Neur_chan_LBD domain-containing protein

Overview
NameNeur_chan_LBD domain-containing protein
Smed IDSMED30015643
Length (bp)1279
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Neur_chan_LBD domain-containing protein (SMED30015643) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Neur_chan_LBD domain-containing protein (SMED30015643) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30015643

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 1

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
headSMED30015643SMESG000041796.1 SMESG000041740.1 SmedASXL_010269SmedAsxl_ww_GCZZ01PMID:27034770
Currie et al., 2016
whole organism asexual adult RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Neur_chan_LBD domain-containing protein vs. Ensembl Human
Match: GLRA3 (glycine receptor alpha 3 [Source:HGNC Symbol;Acc:HGNC:4328])

HSP 1 Score: 51.2174 bits (121), Expect = 2.322e-6
Identity = 67/257 (26.07%), Postives = 107/257 (41.63%), Query Frame = 3
Query:  174 YSGEIFLHAKWREPLL------DNKSDLKDISLSTFWNPKLSI-----ENIFQITKSTTSLEVSFDEGNNKRAFVVEKTRLKAAFRETLELQHFPFDCQDLSISVGT-EYSIEELEMAENPNDISKLNTLDGIESQEWNLYEHVEVENKIVINDCNFGPKERQIMTFTC-----RATRRFKYFLINHXXXXXXXXXXXXXXXXXXXXNTYGRLALCMTTLLTSVTFKVAVSNNLPKVPYLTYLDKAILGNIFMIMCL 893
            Y   IFL  KW +P L      D+  DL    L + W P L        N  ++T     L + F  GN     V+   RL       ++L++FP D Q   + + +  Y++ +L       D + +   +G+   ++ L E           D  +  K      FTC        R+  Y+LI  ++ S +  +L++ SF I       R+AL +TT+LT  T       +LPKV Y+  +D      I+M +CL
Sbjct:   91 YRVNIFLRQKWNDPRLAYSEYPDDSLDLDPSMLDSIWKPDLFFANEKGANFHEVTTDNKLLRI-FKNGN-----VLYSIRLTLTLSCPMDLKNFPMDVQTCIMQLESFGYTMNDLIFEW--QDEAPVQVAEGLTLPQFLLKEE---------KDLRYCTKHYNTGKFTCIEVRFHLERQMGYYLIQMYIPSLLIVILSWVSFWINMDAAPARVALGITTVLTMTTQSSGSRASLPKVSYVKAID------IWMAVCL 324          
BLAST of Neur_chan_LBD domain-containing protein vs. Ensembl Human
Match: GLRA3 (glycine receptor alpha 3 [Source:HGNC Symbol;Acc:HGNC:4328])

HSP 1 Score: 51.2174 bits (121), Expect = 2.416e-6
Identity = 67/257 (26.07%), Postives = 107/257 (41.63%), Query Frame = 3
Query:  174 YSGEIFLHAKWREPLL------DNKSDLKDISLSTFWNPKLSI-----ENIFQITKSTTSLEVSFDEGNNKRAFVVEKTRLKAAFRETLELQHFPFDCQDLSISVGT-EYSIEELEMAENPNDISKLNTLDGIESQEWNLYEHVEVENKIVINDCNFGPKERQIMTFTC-----RATRRFKYFLINHXXXXXXXXXXXXXXXXXXXXNTYGRLALCMTTLLTSVTFKVAVSNNLPKVPYLTYLDKAILGNIFMIMCL 893
            Y   IFL  KW +P L      D+  DL    L + W P L        N  ++T     L + F  GN     V+   RL       ++L++FP D Q   + + +  Y++ +L       D + +   +G+   ++ L E           D  +  K      FTC        R+  Y+LI  ++ S +  +L++ SF I       R+AL +TT+LT  T       +LPKV Y+  +D      I+M +CL
Sbjct:   91 YRVNIFLRQKWNDPRLAYSEYPDDSLDLDPSMLDSIWKPDLFFANEKGANFHEVTTDNKLLRI-FKNGN-----VLYSIRLTLTLSCPMDLKNFPMDVQTCIMQLESFGYTMNDLIFEW--QDEAPVQVAEGLTLPQFLLKEE---------KDLRYCTKHYNTGKFTCIEVRFHLERQMGYYLIQMYIPSLLIVILSWVSFWINMDAAPARVALGITTVLTMTTQSSGSRASLPKVSYVKAID------IWMAVCL 324          
BLAST of Neur_chan_LBD domain-containing protein vs. Ensembl Human
Match: GABRB3 (gamma-aminobutyric acid type A receptor beta3 subunit [Source:HGNC Symbol;Acc:HGNC:4083])

