLFLI+F+V+  +G++ I L  P L+     +N     + L  +N+
Sbjct:   33 TAKDLESQLYEDLLFDYNKVPR--PVKNSSDILTVDVGASLIRIIDVDEKNQVLTTNLWLEMKWNDAKLTWTPEKYGGLKTLHIPSDFIWTPDLVLYNNAAGDPDITILTDA--LVTFEGNVYWQPPAIYKSFCPIDVTWFPYDSQKCEMKFGTWTYTGRYVDLKQLPQEEVVTIT----KDDNDVEFMQQGMDLSFFYRSAEWDLLSLTSERHSVLYASCCGPEKYVDITYYFGLRRKTLFFTCNLILPCFLISILTTFVFYL---SDHKITFSISILVTLTVFFLVLIDLMPPTSLVIPMFGRYLITTMILVALSTVVSVITVNFRFRSGSAHKMSPWIRAVFLKFLPKILLMSRPEKGEVTKQPPLVNAASLVGSNYATAAKAANEYRNKAKGKNNDLMSLRGKPSSQAVLNNTFDMRMRNNDSTVENRLKPYLCAQNNNAPTVAFRKTKRQKSKSVDDVVFMNLLNQVRFIAEHFRHNELEGEISDDWTFVAMVLDRLFLIIFSVL-NVGTVFIILESPSLYDYSKPMNITVPNKPLGQANF 566          
BLAST of Acetylcholine receptor subunit alpha-like vs. Ensembl Celegans
Match: acr-8 (AcetylCholine Receptor [Source:UniProtKB/TrEMBL;Acc:Q23355])

HSP 1 Score: 281.952 bits (720), Expect = 5.809e-88
Identity = 170/504 (33.73%), Postives = 279/504 (55.36%), Query Frame = 2
Query:  104 ARNLYDDL---FNKAHNYPKLLPVVNLETPVIVYMNLSLSQILEVNVKDQIIVLNVWVYQEWNDNRFSWDPSDYGGLTEIQIPSSMIWLPDLVLYNNAGGDWDLSGMSGSKVKVKHDGTIIWKPPVILKSQCEMDVTYFPFDIQTCPLKMGTWTHHGLLIDLRHWAQKVSDLSNERIKYDNCESKIDYAIDLTDYLQSYEWDLLSVTANRNIKKYP-CCPEP-YLDVTFHIKIRRMTLFYGLNLIFPCLSISFLTIMVFYLPTYSTQKITLCISVFLALNIFILVVFDLTPSTSRSVPLIVKYLLFTMFMVTFSIVASIAVLNFSFRQPETDKLSDNMKKIFLKTLPTYLKMRSVEFKENSEIPTSFGSTKSTNYADYSMYDLTWLKWNKGYTEMMNSKCGTAQNFSSAKRNLALESLRSIKYNLLLKTRHNEVRNEWMYMGIVIDRLFLIVFTVIVTLGSLIIFLMPPQLWSQQ--LVLN------SKDAAQMLANSNYTRLC 1576
            A  +Y+DL   +NK      + P+ N    V V    SL +I++V+  +Q++  N+W+  +W D R  WDP  +G + ++ +P   IW+PD++LYNNA G+  ++ MS + V   ++G ++WKPP I KS C +D+ YFP+D QTC +K G WT++G L+D+R    +   L     K   C     +A  ++ + +S EWDL+ + + R+ K Y  CC +  Y+D+TF I+IRR TLFY +NL+ PC   + LT +VFY+P     K+T  IS+ + L +F L++ DL P TS  +PLI KYLLFTMF+V+ SI+ S+  LNF  R   +  +   MK +F+ TLP Y+ +++ E  + S+  +S        + D       ++  N+       S+           RN+ ++++  I        + ++V  +W Y+  VIDR+FLI+F+++  +G+ +I L  P L+  +  L +N      S D  +   N N+T+L 
Sbjct:   25 ADQMYEDLLYYYNK-----NVRPIKNASESVKVKFGSSLIRIIDVDEVNQVLTTNLWLEMQWFDYRLMWDPGRWGKIRKLHVPVDQIWIPDILLYNNADGEPHITIMSDAIVY--YNGLVVWKPPSIYKSFCSIDIEYFPYDTQTCWMKFGGWTYNGFLLDVRQLPVEEWTLVVTTRKLQVCA----HASSISFFFRSLEWDLMELNSARHEKIYAGCCGQDFYIDITFKIEIRRKTLFYTINLMIPCTMFAILTSIVFYVPPIE-HKMTFSISILVTLTVFYLILIDLVPPTSLVIPLIGKYLLFTMFLVSISIMLSVISLNFYRRDGSSFPMPHWMKVVFIHTLPRYICIKTAEEDDGSDRGSSISDIGP--FMDSRRPSPFFITVNERQLNGRLSELKKKGMHPDLIRNM-IQNVEFIAEYFNSLKKEDKVSEDWSYVANVIDRIFLIIFSIMNVVGTWVILLNSPALFDNRTPLFINSVARPLSGDTFEHFINENFTQLA 513          
BLAST of Acetylcholine receptor subunit alpha-like vs. Ensembl Celegans
Match: acr-8 (AcetylCholine Receptor [Source:UniProtKB/TrEMBL;Acc:Q23355])

HSP 1 Score: 281.952 bits (720), Expect = 5.809e-88
Identity = 170/504 (33.73%), Postives = 279/504 (55.36%), Query Frame = 2
Query:  104 ARNLYDDL---FNKAHNYPKLLPVVNLETPVIVYMNLSLSQILEVNVKDQIIVLNVWVYQEWNDNRFSWDPSDYGGLTEIQIPSSMIWLPDLVLYNNAGGDWDLSGMSGSKVKVKHDGTIIWKPPVILKSQCEMDVTYFPFDIQTCPLKMGTWTHHGLLIDLRHWAQKVSDLSNERIKYDNCESKIDYAIDLTDYLQSYEWDLLSVTANRNIKKYP-CCPEP-YLDVTFHIKIRRMTLFYGLNLIFPCLSISFLTIMVFYLPTYSTQKITLCISVFLALNIFILVVFDLTPSTSRSVPLIVKYLLFTMFMVTFSIVASIAVLNFSFRQPETDKLSDNMKKIFLKTLPTYLKMRSVEFKENSEIPTSFGSTKSTNYADYSMYDLTWLKWNKGYTEMMNSKCGTAQNFSSAKRNLALESLRSIKYNLLLKTRHNEVRNEWMYMGIVIDRLFLIVFTVIVTLGSLIIFLMPPQLWSQQ--LVLN------SKDAAQMLANSNYTRLC 1576
            A  +Y+DL   +NK      + P+ N    V V    SL +I++V+  +Q++  N+W+  +W D R  WDP  +G + ++ +P   IW+PD++LYNNA G+  ++ MS + V   ++G ++WKPP I KS C +D+ YFP+D QTC +K G WT++G L+D+R    +   L     K   C     +A  ++ + +S EWDL+ + + R+ K Y  CC +  Y+D+TF I+IRR TLFY +NL+ PC   + LT +VFY+P     K+T  IS+ + L +F L++ DL P TS  +PLI KYLLFTMF+V+ SI+ S+  LNF  R   +  +   MK +F+ TLP Y+ +++ E  + S+  +S        + D       ++  N+       S+           RN+ ++++  I        + ++V  +W Y+  VIDR+FLI+F+++  +G+ +I L  P L+  +  L +N      S D  +   N N+T+L 
Sbjct:   25 ADQMYEDLLYYYNK-----NVRPIKNASESVKVKFGSSLIRIIDVDEVNQVLTTNLWLEMQWFDYRLMWDPGRWGKIRKLHVPVDQIWIPDILLYNNADGEPHITIMSDAIVY--YNGLVVWKPPSIYKSFCSIDIEYFPYDTQTCWMKFGGWTYNGFLLDVRQLPVEEWTLVVTTRKLQVCA----HASSISFFFRSLEWDLMELNSARHEKIYAGCCGQDFYIDITFKIEIRRKTLFYTINLMIPCTMFAILTSIVFYVPPIE-HKMTFSISILVTLTVFYLILIDLVPPTSLVIPLIGKYLLFTMFLVSISIMLSVISLNFYRRDGSSFPMPHWMKVVFIHTLPRYICIKTAEEDDGSDRGSSISDIGP--FMDSRRPSPFFITVNERQLNGRLSELKKKGMHPDLIRNM-IQNVEFIAEYFNSLKKEDKVSEDWSYVANVIDRIFLIIFSIMNVVGTWVILLNSPALFDNRTPLFINSVARPLSGDTFEHFINENFTQLA 513          
BLAST of Acetylcholine receptor subunit alpha-like vs. Ensembl Fly
Match: nAChRalpha4 (gene:FBgn0266347 transcript:FBtr0332872)

HSP 1 Score: 350.132 bits (897), Expect = 8.758e-115
Identity = 190/491 (38.70%), Postives = 296/491 (60.29%), Query Frame = 2
Query:  104 ARNLYDDLFNKAHNYPKLL-PVVNLETPVIVYMNLSLSQILEVNVKDQIIVLNVWVYQEWNDNRFSWDPSDYGGLTEIQIPSSMIWLPDLVLYNNAGGDWDLSGMSGSKVKVKHDGTIIWKPPVILKSQCEMDVTYFPFDIQTCPLKMGTWTHHGLLIDLRHWAQKVSDLSNERIKYDNCESKIDYAIDLTDYLQSYEWDLLSVTANRNIKKYPCCPEPYLDVTFHIKIRRMTLFYGLNLIFPCLSISFLTIMVFYLPTYSTQKITLCISVFLALNIFILVVFDLTPSTSRSVPLIVKYLLFTMFMVTFSIVASIAVLNFSFRQPETDKLSDNMKKIFLKTLPTYLKMRSVEFKENSEIPTSFGSTKSTNYADYSMYDLTWLKWNK--GYTEM------MNSKCGTAQNFSSAKR----NLALESLRSIKYNLLLKTRHNEVRNEWMYMGIVIDRLFLIVFTVIVTLGSLIIFLMPPQLWSQQL-VLNSKD 1534
            A+ LYDDL +   NY KL+ PVVN    + V + L LSQ+++VN+K+QI+  N+WV Q W D +  W+P +YGG+  + +PS  IW PD+VLYNNA G+++++    +K  +  +G + WKPP I KS CE+DV YFPFD QTC LK G+WT+ G  +DLRH  ++               + +   +DL+++  S EWD+L V A RN K Y CC EPYLD+TF+I +RR TLFY +N+I PC+ ISFLT++ FYLP+ S +K+TL IS+ ++L++F L+V ++ P TS  VPL+ KYL+F M +V+ SI  ++ VLN  FR P+T K++  +K++F+  LP +L ++   +   + I T+ G    +      +  LT    ++     +M      M S       FS +K     + +   +R I  +  ++    +V+ +W Y+ +V+DRLFL +FT+ V +G+  I L  P L+  ++ ++  KD
Sbjct:   12 AKRLYDDLLS---NYNKLVRPVVNTTDVLKVCIKLKLSQLIDVNLKNQIMTTNLWVEQSWYDYKLRWEPKEYGGVHMLHVPSDHIWRPDIVLYNNADGNFEVT--LATKATIYSEGLVEWKPPAIYKSSCEIDVEYFPFDEQTCVLKFGSWTYDGFKVDLRHMDEQ------------QGSNVVAVGVDLSEFYMSVEWDILEVPAVRNEKFYTCCDEPYLDITFNITMRRKTLFYTVNIIIPCMGISFLTVLTFYLPSDSGEKVTLSISILISLHVFFLLVVEIIPPTSLVVPLLGKYLIFAMILVSISICVTVVVLNVHFRSPQTHKMAPWVKRVFIDFLPAFLFIKRPTYNFETSI-TANGPFGGSCQVHGPVPPLTHCSSDEIAAVPDMDIGPLGMKSPILNNPAFSHSKCLPKIHKSCFCVRFIAEHTKMQEDSTKVKEDWKYVAMVLDRLFLWIFTLAVVVGTAGIILQAPTLYDDRIPIIEQKD 484          
BLAST of Acetylcholine receptor subunit alpha-like vs. Ensembl Fly
Match: nAChRalpha1 (gene:FBgn0000036 transcript:FBtr0334916)

HSP 1 Score: 350.903 bits (899), Expect = 3.846e-114
Identity = 176/365 (48.22%), Postives = 247/365 (67.67%), Query Frame = 2
Query:   50 FLLSFVAIKICVTT-AYSAARNLYDDLFNKAHNYPKLL-PVVNLETPVIVYMNLSLSQILEVNVKDQIIVLNVWVYQEWNDNRFSWDPSDYGGLTEIQIPSSMIWLPDLVLYNNAGGDWDLSGMSGSKVKVKHDGTIIWKPPVILKSQCEMDVTYFPFDIQTCPLKMGTWTHHGLLIDLRHWAQKVSDLSNERIKYDNCESKIDYAIDLTDYLQSYEWDLLSVTANRNIKKYPCCPEPYLDVTFHIKIRRMTLFYGLNLIFPCLSISFLTIMVFYLPTYSTQKITLCISVFLALNIFILVVFDLTPSTSRSVPLIVKYLLFTMFMVTFSIVASIAVLNFSFRQPETDKLSDNMKKIFLKTLPTYL 1138
            F   F+A+       A   A+ LYDDL +   NY +L+ PV N    + V M L LSQ+++VN+K+QI+  NVWV QEWND +  W+P DYGG+  + +PS  IWLPD+VLYNNA G+++++ M+  K  + H G ++WKPP I KS CE+DV YFPFD QTC +K G+WT+ G ++DLRH  Q            DN    I+  IDL DY  S EWD++ V A RN K Y CC EPYLD+ F++ +RR TLFY +NLI PC+ ISFL+++VFYLP+ S +KI+LCIS+ L+L +F L++ ++ P TS +VPL+ KYLLFTM +VT S+V +IAVLN +FR P T +++  ++++F++ LP  L
Sbjct:    6 FAAVFIALHFATGGLANPDAKRLYDDLLS---NYNRLIRPVGNNSDRLTVKMGLRLSQLIDVNLKNQIMTTNVWVEQEWNDYKLKWNPDDYGGVDTLHVPSEHIWLPDIVLYNNADGNYEVTIMT--KAILHHTGKVVWKPPAIYKSFCEIDVEYFPFDEQTCFMKFGSWTYDGYMVDLRHLKQTADS--------DN----IEVGIDLQDYYISVEWDIMRVPAVRNEKFYSCCEEPYLDIVFNLTLRRKTLFYTVNLIIPCVGISFLSVLVFYLPSDSGEKISLCISILLSLTVFFLLLAEIIPPTSLTVPLLGKYLLFTMMLVTLSVVVTIAVLNVNFRSPVTHRMAPWVQRLFIQILPKLL 353          
BLAST of Acetylcholine receptor subunit alpha-like vs. Ensembl Fly
Match: nAChRalpha1 (gene:FBgn0000036 transcript:FBtr0084619)

HSP 1 Score: 350.903 bits (899), Expect = 3.846e-114
Identity = 176/365 (48.22%), Postives = 247/365 (67.67%), Query Frame = 2
Query:   50 FLLSFVAIKICVTT-AYSAARNLYDDLFNKAHNYPKLL-PVVNLETPVIVYMNLSLSQILEVNVKDQIIVLNVWVYQEWNDNRFSWDPSDYGGLTEIQIPSSMIWLPDLVLYNNAGGDWDLSGMSGSKVKVKHDGTIIWKPPVILKSQCEMDVTYFPFDIQTCPLKMGTWTHHGLLIDLRHWAQKVSDLSNERIKYDNCESKIDYAIDLTDYLQSYEWDLLSVTANRNIKKYPCCPEPYLDVTFHIKIRRMTLFYGLNLIFPCLSISFLTIMVFYLPTYSTQKITLCISVFLALNIFILVVFDLTPSTSRSVPLIVKYLLFTMFMVTFSIVASIAVLNFSFRQPETDKLSDNMKKIFLKTLPTYL 1138
            F   F+A+       A   A+ LYDDL +   NY +L+ PV N    + V M L LSQ+++VN+K+QI+  NVWV QEWND +  W+P DYGG+  + +PS  IWLPD+VLYNNA G+++++ M+  K  + H G ++WKPP I KS CE+DV YFPFD QTC +K G+WT+ G ++DLRH  Q            DN    I+  IDL DY  S EWD++ V A RN K Y CC EPYLD+ F++ +RR TLFY +NLI PC+ ISFL+++VFYLP+ S +KI+LCIS+ L+L +F L++ ++ P TS +VPL+ KYLLFTM +VT S+V +IAVLN +FR P T +++  ++++F++ LP  L
Sbjct:    6 FAAVFIALHFATGGLANPDAKRLYDDLLS---NYNRLIRPVGNNSDRLTVKMGLRLSQLIDVNLKNQIMTTNVWVEQEWNDYKLKWNPDDYGGVDTLHVPSEHIWLPDIVLYNNADGNYEVTIMT--KAILHHTGKVVWKPPAIYKSFCEIDVEYFPFDEQTCFMKFGSWTYDGYMVDLRHLKQTADS--------DN----IEVGIDLQDYYISVEWDIMRVPAVRNEKFYSCCEEPYLDIVFNLTLRRKTLFYTVNLIIPCVGISFLSVLVFYLPSDSGEKISLCISILLSLTVFFLLLAEIIPPTSLTVPLLGKYLLFTMMLVTLSVVVTIAVLNVNFRSPVTHRMAPWVQRLFIQILPKLL 353          
BLAST of Acetylcholine receptor subunit alpha-like vs. Ensembl Fly
Match: nAChRalpha2 (gene:FBgn0000039 transcript:FBtr0084639)

HSP 1 Score: 350.517 bits (898), Expect = 7.908e-114
Identity = 169/353 (47.88%), Postives = 243/353 (68.84%), Query Frame = 2
Query:   92 AYSAARNLYDDLFNKAHNYPKLL-PVVNLETPVIVYMNLSLSQILEVNVKDQIIVLNVWVYQEWNDNRFSWDPSDYGGLTEIQIPSSMIWLPDLVLYNNAGGDWDLSGMSGSKVKVKHDGTIIWKPPVILKSQCEMDVTYFPFDIQTCPLKMGTWTHHGLLIDLRHWAQKVSDLSNERIKYDNCESKIDYAIDLTDYLQSYEWDLLSVTANRNIKKYPCCPEPYLDVTFHIKIRRMTLFYGLNLIFPCLSISFLTIMVFYLPTYSTQKITLCISVFLALNIFILVVFDLTPSTSRSVPLIVKYLLFTMFMVTFSIVASIAVLNFSFRQPETDKLSDNMKKIFLKTLPTYLKMR 1147
            A   A+ LYDDL +   NY +L+ PV N    V+V + L LSQ++++N+KDQI+  NVW+  EW D++F WDPS+YGG+TE+ +PS  IWLPD+VLYNNA G++ ++ M+  K  + + G ++W PP I KS CE+DV YFPFD QTC +K G+WT+ G  IDL+H +QK           ++ ++K++  IDL +Y  S EWD+L V A R+ K YPCC EPY D+ F+I +RR TLFY +NLI PC+ IS+L+++VFYLP  S +KI LCIS+ L+  +F L++ ++ PSTS ++PL+ KYLLFTM +V  S+V +I +LN  +R+P T K+   ++  F+K LP  L MR
Sbjct:   41 ANPDAKRLYDDLLS---NYNRLIRPVSNNTDTVLVKLGLRLSQLIDLNLKDQILTTNVWLEHEWQDHKFKWDPSEYGGVTELYVPSEHIWLPDIVLYNNADGEYVVTTMT--KAILHYTGKVVWTPPAIFKSSCEIDVRYFPFDQQTCFMKFGSWTYDGDQIDLKHISQK-----------NDKDNKVEIGIDLREYYPSVEWDILGVPAERHEKYYPCCAEPYPDIFFNITLRRKTLFYTVNLIIPCVGISYLSVLVFYLPADSGEKIALCISILLSQTMFFLLISEIIPSTSLALPLLGKYLLFTMLLVGLSVVITIIILNIHYRKPSTHKMRPWIRSFFIKRLPKLLLMR 377          
BLAST of Acetylcholine receptor subunit alpha-like vs. Ensembl Fly
Match: nAChRalpha2 (gene:FBgn0000039 transcript:FBtr0084640)

HSP 1 Score: 350.517 bits (898), Expect = 7.908e-114
Identity = 169/353 (47.88%), Postives = 243/353 (68.84%), Query Frame = 2
Query:   92 AYSAARNLYDDLFNKAHNYPKLL-PVVNLETPVIVYMNLSLSQILEVNVKDQIIVLNVWVYQEWNDNRFSWDPSDYGGLTEIQIPSSMIWLPDLVLYNNAGGDWDLSGMSGSKVKVKHDGTIIWKPPVILKSQCEMDVTYFPFDIQTCPLKMGTWTHHGLLIDLRHWAQKVSDLSNERIKYDNCESKIDYAIDLTDYLQSYEWDLLSVTANRNIKKYPCCPEPYLDVTFHIKIRRMTLFYGLNLIFPCLSISFLTIMVFYLPTYSTQKITLCISVFLALNIFILVVFDLTPSTSRSVPLIVKYLLFTMFMVTFSIVASIAVLNFSFRQPETDKLSDNMKKIFLKTLPTYLKMR 1147
            A   A+ LYDDL +   NY +L+ PV N    V+V + L LSQ++++N+KDQI+  NVW+  EW D++F WDPS+YGG+TE+ +PS  IWLPD+VLYNNA G++ ++ M+  K  + + G ++W PP I KS CE+DV YFPFD QTC +K G+WT+ G  IDL+H +QK           ++ ++K++  IDL +Y  S EWD+L V A R+ K YPCC EPY D+ F+I +RR TLFY +NLI PC+ IS+L+++VFYLP  S +KI LCIS+ L+  +F L++ ++ PSTS ++PL+ KYLLFTM +V  S+V +I +LN  +R+P T K+   ++  F+K LP  L MR
Sbjct:   41 ANPDAKRLYDDLLS---NYNRLIRPVSNNTDTVLVKLGLRLSQLIDLNLKDQILTTNVWLEHEWQDHKFKWDPSEYGGVTELYVPSEHIWLPDIVLYNNADGEYVVTTMT--KAILHYTGKVVWTPPAIFKSSCEIDVRYFPFDQQTCFMKFGSWTYDGDQIDLKHISQK-----------NDKDNKVEIGIDLREYYPSVEWDILGVPAERHEKYYPCCAEPYPDIFFNITLRRKTLFYTVNLIIPCVGISYLSVLVFYLPADSGEKIALCISILLSQTMFFLLISEIIPSTSLALPLLGKYLLFTMLLVGLSVVITIIILNIHYRKPSTHKMRPWIRSFFIKRLPKLLLMR 377          
BLAST of Acetylcholine receptor subunit alpha-like vs. Ensembl Zebrafish
Match: chrna3 (cholinergic receptor, nicotinic, alpha 3 [Source:ZFIN;Acc:ZDB-GENE-070822-1])

HSP 1 Score: 320.472 bits (820), Expect = 1.430e-102
Identity = 184/516 (35.66%), Postives = 286/516 (55.43%), Query Frame = 2
Query:   56 LSFVAIKICVTTAYSAARNLYDDLFNKAHNYPKLLPVVNLETPVIVYMNLSLSQILEVNVKDQIIVLNVWVYQEWNDNRFSWDPSDYGGLTEIQIPSSMIWLPDLVLYNNAGGDWDLSGMSGSKVKVKHDGTIIWKPPVILKSQCEMDVTYFPFDIQTCPLKMGTWTHHGLLIDLRHWAQKVSDLSNERIKYDNCESKIDYAIDLTDYLQSYEWDLLSVTANRNIKKYPCCPEPYLDVTFHIKIRRMTLFYGLNLIFPCLSISFLTIMVFYLPTYSTQKITLCISVFLALNIFILVVFDLTPSTSRSVPLIVKYLLFTMFMVTFSIVASIAVLNFSFRQPETDKLSDNMKKIFLKTLPTYLKMRSVEFKENSEIPTSFG------STKSTNYADYSMYDLTWLK----------------WNKGYTEMMN-------SKCGTAQNFS--------SAKRNLALESLRSIKYNLLLKTRHNEVRNEWMYMGIVIDRLFLIVFTVIVTLGSLIIFLMP 1492
            L F+   +C +    A   L+  +F+  + Y  + PV N+  PV+V   +S+SQ+++V+  +QI+  N+W+   WND +  WDP D+GG+  I++PS+ IW PD+VLYNNA GD+ +     +K  ++ +G + W PP I KS C++DVTYFPFD Q C +K G+WT+    IDL                       I   I+L D+ +S EW ++     ++  KY CC E Y D+T+ + IRR+ LFY +N+I PCL ISFLT++VFYLP+   +K+TLCISV L+L +F+LV+ +  PSTS  +PLI +YLLFTM  VT SIV ++ VLN  +R P+T  +   ++++FL  LP  + M   E  ++ E+P          S+K T+        L   +                W K  + M +       S C ++++          S +   A+ES++ I  N+ L+    EV+++W Y+ +VIDR+FL VF ++  LG+  +FL P
Sbjct:   51 LCFLLSGVCCS---EAEHRLFSVIFSSYNQY--IRPVENVSDPVVVQFEVSMSQLVKVDEVNQIMETNLWLRHIWNDYKLRWDPKDFGGVEFIRVPSNKIWKPDIVLYNNAVGDFQVD--DKTKALLRFNGDVTWIPPAIFKSSCKIDVTYFPFDYQNCTMKFGSWTYDKAKIDL---------------------VLIGSTINLKDFWESGEWTIIDAPGYKHDIKYNCCEEIYTDITYSLYIRRLPLFYTINMIIPCLLISFLTVLVFYLPSDCGEKVTLCISVLLSLTVFLLVITETIPSTSLVIPLIGEYLLFTMIFVTLSIVITVFVLNVHYRTPKTHTMPCWVRRVFLSLLPRVMFMTRPE--KDQEVPAKQCSVHPPVSSKQTSVCRGPQLLLCPTELNEASRTAFLCREHHCWKKHISNMTSEGAEDGGSPCSSSESLDGFLCMSAVSPQVREAIESVKYIAENMRLQNEAKEVQDDWKYVAMVIDRIFLWVFVLVCILGTAGLFLQP 536          
BLAST of Acetylcholine receptor subunit alpha-like vs. Ensembl Zebrafish
Match: chrna6 (cholinergic receptor, nicotinic, alpha 6 [Source:ZFIN;Acc:ZDB-GENE-090312-91])