HSP 1 Score: 49.6766 bits (117), Expect = 3.825e-6
Identity = 43/176 (24.43%), Postives = 87/176 (49.43%), Query Frame = 3
Query:  405 LELQHFPFDCQDLSISVGT-EYSIEELEMAENPNDISKLNTLDGIESQEWNLYEHVEVENKIVINDCNFGPKERQIMTFTCRATRRFKYFLINHXXXXXXXXXXXXXXXXXXXXNTYGRLALCMTTLLTSVTFKVAVSNNLPKVPYLTYLDKAILGNIFMIMCLCLWHAATSVYFY 929
            ++L+ +P D Q+ ++ + +  Y+ +++E      D      + G+E  E  L +   VE+++V  +  F       ++ + R  R   YF++  +M S +  +L++ SF I    +  R+AL +TT+LT  T    +   LPK+PY+  +D  ++G    +    L +A  +  F+
Sbjct:   58 MDLRRYPLDEQNCTLEIESYGYTTDDIEFYWRGGD----KAVTGVERIE--LPQFSIVEHRLVSRNVVFATGAYPRLSLSFRLKRNIGYFILQTYMPSILITILSWVSFWINYDASAARVALGITTVLTMTTINTHLRETLPKIPYVKAIDMYLMGCFVFVFLALLEYAFVNYIFF 227          
BLAST of Neur_chan_LBD domain-containing protein vs. Ensembl Human
Match: GABRB3 (gamma-aminobutyric acid type A receptor beta3 subunit [Source:HGNC Symbol;Acc:HGNC:4083])

HSP 1 Score: 49.2914 bits (116), Expect = 7.932e-6
Identity = 43/176 (24.43%), Postives = 87/176 (49.43%), Query Frame = 3
Query:  405 LELQHFPFDCQDLSISVGT-EYSIEELEMAENPNDISKLNTLDGIESQEWNLYEHVEVENKIVINDCNFGPKERQIMTFTCRATRRFKYFLINHXXXXXXXXXXXXXXXXXXXXNTYGRLALCMTTLLTSVTFKVAVSNNLPKVPYLTYLDKAILGNIFMIMCLCLWHAATSVYFY 929
            ++L+ +P D Q+ ++ + +  Y+ +++E      D      + G+E  E  L +   VE+++V  +  F       ++ + R  R   YF++  +M S +  +L++ SF I    +  R+AL +TT+LT  T    +   LPK+PY+  +D  ++G    +    L +A  +  F+
Sbjct:   78 MDLRRYPLDEQNCTLEIESYGYTTDDIEFYWRGGD----KAVTGVERIE--LPQFSIVEHRLVSRNVVFATGAYPRLSLSFRLKRNIGYFILQTYMPSILITILSWVSFWINYDASAARVALGITTVLTMTTINTHLRETLPKIPYVKAIDMYLMGCFVFVFLALLEYAFVNYIFF 247          
BLAST of Neur_chan_LBD domain-containing protein vs. Ensembl Human
Match: GABRB3 (gamma-aminobutyric acid type A receptor beta3 subunit [Source:HGNC Symbol;Acc:HGNC:4083])