HSP 1 Score: 313.923 bits (803), Expect = 1.607e-100
Identity = 182/486 (37.45%), Postives = 267/486 (54.94%), Query Frame = 2
Query:  161 PVVNLETPVIVYMNLSLSQILEVNVKDQIIVLNVWVYQEWNDNRFSWDPSDYGGLTEIQIPSSMIWLPDLVLYNNAGGDWDLSGMSGSKVKVKHDGTIIWKPPVILKSQCEMDVTYFPFDIQTCPLKMGTWTHHGLLIDLRHWAQKVSDLSNERIKYDNCESKIDYAIDLTDYLQSYEWDLLSVTANRNIKKYPCCPEPYLDVTFHIKIRRMTLFYGLNLIFPCLSISFLTIMVFYLPTYSTQKITLCISVFLALNIFILVVFDLTPSTSRSVPLIVKYLLFTMFMVTFSIVASIAVLNFSFRQPETDKLSDNMKKIFLKTLPTYLKMRS-VEFKENS---------------EIPTSFGSTKSTNYADYSMYDLTW------LKWNKG------YTEMMNSKCG------------TAQNFS--SAKRNLALESLRSIKYNLLLKTRHNEVRNEWMYMGIVIDRLFLIVFTVIVTLGSLIIFLMP 1492
            PV N+  PV V   +S+SQ+++V+  +QI+  N+W+   WND +  W P+++ G+  I++PS+ IW PD+VLYNNA GD+ +     +K  +K DGTI W PP I KS C MD+TYFPFD Q C +K G+WT+    IDL     KV                     +L D+ +S EW+++     ++  KY CC E Y D+T+   IRR+ LFY +NLI PCL ISFLT++VFYLP+   +K+TLCISV L+L +F+LV+ +  PSTS  +PLI +YLLFTM  VT SIV ++ VLN  +R P T  +   ++ +FL+ LP  + MR  ++  E+S                        K++     +M  L +      L+  KG        E     CG            T   FS  S +   A+ES++ I  N+  + +  EV ++W Y+ +VIDR+FL VF ++  LG+L +FL P
Sbjct:   30 PVENVSDPVTVEFEVSISQLVKVDEVNQIMETNLWLRHIWNDYKLKWSPAEFDGIEFIRVPSNKIWRPDIVLYNNAVGDFLVE--DKTKALLKFDGTITWVPPAIFKSSCPMDITYFPFDYQNCSMKFGSWTYDKAKIDLVLIGSKV---------------------NLKDFWESGEWEIIDAPGYKHDIKYNCCEEIYPDITYSFYIRRLPLFYTINLIIPCLLISFLTVLVFYLPSDCGEKVTLCISVLLSLTVFLLVITETIPSTSLVIPLIGEYLLFTMIFVTLSIVITVFVLNVHYRTPMTHTMPSWVRTVFLRALPRIMLMRRPLDLSESSGKGGLETGGSSGTGAGRGGEGKKRKNSGSQQGAMNSLEFGEGKAALEGKKGGCPCHPLKEATEGDCGKVSRQLSPQAINTVVAFSVVSPEIKQAIESVKYIAENMRSRNKAKEVEDDWKYVAMVIDRIFLWVFVLVCVLGTLGLFLQP 492          
BLAST of Acetylcholine receptor subunit alpha-like vs. Ensembl Zebrafish
Match: chrna6 (cholinergic receptor, nicotinic, alpha 6 [Source:ZFIN;Acc:ZDB-GENE-090312-91])

HSP 1 Score: 314.309 bits (804), Expect = 1.708e-100
Identity = 182/486 (37.45%), Postives = 267/486 (54.94%), Query Frame = 2
Query:  161 PVVNLETPVIVYMNLSLSQILEVNVKDQIIVLNVWVYQEWNDNRFSWDPSDYGGLTEIQIPSSMIWLPDLVLYNNAGGDWDLSGMSGSKVKVKHDGTIIWKPPVILKSQCEMDVTYFPFDIQTCPLKMGTWTHHGLLIDLRHWAQKVSDLSNERIKYDNCESKIDYAIDLTDYLQSYEWDLLSVTANRNIKKYPCCPEPYLDVTFHIKIRRMTLFYGLNLIFPCLSISFLTIMVFYLPTYSTQKITLCISVFLALNIFILVVFDLTPSTSRSVPLIVKYLLFTMFMVTFSIVASIAVLNFSFRQPETDKLSDNMKKIFLKTLPTYLKMRS-VEFKENS---------------EIPTSFGSTKSTNYADYSMYDLTW------LKWNKG------YTEMMNSKCG------------TAQNFS--SAKRNLALESLRSIKYNLLLKTRHNEVRNEWMYMGIVIDRLFLIVFTVIVTLGSLIIFLMP 1492
            PV N+  PV V   +S+SQ+++V+  +QI+  N+W+   WND +  W P+++ G+  I++PS+ IW PD+VLYNNA GD+ +     +K  +K DGTI W PP I KS C MD+TYFPFD Q C +K G+WT+    IDL     KV                     +L D+ +S EW+++     ++  KY CC E Y D+T+   IRR+ LFY +NLI PCL ISFLT++VFYLP+   +K+TLCISV L+L +F+LV+ +  PSTS  +PLI +YLLFTM  VT SIV ++ VLN  +R P T  +   ++ +FL+ LP  + MR  ++  E+S                        K++     +M  L +      L+  KG        E     CG            T   FS  S +   A+ES++ I  N+  + +  EV ++W Y+ +VIDR+FL VF ++  LG+L +FL P
Sbjct:   44 PVENVSDPVTVEFEVSISQLVKVDEVNQIMETNLWLRHIWNDYKLKWSPAEFDGIEFIRVPSNKIWRPDIVLYNNAVGDFLVE--DKTKALLKFDGTITWVPPAIFKSSCPMDITYFPFDYQNCSMKFGSWTYDKAKIDLVLIGSKV---------------------NLKDFWESGEWEIIDAPGYKHDIKYNCCEEIYPDITYSFYIRRLPLFYTINLIIPCLLISFLTVLVFYLPSDCGEKVTLCISVLLSLTVFLLVITETIPSTSLVIPLIGEYLLFTMIFVTLSIVITVFVLNVHYRTPMTHTMPSWVRTVFLRALPRIMLMRRPLDLSESSGKGGLETGGSSGTGAGRGGEGKKRKNSGSQQGAMNSLEFGEGKAALEGKKGGCPCHPLKEATEGDCGKVSRQLSPQAINTVVAFSVVSPEIKQAIESVKYIAENMRSRNKAKEVEDDWKYVAMVIDRIFLWVFVLVCVLGTLGLFLQP 506          
BLAST of Acetylcholine receptor subunit alpha-like vs. Ensembl Zebrafish
Match: chrna2a (cholinergic receptor, nicotinic, alpha 2a (neuronal) [Source:ZFIN;Acc:ZDB-GENE-040108-2])

HSP 1 Score: 308.531 bits (789), Expect = 2.915e-98
Identity = 181/504 (35.91%), Postives = 280/504 (55.56%), Query Frame = 2
Query:  101 AARNLYDDLFNKAHNYPKLLPVVNLETPVIVYMNLSLSQILEVNVKDQIIVLNVWVYQEWNDNRFSWDPSDYGGLTEIQIPSSMIWLPDLVLYNNAGGDWDLSGMSGSKVKVKHDGTIIWKPPVILKSQCEMDVTYFPFDIQTCPLKMGTWTHHGLLIDLRHWAQKVSDLSNERIKYDNCESKIDYAIDLTDYLQSYEWDLLSVTANRNIKKYPCCPEPYLDVTFHIKIRRMTLFYGLNLIFPCLSISFLTIMVFYLPTYSTQKITLCISVFLALNIFILVVFDLTPSTSRSVPLIVKYLLFTMFMVTFSIVASIAVLNFSFRQPETDKLSDNMKKIFLKTLPTYLKMRSVEFKENSEIPTSFGSTKSTNYADYSMYDLTW--LKWNKGYTEMMNSKCGTAQNFSSAKRNL--------------------------------------ALESLRSIKYNLLLKTRHNEVRNEWMYMGIVIDRLFLIVFTVIVTLGSLIIFLMP 1492
            A   L+  LF   + + +  PV N+   VIV   LS++Q+++V+ K+Q++  NVW+ QEWND +  W+PS++  +T I++PS MIW+PD+VLYNNA G++ ++ M+  K  + H G + W PP I KS C +DVT+FPFD Q C +K G+WT+    IDL                      +I+  +DL DY +S EW +++     N KKY CC E Y D+T+   IRR+ LFY +NLI PCL IS LT++VFYLP+   +KITLCISV L+L +F+L++ ++ PSTS  +PLI +YLLFTM  VT SIV ++ VLN   R P T  +   +  +FL  +P +L MR  E ++  +   +  ++KS    +  +  L    +++  G +  ++S   T+ + S ++  L                                      ALE +R I  +L  +     V+ +W Y+ +VIDR+FL +F ++  LG++ +FL P
Sbjct:   36 AEDKLFHKLFIGYNKWSR--PVRNISDVVIVKFGLSIAQLIDVDEKNQMMTTNVWLKQEWNDYKLRWNPSEFDNVTSIRVPSEMIWVPDIVLYNNADGEFAVTHMT--KAHLFHTGKVSWVPPAIYKSSCSIDVTFFPFDQQNCKMKFGSWTYDKAKIDLE---------------------QIEGTVDLKDYWESGEWAIINAVGTYNTKKYDCCHEIYPDITYFFIIRRLPLFYTINLIIPCLLISCLTVLVFYLPSDCGEKITLCISVLLSLTVFLLLITEIIPSTSLVIPLIGEYLLFTMIFVTLSIVITVFVLNVHHRSPSTHSMPRWVHSVFLDHIPRWLFMRRPEPEKKPKKTANLSTSKSWFQQETGVDGLVCQDMEFGIGLSTSISSPSATSLHLSDSEPLLQKYELQHLGHVVNLCQHPAKLGNLVSEPGLLFSPCVLRALEGVRYIADHLRAEDEDFSVKEDWKYVAMVIDRIFLWMFIIVCLLGTIGLFLPP 514          
BLAST of Acetylcholine receptor subunit alpha-like vs. Ensembl Zebrafish
Match: chrna2b (cholinergic receptor, nicotinic, alpha 2b (neuronal) [Source:ZFIN;Acc:ZDB-GENE-041001-99])

HSP 1 Score: 305.449 bits (781), Expect = 1.199e-96
Identity = 191/547 (34.92%), Postives = 280/547 (51.19%), Query Frame = 2
Query:   68 AIKICVTTAYSAARNLYDDLFNKAHNYPKLLPVVNLETPVIVYMNLSLSQILEVNVKDQIIVLNVWVYQEWNDNRFSWDPSDYGGLTEIQIPSSMIWLPDLVLYNNAGGDWDLSGMSGSKVKVKHDGTIIWKPPVILKSQCEMDVTYFPFDIQTCPLKMGTWTHHGLLIDLRHWAQKVSDLSNERIKYDNCESKIDYAIDLTDYLQSYEWDLLSVTANRNIKKYPCCPEPYLDVTFHIKIRRMTLFYGLNLIFPCLSISFLTIMVFYLPTYSTQKITLCISVFLALNIFILVVFDLTPSTSRSVPLIVKYLLFTMFMVTFSIVASIAVLNFSFRQPETDKLSDNMKKIFLKTLPTYLKMRS---------------------VEFKENSEIPTSF--------GSTKSTNYADYSMYDLTWLKWNKGYTEMMNSKC--------------------GTAQNFSSAKRNL-----------------------ALESLRSIKYNLLLKTRHNEVRNEWMYMGIVIDRLFLIVFTVIVTLGSLIIFLMP 1492
            +I  C  T   A   L+  LF+  + + +  PV N    VIV   LS++Q+++V+ K+Q++  NVW+ QEWND +  W PSDY  +T I++PS +IW+PD+VLYNNA G++ ++ M+  K  + H G + W PP I KS C +DVT+FPFD Q C +K G+WT+    IDL                      +I+  +DL DY +S EW +++     N KKY CC E Y D+T+   IRR+ LFY +NLI PCL IS LT++VFYLP+   +KITLCISV L+L +F+L++ ++ PSTS  +PLI +YLLFTM  VT SIV ++ VLN   R P T K+   +  +FL  +P +L MR                           N+ + TS         G  +S  +  Y   +L  L      +   +S C                    GTA    S + N+                       ALE +  I  +L  +     V+ +W Y+ +VIDR+FL +F ++  LG++ +FL P
Sbjct:   23 SISCCEKTHSHAEDELFKKLFDGYNKWSR--PVPNTSDVVIVKFGLSIAQLIDVDEKNQMMTTNVWLKQEWNDYKLRWKPSDYDNVTSIRVPSELIWVPDIVLYNNADGEFAVTHMT--KAHLFHTGKVRWVPPAIYKSSCSIDVTFFPFDQQNCKMKFGSWTYDKAKIDLE---------------------RIENTVDLKDYWESGEWAIINAVGTYNTKKYDCCHEIYPDITYFFIIRRLPLFYTINLIIPCLLISCLTVLVFYLPSDCGEKITLCISVLLSLTVFLLLITEIIPSTSLVIPLIGEYLLFTMIFVTLSIVITVFVLNVHHRSPSTHKMPCWVHSVFLDLIPRWLFMRRPAPDSRRRQKLLLLQRQVPGMTARPANASLSTSTSWFRGQNSGEDESCRHFSYKDLELGTLSSAISLSLQASSPCPLGLTPPPLQKFGPAPRLEVGTASRQLSGRANVTKRLDNMIPHDNPGFPLSPSVLQALEGVHYIADHLRAEDADFSVKEDWKYVAMVIDRIFLWMFIIVCLLGTIGLFLPP 544          
BLAST of Acetylcholine receptor subunit alpha-like vs. Ensembl Xenopus
Match: mppe1 (metallophosphoesterase 1 [Source:Xenbase;Acc:XB-GENE-987928])

HSP 1 Score: 315.849 bits (808), Expect = 3.611e-101
Identity = 186/510 (36.47%), Postives = 283/510 (55.49%), Query Frame = 2
Query:   23 YSMQILKFYFLLSFVAIKICVTTAYSAARNLYDDLFNKAHNYPKLLPVVNLETPVIVYMNLSLSQILEVNVKDQIIVLNVWVYQEWNDNRFSWDPSDYGGLTEIQIPSSMIWLPDLVLYNNAGGDWDLSGMSGSKVKVKHDGTIIWKPPVILKSQCEMDVTYFPFDIQTCPLKMGTWTHHGLLIDLRHWAQKVSDLSNERIKYDNCESKIDYAIDLTDYLQSYEWDLLSVTANRNIKKYPCCPEPYLDVTFHIKIRRMTLFYGLNLIFPCLSISFLTIMVFYLPTYSTQKITLCISVFLALNIFILVVFDLTPSTSRSVPLIVKYLLFTMFMVTFSIVASIAVLNFSFRQPETDKLSDNMKKIFLKTLPTYLKMRSVEFKENSEIPTSFGSTKSTN---------YADYSMY---------DLTWLKWNKGYT--EMMNSKCGTAQNFSSAKRNLALESLRSIKYNLLLKTRHNEVRNEWMYMGIVIDRLFLIVFTVIVTLGSLIIFLMP 1492
            Y +QI    FLL F    +           LY+DL  K++N P + PV+N+  PVI++  +S+SQ+++V+  +QI+  N+W+   WND +  W+PSDYGG+  ++IP+S IW PD+VLYNNA G + +     +K  V++ G + W PP I KS C++DVT+FPFD Q C LK G+WT+    I+L     K                     I+L ++ +S EW +++    ++  KY CC E Y D+T+ + IRR+ LFY + +I PCL IS LTI+VFYLP+   +K+TLC+SV L+L +F+LV+ ++ PSTS  +PLI +YLLFTM  VT SIV ++ VLN  +R P+T  +   +K+ FL  LP  + M   E +  +  P ++    S+          Y D S             T     +G +   M N    +    S   R  A+E +  I  N+  +    EV+++W Y+ +VIDR+FL VF ++  LG+  +FL P
Sbjct:    5 YELQIDSNCFLLGFFCSNV--------EHRLYEDLL-KSYN-PYIRPVMNVSDPVILHFEVSMSQLVKVDEVNQIMETNLWLRHLWNDYKLKWNPSDYGGIEFLRIPASQIWRPDIVLYNNAVGAFHVD--DKAKAVVRYSGDVTWIPPAIFKSSCKIDVTFFPFDYQNCSLKFGSWTYDKAKINLVMIGSK---------------------INLKEFWESGEWVIINAPGYKHEIKYNCCVEIYQDITYSLYIRRLPLFYTIYIIIPCLLISCLTILVFYLPSDCGEKVTLCMSVLLSLTVFLLVITEIIPSTSLVIPLIGEYLLFTMIFVTLSIVITVFVLNVHYRTPKTHTMPHWVKRFFLHLLPKVMFMTRPEKQPYALKPQAYLDISSSEIRSCQDQLFYQDSSCACGQLKRLYTSDTACNVTRGSSLESMYNLGLHSGSGLSPEIRE-AIEDVHFIAENMKAQDEAKEVQDDWKYVAMVIDRIFLWVFVLVCILGTAGLFLQP 480          
BLAST of Acetylcholine receptor subunit alpha-like vs. Ensembl Xenopus
Match: mppe1 (metallophosphoesterase 1 [Source:Xenbase;Acc:XB-GENE-987928])

HSP 1 Score: 314.309 bits (804), Expect = 9.368e-101
Identity = 184/510 (36.08%), Postives = 281/510 (55.10%), Query Frame = 2
Query:   23 YSMQILKFYFLLSFVAIKICVTTAYSAARNLYDDLFNKAHNYPKLLPVVNLETPVIVYMNLSLSQILEVNVKDQIIVLNVWVYQEWNDNRFSWDPSDYGGLTEIQIPSSMIWLPDLVLYNNAGGDWDLSGMSGSKVKVKHDGTIIWKPPVILKSQCEMDVTYFPFDIQTCPLKMGTWTHHGLLIDLRHWAQKVSDLSNERIKYDNCESKIDYAIDLTDYLQSYEWDLLSVTANRNIKKYPCCPEPYLDVTFHIKIRRMTLFYGLNLIFPCLSISFLTIMVFYLPTYSTQKITLCISVFLALNIFILVVFDLTPSTSRSVPLIVKYLLFTMFMVTFSIVASIAVLNFSFRQPETDKLSDNMKKIFLKTLPTYLKMRSVEFKENSEIPTSFGSTKSTN---------YAD-----------YSMYDLTWLKWNKGYTEMMNSKCGTAQNFSSAKRNLALESLRSIKYNLLLKTRHNEVRNEWMYMGIVIDRLFLIVFTVIVTLGSLIIFLMP 1492
            Y +QI    FLL F    +           LY+DL  K++N P + PV+N+  PVI++  +S+SQ+++V+  +QI+  N+W+   WND +  W+PSDYGG+  ++IP+S IW PD+VLYNNA G + +     +K  V++ G + W PP I KS C++DVT+FPFD Q C LK G+WT+    I+L     K                     I+L ++ +S EW +++    ++  KY CC E Y D+T+ + IRR+ LFY + +I PCL IS LTI+VFYLP+   +K+TLC+SV L+L +F+LV+ ++ PSTS  +PLI +YLLFTM  VT SIV ++ VLN  +R P+T  +   +K+ FL  LP  + M   E +  +  P ++    S+          Y D           Y+      +        M N    +    S   R  A+E +  I  N+  +    EV+++W Y+ +VIDR+FL VF ++  LG+  +FL P
Sbjct:    1 YLLQIDSNCFLLGFFCSNV--------EHRLYEDLL-KSYN-PYIRPVMNVSDPVILHFEVSMSQLVKVDEVNQIMETNLWLRHLWNDYKLKWNPSDYGGIEFLRIPASQIWRPDIVLYNNAVGAFHVD--DKAKAVVRYSGDVTWIPPAIFKSSCKIDVTFFPFDYQNCSLKFGSWTYDKAKINLVMIGSK---------------------INLKEFWESGEWVIINAPGYKHEIKYNCCVEIYQDITYSLYIRRLPLFYTIYIIIPCLLISCLTILVFYLPSDCGEKVTLCMSVLLSLTVFLLVITEIIPSTSLVIPLIGEYLLFTMIFVTLSIVITVFVLNVHYRTPKTHTMPHWVKRFFLHLLPKVMFMTRPEKQPYALKPQAYLDISSSEIRSCQDQLFYQDSSCACGQLKRLYTSDTACNVTRGSSLESMYNLGLHSGSGLSPEIRE-AIEDVHFIAENMKAQDEAKEVQDDWKYVAMVIDRIFLWVFVLVCILGTAGLFLQP 476          
BLAST of Acetylcholine receptor subunit alpha-like vs. Ensembl Xenopus
Match: mppe1 (metallophosphoesterase 1 [Source:Xenbase;Acc:XB-GENE-987928])

HSP 1 Score: 313.923 bits (803), Expect = 1.974e-100
Identity = 183/509 (35.95%), Postives = 281/509 (55.21%), Query Frame = 2
Query:   26 SMQILKFYFLLSFVAIKICVTTAYSAARNLYDDLFNKAHNYPKLLPVVNLETPVIVYMNLSLSQILEVNVKDQIIVLNVWVYQEWNDNRFSWDPSDYGGLTEIQIPSSMIWLPDLVLYNNAGGDWDLSGMSGSKVKVKHDGTIIWKPPVILKSQCEMDVTYFPFDIQTCPLKMGTWTHHGLLIDLRHWAQKVSDLSNERIKYDNCESKIDYAIDLTDYLQSYEWDLLSVTANRNIKKYPCCPEPYLDVTFHIKIRRMTLFYGLNLIFPCLSISFLTIMVFYLPTYSTQKITLCISVFLALNIFILVVFDLTPSTSRSVPLIVKYLLFTMFMVTFSIVASIAVLNFSFRQPETDKLSDNMKKIFLKTLPTYLKMRSVEFKENSEIPTSFGSTKSTN---------YAD-----------YSMYDLTWLKWNKGYTEMMNSKCGTAQNFSSAKRNLALESLRSIKYNLLLKTRHNEVRNEWMYMGIVIDRLFLIVFTVIVTLGSLIIFLMP 1492
            ++QI    FLL F    +           LY+DL  K++N P + PV+N+  PVI++  +S+SQ+++V+  +QI+  N+W+   WND +  W+PSDYGG+  ++IP+S IW PD+VLYNNA G + +     +K  V++ G + W PP I KS C++DVT+FPFD Q C LK G+WT+    I+L     K                     I+L ++ +S EW +++    ++  KY CC E Y D+T+ + IRR+ LFY + +I PCL IS LTI+VFYLP+   +K+TLC+SV L+L +F+LV+ ++ PSTS  +PLI +YLLFTM  VT SIV ++ VLN  +R P+T  +   +K+ FL  LP  + M   E +  +  P ++    S+          Y D           Y+      +        M N    +    S   R  A+E +  I  N+  +    EV+++W Y+ +VIDR+FL VF ++  LG+  +FL P
Sbjct:   13 TLQIDSNCFLLGFFCSNV--------EHRLYEDLL-KSYN-PYIRPVMNVSDPVILHFEVSMSQLVKVDEVNQIMETNLWLRHLWNDYKLKWNPSDYGGIEFLRIPASQIWRPDIVLYNNAVGAFHVD--DKAKAVVRYSGDVTWIPPAIFKSSCKIDVTFFPFDYQNCSLKFGSWTYDKAKINLVMIGSK---------------------INLKEFWESGEWVIINAPGYKHEIKYNCCVEIYQDITYSLYIRRLPLFYTIYIIIPCLLISCLTILVFYLPSDCGEKVTLCMSVLLSLTVFLLVITEIIPSTSLVIPLIGEYLLFTMIFVTLSIVITVFVLNVHYRTPKTHTMPHWVKRFFLHLLPKVMFMTRPEKQPYALKPQAYLDISSSEIRSCQDQLFYQDSSCACGQLKRLYTSDTACNVTRGSSLESMYNLGLHSGSGLSPEIRE-AIEDVHFIAENMKAQDEAKEVQDDWKYVAMVIDRIFLWVFVLVCILGTAGLFLQP 487          
BLAST of Acetylcholine receptor subunit alpha-like vs. Ensembl Xenopus
Match: mppe1 (metallophosphoesterase 1 [Source:Xenbase;Acc:XB-GENE-987928])