HSP 1 Score: 49.2914 bits (116), Expect = 7.932e-6
Identity = 43/176 (24.43%), Postives = 87/176 (49.43%), Query Frame = 3
Query:  405 LELQHFPFDCQDLSISVGT-EYSIEELEMAENPNDISKLNTLDGIESQEWNLYEHVEVENKIVINDCNFGPKERQIMTFTCRATRRFKYFLINHXXXXXXXXXXXXXXXXXXXXNTYGRLALCMTTLLTSVTFKVAVSNNLPKVPYLTYLDKAILGNIFMIMCLCLWHAATSVYFY 929
            ++L+ +P D Q+ ++ + +  Y+ +++E      D      + G+E  E  L +   VE+++V  +  F       ++ + R  R   YF++  +M S +  +L++ SF I    +  R+AL +TT+LT  T    +   LPK+PY+  +D  ++G    +    L +A  +  F+
Sbjct:   78 MDLRRYPLDEQNCTLEIESYGYTTDDIEFYWRGGD----KAVTGVERIE--LPQFSIVEHRLVSRNVVFATGAYPRLSLSFRLKRNIGYFILQTYMPSILITILSWVSFWINYDASAARVALGITTVLTMTTINTHLRETLPKIPYVKAIDMYLMGCFVFVFLALLEYAFVNYIFF 247          
BLAST of Neur_chan_LBD domain-containing protein vs. Ensembl Fly
Match: CG8916 (gene:FBgn0030707 transcript:FBtr0301233)

HSP 1 Score: 51.9878 bits (123), Expect = 6.817e-7
Identity = 61/241 (25.31%), Postives = 103/241 (42.74%), Query Frame = 3
Query:  174 YSGEIFLHAKWREPLLDNKSDLKDISLS-----TFWNPKLSIEN-----IFQITKSTTSLEVSFDEGNNKRAFVVEKTRLKAAFRETLELQHFPFDCQDLSISVGTEYSIEELEMAENPNDISKLNTLDGIESQEWNLYEHVEVENKIVINDCNFGPKERQIMTFTCRATRRFKYFLINHXXXXXXXXXXXXXXXXXXXXNTYGRLALCMTTLLTSVTFKVAVSNNLPKVPYLTYLDKAIL 866
            YS + +    WR+  L  K  +K +SLS       W P     N     I  IT     L +  + G      ++   RL       +ELQ+FP D Q   + +G+   I +  + E  N    ++ + G+   +++L   +      V  + +F      ++       R   YFLI  ++   +  +L++ SF I    T  R++LC+T++LT  T  +    +LPKV Y T LD  +L
Sbjct:   52 YSMDCYFRQYWRDKRLSFKGPIKSLSLSIKMLDKIWRPDTYFYNGKHSQIHMITVPNKLLRLDQNGG------ILYSMRLTIKATCPMELQNFPMDRQSCPLVIGSYGYINQQLIYEWKNQDDAVSFVPGMTLNQFDLISMMHRNFTTVRREGDF-----SVLHVAFNLKRHTGYFLIQVYVPCILIVVLSWVSFWIHREATSDRVSLCVTSVLTLSTISLDSRTDLPKVKYATALDWFLL 281          
BLAST of Neur_chan_LBD domain-containing protein vs. Ensembl Fly
Match: CG8916 (gene:FBgn0030707 transcript:FBtr0301232)

HSP 1 Score: 51.6026 bits (122), Expect = 9.710e-7
Identity = 61/241 (25.31%), Postives = 103/241 (42.74%), Query Frame = 3
Query:  174 YSGEIFLHAKWREPLLDNKSDLKDISLS-----TFWNPKLSIEN-----IFQITKSTTSLEVSFDEGNNKRAFVVEKTRLKAAFRETLELQHFPFDCQDLSISVGTEYSIEELEMAENPNDISKLNTLDGIESQEWNLYEHVEVENKIVINDCNFGPKERQIMTFTCRATRRFKYFLINHXXXXXXXXXXXXXXXXXXXXNTYGRLALCMTTLLTSVTFKVAVSNNLPKVPYLTYLDKAIL 866
            YS + +    WR+  L  K  +K +SLS       W P     N     I  IT     L +  + G      ++   RL       +ELQ+FP D Q   + +G+   I +  + E  N    ++ + G+   +++L   +      V  + +F      ++       R   YFLI  ++   +  +L++ SF I    T  R++LC+T++LT  T  +    +LPKV Y T LD  +L
Sbjct:  154 YSMDCYFRQYWRDKRLSFKGPIKSLSLSIKMLDKIWRPDTYFYNGKHSQIHMITVPNKLLRLDQNGG------ILYSMRLTIKATCPMELQNFPMDRQSCPLVIGSYGYINQQLIYEWKNQDDAVSFVPGMTLNQFDLISMMHRNFTTVRREGDF-----SVLHVAFNLKRHTGYFLIQVYVPCILIVVLSWVSFWIHREATSDRVSLCVTSVLTLSTISLDSRTDLPKVKYATALDWFLL 383          
BLAST of Neur_chan_LBD domain-containing protein vs. Ensembl Zebrafish
Match: glra3 (glycine receptor, alpha 3 [Source:ZFIN;Acc:ZDB-GENE-020402-1])

HSP 1 Score: 50.8322 bits (120), Expect = 1.795e-6
Identity = 68/259 (26.25%), Postives = 108/259 (41.70%), Query Frame = 3
Query:  174 YSGEIFLHAKWREPLL------DNKSDLKDISLSTFWNPKLSIEN-----IFQITKSTTSLEVSFDEGNNKRAFVVEKTRLKAAFRETLELQHFPFDCQDLSISVGT-EYSIEEL--EMAENPNDISKLNTLDGIESQEWNLYEHVEVENKIVINDCNFGPKERQIMTFTC-----RATRRFKYFLINHXXXXXXXXXXXXXXXXXXXXNTYGRLALCMTTLLTSVTFKVAVSNNLPKVPYLTYLDKAILGNIFMIMCL 893
            Y   IFL  KW +P L      D+  DL    L + W P L   N       ++T     L + F  GN     V+   RL       ++L++FP D Q   + + +  Y++ +L  E  E       +   DG+   ++ L +          +D  +  K      FTC        R+  Y+LI  ++ S +  +L++ SF I       R+AL +TT+LT  T       +LPKV Y+  +D      I+M +CL
Sbjct:   91 YRVNIFLRQKWNDPRLAYSEYPDDSLDLDPSMLDSIWKPDLFFANEKGAHFHEVTTDNKLLRI-FKNGN-----VLYSIRLTLTLSCPMDLKNFPMDVQTCIMQLESFGYTMNDLIFEWQEK----GPVQVADGLTLPQFILKDE---------SDLRYCTKHYNTGKFTCIEVRFHLERQMGYYLIQMYIPSLLIVILSWVSFWINMDAAPARVALGITTVLTMTTQSSGSRTSLPKVSYVKAID------IWMAVCL 324          
BLAST of Neur_chan_LBD domain-containing protein vs. Ensembl Zebrafish
Match: glra2 (glycine receptor, alpha 2 [Source:ZFIN;Acc:ZDB-GENE-090407-1])