HSP 1 Score: 313.153 bits (801), Expect = 2.705e-100
Identity = 185/508 (36.42%), Postives = 282/508 (55.51%), Query Frame = 2
Query:   29 MQILKFYFLLSFVAIKICVTTAYSAARNLYDDLFNKAHNYPKLLPVVNLETPVIVYMNLSLSQILEVNVKDQIIVLNVWVYQEWNDNRFSWDPSDYGGLTEIQIPSSMIWLPDLVLYNNAGGDWDLSGMSGSKVKVKHDGTIIWKPPVILKSQCEMDVTYFPFDIQTCPLKMGTWTHHGLLIDLRHWAQKVSDLSNERIKYDNCESKIDYAIDLTDYLQSYEWDLLSVTANRNIKKYPCCPEPYLDVTFHIKIRRMTLFYGLNLIFPCLSISFLTIMVFYLPTYSTQKITLCISVFLALNIFILVVFDLTPSTSRSVPLIVKYLLFTMFMVTFSIVASIAVLNFSFRQPETDKLSDNMKKIFLKTLPTYLKMRSVEFKENSEIPTSFGSTKSTN---------YADYSMY---------DLTWLKWNKGYT--EMMNSKCGTAQNFSSAKRNLALESLRSIKYNLLLKTRHNEVRNEWMYMGIVIDRLFLIVFTVIVTLGSLIIFLMP 1492
            +QI    FLL F    +           LY+DL  K++N P + PV+N+  PVI++  +S+SQ+++V+  +QI+  N+W+   WND +  W+PSDYGG+  ++IP+S IW PD+VLYNNA G + +     +K  V++ G + W PP I KS C++DVT+FPFD Q C LK G+WT+    I+L     K                     I+L ++ +S EW +++    ++  KY CC E Y D+T+ + IRR+ LFY + +I PCL IS LTI+VFYLP+   +K+TLC+SV L+L +F+LV+ ++ PSTS  +PLI +YLLFTM  VT SIV ++ VLN  +R P+T  +   +K+ FL  LP  + M   E +  +  P ++    S+          Y D S             T     +G +   M N    +    S   R  A+E +  I  N+  +    EV+++W Y+ +VIDR+FL VF ++  LG+  +FL P
Sbjct:   11 LQIDSNCFLLGFFCSNV--------EHRLYEDLL-KSYN-PYIRPVMNVSDPVILHFEVSMSQLVKVDEVNQIMETNLWLRHLWNDYKLKWNPSDYGGIEFLRIPASQIWRPDIVLYNNAVGAFHVD--DKAKAVVRYSGDVTWIPPAIFKSSCKIDVTFFPFDYQNCSLKFGSWTYDKAKINLVMIGSK---------------------INLKEFWESGEWVIINAPGYKHEIKYNCCVEIYQDITYSLYIRRLPLFYTIYIIIPCLLISCLTILVFYLPSDCGEKVTLCMSVLLSLTVFLLVITEIIPSTSLVIPLIGEYLLFTMIFVTLSIVITVFVLNVHYRTPKTHTMPHWVKRFFLHLLPKVMFMTRPEKQPYALKPQAYLDISSSEIRSCQDQLFYQDSSCACGQLKRLYTSDTACNVTRGSSLESMYNLGLHSGSGLSPEIRE-AIEDVHFIAENMKAQDEAKEVQDDWKYVAMVIDRIFLWVFVLVCILGTAGLFLQP 484          
BLAST of Acetylcholine receptor subunit alpha-like vs. Ensembl Xenopus
Match: mppe1 (metallophosphoesterase 1 [Source:Xenbase;Acc:XB-GENE-987928])

HSP 1 Score: 312.768 bits (800), Expect = 3.529e-100
Identity = 183/508 (36.02%), Postives = 280/508 (55.12%), Query Frame = 2
Query:   29 MQILKFYFLLSFVAIKICVTTAYSAARNLYDDLFNKAHNYPKLLPVVNLETPVIVYMNLSLSQILEVNVKDQIIVLNVWVYQEWNDNRFSWDPSDYGGLTEIQIPSSMIWLPDLVLYNNAGGDWDLSGMSGSKVKVKHDGTIIWKPPVILKSQCEMDVTYFPFDIQTCPLKMGTWTHHGLLIDLRHWAQKVSDLSNERIKYDNCESKIDYAIDLTDYLQSYEWDLLSVTANRNIKKYPCCPEPYLDVTFHIKIRRMTLFYGLNLIFPCLSISFLTIMVFYLPTYSTQKITLCISVFLALNIFILVVFDLTPSTSRSVPLIVKYLLFTMFMVTFSIVASIAVLNFSFRQPETDKLSDNMKKIFLKTLPTYLKMRSVEFKENSEIPTSFGSTKSTN---------YAD-----------YSMYDLTWLKWNKGYTEMMNSKCGTAQNFSSAKRNLALESLRSIKYNLLLKTRHNEVRNEWMYMGIVIDRLFLIVFTVIVTLGSLIIFLMP 1492
            +QI    FLL F    +           LY+DL  K++N P + PV+N+  PVI++  +S+SQ+++V+  +QI+  N+W+   WND +  W+PSDYGG+  ++IP+S IW PD+VLYNNA G + +     +K  V++ G + W PP I KS C++DVT+FPFD Q C LK G+WT+    I+L     K                     I+L ++ +S EW +++    ++  KY CC E Y D+T+ + IRR+ LFY + +I PCL IS LTI+VFYLP+   +K+TLC+SV L+L +F+LV+ ++ PSTS  +PLI +YLLFTM  VT SIV ++ VLN  +R P+T  +   +K+ FL  LP  + M   E +  +  P ++    S+          Y D           Y+      +        M N    +    S   R  A+E +  I  N+  +    EV+++W Y+ +VIDR+FL VF ++  LG+  +FL P
Sbjct:    8 LQIDSNCFLLGFFCSNV--------EHRLYEDLL-KSYN-PYIRPVMNVSDPVILHFEVSMSQLVKVDEVNQIMETNLWLRHLWNDYKLKWNPSDYGGIEFLRIPASQIWRPDIVLYNNAVGAFHVD--DKAKAVVRYSGDVTWIPPAIFKSSCKIDVTFFPFDYQNCSLKFGSWTYDKAKINLVMIGSK---------------------INLKEFWESGEWVIINAPGYKHEIKYNCCVEIYQDITYSLYIRRLPLFYTIYIIIPCLLISCLTILVFYLPSDCGEKVTLCMSVLLSLTVFLLVITEIIPSTSLVIPLIGEYLLFTMIFVTLSIVITVFVLNVHYRTPKTHTMPHWVKRFFLHLLPKVMFMTRPEKQPYALKPQAYLDISSSEIRSCQDQLFYQDSSCACGQLKRLYTSDTACNVTRGSSLESMYNLGLHSGSGLSPEIRE-AIEDVHFIAENMKAQDEAKEVQDDWKYVAMVIDRIFLWVFVLVCILGTAGLFLQP 481          
BLAST of Acetylcholine receptor subunit alpha-like vs. Ensembl Mouse
Match: Chrna6 (cholinergic receptor, nicotinic, alpha polypeptide 6 [Source:MGI Symbol;Acc:MGI:106213])

HSP 1 Score: 327.791 bits (839), Expect = 5.689e-106
Identity = 177/493 (35.90%), Postives = 272/493 (55.17%), Query Frame = 2
Query:   86 TTAYSAARNLYDDLFNKAHNYPKLLPVVNLETPVIVYMNLSLSQILEVNVKDQIIVLNVWVYQEWNDNRFSWDPSDYGGLTEIQIPSSMIWLPDLVLYNNAGGDWDLSGMSGSKVKVKHDGTIIWKPPVILKSQCEMDVTYFPFDIQTCPLKMGTWTHHGLLIDLRHWAQKVSDLSNERIKYDNCESKIDYAIDLTDYLQSYEWDLLSVTANRNIKKYPCCPEPYLDVTFHIKIRRMTLFYGLNLIFPCLSISFLTIMVFYLPTYSTQKITLCISVFLALNIFILVVFDLTPSTSRSVPLIVKYLLFTMFMVTFSIVASIAVLNFSFRQPETDKLSDNMKKIFLKTLPTYLKMRSV--EFKENSEIPTSFGSTKSTNYADYSMYDLTWLKWNKGYTEMMNS--KCGTAQNFSSAKRNLA--------------------LESLRSIKYNLLLKTRHNEVRNEWMYMGIVIDRLFLIVFTVIVTLGSLIIFLMP 1492
            +T   +   L+  LF  AH    + PV N+  PV V+  L+++Q+  V+  +QI+  N+W+   W D R  WDP++Y G+  +++P+  IW PD+VLYNNA GD+ + G   +K  +K+DG I W PP I KS C MD+T+FPFD Q C LK G+WT+    IDL     KV                     D+ D+ ++ EW+++  +  ++  KY CC E Y D+T+   IRR+ +FY +NLI PCL ISFLT++VFYLP+   +K+TLCISV L+L +F+LV+ +  PSTS  +PL+ +YLLFTM  VT SIV ++ VLN  +R P T  +   +K IFL+  P+ L MR    + KE   +      TK      ++         ++G ++++     C  + + +  KR  +                    +ES++ I  N+      NEV ++W YM +V+DR+FL VF ++   G++ +FL P
Sbjct:   28 STGCESEEQLFHRLF--AHYNRFIRPVENVSDPVTVHFELAITQLANVDEVNQIMETNLWLRHIWKDYRLRWDPTEYDGIETLRVPADNIWKPDIVLYNNAVGDFQVEG--KTKALLKYDGVITWTPPAIFKSSCPMDITFFPFDHQNCSLKFGSWTYDKAEIDLLIIGSKV---------------------DMNDFWENSEWEIVDASGYKHDIKYNCCEEIYTDITYSFYIRRLPMFYTINLIIPCLFISFLTVLVFYLPSDCGEKVTLCISVLLSLTVFLLVITETIPSTSLVIPLVGEYLLFTMIFVTLSIVVTVFVLNIHYRTPATHTMPKWVKTIFLQAFPSILMMRKPLDKTKEAGGVKDPKSHTKRPAKVKFT---------HRGESKLLKECHHCQKSSDIAPGKRRSSQQPARWVAENSEHSSDVEDVIESVQFIAENMKSHNETNEVEDDWKYMAMVVDRVFLWVFIIVCVFGTVGLFLQP 486          
BLAST of Acetylcholine receptor subunit alpha-like vs. Ensembl Mouse
Match: Chrna3 (cholinergic receptor, nicotinic, alpha polypeptide 3 [Source:MGI Symbol;Acc:MGI:87887])

HSP 1 Score: 319.701 bits (818), Expect = 7.950e-103
Identity = 184/500 (36.80%), Postives = 280/500 (56.00%), Query Frame = 2
Query:   83 VTTAYSAARNLYDDLFNKAHNYPKLL-PVVNLETPVIVYMNLSLSQILEVNVKDQIIVLNVWVYQEWNDNRFSWDPSDYGGLTEIQIPSSMIWLPDLVLYNNAGGDWDLSGMSGSKVKVKHDGTIIWKPPVILKSQCEMDVTYFPFDIQTCPLKMGTWTHHGLLIDLRHWAQKVSDLSNERIKYDNCESKIDYAIDLTDYLQSYEWDLLSVTANRNIKKYPCCPEPYLDVTFHIKIRRMTLFYGLNLIFPCLSISFLTIMVFYLPTYSTQKITLCISVFLALNIFILVVFDLTPSTSRSVPLIVKYLLFTMFMVTFSIVASIAVLNFSFRQPETDKLSDNMKKIFLKTLPTYLKM-RSVEFKENSEIPTSFGSTKSTNYADYSMYDLTWLKWNKGYTEMMNSKCGTAQ-------NFS---------------------SAKRNLALESLRSIKYNLLLKTRHNEVRNEWMYMGIVIDRLFLIVFTVIVTLGSLIIFLMP 1492
            V +A  A   L+  LF    +Y +++ PV N+  PVI+   +S+SQ+++V+  +QI+  N+W+ Q WND +  W PSDY G+  +++P+  IW PD+VLYNNA GD+ +     +K  +K+ G + W PP I KS C++DVTYFPFD Q C +K G+W++    IDL                       I  +++L DY +S EW ++     ++  KY CC E Y D+T+ + IRR+ LFY +NLI PCL ISFLT++VFYLP+   +K+TLCISV L+L +F+LV+ +  PSTS  +PLI +YLLFTM  VT SIV ++ VLN  +R P T  +   +K +FL  LP  + M R    +E++    +F   + +N   +S  D    K  +GY    +  CG          NFS                     S +   A++S++ I  N+  +    E++++W Y+ +VIDR+FL VF ++  LG+  +FL P
Sbjct:   22 VASASEAEHRLFQYLF---EDYNEIIRPVANVSHPVIIQFEVSMSQLVKVDEVNQIMETNLWLKQIWNDYKLKWKPSDYQGVEFMRVPAEKIWKPDIVLYNNADGDFQVD--DKTKALLKYTGEVTWIPPAIFKSSCKIDVTYFPFDYQNCTMKFGSWSYDKAKIDL---------------------VLIGSSMNLKDYWESGEWAIIKAPGYKHEIKYNCCEEIYQDITYSLYIRRLPLFYTINLIIPCLLISFLTVLVFYLPSDCGEKVTLCISVLLSLTVFLLVITETIPSTSLVIPLIGEYLLFTMIFVTLSIVITVFVLNVHYRTPTTHTMPTWVKAVFLNLLPRVMFMTRPTSTEEDAPKTRNFYGAELSNLNCFSRADSKSCK--EGY-PCQDGTCGYCHHRRVKISNFSANLTRSSSSESVDAVLSLSALSPEIKEAIQSVKYIAENMKAQNVAKEIQDDWKYVAMVIDRIFLWVFILVCILGTAGLFLQP 492          
BLAST of Acetylcholine receptor subunit alpha-like vs. Ensembl Mouse
Match: Chrna3 (cholinergic receptor, nicotinic, alpha polypeptide 3 [Source:MGI Symbol;Acc:MGI:87887])

HSP 1 Score: 320.087 bits (819), Expect = 8.908e-103
Identity = 184/500 (36.80%), Postives = 280/500 (56.00%), Query Frame = 2
Query:   83 VTTAYSAARNLYDDLFNKAHNYPKLL-PVVNLETPVIVYMNLSLSQILEVNVKDQIIVLNVWVYQEWNDNRFSWDPSDYGGLTEIQIPSSMIWLPDLVLYNNAGGDWDLSGMSGSKVKVKHDGTIIWKPPVILKSQCEMDVTYFPFDIQTCPLKMGTWTHHGLLIDLRHWAQKVSDLSNERIKYDNCESKIDYAIDLTDYLQSYEWDLLSVTANRNIKKYPCCPEPYLDVTFHIKIRRMTLFYGLNLIFPCLSISFLTIMVFYLPTYSTQKITLCISVFLALNIFILVVFDLTPSTSRSVPLIVKYLLFTMFMVTFSIVASIAVLNFSFRQPETDKLSDNMKKIFLKTLPTYLKM-RSVEFKENSEIPTSFGSTKSTNYADYSMYDLTWLKWNKGYTEMMNSKCGTAQ-------NFS---------------------SAKRNLALESLRSIKYNLLLKTRHNEVRNEWMYMGIVIDRLFLIVFTVIVTLGSLIIFLMP 1492
            V +A  A   L+  LF    +Y +++ PV N+  PVI+   +S+SQ+++V+  +QI+  N+W+ Q WND +  W PSDY G+  +++P+  IW PD+VLYNNA GD+ +     +K  +K+ G + W PP I KS C++DVTYFPFD Q C +K G+W++    IDL                       I  +++L DY +S EW ++     ++  KY CC E Y D+T+ + IRR+ LFY +NLI PCL ISFLT++VFYLP+   +K+TLCISV L+L +F+LV+ +  PSTS  +PLI +YLLFTM  VT SIV ++ VLN  +R P T  +   +K +FL  LP  + M R    +E++    +F   + +N   +S  D    K  +GY    +  CG          NFS                     S +   A++S++ I  N+  +    E++++W Y+ +VIDR+FL VF ++  LG+  +FL P
Sbjct:   27 VASASEAEHRLFQYLF---EDYNEIIRPVANVSHPVIIQFEVSMSQLVKVDEVNQIMETNLWLKQIWNDYKLKWKPSDYQGVEFMRVPAEKIWKPDIVLYNNADGDFQVD--DKTKALLKYTGEVTWIPPAIFKSSCKIDVTYFPFDYQNCTMKFGSWSYDKAKIDL---------------------VLIGSSMNLKDYWESGEWAIIKAPGYKHEIKYNCCEEIYQDITYSLYIRRLPLFYTINLIIPCLLISFLTVLVFYLPSDCGEKVTLCISVLLSLTVFLLVITETIPSTSLVIPLIGEYLLFTMIFVTLSIVITVFVLNVHYRTPTTHTMPTWVKAVFLNLLPRVMFMTRPTSTEEDAPKTRNFYGAELSNLNCFSRADSKSCK--EGY-PCQDGTCGYCHHRRVKISNFSANLTRSSSSESVDAVLSLSALSPEIKEAIQSVKYIAENMKAQNVAKEIQDDWKYVAMVIDRIFLWVFILVCILGTAGLFLQP 497          
BLAST of Acetylcholine receptor subunit alpha-like vs. Ensembl Mouse
Match: Chrna2 (cholinergic receptor, nicotinic, alpha polypeptide 2 (neuronal) [Source:MGI Symbol;Acc:MGI:87886])

HSP 1 Score: 299.286 bits (765), Expect = 9.125e-95
Identity = 183/503 (36.38%), Postives = 273/503 (54.27%), Query Frame = 2
Query:  101 AARNLYDDLFNKAHNYPKLLPVVNLETPVIVYMNLSLSQILEVNVKDQIIVLNVWVYQEWNDNRFSWDPSDYGGLTEIQIPSSMIWLPDLVLYNNAGGDWDLSGMSGSKVKVKHDGTIIWKPPVILKSQCEMDVTYFPFDIQTCPLKMGTWTHHGLLIDLRHWAQKVSDLSNERIKYDNCESKIDYAIDLTDYLQSYEWDLLSVTANRNIKKYPCCPEPYLDVTFHIKIRRMTLFYGLNLIFPCLSISFLTIMVFYLPTYSTQKITLCISVFLALNIFILVVFDLTPSTSRSVPLIVKYLLFTMFMVTFSIVASIAVLNFSFRQPETDKLSDNMKKIFLKTLPTYLKMRSVEFKENSEIPTSFGSTKSTNY---------------------------------ADYSMYDLTWLKWNKG--YTEMMNSKCGTAQNFS----SAKRNLALESLRSIKYNLLLKTRHNEVRNEWMYMGIVIDRLFLIVFTVIVTLGSLIIFLMP 1492
            A   L+  LF   + + +  PV N    VIV   LS++Q+++V+ K+Q++  NVW+ QEWND +  WDP+++G +T +++PS MIW+PD+VLYNNA G++ ++ M+  K  +   GT+ W PP I KS C +DVT+FPFD Q C +K G+WT+    IDL                      +++  +DL DY +S EW +++ T   N KKY CC E Y DVT++  IRR+ LFY +NLI PCL IS LT++VFYLP+   +KITLCISV L+L +F+L++ ++ PSTS  +PLI +YLLFTM  VT SIV ++ VLN   R P T  + + ++   L  +P +L M         E+  S G   S  Y                                  D SM  L    +  G  +   M  +  T    S    S +   ALE +  I  +L  +   + V+ +W Y+ +V+DR+FL +F ++  LG++ +FL P
Sbjct:   35 AEDRLFKHLFGGYNRWAR--PVPNTSDVVIVRFGLSIAQLIDVDEKNQMMTTNVWLKQEWNDYKLRWDPAEFGNITSLRVPSEMIWIPDIVLYNNADGEFAVTHMT--KAHLFFTGTVHWVPPAIYKSSCSIDVTFFPFDQQNCKMKFGSWTYDKAKIDLE---------------------QMERTVDLKDYWESGEWAIINATGTYNSKKYDCCAEIYPDVTYYFVIRRLPLFYTINLIIPCLLISCLTVLVFYLPSECGEKITLCISVLLSLTVFLLLITEIIPSTSLVIPLIGEYLLFTMIFVTLSIVITVFVLNVHHRSPSTHNMPNWVRVALLGRVPRWLMMNRP--LPPMELHGSPGLKLSPTYHWLETNMDAEEREETEEEEEEEEDENICMCAGLPDSSMGVL----YGHGSLHLRAMGPEAKTPSQASEILLSPQIQKALEGVHYIADHLRSEDADSSVKEDWKYVAMVVDRIFLWLFIIVCFLGTIGLFLPP 506          
BLAST of Acetylcholine receptor subunit alpha-like vs. Ensembl Mouse
Match: Chrna2 (cholinergic receptor, nicotinic, alpha polypeptide 2 (neuronal) [Source:MGI Symbol;Acc:MGI:87886])

HSP 1 Score: 299.286 bits (765), Expect = 9.125e-95
Identity = 183/503 (36.38%), Postives = 273/503 (54.27%), Query Frame = 2
Query:  101 AARNLYDDLFNKAHNYPKLLPVVNLETPVIVYMNLSLSQILEVNVKDQIIVLNVWVYQEWNDNRFSWDPSDYGGLTEIQIPSSMIWLPDLVLYNNAGGDWDLSGMSGSKVKVKHDGTIIWKPPVILKSQCEMDVTYFPFDIQTCPLKMGTWTHHGLLIDLRHWAQKVSDLSNERIKYDNCESKIDYAIDLTDYLQSYEWDLLSVTANRNIKKYPCCPEPYLDVTFHIKIRRMTLFYGLNLIFPCLSISFLTIMVFYLPTYSTQKITLCISVFLALNIFILVVFDLTPSTSRSVPLIVKYLLFTMFMVTFSIVASIAVLNFSFRQPETDKLSDNMKKIFLKTLPTYLKMRSVEFKENSEIPTSFGSTKSTNY---------------------------------ADYSMYDLTWLKWNKG--YTEMMNSKCGTAQNFS----SAKRNLALESLRSIKYNLLLKTRHNEVRNEWMYMGIVIDRLFLIVFTVIVTLGSLIIFLMP 1492
            A   L+  LF   + + +  PV N    VIV   LS++Q+++V+ K+Q++  NVW+ QEWND +  WDP+++G +T +++PS MIW+PD+VLYNNA G++ ++ M+  K  +   GT+ W PP I KS C +DVT+FPFD Q C +K G+WT+    IDL                      +++  +DL DY +S EW +++ T   N KKY CC E Y DVT++  IRR+ LFY +NLI PCL IS LT++VFYLP+   +KITLCISV L+L +F+L++ ++ PSTS  +PLI +YLLFTM  VT SIV ++ VLN   R P T  + + ++   L  +P +L M         E+  S G   S  Y                                  D SM  L    +  G  +   M  +  T    S    S +   ALE +  I  +L  +   + V+ +W Y+ +V+DR+FL +F ++  LG++ +FL P
Sbjct:   35 AEDRLFKHLFGGYNRWAR--PVPNTSDVVIVRFGLSIAQLIDVDEKNQMMTTNVWLKQEWNDYKLRWDPAEFGNITSLRVPSEMIWIPDIVLYNNADGEFAVTHMT--KAHLFFTGTVHWVPPAIYKSSCSIDVTFFPFDQQNCKMKFGSWTYDKAKIDLE---------------------QMERTVDLKDYWESGEWAIINATGTYNSKKYDCCAEIYPDVTYYFVIRRLPLFYTINLIIPCLLISCLTVLVFYLPSECGEKITLCISVLLSLTVFLLLITEIIPSTSLVIPLIGEYLLFTMIFVTLSIVITVFVLNVHHRSPSTHNMPNWVRVALLGRVPRWLMMNRP--LPPMELHGSPGLKLSPTYHWLETNMDAEEREETEEEEEEEEDENICMCAGLPDSSMGVL----YGHGSLHLRAMGPEAKTPSQASEILLSPQIQKALEGVHYIADHLRSEDADSSVKEDWKYVAMVVDRIFLWLFIIVCFLGTIGLFLPP 506          
BLAST of Acetylcholine receptor subunit alpha-like vs. UniProt
Match: sp|P23414|ACH1_SCHGR (Acetylcholine receptor subunit alpha-L1 OS=Schistocerca gregaria OX=7010 PE=2 SV=1)

HSP 1 Score: 352.443 bits (903), Expect = 7.942e-114
Identity = 171/352 (48.58%), Postives = 242/352 (68.75%), Query Frame = 2
Query:  104 ARNLYDDLFNKAHNYPKLL-PVVNLETPVIVYMNLSLSQILEVNVKDQIIVLNVWVYQEWNDNRFSWDPSDYGGLTEIQIPSSMIWLPDLVLYNNAGGDWDLSGMSGSKVKVKHDGTIIWKPPVILKSQCEMDVTYFPFDIQTCPLKMGTWTHHGLLIDLRHWAQKVSDLSNERIKYDNCESKIDYAIDLTDYLQSYEWDLLSVTANRNIKKYPCCPEPYLDVTFHIKIRRMTLFYGLNLIFPCLSISFLTIMVFYLPTYSTQKITLCISVFLALNIFILVVFDLTPSTSRSVPLIVKYLLFTMFMVTFSIVASIAVLNFSFRQPETDKLSDNMKKIFLKTLPTYLKMRSVE 1156
            A+ LYDDL +   NY +L+ PV N    V+V + L LSQ++++N+KDQI+  NVW+  EW D++F WDP++YGG+TE+ +PS  IWLPD+VLYNNA G++ ++ M+  K  + H G ++W PP I KS CE+DV YFPFD QTC +K G+WT+ G  IDL+H  QK  D            +K+   IDL +Y  S EWD+L V A R+ K YPCC EPY D+ F+I +RR TLFY +NLI PC+ IS+L+++VFYLP  S +KI LCIS+ L+  +F L++ ++ PSTS ++PL+ KYLLFTM +V  S+V +I VLN  +R+P T K++  ++K+F++ LP  L MR  E
Sbjct:   27 AKRLYDDLLS---NYNRLIRPVSNNTDTVLVKLGLRLSQLIDLNLKDQILTTNVWLEHEWQDHKFRWDPAEYGGVTELYVPSEHIWLPDIVLYNNADGEYVVTTMT--KAVLHHTGKVVWTPPAIFKSSCEIDVRYFPFDQQTCFMKFGSWTYDGDQIDLKHINQKYDD------------NKVKVGIDLREYYPSVEWDILGVPAERHEKYYPCCAEPYPDIFFNITLRRKTLFYTVNLIVPCVGISYLSVLVFYLPADSGEKIALCISILLSQTMFFLLISEIIPSTSLALPLLGKYLLFTMVLVGLSVVITIMVLNVHYRKPSTHKMAPWVRKVFIRRLPKLLLMRVPE 361          
BLAST of Acetylcholine receptor subunit alpha-like vs. UniProt
Match: sp|P09478|ACH1_DROME (Acetylcholine receptor subunit alpha-like 1 OS=Drosophila melanogaster OX=7227 GN=nAChRalpha1 PE=2 SV=2)