HSP 1 Score: 50.447 bits (119), Expect = 2.856e-6
Identity = 67/263 (25.48%), Postives = 108/263 (41.06%), Query Frame = 3
Query:  174 YSGEIFLHAKWREPLL------DNKSDLKDISLSTFWNPKL-----SIENIFQITKSTTSLEVSFDEGNNKRAFVVEKTRLKAAFRETLELQHFPFDCQDLSISVGT-EYSIEELEMAENPNDISKLNTLDGIESQEWNLYEHVEVENKIVINDCNFGPKERQIMTFTC-----RATRRFKYFLINHXXXXXXXXXXXXXXXXXXXXNTYGRLALCMTTLLTSVTFKVAVSNNLPKVPYLTYLDKAILGNIFMIMCLCLWHAA 911
            Y   IFL  KW +P L      D+  DL    L + W P L        N   +T     L + F +G      V+   RL       ++L++FP D Q  ++ + +  Y++ +L       D   +   DG+   ++ + +           D  +  K      FTC        R+  Y+LI  ++ S +  +L++ SF I       R+AL +TT+LT  T       +LPKV Y+  +D      I+M +CL    AA
Sbjct:   90 YRVNIFLRQKWNDPRLAYSEYPDSSLDLDPSMLDSIWKPDLFFANEKGANFHDVTTDNKLLRI-FKDGT-----VLYSIRLTLILSCPMDLKNFPMDVQTCTMQLESFGYTMNDLIFEW--LDKGPVQVADGLTLPQFLIRDE---------KDLGYCTKHYNTGKFTCIEVKFHLERQMGYYLIQMYIPSLLIVILSWVSFWINMDAAPARVALGITTVLTMTTQSSGSRASLPKVSYVKAID------IWMAVCLLFVFAA 329          
BLAST of Neur_chan_LBD domain-containing protein vs. Ensembl Xenopus
Match: GLRA3 (glycine receptor alpha 3 [Source:NCBI gene;Acc:100488938])

HSP 1 Score: 55.0694 bits (131), Expect = 1.342e-7
Identity = 70/259 (27.03%), Postives = 109/259 (42.08%), Query Frame = 3
Query:  174 YSGEIFLHAKWREPLL------DNKSDLKDISLSTFWNPKL-----SIENIFQITKSTTSLEVSFDEGNNKRAFVVEKTRLKAAFRETLELQHFPFDCQDLSISVGT-EYSIEEL--EMAENPNDISKLNTLDGIESQEWNLYEHVEVENKIVINDCNFGPKERQIMTFTC-----RATRRFKYFLINHXXXXXXXXXXXXXXXXXXXXNTYGRLALCMTTLLTSVTFKVAVSNNLPKVPYLTYLDKAILGNIFMIMCL 893
            Y   IFL  KW +P L      D+  DL    L + W P L        N  ++T     L + F +GN     V+   RL       ++L++FP D Q   + + +  Y++ +L  E  EN      +   DG+   ++ L E           D  +  K      FTC        R+  Y+LI  ++ S +  +L++ SF I       R+AL +TT+LT  T       +LPKV Y+  +D      I+M +CL
Sbjct:   74 YRLNIFLRQKWNDPRLAYSEYPDDSLDLDPSMLDSIWKPDLFFANEKGANFHEVTTDNKLLRI-FKDGN-----VLYSIRLTLTLSCPMDLKNFPMDVQTCIMQLESFGYTMNDLIFEWQEN----GPVQIADGLTLPQFVLKEE---------KDLRYCTKHYNTGKFTCIEVRFHLERQMGYYLIQMYIPSLLIVILSWVSFWINMDAAPARVALGITTVLTMTTQSSGSRASLPKVSYVKAID------IWMAVCL 307          
BLAST of Neur_chan_LBD domain-containing protein vs. Ensembl Xenopus
Match: GLRA3 (glycine receptor alpha 3 [Source:NCBI gene;Acc:100488938])