HSP 1 Score: 350.903 bits (899), Expect = 3.855e-113
Identity = 176/365 (48.22%), Postives = 247/365 (67.67%), Query Frame = 2
Query:   50 FLLSFVAIKICVTT-AYSAARNLYDDLFNKAHNYPKLL-PVVNLETPVIVYMNLSLSQILEVNVKDQIIVLNVWVYQEWNDNRFSWDPSDYGGLTEIQIPSSMIWLPDLVLYNNAGGDWDLSGMSGSKVKVKHDGTIIWKPPVILKSQCEMDVTYFPFDIQTCPLKMGTWTHHGLLIDLRHWAQKVSDLSNERIKYDNCESKIDYAIDLTDYLQSYEWDLLSVTANRNIKKYPCCPEPYLDVTFHIKIRRMTLFYGLNLIFPCLSISFLTIMVFYLPTYSTQKITLCISVFLALNIFILVVFDLTPSTSRSVPLIVKYLLFTMFMVTFSIVASIAVLNFSFRQPETDKLSDNMKKIFLKTLPTYL 1138
            F   F+A+       A   A+ LYDDL +   NY +L+ PV N    + V M L LSQ+++VN+K+QI+  NVWV QEWND +  W+P DYGG+  + +PS  IWLPD+VLYNNA G+++++ M+  K  + H G ++WKPP I KS CE+DV YFPFD QTC +K G+WT+ G ++DLRH  Q            DN    I+  IDL DY  S EWD++ V A RN K Y CC EPYLD+ F++ +RR TLFY +NLI PC+ ISFL+++VFYLP+ S +KI+LCIS+ L+L +F L++ ++ P TS +VPL+ KYLLFTM +VT S+V +IAVLN +FR P T +++  ++++F++ LP  L
Sbjct:    6 FAAVFIALHFATGGLANPDAKRLYDDLLS---NYNRLIRPVGNNSDRLTVKMGLRLSQLIDVNLKNQIMTTNVWVEQEWNDYKLKWNPDDYGGVDTLHVPSEHIWLPDIVLYNNADGNYEVTIMT--KAILHHTGKVVWKPPAIYKSFCEIDVEYFPFDEQTCFMKFGSWTYDGYMVDLRHLKQTADS--------DN----IEVGIDLQDYYISVEWDIMRVPAVRNEKFYSCCEEPYLDIVFNLTLRRKTLFYTVNLIIPCVGISFLSVLVFYLPSDSGEKISLCISILLSLTVFFLLLAEIIPPTSLTVPLLGKYLLFTMMLVTLSVVVTIAVLNVNFRSPVTHRMAPWVQRLFIQILPKLL 353          
BLAST of Acetylcholine receptor subunit alpha-like vs. UniProt
Match: sp|P17644|ACH2_DROME (Acetylcholine receptor subunit alpha-like 2 OS=Drosophila melanogaster OX=7227 GN=nAChRalpha2 PE=2 SV=1)

HSP 1 Score: 350.517 bits (898), Expect = 7.927e-113
Identity = 169/353 (47.88%), Postives = 243/353 (68.84%), Query Frame = 2
Query:   92 AYSAARNLYDDLFNKAHNYPKLL-PVVNLETPVIVYMNLSLSQILEVNVKDQIIVLNVWVYQEWNDNRFSWDPSDYGGLTEIQIPSSMIWLPDLVLYNNAGGDWDLSGMSGSKVKVKHDGTIIWKPPVILKSQCEMDVTYFPFDIQTCPLKMGTWTHHGLLIDLRHWAQKVSDLSNERIKYDNCESKIDYAIDLTDYLQSYEWDLLSVTANRNIKKYPCCPEPYLDVTFHIKIRRMTLFYGLNLIFPCLSISFLTIMVFYLPTYSTQKITLCISVFLALNIFILVVFDLTPSTSRSVPLIVKYLLFTMFMVTFSIVASIAVLNFSFRQPETDKLSDNMKKIFLKTLPTYLKMR 1147
            A   A+ LYDDL +   NY +L+ PV N    V+V + L LSQ++++N+KDQI+  NVW+  EW D++F WDPS+YGG+TE+ +PS  IWLPD+VLYNNA G++ ++ M+  K  + + G ++W PP I KS CE+DV YFPFD QTC +K G+WT+ G  IDL+H +QK           ++ ++K++  IDL +Y  S EWD+L V A R+ K YPCC EPY D+ F+I +RR TLFY +NLI PC+ IS+L+++VFYLP  S +KI LCIS+ L+  +F L++ ++ PSTS ++PL+ KYLLFTM +V  S+V +I +LN  +R+P T K+   ++  F+K LP  L MR
Sbjct:   41 ANPDAKRLYDDLLS---NYNRLIRPVSNNTDTVLVKLGLRLSQLIDLNLKDQILTTNVWLEHEWQDHKFKWDPSEYGGVTELYVPSEHIWLPDIVLYNNADGEYVVTTMT--KAILHYTGKVVWTPPAIFKSSCEIDVRYFPFDQQTCFMKFGSWTYDGDQIDLKHISQK-----------NDKDNKVEIGIDLREYYPSVEWDILGVPAERHEKYYPCCAEPYPDIFFNITLRRKTLFYTVNLIIPCVGISYLSVLVFYLPADSGEKIALCISILLSQTMFFLLISEIIPSTSLALPLLGKYLLFTMLLVGLSVVITIIILNIHYRKPSTHKMRPWIRSFFIKRLPKLLLMR 377          
BLAST of Acetylcholine receptor subunit alpha-like vs. UniProt
Match: sp|P25162|ACH4_DROME (Acetylcholine receptor subunit beta-like 2 OS=Drosophila melanogaster OX=7227 GN=nAChRbeta2 PE=2 SV=3)

HSP 1 Score: 345.125 bits (884), Expect = 1.948e-111
Identity = 190/511 (37.18%), Postives = 302/511 (59.10%), Query Frame = 2
Query:   92 AYSAARNLYDDLFNKAHNYPKLL-PVVNLETPVIVYMNLSLSQILEVNVKDQIIVLNVWVYQEWNDNRFSWDPSDYGGLTEIQIPSSMIWLPDLVLYNNAGGDWDLSGMSGSKVKVKHDGTIIWKPPVILKSQCEMDVTYFPFDIQTCPLKMGTWTHHGLLIDLRHWAQKVSDLSNERIKYDNCESKIDYAIDLTDYLQSYEWDLLSVTANRNIKKYPCCPEPYLDVTFHIKIRRMTLFYGLNLIFPCLSISFLTIMVFYLPTYSTQKITLCISVFLALNIFILVVFDLTPSTSRSVPLIVKYLLFTMFMVTFSIVASIAVLNFSFRQPETDKLSDNMKKIFLKTLPTYLKMRSVEFKENSEIPTSFGSTKSTNYADY-----SMYDLTWLKWNKGYTEMMNSKCGTAQNF--------SSAKRNL------ALESLRSIKYNLLLKTRHNEVRNEWMYMGIVIDRLFLIVFTVIVTLGSLIIFLMPPQLWSQQLVLNSKDAAQMLANSNY 1564
            A    + LYDDL +   NY +L+ PVVN    + V++ L LSQ++EVN+K+Q++  N+WV Q W D +  WDP +YGG+ ++ +PS  IW+PD+VLYNN  G+++++ M+  K  +K+ G + W+PP I KS CEM+V YFP+D Q C +K G+WT++G  +DL+H  Q         I   N    +   IDLT++  S EWD+L V A +N + YP   EP+ D+TF + +RR TLFY +NLI PC++++FLT++VFYLP+ S +K+TLCIS+ ++L +F L++ ++ P TS +VPL+ KYLLFTM +V+ S+  ++ VLN  FR P T  +S  ++K+FL  +P  + MR  ++     +P    ST S  Y +      S+ D          +E  +S+ G   N         +   RNL      AL ++R I  ++    + NE+  +W ++ +V+DR FL +FT+    G+L I    P L+  +  ++ + +   L  +N+
Sbjct:   26 ANPDTKRLYDDLLS---NYNRLIRPVVNNTETLTVWLGLKLSQLIEVNLKNQVMTTNLWVKQRWFDYKLRWDPEEYGGVEQLYVPSEHIWVPDIVLYNNWDGNYEVTLMT--KATLKYTGEVFWEPPAIYKSSCEMNVEYFPYDEQICFMKFGSWTYNGAQVDLKHLDQ---------IPGSNL---VQVGIDLTEFYLSVEWDILEVPATKNEEYYPDTLEPFSDITFKLTMRRKTLFYTVNLIVPCVALTFLTVLVFYLPSDSGEKVTLCISILVSLTVFFLLLAEIIPPTSLAVPLLGKYLLFTMILVSLSVWTTVCVLNIHFRSPSTHNMSPLVRKLFLHFMPKLMMMRRTQYT----LPDYDDSTPSNGYTNEIDVRDSISDFP--------SEFKDSQDGAYDNGMQNSVDSDNVIPRNLTPEVLQALRAVRFIAQHIKDADKDNEIVEDWKFVSMVLDRFFLWLFTLSCVFGTLAIICQSPSLYDTRSPIDRQLSEIPLRKNNF 507          
BLAST of Acetylcholine receptor subunit alpha-like vs. UniProt
Match: sp|Q9N587|ACH6_CAEEL (Acetylcholine receptor subunit alpha-type unc-63 OS=Caenorhabditis elegans OX=6239 GN=unc-63 PE=1 SV=2)

HSP 1 Score: 334.339 bits (856), Expect = 1.662e-107
Identity = 192/493 (38.95%), Postives = 294/493 (59.63%), Query Frame = 2
Query:   86 TTAYSAARNLYDDLFNKAHNYPKLL-PVVNLETPVIVYMNLSLSQILEVNVKDQIIVLNVWVYQEWNDNRFSWDPSDYGGLTEIQIPSSMIWLPDLVLYNNAGGDWDLSGMSGSKVKVKHDGTIIWKPPVILKSQCEMDVTYFPFDIQTCPLKMGTWTHHGLLIDLRHWAQKVSDLSNERIKYDNCESK-----IDYAIDLTDYLQSYEWDLLSVTANRNIKKYPCCPEPYLDVTFHIKIRRMTLFYGLNLIFPCLSISFLTIMVFYLPTYSTQKITLCISVFLALNIFILVVFDLTPSTSRSVPLIVKYLLFTMFMVTFSIVASIAVLNFSFRQPETDKLSDNMKKIFLKTLPTYLKM-RSVEFKENSEIPTSFGSTKSTNYADYSMYDLTWLKWNKGYTEMMNSKCGTAQNFSS-------AKRNLALESLRSIKYNLLLKTRHNEVRNEWMYMGIVIDRLFLIVFTVIVTLGSLIIFLMPPQLWSQQLVL 1522
            T A   A  L++DL     +Y KL+ PV      ++V   L LSQ+L+V+ K+QI+  NVW+   W D +  WDP +YGG+  + +PS  IWLPD+VLYNNA G++ ++ M+  K K+ ++GT+ W PP I KS C++DV +FPFD Q C +K G+WT+ GL +DL+H  + +     E ++  +  +K     +D  IDL+DY  S EWD+L+V   R+ K+YPCC  P++D+T+ I +RR TLFY +NLIFP + ISFLT +VFYLP+   +KI+LCIS+ ++L +F L++ ++ PSTS  +PLI KYLLFTM +VT S+V ++  LN  +R P T  +   MK++F+  LP YL M R      +S+    F S  ST    +S+     L  N   +E+++    + +  SS       +    A+ES+  I  +L  +    +V  +W Y+ +V+DR+FLI FT     G+++I    P ++     L
Sbjct:   21 THANRDANRLFEDLIA---DYNKLVRPVSENGETLVVTFKLKLSQLLDVHEKNQIMTTNVWLQHSWMDYKLRWDPVEYGGVEVLYVPSDTIWLPDVVLYNNADGNYQVTIMT--KAKLTYNGTVEWAPPAIYKSMCQIDVEFFPFDRQQCEMKFGSWTYGGLEVDLQHRDKHLEKEIEEDVEGVDGPTKEIVWVVDRGIDLSDYYPSVEWDILNVPGKRHSKRYPCCESPFIDITYEIHLRRKTLFYTVNLIFPSVGISFLTALVFYLPSDGGEKISLCISILISLTVFFLLLVEIIPSTSLVIPLIGKYLLFTMVLVTLSVVVTVVTLNVHYRSPTTHTMPKWMKRLFVDFLPKYLLMTRPQPPGHHSKPNRKFDSRAST----FSIGVNHVLGQN---SELLSPGLNSNREESSFTLPRDNSPVRSAVESVAYIADHLKNEEDDKQVIEDWKYISVVMDRIFLITFTFACAFGTVVIIARAPSIYDNTPAL 501          
BLAST of Acetylcholine receptor subunit alpha-like vs. TrEMBL
Match: gnl|BL_ORD_ID|18249263 (tr|A0A1I8G5C2|A0A1I8G5C2_9PLAT Uncharacterized protein OS=Macrostomum lignano OX=282301 PE=3 SV=1)

HSP 1 Score: 455.677 bits (1171), Expect = 5.988e-153
Identity = 222/463 (47.95%), Postives = 321/463 (69.33%), Query Frame = 2
Query:  131 NKAHNYPKLLPVVNLETPVIVYMNLSLSQILEVNVKDQIIVLNVWVYQEWNDNRFSWDPSDYGGLTEIQIPSSMIWLPDLVLYNNAGGDWDLSGMSGSKVKVKHDGTIIWKPPVILKSQCEMDVTYFPFDIQTCPLKMGTWTHHGLLIDLRHWAQKVSDLSNERIKYDNCESKIDYAIDLTDYLQSYEWDLLSVTANRNIKKYPCCPEPYLDVTFHIKIRRMTLFYGLNLIFPCLSISFLTIMVFYLPTYSTQKITLCISVFLALNIFILVVFDLTPSTSRSVPLIVKYLLFTMFMVTFSIVASIAVLNFSFRQPETDKLSDNMKKIFLKTLPTYLKMRSVEF-KENSEIPTSFGSTKSTNYADYSMYDLTWLKWNKGYTEMMNSKCGTAQNFSSAKR-----NLALESLRSIKYNLLLKTRHNEVRNEWMYMGIVIDRLFLIVFTVIVTLGSLIIFLMPPQL 1501
            N+ +    + PV N   PV++YMNLSL+QIL+V+ K+QI+ LN+WV Q+W+D  F W+P+ YG +TE+ IPS  IW PDLVLYNNAGGDWDL G S +KV V  DGTI+W+PP+I KSQCE++V +FPFD Q C LK+GTWTH+G LIDLRH AQK     N    +DNC++ IDYAIDL+ ++ + EWD+L V A RNI+KY CCPEPYLD+TF + IRR TLFYG+NLI PCL+ISFLTI+VFYLP  S +K++L I++ L+L +F L++FD+ P TS  VPLI+KYLLFTM +VT S++A++ VLN  +R P+T  ++  ++++F++TLP  L M+  E  +   E+  + G T +     + + D    +++ G  E+M  +  + +   ++        LALE +R+I  ++  +   N +R++W Y+ +V+DRLF+ +F+    +G+L IF+  P L
Sbjct:    2 NRTNYRSSVRPVTNYSQPVLLYMNLSLTQILDVDEKNQIVTLNMWVSQQWHDPNFVWNPAHYGNITELHIPSEDIWTPDLVLYNNAGGDWDL-GSSANKVNVLSDGTILWRPPIIFKSQCEINVEFFPFDTQNCTLKLGTWTHNGYLIDLRHVAQKEEADRNGWRNFDNCKAYIDYAIDLSQFVDNVEWDILEVAAKRNIEKYKCCPEPYLDLTFSLNIRRKTLFYGVNLICPCLAISFLTILVFYLPGESGEKMSLSINILLSLTVFFLLIFDICPPTSLVVPLILKYLLFTMILVTLSVMATVIVLNVHWRSPDTYVMAPWVRQVFMRTLPKLLLMKKPETERRKEEVIPNIGGTDTEALCAF-LAD----EFDDG--EVMRERLRSRRTAMTSSGIINEIELALEGVRNIATHMKKEDERNTIRDDWKYVAVVLDRLFMWLFSCAAIIGALGIFMQAPSL 456          
BLAST of Acetylcholine receptor subunit alpha-like vs. TrEMBL
Match: gnl|BL_ORD_ID|18309553 (tr|A0A267GJH6|A0A267GJH6_9PLAT Uncharacterized protein OS=Macrostomum lignano OX=282301 GN=BOX15_Mlig014979g2 PE=3 SV=1)

HSP 1 Score: 448.743 bits (1153), Expect = 1.596e-149
Identity = 232/516 (44.96%), Postives = 327/516 (63.37%), Query Frame = 2
Query:   53 LLSFVAIKICVTTAYSAARNLYDDLFNKAHNYPKLLPVVNLETPVIVYMNLSLSQILEVNVKDQIIVLNVWVYQEWNDNRFSWDPSDYGGLTEIQIPSSMIWLPDLVLYNNAGGDWDLSGMSGSKVKVKHDGTIIWKPPVILKSQCEMDVTYFPFDIQTCPLKMGTWTHHGLLIDLRHWAQKVSDLSNERIKYDNCESKIDYAIDLTDYLQSYEWDLLSVTANRNIKKYPCCPEPYLDVTFHIKIRRMTLFYGLNLIFPCLSISFLTIMVFYLPTYSTQKITLCISVFLALNIFILVVFDLTPSTSRSVPLIVKYLLFTMFMVTFSIVASIAVLNFSFRQPETDKLSDNMKKIFLKTLPTYLKMRSVEFKENSEIPTSFGSTKSTNYADYSMYDLTWLKWNKGYTEMMNSKCGTAQNFSSAKRNL-----ALESLRSIKYNLLLKTRHNEVRNEWMYMGIVIDRLFLIVFTVIVTLGSLIIFLMPPQLWSQQLVLNSKDAAQMLANSNYTRLCK*R 1585
            +LS V+I   +  +     +LY D +    +Y    PVVN   PVI+YMN+SL+QI++V+ K+QII LN+WV QEW D  F W P  YGG+  + +PS  +W PD+VLY+NAG DWDLS  S +K+KV +DGT++WKPPVI +S C+++V +FPFD+Q C LKMGTWT+HGL IDLRH AQK       RIK+D+CE++I+YA+DL++Y+++ EWDLL V+A RNI  Y CCPEPYLD+TF +K RR +LFYG++LI PCL+ISFLTI VFYLP  S +KITL IS+ +AL +F+++VFDLTP TS  VPLI KYL+FTM +V+ SI+ S  VLN  +R P  +K+ D  K++FL+TLP  L M       +   P    S  S + AD    D    K  +    + + +   + +    + ++     A+  +RSI   +    R +    EW Y+ +V+DR+FL+ F +   +G+  IF   P L+  Q  L  +   +  +N    R C  R
Sbjct:   10 VLSLVSIFEAINASPPGLAHLYSDFYLSRTSYRYARPVVNNSQPVIMYMNVSLTQIMDVDEKNQIIKLNMWVLQEWTDPFFIWHPESYGGVDHMLLPSDALWTPDVVLYSNAGSDWDLS-QSSTKLKVYYDGTVVWKPPVIYESTCDINVEFFPFDMQDCRLKMGTWTYHGLHIDLRHLAQKAEAKRLNRIKFDDCEAEINYAVDLSEYVENTEWDLLQVSAKRNIVYYACCPEPYLDITFFLKFRRQSLFYGISLICPCLAISFLTICVFYLPADSQEKITLSISILIALTVFMMMVFDLTPPTSLVVPLITKYLMFTMILVSLSILVSTVVLNVRYRSPHVNKVPDWAKRLFLQTLPGTLCM-------DRRAPVEDISHSSYHGADCLEDDDDDEKEEEDEERLESMEENDSTDVIDGEVSVHDMARAVRGVRSIARRIRADIRSSTSTEEWKYVALVLDRIFLLSFGLSAIVGTFGIFFQAPTLFDTQKPLRRELVHEYESNLTVVRNCSYR 517          
BLAST of Acetylcholine receptor subunit alpha-like vs. TrEMBL
Match: gnl|BL_ORD_ID|18250252 (tr|A0A267GHW3|A0A267GHW3_9PLAT Uncharacterized protein OS=Macrostomum lignano OX=282301 GN=BOX15_Mlig014979g1 PE=3 SV=1)

HSP 1 Score: 448.743 bits (1153), Expect = 1.798e-149
Identity = 232/516 (44.96%), Postives = 327/516 (63.37%), Query Frame = 2
Query:   53 LLSFVAIKICVTTAYSAARNLYDDLFNKAHNYPKLLPVVNLETPVIVYMNLSLSQILEVNVKDQIIVLNVWVYQEWNDNRFSWDPSDYGGLTEIQIPSSMIWLPDLVLYNNAGGDWDLSGMSGSKVKVKHDGTIIWKPPVILKSQCEMDVTYFPFDIQTCPLKMGTWTHHGLLIDLRHWAQKVSDLSNERIKYDNCESKIDYAIDLTDYLQSYEWDLLSVTANRNIKKYPCCPEPYLDVTFHIKIRRMTLFYGLNLIFPCLSISFLTIMVFYLPTYSTQKITLCISVFLALNIFILVVFDLTPSTSRSVPLIVKYLLFTMFMVTFSIVASIAVLNFSFRQPETDKLSDNMKKIFLKTLPTYLKMRSVEFKENSEIPTSFGSTKSTNYADYSMYDLTWLKWNKGYTEMMNSKCGTAQNFSSAKRNL-----ALESLRSIKYNLLLKTRHNEVRNEWMYMGIVIDRLFLIVFTVIVTLGSLIIFLMPPQLWSQQLVLNSKDAAQMLANSNYTRLCK*R 1585
            +LS V+I   +  +     +LY D +    +Y    PVVN   PVI+YMN+SL+QI++V+ K+QII LN+WV QEW D  F W P  YGG+  + +PS  +W PD+VLY+NAG DWDLS  S +K+KV +DGT++WKPPVI +S C+++V +FPFD+Q C LKMGTWT+HGL IDLRH AQK       RIK+D+CE++I+YA+DL++Y+++ EWDLL V+A RNI  Y CCPEPYLD+TF +K RR +LFYG++LI PCL+ISFLTI VFYLP  S +KITL IS+ +AL +F+++VFDLTP TS  VPLI KYL+FTM +V+ SI+ S  VLN  +R P  +K+ D  K++FL+TLP  L M       +   P    S  S + AD    D    K  +    + + +   + +    + ++     A+  +RSI   +    R +    EW Y+ +V+DR+FL+ F +   +G+  IF   P L+  Q  L  +   +  +N    R C  R
Sbjct:   10 VLSLVSIFEAINASPPGLAHLYSDFYLSRTSYRYARPVVNNSQPVIMYMNVSLTQIMDVDEKNQIIKLNMWVLQEWTDPFFIWHPESYGGVDHMLLPSDALWTPDVVLYSNAGSDWDLS-QSSTKLKVYYDGTVVWKPPVIYESTCDINVEFFPFDMQDCRLKMGTWTYHGLHIDLRHLAQKAEAKRLNRIKFDDCEAEINYAVDLSEYVENTEWDLLQVSAKRNIVYYACCPEPYLDITFFLKFRRQSLFYGISLICPCLAISFLTICVFYLPADSQEKITLSISILIALTVFMMMVFDLTPPTSLVVPLITKYLMFTMILVSLSILVSTVVLNVRYRSPHVNKVPDWAKRLFLQTLPGTLCM-------DRRAPVEDISHSSYHGADCLEDDDDDEKEEEDEERLESMEENDSTDVIDGEVSVHDMARAVRGVRSIARRIRADIRSSTSTEEWKYVALVLDRIFLLSFGLSAIVGTFGIFFQAPTLFDTQKPLRRELVHEYESNLTVVRNCSYR 517          
BLAST of Acetylcholine receptor subunit alpha-like vs. TrEMBL
Match: gnl|BL_ORD_ID|15771142 (tr|A0A1I8H3A1|A0A1I8H3A1_9PLAT Uncharacterized protein OS=Macrostomum lignano OX=282301 PE=3 SV=1)

HSP 1 Score: 446.432 bits (1147), Expect = 2.487e-148
Identity = 221/500 (44.20%), Postives = 313/500 (62.60%), Query Frame = 2
Query:  110 NLYDDLFNKAHNYPKLLPVVNLETPVIVYMNLSLSQILEVNVKDQIIVLNVWVYQEWNDNRFSWDPSDYGGLTEIQIPSSMIWLPDLVLYNNAGGDWDLSGMSGSKVKVKHDGTIIWKPPVILKSQCEMDVTYFPFDIQTCPLKMGTWTHHGLLIDLRHWAQKVSDLSNERIKYDNCESKIDYAIDLTDYLQSYEWDLLSVTANRNIKKYPCCPEPYLDVTFHIKIRRMTLFYGLNLIFPCLSISFLTIMVFYLPTYSTQKITLCISVFLALNIFILVVFDLTPSTSRSVPLIVKYLLFTMFMVTFSIVASIAVLNFSFRQPETDKLSDNMKKIFLKTLPTYL---KMRSVEFKENSEIPTSFGSTKSTNYADYSMYDLTWLKWNKGYTE------MMNSKCGTAQNFSSAKRNL--ALESLRSIKYNLLLKTRHNEVRNEWMYMGIVIDRLFLIVFTVIVTLGSLIIFLMPPQLWSQQLVLNSKDAAQMLANSNYTRLC 1576
            +LY D +    +Y    P VN   PV++YMN+SL+QI++V+ K+Q+I LN+W+ QEW D  F W+P++YG    + +P   +W PD+VLY+N GGDWDLS  S +K+KV HDG ++WKPPVI +S C+++V +FPFD Q C LKMGTWT+HGLLIDLRH AQK  D   +R  +DNCE+ I+YA DL++Y+++ EWDLL V+A RNI  Y CCPEPYLD+TF I+ RR  +FYG NLI PC++ISFLT+ VFYLP+ S +KITL IS+ +AL +FIL+VF+LTP TS  VPLI KYLLFTM +V+ SI+ S  VLN  +R P+ +++    K++F+ TLP      ++  ++ +E   + T        +  D S  D      + GY E         S+  +  N +   R++  AL  +RSI   +           EW Y+ +V+DRLFL  F +  T+G+  IFL  P +      +  +   +   N +  R C
Sbjct:   34 HLYSDFYLSRSDYRYARPSVNSSEPVVMYMNVSLTQIMDVDEKNQLIKLNMWIVQEWKDPFFEWNPAEYGDADHMLLPPDALWTPDIVLYSNTGGDWDLS-QSATKLKVYHDGRVVWKPPVIYESSCDINVEFFPFDTQECRLKMGTWTYHGLLIDLRHLAQKTEDERVKRTSFDNCEADINYAADLSEYVENTEWDLLQVSATRNIAFYACCPEPYLDITFFIRFRRQPVFYGTNLICPCMAISFLTVFVFYLPSDSQEKITLSISILIALTVFILLVFELTPPTSLVVPLITKYLLFTMILVSLSILVSTVVLNVRYRSPDANRVPLWAKRLFMHTLPRAALLDRVDDLQKQEQQRLRTRLQREGDASCGD-SESDSDEQSNDDGYFEGSVEAGRYGSETSSTSNAAINARDIARALRGVRSIARKIRDDIASESSEEEWKYVALVLDRLFLYCFGLSATVGTFGIFLQAPAIADTAAPMRREFVTEYERNISVVRRC 531          
BLAST of Acetylcholine receptor subunit alpha-like vs. TrEMBL
Match: gnl|BL_ORD_ID|15804733 (tr|A0A1I8GVX5|A0A1I8GVX5_9PLAT Uncharacterized protein OS=Macrostomum lignano OX=282301 PE=3 SV=1)

HSP 1 Score: 444.121 bits (1141), Expect = 9.133e-148
Identity = 228/510 (44.71%), Postives = 323/510 (63.33%), Query Frame = 2
Query:   71 IKICVTTAYSAARNLYDDLFNKAHNYPKLLPVVNLETPVIVYMNLSLSQILEVNVKDQIIVLNVWVYQEWNDNRFSWDPSDYGGLTEIQIPSSMIWLPDLVLYNNAGGDWDLSGMSGSKVKVKHDGTIIWKPPVILKSQCEMDVTYFPFDIQTCPLKMGTWTHHGLLIDLRHWAQKVSDLSNERIKYDNCESKIDYAIDLTDYLQSYEWDLLSVTANRNIKKYPCCPEPYLDVTFHIKIRRMTLFYGLNLIFPCLSISFLTIMVFYLPTYSTQKITLCISVFLALNIFILVVFDLTPSTSRSVPLIVKYLLFTMFMVTFSIVASIAVLNFSFRQPETDKLSDNMKKIFLKTLPTYLKMRSVEFKENSEIPTSFGSTKSTNYADYSMYDLTWLKWNKGYTEMMNSKCGTAQNFSSAKRNL-----ALESLRSIKYNLLLKTRHNEVRNEWMYMGIVIDRLFLIVFTVIVTLGSLIIFLMPPQLWSQQLVLNSKDAAQMLANSNYTRLCK*R 1585
            + + +  +     +LY D +    +Y    PVVN   PVI+YMN+SL+QI++V+ K+QII LN+WV QEW D  F W P  YGG+  + +PS  +W PD+VLY+NAG DWDLS  S +K+KV +DGT++WKPPVI +S C+++V +FPFD+Q C LKMGTWT+HGL IDLRH AQK       RIK+D+CE++I+YA+DL++Y+++ EWDLL V+A RNI  Y CCPEPYLD+TF +K RR +LFYG++LI PCL+ISFLTI VFYLP  S +KITL IS+ +AL +F+++VFDLTP TS  VPLI KYL+FTM +V+ SI+ S  VLN  +R P  +K+ D  K++FL+TLP  L M       +   P    S  S + AD    D    K  +    + + +   + +    + ++     A+  +RSI   +    R +    EW Y+ +V+DR+FL+ F +   +G+  IF   P L+  Q  L  +   +  +N    R C  R
Sbjct:   13 LHLAINASPPGLAHLYSDFYLSRTSYRYARPVVNNSQPVIMYMNVSLTQIMDVDEKNQIIKLNMWVLQEWTDPFFIWHPESYGGVDHMLLPSDALWTPDVVLYSNAGSDWDLS-QSSTKLKVYYDGTVVWKPPVIYESTCDINVEFFPFDMQDCRLKMGTWTYHGLHIDLRHLAQKAEAKRLNRIKFDDCEAEINYAVDLSEYVENTEWDLLQVSAKRNIVYYACCPEPYLDITFFLKFRRQSLFYGISLICPCLAISFLTICVFYLPADSQEKITLSISILIALTVFMMMVFDLTPPTSLVVPLITKYLMFTMILVSLSILVSTVVLNVRYRSPHVNKVPDWAKRLFLQTLPGTLCM-------DRRAPVEDISHSSYHGADCLEDDDDDEKEEEDEERLESMEENDSTDVIDGEVSVHDMARAVRGVRSIARRIRADIRSSTSTEEWKYVALVLDRIFLLSFGLSAIVGTFGIFFQAPTLFDTQKPLRRELVHEYESNLTVVRNCSYR 514          
BLAST of Acetylcholine receptor subunit alpha-like vs. Ensembl Cavefish
Match: chrna3 (neuronal acetylcholine receptor subunit alpha-3-like [Source:NCBI gene;Acc:103025148])

HSP 1 Score: 324.324 bits (830), Expect = 4.352e-105
Identity = 180/481 (37.42%), Postives = 278/481 (57.80%), Query Frame = 2
Query:   71 IKICVTT---AYSAARNLYDDLFNKAHNYPKLLPVVNLETPVIVYMNLSLSQILEVNVKDQIIVLNVWVYQEWNDNRFSWDPSDYGGLTEIQIPSSMIWLPDLVLYNNAGGDWDLSGMSGSKVKVKHDGTIIWKPPVILKSQCEMDVTYFPFDIQTCPLKMGTWTHHGLLIDLRHWAQKVSDLSNERIKYDNCESKIDYAIDLTDYLQSYEWDLLSVTANRNIKKYPCCPEPYLDVTFHIKIRRMTLFYGLNLIFPCLSISFLTIMVFYLPTYSTQKITLCISVFLALNIFILVVFDLTPSTSRSVPLIVKYLLFTMFMVTFSIVASIAVLNFSFRQPETDKLSDNMKKIFLKTLPTYLKMRSVEFKENSEIPTSFGSTKSTNYADYSMYDLTWLKWNKGYTEMMNSKCGTAQNFS----SAKRNLALESLRSIKYNLLLKTRHNEVRNEWMYMGIVIDRLFLIVFTVIVTLGSLIIFLMP 1492
            I IC +    A  A   L+  +F+  + Y +  PV N+  PVIV   +S+SQ+++V+  +QI+  N+W+   WND +  WDP D+GG+  I++PS+ IW PD+VLYNNA GD+ +     +K  ++++G + W PP I KS C++DVTYFPFD Q C +K G+WT+    IDL                       I   I+L D+ +S EW ++     ++  KY CC E Y D+T+ + IRR+ LFY +N+I PCL ISFLT++VFYLP+   +K+TLCISV L+L +F+LV+ +  PSTS  +PLI +YLLFTM  VT SIV ++ VLN  +R P+T  +   ++++FL  LP  + M   +   + E P   GS+  +            L  +  + + +    G  +  +    S +   A+ES++ I  N+ L+    EV+++W Y+ +VIDR+FL VF ++  LG+  +FL P
Sbjct:   11 IFICFSAGGWASEAEHRLFSVIFSSYNQYIR--PVENVSDPVIVQFEVSMSQLVKVDEVNQIMETNLWLRHIWNDYKLRWDPKDFGGVEFIRVPSNRIWKPDIVLYNNAVGDFQVD--DKTKALLRYNGDVTWIPPAIFKSSCKIDVTYFPFDYQNCTMKFGSWTYDKAKIDL---------------------VLIGSTINLKDFWESGEWMIIDAPGYKHDIKYNCCEEIYTDITYSLYIRRLPLFYTINMIIPCLLISFLTVLVFYLPSDCGEKVTLCISVLLSLTVFLLVITETIPSTSLVIPLIGEYLLFTMIFVTLSIVITVFVLNVHYRTPKTHTMPCWVRRVFLGLLPRVMFMTRPD--RDPERPQVSGSSARS----------CTLHNSSSFPQHLTKPLGPVRLLAFSALSPEVREAIESVKYIAENMRLQNEAKEVQDDWKYVAMVIDRIFLWVFILVCILGTAGLFLQP 454          
BLAST of Acetylcholine receptor subunit alpha-like vs. Ensembl Cavefish
Match: chrna6 (neuronal acetylcholine receptor subunit alpha-3 [Source:NCBI gene;Acc:103022127])

HSP 1 Score: 319.316 bits (817), Expect = 2.436e-103
Identity = 175/446 (39.24%), Postives = 258/446 (57.85%), Query Frame = 2
Query:  161 PVVNLETPVIVYMNLSLSQILEVNVKDQIIVLNVWVYQEWNDNRFSWDPSDYGGLTEIQIPSSMIWLPDLVLYNNAGGDWDLSGMSGSKVKVKHDGTIIWKPPVILKSQCEMDVTYFPFDIQTCPLKMGTWTHHGLLIDLRHWAQKVSDLSNERIKYDNCESKIDYAIDLTDYLQSYEWDLLSVTANRNIKKYPCCPEPYLDVTFHIKIRRMTLFYGLNLIFPCLSISFLTIMVFYLPTYSTQKITLCISVFLALNIFILVVFDLTPSTSRSVPLIVKYLLFTMFMVTFSIVASIAVLNFSFRQPETDKLSDNMKKIFLKTLPTYLKMRSVEFKENSEIPTSFGSTKSTNYADYSMYDLTWLKWNKGYTEMMNSKCGTAQNFS--SAKRNLALESLRSIKYNLLLKTRHNEVRNEWMYMGIVIDRLFLIVFTVIVTLGSLIIFLMP 1492
            PV N+  PV V   +S+SQ+++V+  +QI+  N+W+   WND +  W P+++ G+  I++PS+ IW PD+VLYNNA GD+ +     +K  +K DGTI W PP I KS C MD+TYFPFD Q C +K G+WT+    IDL     KV                     +L D+ +S EW+++     ++  KY CC E Y D+T+   IRR+ LFY +NLI PCL ISFLT++VFYLP+   +K+TLCISV L+L +F+LV+ +  PSTS  +PLI +YLLFTM  VT SIV ++ VLN  +R P T  +   ++ +FL+ LP  + MR         I  S  STK+    +        +   K   ++      T   FS  S +   A+ES++ I  N+  + +  EV ++W Y+ +VIDR+FL VF ++  LG++ +F  P
Sbjct:   34 PVENVSDPVTVEFEVSISQLVKVDEVNQIMETNLWLRHIWNDYKLKWIPAEFDGIEYIRVPSNKIWRPDIVLYNNAVGDFLVE--DKTKALLKFDGTITWVPPAIFKSSCPMDITYFPFDYQNCSMKFGSWTYDKAKIDLVLIGSKV---------------------NLKDFWESGEWEIIDAPGYKHDIKYNCCEEIYPDITYSFYIRRLPLFYTINLIIPCLLISFLTVLVFYLPSDCGEKVTLCISVLLSLTVFLLVITETIPSTSLVIPLIGEYLLFTMIFVTLSIVITVFVLNVHYRTPTTHTMPGWVRTVFLRALPRIMLMR-------RPIDQSESSTKAKEGPE--------VDCGKVSRQLSPQAINTVVAFSVVSPEIKQAIESVKYIAENMRSRNKAKEVEDDWKYVAMVIDRIFLWVFVLVCVLGTVGLFFQP 441          
BLAST of Acetylcholine receptor subunit alpha-like vs. Ensembl Cavefish
Match: chrna2a (cholinergic receptor, nicotinic, alpha 2a (neuronal) [Source:ZFIN;Acc:ZDB-GENE-040108-2])

HSP 1 Score: 310.457 bits (794), Expect = 6.389e-99
Identity = 190/534 (35.58%), Postives = 286/534 (53.56%), Query Frame = 2
Query:   77 ICVTTAYSAARNLYDDLFNKAHNYPKLLPVVNLETPVIVYMNLSLSQILEVNVKDQIIVLNVWVYQEWNDNRFSWDPSDYGGLTEIQIPSSMIWLPDLVLYNNAGGDWDLSGMSGSKVKVKHDGTIIWKPPVILKSQCEMDVTYFPFDIQTCPLKMGTWTHHGLLIDLRHWAQKVSDLSNERIKYDNCESKIDYAIDLTDYLQSYEWDLLSVTANRNIKKYPCCPEPYLDVTFHIKIRRMTLFYGLNLIFPCLSISFLTIMVFYLPTYSTQKITLCISVFLALNIFILVVFDLTPSTSRSVPLIVKYLLFTMFMVTFSIVASIAVLNFSFRQPETDKLSDNMKKIFLKTLPTYLKMRS-----------VEFKENSEIPT---------------------------------------SFGSTKSTNYAD-----YSMYDLTWLKWNKGYTEMMNSKCGTAQNFSSAKR-------NLALESLRSIKYNLLLKTRHNEVRNEWMYMGIVIDRLFLIVFTVIVTLGSLIIFLMP 1492
            +C  T   A   L+  LF+  + + +  PV N+   VIV   LS++Q+++V+ K+Q++  NVW+ QEWND +  W PSDY  +T I++PS +IW+PD+VLYNNA G++ ++ M+  K  + H G ++W PP I KS C +DVT+FPFD Q C +K G+WT+    IDL                      +I+  +DL DY +S EW +++     N KKY CC E Y D+T+   IRR+ LFY +NLI PCL IS LT++VFYLP+   +KITLCISV L+L +F+L++ ++ PSTS  +PLI +YLLFTM  VT SIV ++ VLN   R P T K+   ++ IFL  +P +L M+            +  +E  ++P                                        SF +  S + ++      S+YDL  L    G+   +NS+     N     R         ALE ++ I  +L  +     V+ +W Y+ +VIDR+FL +F ++  LG++ +FL P
Sbjct:   14 LCDWTHAHAEDQLFKKLFSGYNKWSR--PVRNITDVVIVKFGLSIAQLIDVDEKNQMMTTNVWLKQEWNDYKLRWKPSDYDNVTSIRVPSELIWVPDIVLYNNADGEFAVTHMT--KAHLFHTGKVLWVPPAIYKSSCSIDVTFFPFDQQNCKMKFGSWTYDKAKIDLE---------------------RIENTVDLKDYWESGEWAIVNAVGTYNTKKYDCCHEIYPDITYFFIIRRLPLFYTINLIIPCLLISCLTVLVFYLPSDCGEKITLCISVLLSLTVFLLLITEIIPSTSLVIPLIGEYLLFTMIFVTLSIVITVFVLNVHHRSPSTHKMPGWVQSIFLGFIPRWLFMKRPAPDQTRRRLLLNAQEKKQVPNQTSNLSTSRSSWLQQETDVDIGRYQDSNGRAGMGIPASFSFPTATSLHLSESEPLLQSLYDLQQL----GHRINLNSRPVNLSNLEPEPRLPFSHSVMQALEGVQYIADHLRAEDADFSVKEDWKYVAMVIDRIFLWMFIIVCLLGTVGLFLPP 518          
BLAST of Acetylcholine receptor subunit alpha-like vs. Ensembl Cavefish
Match: chrna2b (neuronal acetylcholine receptor subunit alpha-2 [Source:NCBI gene;Acc:103031133])

HSP 1 Score: 298.901 bits (764), Expect = 6.660e-95
Identity = 178/480 (37.08%), Postives = 266/480 (55.42%), Query Frame = 2
Query:   89 TAYSAARNLYDDLFNKAHNYPKLLPVVNLETPVIVYMNLSLSQILEVNVKDQIIVLNVWVYQEWNDNRFSWDPSDYGGLTEIQIPSSMIWLPDLVLYNNAGGDWDLSGMSGSKVKVKHDGTIIWKPPVILKSQCEMDVTYFPFDIQTCPLKMGTWTHHGLLIDLRHWAQKVSDLSNERIKYDNCESKIDYAIDLTDYLQSYEWDLLSVTANRNIKKYPCCPEPYLDVTFHIKIRRMTLFYGLNLIFPCLSISFLTIMVFYLPTYSTQKITLCISVFLALNIFILVVFDLTPSTSRSVPLIVKYLLFTMFMVTFSIVASIAVLNFSFRQPETDKLSDNMKKIFLKTLPTYLKMRS------------VEFKENSEIPTSFGSTKSTNYADYSMYDLTWLKWNKGYTEMMNSKCGTAQNFSSAKRNLALESLRSIKYNLLLKTRHNEVRNEWMYMGIVIDRLFLIVFTVIVTLGSLIIFLMP 1492
            T   A   L+  LF   + + +  PV N    VIV   LS++Q+++V+ K+Q++  NVW+ QEWND +  W PSDY  +T I++PS +IW+PD+VLYNNA G++ ++ M+  K  + + G + W PP I KS C +DVT+FPFD Q C +K G+WT+    IDL                      +++  +DL DY +S EW +++     N KKY CC E Y D+T+   IRR+ LFY +NLI PCL IS LT++VFYLP+   +KITLCISV L+L +F+L++ ++ PSTS  +PLI +YLLFTM  VT SI+ ++ VLN   R P T ++   +  +FL  +P +L MR             +  +  + +P S  S    N+             N+   E   S         S     ALE +  I  +L  +     V+ +W Y+ +VIDR+FL +F ++  LG++ +FL P
Sbjct:   48 THSHAEDELFKKLFIGYNKWSR--PVPNTSDVVIVKFGLSIAQLIDVDEKNQMMTTNVWLKQEWNDYKLRWKPSDYDNVTSIRVPSELIWVPDIVLYNNADGEFAVTHMT--KAHLFYTGKVRWVPPAIYKSSCSIDVTFFPFDQQNCKMKFGSWTYDKAKIDLE---------------------RLETMVDLKDYWESGEWAIINAVGTYNTKKYDCCHEIYPDITYFFIIRRLPLFYTINLIIPCLLISCLTVLVFYLPSDCGEKITLCISVLLSLTVFLLLITEIIPSTSLVIPLIGEYLLFTMIFVTLSIIITVFVLNVHHRSPGTHEMPHWVHAVFLDLIPRWLFMRRPAPDSRRRQRLLLLQQGMACLPNSRHSGARINHT------------NRPTEEDQRSPL-------SPSIMQALEGVHYIADHLRAEDADFSVKEDWKYVAMVIDRIFLWMFIIVCLLGTIGLFLPP 483          
BLAST of Acetylcholine receptor subunit alpha-like vs. Ensembl Cavefish
Match: chrnb3a (cholinergic receptor, nicotinic, beta polypeptide 3a [Source:ZFIN;Acc:ZDB-GENE-040108-1])

HSP 1 Score: 293.893 bits (751), Expect = 1.815e-93
Identity = 166/469 (35.39%), Postives = 259/469 (55.22%), Query Frame = 2
Query:   95 YSAARNLYDDLF-NKAHNYPK-LLPVVNLETPVIVYMNLSLSQILEVNVKDQIIVLNVWVYQEWNDNRFSWDPSDYGGLTEIQIPSSMIWLPDLVLYNNAGGDWDLSGMSGSKVKVKHDGTIIWKPPVILKSQCEMDVTYFPFDIQTCPLKMGTWTHHGLLIDLRHWAQKVSDLSNERIKYDNCESKIDYAIDLTDYLQSYEWDLLSVTANRNIKKYPCCPEPYLDVTFHIKIRRMTLFYGLNLIFPCLSISFLTIMVFYLPTYSTQKITLCISVFLALNIFILVVFDLTPSTSRSVPLIVKYLLFTMFMVTFSIVASIAVLNFSFRQPET-DKLSDNMKKIFLKTLPTYLKMRSVEFKENSEIPTSFGSTKSTNYADYSMYDLTWLKWNKGYTEMMNSKCGTAQNFSSAKRNLALESLRSIKY-NLLLKTRH--NEVRNEWMYMGIVIDRLFLIVFTVIVTLGSLIIF 1483
            Y +   L D L  N    Y K + PV +    + V   L +SQ+++V+ K+Q++  NVW++QEW D +  WDP DYGG+T I++PS  IWLPD+VLY NA G ++ S M+  K  VK+DGTI W PP   KS C MDVT+FPFD Q C +K G+WT+ G ++DL                     + +D  +D  D+  + EW++L  T  R  ++      P+  VT+   ++R+ LFY L LI PCL +SFLT++VFYLP+   +K++L  SV ++L +F+LV+ ++ PS+S+ +PLI +YLLF M  VTFSI+ ++ V+N   R   T   ++  +K +FL+ LP  L M               G T    Y D  ++     +  K   +      G  +  + A  ++  ++  S++Y +  +K  H   EV  +W ++  V+DR+FL  F  +  LG+++IF
Sbjct:   11 YVSLAELEDTLLRNVFRGYQKWVRPVFHANDTIAVRFGLKISQLVDVDEKNQLMTTNVWLWQEWTDYKLRWDPEDYGGITSIRVPSENIWLPDIVLYENADGRFEGSLMT--KAIVKYDGTITWTPPASYKSSCTMDVTFFPFDRQNCSMKFGSWTYDGTMVDL---------------------ALVDQHVDRKDFFDNGEWEILDATGRRGSRRDGIYSYPF--VTYSFILKRLPLFYTLFLIIPCLGLSFLTVLVFYLPSDEGEKLSLSTSVLVSLTVFLLVIEEIIPSSSKVIPLIGEYLLFIMIFVTFSIIVTVFVINVHHRSSATYHPMAPWVKSLFLQRLPRLLCMH--------------GHTDRYRYPDMELHSPELKRGMKRGQQRSACGVGVKEEENQAWMSMLEKATSSVRYISRHIKKEHFIREVVQDWKFVAQVLDRIFLWAFLTVSVLGTILIF 440          
BLAST of Acetylcholine receptor subunit alpha-like vs. Ensembl Sea Lamprey
Match: chrna3 (cholinergic receptor, nicotinic, alpha 3 [Source:ZFIN;Acc:ZDB-GENE-070822-1])

HSP 1 Score: 298.13 bits (762), Expect = 2.917e-95
Identity = 151/352 (42.90%), Postives = 221/352 (62.78%), Query Frame = 2
Query:   92 AYSAARNLYDDLFNKAHNYPKLLPVVNLETPVIVYMNLSLSQILEVNVKDQIIVLNVWVYQEWNDNRFSWDPSDYGGLTEIQIPSSMIWLPDLVLYNNAGGDWDLSGMSGSKVKVKHDGTIIWKPPVILKSQCEMDVTYFPFDIQTCPLKMGTWTHHGLLIDLRHWAQKVSDLSNERIKYDNCESKIDYAIDLTDYLQSYEWDLLSVTANRNIKKYPCCPEPYLDVTFHIKIRRMTLFYGLNLIFPCLSISFLTIMVFYLPTYSTQKITLCISVFLALNIFILVVFDLTPSTSRSVPLIVKYLLFTMFMVTFSIVASIAVLNFSFRQPETDKLSDNMKKIFLKTLPTYLKMR 1147
            A  AA  LY  LF   +  P + PV N+  PVIV   +S+SQ+++++  +QI+  N+W+   WND +F W+P  + G+  I++PS  IW PD+VLYNNA GD+ + G   +K  +K+DGT++W PP I KS C++DVTYFPFD Q C +K G+WT+    IDL     K                     I+L D+ +S EW ++ V   ++  KY CC + Y D+T+ + +RR+ LFY +NLI PCL ISFLT++VFYLP+   +K+TL ISV L+L +F+LV+ +  PSTS  +PLI +YLLFTM  VT SIV +I VLN  +R PE   + + ++++FL TLP  + ++
Sbjct:    4 ASEAASRLYKTLFTSYN--PYIRPVFNVSDPVIVRFEVSMSQLVKLDEVNQIMATNLWLKHTWNDYKFQWNPGQFEGMEYIRVPSDKIWKPDIVLYNNADGDFQVEG--KTKALLKYDGTVMWMPPAIFKSSCKIDVTYFPFDYQNCTMKFGSWTYDKAKIDLVLVGTK---------------------INLKDFWESGEWVIIDVPGYKHDIKYNCCEQIYPDITYSVYVRRLPLFYTINLIIPCLLISFLTVLVFYLPSDCGEKVTLSISVLLSLTVFLLVITETIPSTSLVIPLIGEYLLFTMIFVTLSIVITIFVLNVHYRTPEAHTMPNWVRRVFLDTLPKIMLLQ 330          
BLAST of Acetylcholine receptor subunit alpha-like vs. Ensembl Sea Lamprey
Match: chrnb3b (cholinergic receptor, nicotinic, beta 3b (neuronal) [Source:ZFIN;Acc:ZDB-GENE-030102-4])

HSP 1 Score: 288.886 bits (738), Expect = 3.959e-92
Identity = 161/446 (36.10%), Postives = 247/446 (55.38%), Query Frame = 2
Query:  161 PVVNLETPVIVYMNLSLSQILEVNVKDQIIVLNVWVYQEWNDNRFSWDPSDYGGLTEIQIPSSMIWLPDLVLYNNAGGDWDLSGMSGSKVKVKHDGTIIWKPPVILKSQCEMDVTYFPFDIQTCPLKMGTWTHHGLLIDLRHWAQKVSDLSNERIKYDNCESKIDYAIDLTDYLQSYEWDLLSVTANRNIKKYPCCPEPYLDVTFHIKIRRMTLFYGLNLIFPCLSISFLTIMVFYLPTYSTQKITLCISVFLALNIFILVVFDLTPSTSRSVPLIVKYLLFTMFMVTFSIVASIAVLNFSFRQPETDK-LSDNMKKIFLKTLPTYLKMRSVEFKENSEIPTSFGSTKSTNYADYSMYDLTWLKWNKGYTEMMNSKCGTAQNFSSAKRNLALESLRSIKYNLLLKTRHNEVR---NEWMYMGIVIDRLFLIVFTVIVTLGSLIIFL 1486
            PV  L   V V   L ++Q+++V+ K+Q++  NVW+ QEW D    W+P DYGG+  I++P+S IWLPD+VLY+NA G ++  G   +K  VKHDG I W PP I KS C +DVT+FPFD Q C +K G+WT+ G L+DL                       ++  +D  +Y  + EW+ L+ T N+ ++       PY  +T+   IRR+ LFY L LI PCL +SFLT+ VFYLP+   +KI+LC SV ++L +F+LV+ ++ PS+S+ +PLI +YLLF M  VT SI+ ++ V+N   R   T   ++  ++++FL  LP  L MRS                   +   Y+  D    + ++ +       C   ++  SA   L L ++ S++Y      + NEVR    +W ++  V+DR+ L  F  +   GS++IFL
Sbjct:   52 PVDKLSDTVEVKFGLGIAQLVDVDEKNQLMTTNVWLKQEWVDINLRWNPDDYGGINSIRVPASSIWLPDIVLYDNADGRFE--GSIVTKAVVKHDGRIKWTPPAIYKSSCTIDVTFFPFDQQNCSMKFGSWTYDGTLVDL---------------------IMVNSDVDRGEYFDNGEWEFLNATGNKGVRLDGHRFYPY--ITYSFVIRRLPLFYTLFLIVPCLGLSFLTVFVFYLPSDEGEKISLCTSVLVSLTVFLLVIEEIIPSSSKVIPLIGEYLLFIMIFVTLSIIITVFVINVHHRSSSTHHPMAPWVRQLFLHKLPKILCMRS-------------------HVDRYTAPD----EADRDHPGRAGCACHGGESPPSASERLILTAIDSVRYITRHIKKENEVREVVEDWKFVAQVVDRILLWTFLSVSVFGSILIFL 449          
BLAST of Acetylcholine receptor subunit alpha-like vs. Ensembl Sea Lamprey
Match: chrna2a (cholinergic receptor, nicotinic, alpha 2a (neuronal) [Source:ZFIN;Acc:ZDB-GENE-040108-2])

HSP 1 Score: 271.552 bits (693), Expect = 3.211e-84
Identity = 139/312 (44.55%), Postives = 199/312 (63.78%), Query Frame = 2
Query:  212 SQILEVNVKDQIIVLNVWVYQEWNDNRFSWDPSDYGGLTEIQIPSSMIWLPDLVLYNNAGGDWDLSGMSGSKVKVKHDGTIIWKPPVILKSQCEMDVTYFPFDIQTCPLKMGTWTHHGLLIDLRHWAQKVSDLSNERIKYDNCESKIDYAIDLTDYLQSYEWDLLSVTANRNIKKYPCCPEPYLDVTFHIKIRRMTLFYGLNLIFPCLSISFLTIMVFYLPTYSTQKITLCISVFLALNIFILVVFDLTPSTSRSVPLIVKYLLFTMFMVTFSIVASIAVLNFSFRQPETDKLSDNMKKIFLKTLPTYLKMR 1147
            + + + + K+Q++  NVW+ QEW+D +  WDP++Y  +T I++PS +IW+PD+VLYNNA GD+ ++ M+  K  + H G + WKPP I KS C +DVT+FPFD Q C +K G+WT+    IDL   A+ V                     DL DY +S EW ++      N KKY CCP+ Y D+T+   IRR+ LFY +NLI PCL IS LT++VFYLP+   +KITLCISV L+L +F+L++ ++ PSTS  +PLI +YLLFTM  VT SIV ++ VLN   R P T  +   ++++FL  +P +L MR
Sbjct:    8 THLCDCDEKNQMMTTNVWLKQEWDDYKLQWDPAEYENVTSIRVPSELIWVPDIVLYNNADGDFAVTHMT--KAHLFHTGRVRWKPPAIYKSSCSIDVTFFPFDQQNCTMKFGSWTYDKAKIDLVSMARDV---------------------DLKDYWESGEWAIVHAVGTYNTKKYDCCPQVYPDITYSFIIRRLPLFYTINLIIPCLLISCLTVLVFYLPSDCGEKITLCISVLLSLTVFLLLITEIIPSTSLVIPLIGEYLLFTMIFVTLSIVITVFVLNVHHRSPATHAMPRWVRRVFLDRVPRWLVMR 296          
BLAST of Acetylcholine receptor subunit alpha-like vs. Ensembl Sea Lamprey
Match: ENSPMAT00000008550.1 (pep scaffold:Pmarinus_7.0:GL476601:34:38373:1 gene:ENSPMAG00000007717.1 transcript:ENSPMAT00000008550.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 212.231 bits (539), Expect = 2.597e-63
Identity = 135/439 (30.75%), Postives = 212/439 (48.29%), Query Frame = 2
Query:  311 DYGGLTEIQIPSSMIWLPDLVLYNNAGGDWDLSGMSGSKVKVKHDGTIIWKPPVILKSQCEMDVTYFPFDIQTCPLKMGTWTHHGLLIDLRHWAQKVSDLSNERIKYDNCESKIDYAIDLTDYLQSYEWDLLSVTANRNIKKYPCCPEPYLDVTFHIKIRRMTLFYGLNLIFPCLSISFLTIMVFYLPTYSTQKITLCISVFLALNIFILVVFDLTPSTSRSVPLIVKYLLFTMFMVTFSIVASIAVLNFSFRQPETDKLSDNMKKIFLKTLPTYLKMRSVEFKENSEIPTSFGSTKSTNYADYSMYDLTWLKWNK---------GYTEMMNSK----------CGTAQNFSS---------AKRNLA--------------LESLRSIKYNLLLKTRHNEVRNEWMYMGIVIDRLFLIVFTVIVTLGSLIIFLMPPQL 1501
            ++ G+  ++     IW PD++LYN+A   +D +    + V V + G     PP +LKS C +DV +FPFD+Q C LK G+WTH G LIDL+                           D + Y+ + EWDL+ +   RN   Y CC EPY DVT+ + IRR TL+YGLNL+ PC+ IS L+++VF LP  S +KI+L I+V L+L +F+L+V ++ P+TS SVPLI +Y   TM +V FS+V ++ VL +    P+  K+   ++ I L     +L+M+    +E  E+          +     +  L+    +K         G+T     +          CG    F+S         A+R +               L  LR I      +  +  + +EW +   V+DRL L+ FT+   + ++ I +  P  
Sbjct:    2 EHPGVKNLRFQPHQIWTPDILLYNSADERFDAT--FHTNVLVNYTGNCQHLPPGMLKSTCYIDVRWFPFDVQKCDLKFGSWTHDGWLIDLQM-----------------------LEADTSGYIANGEWDLVEIPGKRNELYYDCCQEPYPDVTYTLTIRRRTLYYGLNLLVPCVLISALSLLVFLLPADSGEKISLGITVLLSLTVFMLLVAEIMPATSDSVPLIGQYFASTMIIVAFSVVVTVIVLQYHHHNPDGKKMPQWVRVILLDWCAWFLRMKQ-PGRERHELARRLSILHRNSMVSLDLALLSASGIHKKTNGHGVFIGFTNPDAPQQPPTSDSGVMCGRETCFNSTGPEEEPGNAQRGMPPDPTAGMSSEITKILIELRYIAGRFRTQDENEAIASEWKFAAAVVDRLCLLAFTLFTIISTISILMSAPHF 414          
BLAST of Acetylcholine receptor subunit alpha-like vs. Ensembl Sea Lamprey
Match: chrnb1l (cholinergic receptor, nicotinic, beta 1 (muscle) like [Source:ZFIN;Acc:ZDB-GENE-060811-1])

HSP 1 Score: 206.838 bits (525), Expect = 1.576e-60
Identity = 142/473 (30.02%), Postives = 237/473 (50.11%), Query Frame = 2
Query:   98 SAARNLYDDLFNKAHNYPKLLPVVNLETPVIVYMNLSLSQILEVNVKDQIIVLNVWVYQEWNDNRFSWDPSDYGGLTEIQIPSSMIWLPDLVLYNNAGGDWDLSGMSGSKVKVKHDGTIIWKPPVILKSQCEMDVTYFPFDIQTCPLKMGTWTHHGLLIDLRHWAQKVSDLSNERIKYDNCESKIDYAIDLTDYLQSYEWDLLSVTANRNIKKYPCCPEP-YLDVTFHIKIRRMTLFYGLNLIFPCLSISFLTIMVFYLPTYSTQKITLCISVFLALNIFILVVFDLTPSTSRSVPLIVKYLLFTMFMVTFSIVASIAVLNFSFRQPETDKLSDNMKKIFLKTLPTYLKMRSVEFKENSEIPTSFGSTKSTNYADYSMYD-------LTWLKWNKGYTEMMNSKCGTAQNFSSAKRNL--ALESLRSIKYNLLLKTRHNEVRNEWMYMGIVIDRLFLIVFTVIVTLGSLIIFL 1486
             A  NL  DLF        + P       V V + ++LSQ++ +      + L+  +   W D R SWDP +Y  L  I++    +WLPD+ L NN  G++D  G+    V V + G + W PP I +S C M V YFPFD Q C +   ++T+    I+L +      D   + I++          ID + +  S EW +    + +N        +P Y D+TF++ + R  LFY +N++ PC+ I+   +  FYLP  + +K+ LCISV LAL +F+L++ D  P TS  VP+IV YL+FTM +VT  ++ ++ VLN  FR P T  +   +++IF+ +LP YL +   + +E +         +   + +Y +         L     + G T   +   G  +        L  A++++  I  ++L +   +E++ +W Y+ +V+DR+F I F +I +LG+  IF 
Sbjct:   22 EAEENLLKDLFVVQQYKTLVRPARTATGRVTVRLGMTLSQLISLPACQPDMTLSRLISLSWEDPRLSWDPRNYDNLRSIRLSPKRVWLPDIALSNNNDGNFDF-GLY-VHVLVDYTGAVRWVPPSIYRSSCGMQVKYFPFDWQNCSMVFQSFTYDTSEINLEY----ALDEHRQEIRH--------IIIDESTFPVSGEWQIKHKPSRKNTNPR----DPLYQDITFYLIMERKPLFYIINIVVPCILITICAVFTFYLPPDAGEKMGLCISVLLALTVFLLLLADKVPETSLGVPVIVNYLMFTMVIVTACVILTVIVLNLHFRSPATHIMPYWVRRIFIHSLPKYLWIERPKKEELAPKLPVLTQHQQHCHDEYFIRTPPSQALLLLPTSPSFGMTPFSSELAGPDKLHVVLPPELQSAVDAVHYISEHMLSQKEFDELKEDWQYVAMVVDRIFFITFFLITSLGTFGIFF 476          
BLAST of Acetylcholine receptor subunit alpha-like vs. Ensembl Nematostella
Match: EDO46927 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RNI2])

HSP 1 Score: 249.98 bits (637), Expect = 1.219e-76
Identity = 154/476 (32.35%), Postives = 240/476 (50.42%), Query Frame = 2
Query:  107 RNLYDDLFNKAHNYPKLLPVVNLETPVIVYMNLSLSQILEVNVKDQIIVLNVWVYQEWNDNRFSWDPSDYGGLTEIQIPSSMIWLPDLVLYNNAG-GDWDLSGMSGSKVKVKHDGTIIWKPPVILKSQCEMDVTYFPFDIQTCPLKMGTWTHHGLLIDLRHWAQKVSDLSNERIKYDNCESKIDYAIDLTDYLQSYEWDLLSVTANRNIKKYPCCPEPYLDVTFHIKIRRMTLFYGLNLIFPCLSISFLTIMVFYLPTYSTQKITLCISVFLALNIFILVVFDLTPSTSRSVPLIVKYLLFTMFMVTFSIVASIAVLNFSFRQPETDKLSDNMKKIFLKTLPTYLKMRSVEFKENSEIPT-------SFGSTKST-----NYADYSMYDLTWLKWNKGYTEMMNSKCGTAQNFSSAKRNLALESLRSIKYNLLLKTRHNEVRNEWMYMGIVIDRLFLIVFTVIVTLGSLIIFLMPP 1495
              L +DLF   +   +  PV+N    + V  +++ +Q++ +N KDQI+   VW  Q W +   +WDP  YGGLT I +  +MIW PD+VLY+N G G+        ++  + H+G   W  P  + S C +D+TYFPFD Q C +K G+W++ G  ++L                     SK D A DL+ Y +S EWDLL + A RN+ KY CCP+P++D+TF + IRR  LFY  NLI PC+ ++ LT+  F LP  S ++I L I+++L L +F+LV  +  P TS  +PLI KY    M +V+ S++ +  +L    + P   K+S   KK+  K L   L M+  +  E+S           S G  K T     +   Y       +     Y  +  S+  T  + S  + +  L  +R++  +   +  +  V  EW Y   V+D +F  V  V++   +L  + M P
Sbjct:   28 HRLLNDLFKDYNKEAR--PVLNKSEAIEVQFDMAYAQLINLNSKDQILQSKVWFRQRWVNPFLTWDPKMYGGLTSINVNPNMIWKPDIVLYHNIGFGETGAIYKFDTRATIMHNGYTEWFAPTEIHSICAIDITYFPFDEQFCKMKFGSWSYSGRQLNL--------------------TSKGDSA-DLSKYTKSGEWDLLGMRAVRNVVKYSCCPDPFIDITFTMHIRRKVLFYLTNLIAPCIVLATLTVFSFQLPLESGERIGLVITIWLGLTVFMLVFTENVPRTSEVIPLIGKYSFSVMCVVSCSLIVTCCILKVFNKDPNI-KMSSWFKKLIFKVLGPLLMMKPPKNDESSATRGDKIRSLLSRGKLKGTHLELKDQVPYKTDQRMRVHNGHVYQSVKKSESATVVSNSQEQLDELLHYVRAMAEHWAERETNEHVSGEWRYAATVLDAVFFRVTFVLILGSTLAFYFMIP 479          
BLAST of Acetylcholine receptor subunit alpha-like vs. Ensembl Nematostella
Match: EDO43642 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RY59])

HSP 1 Score: 236.498 bits (602), Expect = 6.044e-74
Identity = 123/305 (40.33%), Postives = 188/305 (61.64%), Query Frame = 2
Query:  113 LYDDLFNKAHNYPKLLPVVNLETPVIVYMNLSLSQILEVNVKDQIIVLNVWVYQEWNDNRFSWDPSDYGGLTEIQIPSSMIWLPDLVLYNNAGGDWDLS-GMSGSKVKVKHDGTIIWKPPVILKSQCEMDVTYFPFDIQTCPLKMGTWTHHGLLIDLRHWAQKVSDLSNERIKYDNCESKIDYAIDLTDYLQSYEWDLLSVTANRNIKKYPCCPEPYLDVTFHIKIRRMTLFYGLNLIFPCLSISFLTIMVFYLPTYSTQKITLCISVFLALNIFILVVFDLTPSTSRSVPLIVKYLLFTMFMVT 1024
            L  DLF+  +  P + PV+   + V V + +SL QI++++ ++QI++ N+WV Q+WN+   +WDP+ +G LT I +    +W PDL+LYNNA  D D +     +KV++K DG+ +W  P+I KS C+ DV YFPFD Q+C LK G+WT+ GL +++                    E+  D  ID   ++ + EW+L  V+ANRN+  Y CC EPY DVTF +KIRR+TLFY +N++ PC  I+ LT++ + LP  S ++ITL ++  LA  +++L+V ++ P  +  VPLI  Y    MFMVT
Sbjct:    5 LLKDLFSNYN--PSVRPVLKATSSVTVQLGVSLHQIIDLDERNQILISNLWVRQKWNNPLLTWDPTHFGNLTSINVDPLRVWRPDLILYNNADRDTDGALDRFYTKVQLKFDGSSLWLAPIIFKSTCKFDVAYFPFDEQSCILKFGSWTYDGLRLNIVP------------------ENGTDIGID--KFVSNGEWELTGVSANRNVMFYDCCVEPYPDVTFTLKIRRLTLFYYMNMLIPCFLITGLTLLSYILPPESGERITLVVTSLLAQAVYLLLVSEIMPPVAEVVPLISIYYTTAMFMVT 287          
BLAST of Acetylcholine receptor subunit alpha-like vs. Ensembl Nematostella
Match: EDO42054 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S2J7])

HSP 1 Score: 236.498 bits (602), Expect = 7.398e-72
Identity = 148/474 (31.22%), Postives = 237/474 (50.00%), Query Frame = 2
Query:   98 SAARNLYDDLFNKAHNY-PKLLPVVNLETPVIVYMNLSLSQILEVNVKDQIIVLNVWVYQEWNDNRFSWDPSDYGGLTEIQIPSSMIWLPDLVLYNNAGGDWDLSGMSGSKVKV--KHDGTIIWKPPVILKSQCEMDVTYFPFDIQTCPLKMGTWTHHGLLIDLRHWAQKVSDLSNERIKYDNCESKIDYAIDLTDYLQSYEWDLLSVTANRNIKKYPCCPEPYLDVTFHIKIRRMTLFYGLNLIFPCLSISFLTIMVFYLPTYSTQKITLCISVFLALNIFILVVFDLTPSTSRSVPLIVKYLLFTMFMVTFSIVASIAVLNFSFRQPETDKLSDNMKKIFLKTLPTYLKMRSVEFKENSEIPTSFGSTKSTNYADYSMYDLTWLKWNKGYTEMMNSKCGTAQNFSSAKRNLALESLRSIKYNLLLKTRHNEVRNEWMYMGIVIDRLFLIVFTVIVTLGSLIIFLMPPQLWSQ 1510
            +A + L  DLF    NY  ++ PV N    V V  +LSL QI+ VN K Q++ ++VW+ Q+W +   +W+ S YGG+  + +  + +W+PD++LYNNA   +   G+   K  V    DGT  W  P    S C ++V YFPFD Q C LK G+WT+ G  + +       SD                 + DL+ Y+ + EW LL++ A  N   Y CC  P+ DVT +++I+R  L+Y  NLI PC  I+ LT++ F+LP  S +K+ L I+V LA+ +F+L+V +  PSTS  +PL+ +Y + TMF+   S+VA+  +LNF  R P T  +   +K I L  +    +   +  +++S IP S  ST                         M++       F+       L+ +  +  ++  +     +R EW    +V+DR+F  +  V   + S +IF   P +  +
Sbjct:   36 TAEKRLLADLF---RNYDSEVRPVFNDSDKVNVEFSLSLIQIIAVNSKSQLVTVSVWIRQKWTNPMLAWNTSKYGGIESVNLNPAKVWIPDIILYNNADETY-AGGLEKYKTSVIASSDGTQEWNSPASFTSTCNINVRYFPFDSQNCSLKFGSWTYVGNRLTM----TSTSD-----------------SADLSKYVNNGEWHLLAMPAKLNRVFYNCCKYPFYDVTLYLEIQRKPLYYVFNLIIPCALIATLTLIKFFLPPESGEKVGLGITVLLAMTVFLLLVAETLPSTSDHIPLLGQYFVATMFVTAISLVATCLILNFFHRNPSTSPMPHWVKVIILDYMARSPRNARL-MRDDSVIPPSGRSTPCER-------------------RRMSTVSSQLNPFTER----LLDDINVLAEDVRARQEDERLREEWRCAALVLDRMFFWIMLVTSLMTSFMIFYRDPVMGGE 460          
BLAST of Acetylcholine receptor subunit alpha-like vs. Ensembl Nematostella
Match: EDO42072 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S2P1])

HSP 1 Score: 231.876 bits (590), Expect = 1.259e-71
Identity = 133/339 (39.23%), Postives = 196/339 (57.82%), Query Frame = 2
Query:  140 HNYPK-LLPVVNLETPVIVYMNLSLSQILEVNVKDQIIVLNVWVYQEWNDNRFSWDPSDYGGLTEIQIPSSMIWLPDLVLYNNAGGDWDLS-GMSGSKVKVKHDGTIIWKPPVILKSQCEMDVTYFPFDIQTCPLKMGTWTHHGLLIDLRHWAQKVSDLSNERIKYDNCESKIDYAIDLTDYLQSYEWDLLSVTANRNIKKYPCCPEPYLDVTFHIKIRRMTLFYGLNLIFPCLSISFLTIMVFYLPTYSTQKITLCISVFLALNIFILVVFDLTPSTSRSVPLIVKYLLFTMFMVTFSIVAS-IAVLNFSFRQPETDKLSDNMKKIFLKTLPTYLKMR 1147
             NY K L PVVN    + V + L+L QI  +  K Q +  ++WV Q W +   +WDP ++GG++ I +    +W+PD+ LYNNA  D D +    G+++K+  +G  IW  PV+L S C++DVTYFPFD Q C LK G+WT+ G  +DL      VS+  +                D++ Y+ S +WDL+S TA RN   Y CCP+ Y DVTF + IRR T+FY +NLI PC  I+ LT++ F+LP  S ++ITL I+  LA+ +F+L+V D  P TS  VPLI  Y   TM  V  ++VA+ +  L   F  P T ++   ++ + LK L    +++
Sbjct:   10 ENYNKHLRPVVNKSRALTVRLGLTLHQIASLVEKSQFLQTSLWVRQMWRNEYLTWDPKEFGGISTINVNVDKVWVPDIYLYNNADADGDGALNKFGTQIKLLFNGINIWLAPVLLTSSCKIDVTYFPFDEQHCSLKFGSWTYDGERLDL------VSESPSG---------------DVSKYVPSGQWDLVSFTAKRNEIFYVCCPQSYPDVTFTLNIRRKTIFYYMNLIMPCFLITGLTLLSFFLPPESGERITLVITNLLAMTVFMLLVADWLPPTSEVVPLISMYYTLTMMEVGLALVATCLDYLKCYFMNPVTTEMPFLVRLLVLKWLAKLTRVK 327          
BLAST of Acetylcholine receptor subunit alpha-like vs. Ensembl Nematostella
Match: EDO39537 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S9T8])

HSP 1 Score: 230.72 bits (587), Expect = 1.706e-70
Identity = 131/421 (31.12%), Postives = 210/421 (49.88%), Query Frame = 2
Query:  236 KDQIIVLNVWVYQEWNDNRFSWDPSDYGGLTEIQIPSSMIWLPDLVLYNNAGG-DWDLSGMSGSKVKVKHDGTIIWKPPVILKSQCEMDVTYFPFDIQTCPLKMGTWTHHGLLIDLRHWAQKVSDLSNERIKYDNCESKIDYAIDLTDYLQSYEWDLLSVTANRNIKKYPCCPEPYLDVTFHIKIRRMTLFYGLNLIFPCLSISFLTIMVFYLPTYSTQKITLCISVFLALNIFILVVFDLTPSTSRSVPLIVKYLLFTMFMVTFSIVASIAVLNFSFRQPETDKLSDNMKKIFLKTLPTYLKMRSVEFKENSEIPTSFGSTKSTNYADYSMYDLTWLKWNKGYTEMMNSKCGTAQNFSSAKRNLALESLRSIKYNLLLKTRHNE-VRNEWMYMGIVIDRLFLIVFTVIVTLGSLIIFLMP 1492
            ++QI+  NVWV Q W D    WDP+ +GG+T I +  S +W PD+VLYNN    D     +  +KV +   G I W  P ILK+ C++D+ YFPFD QTC L  G+WT++GL ID+  +                         D++ Y Q+ EW+L+S  A RN+ KY CCPEPY D+T+ IKI+R ++FY  NLI PC+ ++ LT + F  P  + ++I+L ++V L + +F+++  +  P+TS + PLI KY    +  ++  ++A+   L      P T+ +    K I    + T    +    K+ + +               +  +L   K  KG  E  N +    +   S   + A ++  ++      K  H E  + EW    +++DRLF  +F +   + S  I L P
Sbjct:    3 RNQILTTNVWVRQTWTDAWLKWDPAKHGGITAINVDPSFLWKPDMVLYNNVNDEDRGEQYLFNTKVIIYSTGDIEWYSPNILKTHCKIDIQYFPFDTQTCKLTFGSWTYNGLKIDVTFFRGIA-------------------GADISTYSQNGEWELVSADAVRNVVKYSCCPEPYQDLTYKIKIKRRSMFYVNNLILPCILLALLTGLSFLFPPETGERISLVVTVLLGMTVFMIIFTEAIPATSEATPLIGKYFAAVLIEISLCLLATCVPLRLHHHHPGTE-VPPWAKFIIFDIIGTLCCYKCGRKKQKTNV---------------NFIELETEKHKKGNGEATNVRARNPRMQFSPSLDRAEDNSLAVMTRHYEKVHHEERCKAEWKDAIVILDRLFFWLFVLTFCISSFAILLAP 388          
BLAST of Acetylcholine receptor subunit alpha-like vs. Ensembl Medaka
Match: ENSORLT00000017941.2 (neuronal acetylcholine receptor subunit alpha-3-like [Source:NCBI gene;Acc:101168601])

HSP 1 Score: 318.546 bits (815), Expect = 1.334e-102
Identity = 180/485 (37.11%), Postives = 266/485 (54.85%), Query Frame = 2
Query:  101 AARNLYDDLFNKAHNYPKLLPVVNLETPVIVYMNLSLSQILEVNVKDQIIVLNVWVYQEWNDNRFSWDPSDYGGLTEIQIPSSMIWLPDLVLYNNAGGDWDLSGMSGSKVKVKHDGTIIWKPPVILKSQCEMDVTYFPFDIQTCPLKMGTWTHHGLLIDLRHWAQKVSDLSNERIKYDNCESKIDYAIDLTDYLQSYEWDLLSVTANRNIKKYPCCPEPYLDVTFHIKIRRMTLFYGLNLIFPCLSISFLTIMVFYLPTYSTQKITLCISVFLALNIFILVVFDLTPSTSRSVPLIVKYLLFTMFMVTFSIVASIAVLNFSFRQPETDKLSDNMKKIFLKTLPTYLKMRSVEFKENSEIPTSFGSTKSTNYADYSMYDLTWLKWNKGYT-------------------EMMNSKCGTAQNFS--SAKRNLALESLRSIKYNLLLKTRHNEVRNEWMYMGIVIDRLFLIVFTVIVTLGSLIIFLMP 1492
            A   L+  LF + + +  + PV N+  PV V   +S+SQ+++V+  +QI+  N+W+   WND +  W P+++ G+  I++PS+ IW PD+VLYNNA GD+ +     +K  +K DGTI W PP I KS C MD+TYFPFD Q C +K G+WT+    IDL     KV                     +L D+ +S EW+++     ++  KY CC E Y D+T+   IRR+ LFY +NLI PCL ISFLT++VFYLP+   +K+TLCISV L+L +F+LV+ +  PSTS  +PLI +YLLFTM  VT SIV ++ VLN  +R P T  +   +  +FLK LP  + MR      + +     GS     Y D  +  +      K                      ++      T   FS  S +   A+ES++ I  N+  + +  EV ++W Y+ +VIDR+FL VF  +  LG++ +FL P
Sbjct:   28 AEDRLFRKLFRRYNQF--IRPVENVSDPVTVEFEVSISQLVKVDEVNQIMETNLWLRHIWNDYKLRWTPAEFDGIEFIRVPSNKIWRPDIVLYNNAVGDFLVE--DKTKALLKFDGTITWVPPAIFKSSCPMDITYFPFDYQNCSMKFGSWTYDKAKIDLVLIGSKV---------------------NLKDFWESGEWEIIDAPGYKHDIKYNCCEEIYPDITYSFYIRRLPLFYTINLIIPCLLISFLTVLVFYLPSDCGEKVTLCISVLLSLTVFLLVITETIPSTSLVIPLIGEYLLFTMIFVTLSIVITVFVLNVHYRTPMTHTMPGWVHLVFLKVLPRIMLMRR---PTDEDGKVGGGSLNCLEYGDCKLSSMDGCGAKKCPCPCQHGRETPETAASVRMKHQLSQQSINTVVAFSVVSPEVKQAIESVKYIAENMRSRNKAKEVEDDWKYVAMVIDRIFLWVFVTVCLLGTMGLFLQP 484          
BLAST of Acetylcholine receptor subunit alpha-like vs. Ensembl Medaka
Match: chrna5 (neuronal acetylcholine receptor subunit alpha-5 [Source:NCBI gene;Acc:101173433])

HSP 1 Score: 288.5 bits (737), Expect = 4.525e-91
Identity = 165/486 (33.95%), Postives = 269/486 (55.35%), Query Frame = 2
Query:   68 AIKICVTTAYSAARN-LYDDLFNKAHNYPKLLPVVNLETPVIVYMNLSLSQILEVNVKDQIIVLNVWVYQEWNDNRFSWDPSDYGGLTEIQIPSSMIWLPDLVLYNNAGGDWDLSGMSGSKVKVKHDGTIIWKPPVILKSQCEMDVTYFPFDIQTCPLKMGTWTHHGLLIDLRHWAQKVSDLSNERIKYDNCESKIDYAIDLTDYLQSYEWDLLSVTANRNIKKYPCCPEPYLDVTFHIKIRRMTLFYGLNLIFPCLSISFLTIMVFYLPTYSTQKITLCISVFLALNIFILVVFDLTPSTSRSVPLIVKYLLFTMFMVTFSIVASIAVLNFSFRQPETDK-LSDNMKKIFLKTLPTYLKMRSVEFKENSEIPTSFGSTKSTNYADYSMYDLTWLKWNKGYTEMMNSKCGTAQNFSSAKRNLALESLRSIKYNLLLKTRHNEVRNEWMYMGIVIDRLFLIVFTVIVTLGSLIIFLMPPQLWSQQLV 1519
            ++++   ++Y+ A + L+  LF     + +  P+  L   + V   L++SQ+++V+ K Q++  NVW+ QEW D +  W P DY G+T I++PS  IWLPD+VLY+N+ G ++    + +K  VK+DGTI W PP   KS C +DVT+FPFD+Q C +K G+WT+ G  +D+                        D+ +D  DY  + EW+++  T +R ++       P   +T+   IRR+ LFY L LI PC+ +SFLTI+VFYLP+   +KI+LC SV ++L +F+LV+ ++ PS+S+++PLI +YL+FTM  VT SI+ ++  +N  +R   T   ++  +++IFL  LP  L MRS   +  +      G          S  DLT +               T  N  +     ALES+R I  +++ + +  EV  +W Y+  V+DR+FL  F ++  LGS ++F+     W+  +V
Sbjct:   29 SLRVPKLSSYAKAEDTLFKHLFGTYQKWVR--PIEYLNQTIPVKFGLAISQLVDVDEKKQLMTTNVWLKQEWIDMKLRWKPEDYLGITTIRVPSDRIWLPDVVLYDNSDGRFE---GTVTKAVVKYDGTISWNPPANFKSACTIDVTFFPFDLQNCSMKFGSWTYDGSQVDI---------------------ILEDFHVDKKDYFDNGEWEIVKATGSRGLRTDGSTSYP--TITYFFIIRRLPLFYTLFLIIPCIGLSFLTILVFYLPSNGNEKISLCTSVLVSLTVFLLVIEEIIPSSSKAIPLIGEYLVFTMIFVTLSIIITVFAINIHYRSSSTHHDMAPWVRRIFLHRLPKLLCMRSHVDRYATAGLAGKGKVTVQEKTKDSTPDLTHI-------------LHTRHNLQT-----ALESIRYITMHVVKENQVREVVQDWKYVAQVLDRMFLWAFFLVSVLGSALLFVPVIYKWASIIV 468          
BLAST of Acetylcholine receptor subunit alpha-like vs. Ensembl Medaka
Match: chrna2b (neuronal acetylcholine receptor subunit alpha-2 [Source:NCBI gene;Acc:101155076])

HSP 1 Score: 286.96 bits (733), Expect = 8.758e-90
Identity = 152/349 (43.55%), Postives = 218/349 (62.46%), Query Frame = 2
Query:  101 AARNLYDDLFNKAHNYPKLLPVVNLETPVIVYMNLSLSQILEVNVKDQIIVLNVWVYQEWNDNRFSWDPSDYGGLTEIQIPSSMIWLPDLVLYNNAGGDWDLSGMSGSKVKVKHDGTIIWKPPVILKSQCEMDVTYFPFDIQTCPLKMGTWTHHGLLIDLRHWAQKVSDLSNERIKYDNCESKIDYAIDLTDYLQSYEWDLLSVTANRNIKKYPCCPEPYLDVTFHIKIRRMTLFYGLNLIFPCLSISFLTIMVFYLPTYSTQKITLCISVFLALNIFILVVFDLTPSTSRSVPLIVKYLLFTMFMVTFSIVASIAVLNFSFRQPETDKLSDNMKKIFLKTLPTYLKMR 1147
            A   L+  LF   + + +  PV N+   VIV   LS++Q+++V+ K+Q++  NVW+ QEWND +  W PSDY  +T I++PS +IW+PD+VLYNNA G++ ++ M+  K  + H G + W PP I KS C +DVT+FPFD Q C +K G+WT+    IDL                      +I+  +DL +Y +S EW +++     N KKY CC E Y D+T+   IRR+ LFY +NLI PCL IS LT++VFYLP+   +KITLCISV L+L +F+L++ ++ PSTS  +PLI +YLLFTM  VT SIV ++ VLN   R P T K+   +  +FL  +P +L MR
Sbjct:   43 AEEELFQTLFTGYNKWSR--PVPNISDVVIVKFGLSIAQLIDVDEKNQMMTTNVWLKQEWNDYKLRWKPSDYDNVTSIRVPSELIWVPDIVLYNNADGEFAVTHMT--KAHLFHTGKVRWVPPAIYKSSCSIDVTFFPFDQQNCKMKFGSWTYDKAKIDLE---------------------RIENTVDLNNYWESGEWAIINAVGTYNTKKYDCCHEIYPDITYFFIIRRLPLFYTINLIIPCLLISCLTVLVFYLPSDCGEKITLCISVLLSLTVFLLLITEIIPSTSLVIPLIGEYLLFTMIFVTLSIVITVFVLNVHHRSPSTHKMPRWVHTVFLDLIPRWLFMR 366          
BLAST of Acetylcholine receptor subunit alpha-like vs. Ensembl Medaka
Match: chrna2b (neuronal acetylcholine receptor subunit alpha-2 [Source:NCBI gene;Acc:101155076])

HSP 1 Score: 286.96 bits (733), Expect = 8.758e-90
Identity = 152/349 (43.55%), Postives = 218/349 (62.46%), Query Frame = 2
Query:  101 AARNLYDDLFNKAHNYPKLLPVVNLETPVIVYMNLSLSQILEVNVKDQIIVLNVWVYQEWNDNRFSWDPSDYGGLTEIQIPSSMIWLPDLVLYNNAGGDWDLSGMSGSKVKVKHDGTIIWKPPVILKSQCEMDVTYFPFDIQTCPLKMGTWTHHGLLIDLRHWAQKVSDLSNERIKYDNCESKIDYAIDLTDYLQSYEWDLLSVTANRNIKKYPCCPEPYLDVTFHIKIRRMTLFYGLNLIFPCLSISFLTIMVFYLPTYSTQKITLCISVFLALNIFILVVFDLTPSTSRSVPLIVKYLLFTMFMVTFSIVASIAVLNFSFRQPETDKLSDNMKKIFLKTLPTYLKMR 1147
            A   L+  LF   + + +  PV N+   VIV   LS++Q+++V+ K+Q++  NVW+ QEWND +  W PSDY  +T I++PS +IW+PD+VLYNNA G++ ++ M+  K  + H G + W PP I KS C +DVT+FPFD Q C +K G+WT+    IDL                      +I+  +DL +Y +S EW +++     N KKY CC E Y D+T+   IRR+ LFY +NLI PCL IS LT++VFYLP+   +KITLCISV L+L +F+L++ ++ PSTS  +PLI +YLLFTM  VT SIV ++ VLN   R P T K+   +  +FL  +P +L MR
Sbjct:   43 AEEELFQTLFTGYNKWSR--PVPNISDVVIVKFGLSIAQLIDVDEKNQMMTTNVWLKQEWNDYKLRWKPSDYDNVTSIRVPSELIWVPDIVLYNNADGEFAVTHMT--KAHLFHTGKVRWVPPAIYKSSCSIDVTFFPFDQQNCKMKFGSWTYDKAKIDLE---------------------RIENTVDLNNYWESGEWAIINAVGTYNTKKYDCCHEIYPDITYFFIIRRLPLFYTINLIIPCLLISCLTVLVFYLPSDCGEKITLCISVLLSLTVFLLLITEIIPSTSLVIPLIGEYLLFTMIFVTLSIVITVFVLNVHHRSPSTHKMPRWVHTVFLDLIPRWLFMR 366          
BLAST of Acetylcholine receptor subunit alpha-like vs. Ensembl Medaka
Match: chrna6 (neuronal acetylcholine receptor subunit alpha-3 [Source:NCBI gene;Acc:101162933])

HSP 1 Score: 288.115 bits (736), Expect = 1.316e-89
Identity = 149/349 (42.69%), Postives = 216/349 (61.89%), Query Frame = 2
Query:  161 PVVNLETPVIVYMNLSLSQILEVNVKDQIIVLNVWVYQEWNDNRFSWDPSDYGGLTEIQIPSSMIWLPDLVLYNNAGGDWDLSGMSGSKVKVKHDGTIIWKPPVILKSQCEMDVTYFPFDIQTCPLKMGTWTHHGLLIDLRHWAQKVSDLSNERIKYDNCESKIDYAIDLTDYLQSYEWDLLSVTANRNIKKYPCCPEPYLDVTFHIKIRRMTLFYGLNLIFPCLSISFLTIMVFYLPTYSTQKITLCISVFLALNIFILVVFDLTPSTSRSVPLIVKYLLFTMFMVTFSIVASIAVLNFSFRQPETDKLSDNMKKIFLKTLPTYLKMRS-VEFKENSEIPTSFGSTKS 1204
            PV N+  PV V   +S+SQ+++V+  +QI+  N+W+   WND +  W P++Y G+  I++PS+ IW PD+VLYNNA GD+ ++    +K  +K DGTI W PP I KS C MD+TYFPFD Q C +K G+WT+    IDL     KV                     +L D+ +S EW+++     ++  KY CC E Y D+T+   IRR+ LFY +NLI PCL ISFLT++VFYLP+   +K+TLCISV L+L +F+LV+ +  PSTS  +PLI +YLLFTM  VT SIV ++ VLN  +R P T  + D ++ +FL  LP  + MR  ++   +S    + G+T++
Sbjct:   80 PVENVSDPVTVEFEVSISQLVKVDEVNQIMETNLWLRHVWNDYKLKWTPAEYDGIEFIRVPSNRIWRPDIVLYNNAVGDFLVA--DKTKALLKFDGTITWVPPAIFKSSCPMDITYFPFDYQNCSMKFGSWTYDKAKIDLVLIGSKV---------------------NLKDFWESGEWEIIDAPGYKHDIKYNCCEEIYTDITYSFYIRRLPLFYTINLIIPCLLISFLTVLVFYLPSDCGEKVTLCISVLLSLTVFLLVITETIPSTSLVIPLIGEYLLFTMIFVTLSIVITVFVLNVHYRTPMTHTMPDWVRSVFLGLLPRVMLMRRPIDQSCSSPARCTGGTTRA 405          

HSP 2 Score: 51.9878 bits (123), Expect = 1.238e-6
Identity = 22/55 (40.00%), Postives = 36/55 (65.45%), Query Frame = 2
Query: 1328 ALESLRSIKYNLLLKTRHNEVRNEWMYMGIVIDRLFLIVFTVIVTLGSLIIFLMP 1492
            A+ES++ I  NL  + +  EV ++W Y+ +VIDR+FL VF  +  LG++ +F  P
Sbjct:  534 AIESVKYIAENLRTRNKAKEVEDDWKYVAMVIDRIFLWVFVTVCVLGTVGLFFQP 588          
BLAST of Acetylcholine receptor subunit alpha-like vs. Planmine SMEST
Match: SMESG000056721.1 (SMESG000056721.1)

HSP 1 Score: 1058.51 bits (2736), Expect = 0.000e+0
Identity = 515/517 (99.61%), Postives = 515/517 (99.61%), Query Frame = 2
Query:   29 MQILKFYFLLSFVAIKICVTTAYSAARNLYDDLFNKAHNYPKLLPVVNLETPVIVYMNLSLSQILEVNVKDQIIVLNVWVYQEWNDNRFSWDPSDYGGLTEIQIPSSMIWLPDLVLYNNAGGDWDLSGMSGSKVKVKHDGTIIWKPPVILKSQCEMDVTYFPFDIQTCPLKMGTWTHHGLLIDLRHWAQKVSDLSNERIKYDNCESKIDYAIDLTDYLQSYEWDLLSVTANRNIKKYPCCPEPYLDVTFHIKIRRMTLFYGLNLIFPCLSISFLTIMVFYLPTYSTQKITLCISVFLALNIFILVVFDLTPSTSRSVPLIVKYLLFTMFMVTFSIVASIAVLNFSFRQPETDKLSDNMKKIFLKTLPTYLKMRSVEFKENSEIPTSFGSTKSTNYADYSMYDLTWLKWNKGYTEMMNSKCGTAQNFSSAKRNLALESLRSIKYNLLLKTRHNEVRNEWMYMGIVIDRLFLIVFTVIVTLGSLIIFLMPPQLWSQQLVLNSKDAAQMLANSNYTRLCK 1579
            MQILKFYFLLSFVAIKICVTTAYSAARNLYDDLFNKAHNYPKLLPVVNLETPVIVYMNLSLSQILEVNVKDQIIVLNVWVYQEWNDNRFSWDPSDYGGLTEIQIPSSMIWLPDLVLYNNAGGDWDLSGMSGSKVKVKHDGTIIWKPPVILKSQCEMDVTYFPFDIQTCPLKMGTWTHHGLLIDLRHWAQKVSDLSNERIKYDNCESKIDYAIDLTDYLQSYEWDLLSVTANRNIKKYPCCPEPYLDVTFHIKIRRMTLFYGLNLIFPCLSISFLTIMVFYLPTYSTQKITLCISVFLALNIFILVVFDLTPSTSRSVPLIVKYLLFTMFMVTFSIVASIAVLNFSFRQPETDKLSDNMKKIFLKTLPTYLKMRSVEFKENSEIPTSFGSTKSTNYADYSMYDLTWLKWNKGYTEMMNSK GTAQNFSSAKRNLALESLRSIKYNLLLKTR NEVRNEWMYMGIVIDRLFLIVFTVIVTLGSLIIFLMPPQLWSQQLVLNSKDAAQMLANSNYTRLCK
Sbjct:    1 MQILKFYFLLSFVAIKICVTTAYSAARNLYDDLFNKAHNYPKLLPVVNLETPVIVYMNLSLSQILEVNVKDQIIVLNVWVYQEWNDNRFSWDPSDYGGLTEIQIPSSMIWLPDLVLYNNAGGDWDLSGMSGSKVKVKHDGTIIWKPPVILKSQCEMDVTYFPFDIQTCPLKMGTWTHHGLLIDLRHWAQKVSDLSNERIKYDNCESKIDYAIDLTDYLQSYEWDLLSVTANRNIKKYPCCPEPYLDVTFHIKIRRMTLFYGLNLIFPCLSISFLTIMVFYLPTYSTQKITLCISVFLALNIFILVVFDLTPSTSRSVPLIVKYLLFTMFMVTFSIVASIAVLNFSFRQPETDKLSDNMKKIFLKTLPTYLKMRSVEFKENSEIPTSFGSTKSTNYADYSMYDLTWLKWNKGYTEMMNSKSGTAQNFSSAKRNLALESLRSIKYNLLLKTRRNEVRNEWMYMGIVIDRLFLIVFTVIVTLGSLIIFLMPPQLWSQQLVLNSKDAAQMLANSNYTRLCK 517          
BLAST of Acetylcholine receptor subunit alpha-like vs. Planmine SMEST
Match: SMESG000020665.1 (SMESG000020665.1)

HSP 1 Score: 455.677 bits (1171), Expect = 2.769e-156
Identity = 231/477 (48.43%), Postives = 330/477 (69.18%), Query Frame = 2
Query:   56 LSFVAIKICVTTAYSAARNLYDDLFNKAHNYPKLLPVVNLETPVIVYMNLSLSQILEVNVKDQIIVLNVWVYQEWNDNRFSWDPSDYGGLTEIQIPSSMIWLPDLVLYNNAGGDWDLSGMSGSKVKVKHDGTIIWKPPVILKSQCEMDVTYFPFDIQTCPLKMGTWTHHGLLIDLRHWAQKVSDLSNERIKYDNCESKIDYAIDLTDYLQSYEWDLLSVTANRNIKKYPCCPEPYLDVTFHIKIRRMTLFYGLNLIFPCLSISFLTIMVFYLPTYSTQKITLCISVFLALNIFILVVFDLTPSTSRSVPLIVKYLLFTMFMVTFSIVASIAVLNFSFRQPETDKLSDNMKKIFLKTLPTYLKMR--SVEFKENS--EIPTSFGSTKSTNYADYSMYDLTWLKWNKGYTEMMNSKCGTAQNFSSAKRNLALESLRSIKYNLLLKTRHNEVRNEWMYMGIVIDRLFLIVFTVIVTLGSL 1474
            L F+   I +      AR LYDDL  +    P + PV +  + V++YMNLSL QIL+V+ K+QIIVLN+WV QEWND  F WDP+DYG +TE+ IPS  IW PDLVLYNNAGGDWDL+  S +KV V HDG+++WKPP+I KSQC ++V +FPFD Q C LK+GTWTH+G LIDLRH AQK    +  +  +DNC +KIDYAIDL+ Y+ + EWDLL V+A RNI+ YPCC EPYLD++F++ +RR TLFYG+NLI PCL+ISFLTI+VFYLP  S +K++L IS+ L+L +F L++FD++P TS  VPLI+KYLLFTM +VT S++A++ VLN  +R P+T K++  ++ +F  TLP  L M+    ++++N   +IP +F   ++    D ++ D    KW+         +   + +    +  LALE +R I +++  +  ++ +R++W Y+ +V+DRLFL +F++   +G L
Sbjct:    4 LGFLFGLIFIVQGTKDARRLYDDLMRRRGYDPSVRPVKSYTSTVLLYMNLSLVQILDVDEKNQIIVLNMWVNQEWNDPNFVWDPNDYGNVTELNIPSREIWTPDLVLYNNAGGDWDLASSSNTKVIVNHDGSVLWKPPIIFKSQCGINVEFFPFDKQLCDLKIGTWTHNGFLIDLRHTAQK----NQSQASFDNCNAKIDYAIDLSQYVNNVEWDLLEVSAKRNIEFYPCCTEPYLDISFNVSLRRRTLFYGINLICPCLAISFLTILVFYLPADSGEKVSLSISILLSLTVFFLLIFDISPPTSIVVPLILKYLLFTMILVTLSVMATVLVLNIHWRSPDTHKMAPWVRSVFTSTLPKLLFMKKPDQDYRDNETDDIPETFHEDET----DSNIQD----KWS-------TRRAAVSGDNVVNEIELALEGVRRIVHHIKKENSYSAMRDDWKYVAVVLDRLFLWLFSIAAIIGML 461          
BLAST of Acetylcholine receptor subunit alpha-like vs. Planmine SMEST
Match: SMESG000014741.1 (SMESG000014741.1)

HSP 1 Score: 299.671 bits (766), Expect = 1.121e-94
Identity = 188/539 (34.88%), Postives = 304/539 (56.40%), Query Frame = 2
Query:   47 YFLLSFVAIKICVTTAYSAARNLYDDLFNKAHNYPKLLPVVNLETPVI-VYMNLSLSQILEVNVKDQIIVLNVWVYQEWNDNRFSWDPSDYGGLTEIQIPSSMIWLPDLVLYNNAGGDWDLSGMSGSKVKVKHDGTIIWKPPVILKSQCEMDVTYFPFDIQTCPLKMGTWTHHGLLIDLRHWAQK-VSDLSNERIKYDNCESKIDYAIDLTDYLQSYEWDLLSVTANRNIKKYPCCPEPYLDVTFHIKIRRMTLFYGLNLIFPCLSISFLTIMVFYLPTYSTQKITLCISVFLALNIFILVVFDLTPSTSRSVPLIVKYLLFTMFMVTFSIVASIAVLNFSFRQPETDKLSDNMKKIFLKTLPTYL-------KMRSVEFKENSEIPTSFGSTK-----STNYADYSMYDLTWLKW---NKGYTEMMNSKCGTAQNFSSAKRNL--------------------------ALESLRSIKYNLLLKTRHNEVRNEWMYMGIVIDRLFLIVFTVIVTLGSLIIFLMPPQLWSQQLVLNSKD 1534
            +FL++   + I +  AY  A  LY  L + + NY   +  VN    V+ VY+ L LSQ+ EVN++ + +  NVW+ Q+W D    W+P+ YGG+T++ IPS  IWLPD+VL+NN  G +++S    +K  V HDGT+ W PP I KS C+++V +FP+DIQ C L   +WT+ G  ++L+H AQK V D+ N     +     ID+A+DLT++ +S E+D+L ++A R++  Y    +P   VTF I +RR TLFY +NL+ PCL+I FL+++ FYLP+ S +K+ L I++  +L +F L++ +  PSTS  +PLI KYLLFTM +++ SI+ ++ +LN  FR   +  + D +K+IFL TLP  L        +R    K NS+  T F +T+     ++N   YS Y   ++     N  +T  + ++  TAQ     KR +                          A++ ++ +   L      N+++ +W ++ +V+DRLFL  F+    + +L I L  P L+  +  ++S +
Sbjct:    5 FFLIAVFYVLIPINHAYKDAIRLYKVLMDGS-NYSNYIRPVNYNNDVLTVYLGLRLSQLSEVNMRKETVTTNVWLEQQWIDVNLRWNPNQYGGVTKLYIPSDKIWLPDIVLFNNIDGKYEIS--IKTKATVFHDGTVKWIPPAIYKSSCQINVEFFPYDIQECFLTFASWTYEGSKVNLKHMAQKNVIDIPNATGMVN-----IDFAVDLTNFYESVEFDILELSAERSLVTYL---QPSPKVTFKILMRRKTLFYTVNLMMPCLAICFLSVLAFYLPSESGEKVYLSITILFSLTLFFLLLVETIPSTSLVIPLIGKYLLFTMILISLSIILTVYILNVHFRSSLSHDMPDWVKQIFLITLPRLLLIDRPKKTIRPKPCKHNSKCSTKFVATENNQPCTSNNTSYS-YQYRYMPADASNYTFTSHL-TQDSTAQWSVEPKRKVYRSSKQSSKSQLKPDSENELDWKIDRAIDEVQFVANQLRADDESNDIKEDWKFVAMVMDRLFLWTFSSACLMSTLGIILQSPALYDTRKPIHSNN 530          
BLAST of Acetylcholine receptor subunit alpha-like vs. Planmine SMEST
Match: SMESG000014741.1 (SMESG000014741.1)

HSP 1 Score: 300.056 bits (767), Expect = 3.199e-94
Identity = 188/540 (34.81%), Postives = 303/540 (56.11%), Query Frame = 2
Query:   47 YFLLSFVAIKICVTTAYSAARNLYDDLFNKAHNYPKLLPVVNLETPVI-VYMNLSLSQILEVNVKDQIIVLNVWVYQEWNDNRFSWDPSDYGGLTEIQIPSSMIWLPDLVLYNNAGGDWDLSGMSGSKVKVKHDGTIIWKPPVILKSQCEMDVTYFPFDIQTCPLKMGTWTHHGLLIDLRHWAQK-VSDLSNERIKYDNCESKIDYAIDLTDYLQSYEWDLLSVTANRNIKKYPCCPEPYLDVTFHIKIRRMTLFYGLNLIFPCLSISFLTIMVFYLPTYSTQKITLCISVFLALNIFILVVFDLTPSTSRSVPLIVKYLLFTMFMVTFSIVASIAVLNFSFRQPETDKLSDNMKKIFLKTLPTYL-------KMRSVEFKENSEIPTSFGSTK-----STNYADYSMYDLTWLKW---NKGYTEMMNSKCGTAQNFSSAKRNL--------------------------ALESLRSIKYNLLLKTRHNEVRNEWMYMGIVIDRLFLIVFTVIVTLGSLIIFLMPPQLWSQQLVLNSKDA 1537
            +FL++   + I +  AY  A  LY  L + + NY   +  VN    V+ VY+ L LSQ+ EVN++ + +  NVW+ Q+W D    W+P+ YGG+T++ IPS  IWLPD+VL+NN  G +++S    +K  V HDGT+ W PP I KS C+++V +FP+DIQ C L   +WT+ G  ++L+H AQK V D+ N           ID+A+DLT++ +S E+D+L ++A R++  Y    +P   VTF I +RR TLFY +NL+ PCL+I FL+++ FYLP+ S +K+ L I++  +L +F L++ +  PSTS  +PLI KYLLFTM +++ SI+ ++ +LN  FR   +  + D +K+IFL TLP  L        +R    K NS+  T F +T+     ++N   YS Y   ++     N  +T  + ++  TAQ     KR +                          A++ ++ +   L      N+++ +W ++ +V+DRLFL  F+    + +L I L  P L+  +  ++S + 
Sbjct:   53 FFLIAVFYVLIPINHAYKDAIRLYKVLMDGS-NYSNYIRPVNYNNDVLTVYLGLRLSQLSEVNMRKETVTTNVWLEQQWIDVNLRWNPNQYGGVTKLYIPSDKIWLPDIVLFNNIDGKYEIS--IKTKATVFHDGTVKWIPPAIYKSSCQINVEFFPYDIQECFLTFASWTYEGSKVNLKHMAQKNVIDIPNA-----TGMVNIDFAVDLTNFYESVEFDILELSAERSLVTYL---QPSPKVTFKILMRRKTLFYTVNLMMPCLAICFLSVLAFYLPSESGEKVYLSITILFSLTLFFLLLVETIPSTSLVIPLIGKYLLFTMILISLSIILTVYILNVHFRSSLSHDMPDWVKQIFLITLPRLLLIDRPKKTIRPKPCKHNSKCSTKFVATENNQPCTSNNTSYS-YQYRYMPADASNYTFTSHL-TQDSTAQWSVEPKRKVYRSSKQSSKSQLKPDSENELDWKIDRAIDEVQFVANQLRADDESNDIKEDWKFVAMVMDRLFLWTFSSACLMSTLGIILQSPALYDTRKPIHSNNV 579          
BLAST of Acetylcholine receptor subunit alpha-like vs. Planmine SMEST
Match: SMESG000015383.1 (SMESG000015383.1)

HSP 1 Score: 296.204 bits (757), Expect = 5.927e-94
Identity = 174/483 (36.02%), Postives = 281/483 (58.18%), Query Frame = 2
Query:   86 TTAYSAARNLYDDLFNKAHNYPKLL-PVVNLETPVIVYMNLSLSQILEVNVKDQIIVLNVWVYQEWNDNRFSWDPSDYGGLTEIQIPSSMIWLPDLVLYNNAGGDWDLSGMSGSKVKVKHDGTIIWKPPVILKSQCEMDVTYFPFDIQTCPLKMGTWTHHGLLIDLRHWAQK-VSDLSNERIKYDNCESKIDYAIDLTDYLQSYEWDLLSVTANRNIKKYPCCPEPYLDVTFHIKIRRMTLFYGLNLIFPCLSISFLTIMVFYLPTYSTQKITLCISVFLALNIFILVVFDLTPSTSRSVPLIVKYLLFTMFMVTFSIVASIAVLNFSFRQPETDKLSDNMKKIFLKTLPTYLKMRSVEFKENSEIPTSFGSTKSTNYADYSMYDLTWLKWNKGYTEMMNSKCGTAQNFSSAKRNLALESLRSIKYNLLLKTRHNEVRNEWMYMGIVIDRLFLIVFTVIVTLGSLIIFLMPPQLWSQQLVLNS 1528
            +T + +A  LY  L ++ +NY KL+ PV   E  V  Y  L L+Q++++N++DQ +  NVWV QEW D    W+P DY G+  + IPS+ IWLPD+VLYN A G +++  M  +K KV HDGT+ W PP + +S C ++V +FP+DIQ C +   +WT++   + L+H+ QK + D SN      +    I++A+DL ++  S E+D+L ++A R+I+++    E + +VTF+I +RR TLFY +NLI PCL++SFL+++VFYLPT S +KI+L  ++               PSTS  +PLI KYLLFT+ +++ SI+ ++ VLN +FR   T  +S  ++ IFLK LP  L + S   KE       F     T + + S+  L +  + +      + K  + +     K N  +  L+ +  NL      N+V+ EW ++ +V+DR+FL++F     + +  I L  P L+ ++  L+ 
Sbjct:   22 STGFKSAVQLYQKLLDE-NNYNKLIRPVERNEDAVTTYFGLKLTQLIDLNMRDQKLTTNVWVQQEWQDVNLRWNPEDYEGVQLLHIPSNKIWLPDIVLYNTADGKYEVKLM--TKAKVFHDGTVKWTPPAVYRSSCHINVEFFPYDIQNCQMTFASWTYNDHKMVLKHYTQKGIPDSSNT-----SGTVVINHAVDLRNFYTSVEFDILELSARRHIRQFQGESEKFPEVTFNIIMRRKTLFYTVNLIMPCLAVSFLSVLVFYLPTQSGEKISLIETI---------------PSTSLVIPLIGKYLLFTIILISLSIIITVIVLNVNFRSTMTHSMSPWIRYIFLKFLPPILFLHSPISKEKEMSERCFMYCNKTMFKEASVSKLIYETFMRRSKRSYSLKDASIE----EKINRTIADLKYVVDNLKDDDYKNKVQEEWRFVAVVMDRVFLLLFLSACVISTGSIILRSPALYDRRTPLDG 477          
The following BLAST results are available for this feature:
BLAST of Acetylcholine receptor subunit alpha-like vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
CHRNA31.962e-10537.00cholinergic receptor nicotinic alpha 3 subunit [So... [more]
CHRNA31.962e-10537.00cholinergic receptor nicotinic alpha 3 subunit [So... [more]
CHRNA61.019e-9933.85cholinergic receptor nicotinic alpha 6 subunit [So... [more]
CHRNA32.122e-9338.44cholinergic receptor nicotinic alpha 3 subunit [So... [more]
CHRNA61.242e-9233.07cholinergic receptor nicotinic alpha 6 subunit [So... [more]
back to top
BLAST of Acetylcholine receptor subunit alpha-like vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
unc-631.307e-10838.95Acetylcholine receptor subunit alpha-type unc-63 ... [more]
unc-382.566e-10437.68Acetylcholine receptor subunit alpha-type unc-38 ... [more]
acr-121.095e-9334.80AcetylCholine Receptor; Nicotinic acetylcholine re... [more]
acr-85.809e-8833.73AcetylCholine Receptor [Source:UniProtKB/TrEMBL;A... [more]
acr-85.809e-8833.73AcetylCholine Receptor [Source:UniProtKB/TrEMBL;A... [more]
back to top
BLAST of Acetylcholine receptor subunit alpha-like vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
nAChRalpha48.758e-11538.70gene:FBgn0266347 transcript:FBtr0332872[more]
nAChRalpha13.846e-11448.22gene:FBgn0000036 transcript:FBtr0334916[more]
nAChRalpha13.846e-11448.22gene:FBgn0000036 transcript:FBtr0084619[more]
nAChRalpha27.908e-11447.88gene:FBgn0000039 transcript:FBtr0084639[more]
nAChRalpha27.908e-11447.88gene:FBgn0000039 transcript:FBtr0084640[more]
back to top
BLAST of Acetylcholine receptor subunit alpha-like vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
chrna31.430e-10235.66cholinergic receptor, nicotinic, alpha 3 [Source:Z... [more]
chrna61.607e-10037.45cholinergic receptor, nicotinic, alpha 6 [Source:Z... [more]
chrna61.708e-10037.45cholinergic receptor, nicotinic, alpha 6 [Source:Z... [more]
chrna2a2.915e-9835.91cholinergic receptor, nicotinic, alpha 2a (neurona... [more]
chrna2b1.199e-9634.92cholinergic receptor, nicotinic, alpha 2b (neurona... [more]
back to top
BLAST of Acetylcholine receptor subunit alpha-like vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
mppe13.611e-10136.47metallophosphoesterase 1 [Source:Xenbase;Acc:XB-GE... [more]
mppe19.368e-10136.08metallophosphoesterase 1 [Source:Xenbase;Acc:XB-GE... [more]
mppe11.974e-10035.95metallophosphoesterase 1 [Source:Xenbase;Acc:XB-GE... [more]
mppe12.705e-10036.42metallophosphoesterase 1 [Source:Xenbase;Acc:XB-GE... [more]
mppe13.529e-10036.02metallophosphoesterase 1 [Source:Xenbase;Acc:XB-GE... [more]
back to top
BLAST of Acetylcholine receptor subunit alpha-like vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Chrna65.689e-10635.90cholinergic receptor, nicotinic, alpha polypeptide... [more]
Chrna37.950e-10336.80cholinergic receptor, nicotinic, alpha polypeptide... [more]
Chrna38.908e-10336.80cholinergic receptor, nicotinic, alpha polypeptide... [more]
Chrna29.125e-9536.38cholinergic receptor, nicotinic, alpha polypeptide... [more]
Chrna29.125e-9536.38cholinergic receptor, nicotinic, alpha polypeptide... [more]
back to top
BLAST of Acetylcholine receptor subunit alpha-like vs. UniProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|P23414|ACH1_SCHGR7.942e-11448.58Acetylcholine receptor subunit alpha-L1 OS=Schisto... [more]
sp|P09478|ACH1_DROME3.855e-11348.22Acetylcholine receptor subunit alpha-like 1 OS=Dro... [more]
sp|P17644|ACH2_DROME7.927e-11347.88Acetylcholine receptor subunit alpha-like 2 OS=Dro... [more]
sp|P25162|ACH4_DROME1.948e-11137.18Acetylcholine receptor subunit beta-like 2 OS=Dros... [more]
sp|Q9N587|ACH6_CAEEL1.662e-10738.95Acetylcholine receptor subunit alpha-type unc-63 O... [more]
back to top
BLAST of Acetylcholine receptor subunit alpha-like vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
gnl|BL_ORD_ID|182492635.988e-15347.95tr|A0A1I8G5C2|A0A1I8G5C2_9PLAT Uncharacterized pro... [more]
gnl|BL_ORD_ID|183095531.596e-14944.96tr|A0A267GJH6|A0A267GJH6_9PLAT Uncharacterized pro... [more]
gnl|BL_ORD_ID|182502521.798e-14944.96tr|A0A267GHW3|A0A267GHW3_9PLAT Uncharacterized pro... [more]
gnl|BL_ORD_ID|157711422.487e-14844.20tr|A0A1I8H3A1|A0A1I8H3A1_9PLAT Uncharacterized pro... [more]
gnl|BL_ORD_ID|158047339.133e-14844.71tr|A0A1I8GVX5|A0A1I8GVX5_9PLAT Uncharacterized pro... [more]
back to top
BLAST of Acetylcholine receptor subunit alpha-like vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
chrna34.352e-10537.42neuronal acetylcholine receptor subunit alpha-3-li... [more]
chrna62.436e-10339.24neuronal acetylcholine receptor subunit alpha-3 [S... [more]
chrna2a6.389e-9935.58cholinergic receptor, nicotinic, alpha 2a (neurona... [more]
chrna2b6.660e-9537.08neuronal acetylcholine receptor subunit alpha-2 [S... [more]
chrnb3a1.815e-9335.39cholinergic receptor, nicotinic, beta polypeptide ... [more]
back to top
BLAST of Acetylcholine receptor subunit alpha-like vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 5
Match NameE-valueIdentityDescription
chrna32.917e-9542.90cholinergic receptor, nicotinic, alpha 3 [Source:Z... [more]
chrnb3b3.959e-9236.10cholinergic receptor, nicotinic, beta 3b (neuronal... [more]
chrna2a3.211e-8444.55cholinergic receptor, nicotinic, alpha 2a (neurona... [more]
ENSPMAT00000008550.12.597e-6330.75pep scaffold:Pmarinus_7.0:GL476601:34:38373:1 gene... [more]
chrnb1l1.576e-6030.02cholinergic receptor, nicotinic, beta 1 (muscle) l... [more]
back to top
BLAST of Acetylcholine receptor subunit alpha-like vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Acetylcholine receptor subunit alpha-like vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
EDO469271.219e-7632.35Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO436426.044e-7440.33Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO420547.398e-7231.22Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO420721.259e-7139.23Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO395371.706e-7031.12Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Acetylcholine receptor subunit alpha-like vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ENSORLT00000017941.21.334e-10237.11neuronal acetylcholine receptor subunit alpha-3-li... [more]
chrna54.525e-9133.95neuronal acetylcholine receptor subunit alpha-5 [S... [more]
chrna2b8.758e-9043.55neuronal acetylcholine receptor subunit alpha-2 [S... [more]
chrna2b8.758e-9043.55neuronal acetylcholine receptor subunit alpha-2 [S... [more]
chrna61.316e-8942.69neuronal acetylcholine receptor subunit alpha-3 [S... [more]
back to top
BLAST of Acetylcholine receptor subunit alpha-like vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000056721.10.000e+099.61SMESG000056721.1[more]
SMESG000020665.12.769e-15648.43SMESG000020665.1[more]
SMESG000014741.11.121e-9434.88SMESG000014741.1[more]
SMESG000014741.13.199e-9434.81SMESG000014741.1[more]
SMESG000015383.15.927e-9436.02SMESG000015383.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30015649 ID=SMED30015649|Name=Acetylcholine receptor subunit alpha-like|organism=Schmidtea mediterranea sexual|type=transcript|length=1659bp
GAAAACGTTTATTTAATAGATCTATTCAATGCAAATATTGAAATTTTACT
TTCTGTTAAGTTTTGTTGCAATAAAAATTTGTGTAACAACTGCATATTCA
GCTGCCCGAAATTTGTATGATGACCTATTCAACAAAGCTCACAATTATCC
AAAACTTCTTCCAGTCGTCAACTTAGAAACACCGGTAATTGTTTACATGA
ATTTATCATTATCACAGATTTTAGAAGTCAACGTAAAGGATCAAATAATT
GTATTAAATGTTTGGGTTTATCAAGAATGGAATGATAATAGGTTTTCTTG
GGATCCTTCTGATTATGGAGGTCTTACAGAAATTCAGATACCATCAAGCA
TGATTTGGTTGCCTGATTTAGTTCTATACAACAACGCCGGTGGCGATTGG
GATCTTTCTGGAATGTCTGGAAGTAAAGTAAAAGTTAAGCATGATGGTAC
AATTATATGGAAACCTCCGGTGATACTTAAAAGTCAATGTGAAATGGATG
TAACTTATTTTCCATTCGATATCCAAACTTGTCCATTGAAAATGGGAACG
TGGACACATCACGGACTTCTTATAGATCTTAGACATTGGGCACAAAAGGT
TTCGGATTTGTCTAATGAGAGAATAAAATATGATAATTGCGAATCAAAGA
TCGACTATGCCATTGACTTGACCGATTATTTGCAAAGTTATGAATGGGAT
TTGTTATCAGTCACTGCAAACCGAAACATTAAGAAATATCCGTGTTGCCC
AGAACCATACTTGGATGTTACATTTCATATCAAGATTAGAAGAATGACTT
TATTCTACGGTTTGAATTTAATATTTCCATGCTTATCAATTTCTTTCTTA
ACAATAATGGTATTTTATCTTCCAACATATTCTACTCAGAAAATAACTCT
ATGTATATCAGTATTTTTGGCGTTGAATATTTTTATCTTAGTTGTTTTTG
ATTTGACTCCCTCAACTAGTCGTTCCGTGCCCCTCATAGTAAAGTATCTC
CTGTTTACTATGTTTATGGTTACATTTTCAATAGTAGCCTCAATTGCCGT
GCTAAATTTCAGTTTCAGACAACCAGAAACAGACAAATTATCGGATAATA
TGAAAAAAATATTTTTAAAAACTTTACCCACCTATCTTAAAATGCGTTCA
GTGGAATTCAAAGAAAACAGTGAAATTCCAACATCTTTTGGTAGCACAAA
AAGTACAAATTATGCAGATTATTCTATGTACGATTTAACATGGCTAAAAT
GGAACAAGGGATATACAGAAATGATGAATTCAAAATGTGGGACTGCTCAA
AATTTTTCATCAGCAAAAAGAAATTTAGCATTAGAAAGTCTTCGGTCAAT
CAAATACAATTTATTGCTTAAAACTAGGCATAACGAAGTTCGAAACGAAT
GGATGTACATGGGAATTGTAATTGATAGACTATTTCTCATTGTATTTACG
GTTATTGTCACTCTTGGTTCATTAATAATATTTTTGATGCCCCCTCAACT
GTGGAGTCAACAGTTAGTTCTCAATTCAAAGGATGCGGCTCAAATGTTGG
CAAATTCAAATTACACAAGATTATGTAAATAAAGAAAACTGAATAAATTT
AGCCATTTTTAAATATGTAGTTTATGTTTATTAGTAAAAAATTTATTTTT
TCAAAAAAA
back to top

protein sequence of SMED30015649-orf-1

>SMED30015649-orf-1 ID=SMED30015649-orf-1|Name=SMED30015649-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=518bp
MQILKFYFLLSFVAIKICVTTAYSAARNLYDDLFNKAHNYPKLLPVVNLE
TPVIVYMNLSLSQILEVNVKDQIIVLNVWVYQEWNDNRFSWDPSDYGGLT
EIQIPSSMIWLPDLVLYNNAGGDWDLSGMSGSKVKVKHDGTIIWKPPVIL
KSQCEMDVTYFPFDIQTCPLKMGTWTHHGLLIDLRHWAQKVSDLSNERIK
YDNCESKIDYAIDLTDYLQSYEWDLLSVTANRNIKKYPCCPEPYLDVTFH
IKIRRMTLFYGLNLIFPCLSISFLTIMVFYLPTYSTQKITLCISVFLALN
IFILVVFDLTPSTSRSVPLIVKYLLFTMFMVTFSIVASIAVLNFSFRQPE
TDKLSDNMKKIFLKTLPTYLKMRSVEFKENSEIPTSFGSTKSTNYADYSM
YDLTWLKWNKGYTEMMNSKCGTAQNFSSAKRNLALESLRSIKYNLLLKTR
HNEVRNEWMYMGIVIDRLFLIVFTVIVTLGSLIIFLMPPQLWSQQLVLNS
KDAAQMLANSNYTRLCK*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: molecular function
TermDefinition
GO:0004888transmembrane signaling receptor activity
GO:0004889acetylcholine-activated cation-selective channel activity
GO:0005216ion channel activity
GO:0005230extracellular ligand-gated ion channel activity
GO:0004993G-protein coupled serotonin receptor activity
GO:0005515protein binding
GO:0015276ligand-gated ion channel activity
GO:0015464acetylcholine receptor activity
GO:0022848acetylcholine-gated cation-selective channel activity
GO:0042166acetylcholine binding
Vocabulary: biological process
TermDefinition
GO:0060078regulation of postsynaptic membrane potential
GO:0006811ion transport
GO:0006810transport
GO:0006940regulation of smooth muscle contraction
GO:0007165signal transduction
GO:0007171activation of transmembrane receptor protein tyrosine kinase activity
GO:0007210serotonin receptor signaling pathway
GO:0007271synaptic transmission, cholinergic
GO:0007399nervous system development
GO:0007626locomotory behavior
GO:0014056regulation of acetylcholine secretion, neurotransmission
GO:0034220ion transmembrane transport
GO:0035095behavioral response to nicotine
GO:0042391regulation of membrane potential
GO:0048814regulation of dendrite morphogenesis
GO:0060079excitatory postsynaptic potential
GO:0060084synaptic transmission involved in micturition
GO:0095500acetylcholine receptor signaling pathway
GO:0098664G-protein coupled serotonin receptor signaling pathway
GO:1905144response to acetylcholine
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000034epidermis
PLANA:0000096ventral epidermis
PLANA:0000418head
Vocabulary: INTERPRO
TermDefinition
IPR036734Neur_chan_lig-bd_sf
IPR036719Neuro-gated_channel_TM_sf
IPR002394Nicotinic_acetylcholine_rcpt
IPR006201Neur_channel
IPR006029Neurotrans-gated_channel_TM
IPR027361Acetylcholine_rcpt_TM
IPR006202Neur_chan_lig-bd
IPR018000Neurotransmitter_ion_chnl_CS
Vocabulary: cellular component
TermDefinition
GO:0016021integral component of membrane
GO:0045211postsynaptic membrane
GO:0016020membrane
GO:0005886plasma membrane
GO:0005892acetylcholine-gated channel complex
GO:0014069postsynaptic density
GO:0030054cell junction
GO:0030425dendrite
GO:0043025neuronal cell body
GO:0045202synapse
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR006201Neurotransmitter-gated ion-channelPRINTSPR00252NRIONCHANNELcoord: 75..91
score: 33.27
coord: 251..263
score: 33.87
coord: 154..168
score: 55.35
coord: 108..119
score: 52.79
IPR006201Neurotransmitter-gated ion-channelPANTHERPTHR18945NEUROTRANSMITTER GATED ION CHANNELcoord: 25..491
IPR002394Nicotinic acetylcholine receptorPRINTSPR00254NICOTINICRcoord: 62..78
score: 33.46
coord: 134..152
score: 44.39
coord: 96..110
score: 40.89
NoneNo IPR availableGENE3DG3DSA:1.20.58.390coord: 421..497
e-value: 1.7E-8
score: 36.3
NoneNo IPR availableGENE3DG3DSA:1.20.58.390coord: 263..377
e-value: 3.6E-35
score: 122.7
NoneNo IPR availablePANTHERPTHR18945:SF778ACETYLCHOLINE RECEPTOR SUBUNIT BETA-LIKE 2coord: 25..491
NoneNo IPR availableCDDcd19064LGIC_TM_nAChRcoord: 258..347
e-value: 3.70222E-39
score: 136.104
NoneNo IPR availableCDDcd19031LGIC_ECD_nAChR_proto_alpha-likecoord: 26..259
e-value: 4.28324E-100
score: 298.812
NoneNo IPR availableSIGNALP_EUKSignalP-noTMSignalP-noTMcoord: 1..22
score: 0.677
NoneNo IPR availableTMHMMTMhelixcoord: 7..26
NoneNo IPR availableTMHMMTMhelixcoord: 468..487
NoneNo IPR availableTMHMMTMhelixcoord: 260..282
NoneNo IPR availableTMHMMTMhelixcoord: 289..311
NoneNo IPR availableTMHMMTMhelixcoord: 324..346
IPR036734Neurotransmitter-gated ion-channel ligand-binding domain superfamilyGENE3DG3DSA:2.70.170.10coord: 19..262
e-value: 1.1E-75
score: 256.0
IPR036734Neurotransmitter-gated ion-channel ligand-binding domain superfamilySUPERFAMILYSSF63712Nicotinic receptor ligand binding domain-likecoord: 26..255
IPR006202Neurotransmitter-gated ion-channel ligand-binding domainPFAMPF02931Neur_chan_LBDcoord: 27..256
e-value: 5.5E-59
score: 199.2
IPR006029Neurotransmitter-gated ion-channel transmembrane domainPFAMPF02932Neur_chan_membcoord: 264..485
e-value: 1.6E-46
score: 159.3
IPR018000Neurotransmitter-gated ion-channel, conserved sitePROSITEPS00236NEUROTR_ION_CHANNELcoord: 154..168
IPR036719Neurotransmitter-gated ion-channel transmembrane domain superfamilySUPERFAMILYSSF90112Neurotransmitter-gated ion-channel transmembrane porecoord: 257..492