HSP 1 Score: 54.6842 bits (130), Expect = 1.510e-7
Identity = 70/259 (27.03%), Postives = 109/259 (42.08%), Query Frame = 3
Query:  174 YSGEIFLHAKWREPLL------DNKSDLKDISLSTFWNPKLSI-----ENIFQITKSTTSLEVSFDEGNNKRAFVVEKTRLKAAFRETLELQHFPFDCQDLSISVGT-EYSIEEL--EMAENPNDISKLNTLDGIESQEWNLYEHVEVENKIVINDCNFGPKERQIMTFTC-----RATRRFKYFLINHXXXXXXXXXXXXXXXXXXXXNTYGRLALCMTTLLTSVTFKVAVSNNLPKVPYLTYLDKAILGNIFMIMCL 893
            Y   IFL  KW +P L      D+  DL    L + W P L        N  ++T     L + F +GN     V+   RL       ++L++FP D Q   + + +  Y++ +L  E  EN      +   DG+   ++ L E           D  +  K      FTC        R+  Y+LI  ++ S +  +L++ SF I       R+AL +TT+LT  T       +LPKV Y+  +D      I+M +CL
Sbjct:   75 YRLNIFLRQKWNDPRLAYSEYPDDSLDLDPSMLDSIWKPDLFFANEKGANFHEVTTDNKLLRI-FKDGN-----VLYSIRLTLTLSCPMDLKNFPMDVQTCIMQLESFGYTMNDLIFEWQEN----GPVQIADGLTLPQFVLKEE---------KDLRYCTKHYNTGKFTCIEVRFHLERQMGYYLIQMYIPSLLIVILSWVSFWINMDAAPARVALGITTVLTMTTQSSGSRASLPKVSYVKAID------IWMAVCL 308          
BLAST of Neur_chan_LBD domain-containing protein vs. Ensembl Xenopus
Match: GLRA3 (glycine receptor alpha 3 [Source:NCBI gene;Acc:100488938])

HSP 1 Score: 54.6842 bits (130), Expect = 1.526e-7
Identity = 71/265 (26.79%), Postives = 111/265 (41.89%), Query Frame = 3
Query:  174 YSGEIFLHAKWREPLL------DNKSDLKDISLSTFWNPKLSI-----ENIFQITKSTTSLEVSFDEGNNKRAFVVEKTRLKAAFRETLELQHFPFDCQDLSISVGT-EYSIEEL--EMAENPNDISKLNTLDGIESQEWNLYEHVEVENKIVINDCNFGPKERQIMTFTC-----RATRRFKYFLINHXXXXXXXXXXXXXXXXXXXXNTYGRLALCMTTLLTSVTFKVAVSNNLPKVPYLTYLDKAILGNIFMIMCLCLWHAA 911
            Y   IFL  KW +P L      D+  DL    L + W P L        N  ++T     L + F +GN     V+   RL       ++L++FP D Q   + + +  Y++ +L  E  EN      +   DG+   ++ L E           D  +  K      FTC        R+  Y+LI  ++ S +  +L++ SF I       R+AL +TT+LT  T       +LPKV Y+  +D      I+M +CL    +A
Sbjct:   91 YRLNIFLRQKWNDPRLAYSEYPDDSLDLDPSMLDSIWKPDLFFANEKGANFHEVTTDNKLLRI-FKDGN-----VLYSIRLTLTLSCPMDLKNFPMDVQTCIMQLESFGYTMNDLIFEWQEN----GPVQIADGLTLPQFVLKEE---------KDLRYCTKHYNTGKFTCIEVRFHLERQMGYYLIQMYIPSLLIVILSWVSFWINMDAAPARVALGITTVLTMTTQSSGSRASLPKVSYVKAID------IWMAVCLLFVFSA 330          
BLAST of Neur_chan_LBD domain-containing protein vs. Ensembl Xenopus
Match: GLRA3 (glycine receptor alpha 3 [Source:NCBI gene;Acc:100488938])

HSP 1 Score: 54.6842 bits (130), Expect = 1.638e-7
Identity = 70/259 (27.03%), Postives = 109/259 (42.08%), Query Frame = 3
Query:  174 YSGEIFLHAKWREPLL------DNKSDLKDISLSTFWNPKLSI-----ENIFQITKSTTSLEVSFDEGNNKRAFVVEKTRLKAAFRETLELQHFPFDCQDLSISVGT-EYSIEEL--EMAENPNDISKLNTLDGIESQEWNLYEHVEVENKIVINDCNFGPKERQIMTFTC-----RATRRFKYFLINHXXXXXXXXXXXXXXXXXXXXNTYGRLALCMTTLLTSVTFKVAVSNNLPKVPYLTYLDKAILGNIFMIMCL 893
            Y   IFL  KW +P L      D+  DL    L + W P L        N  ++T     L + F +GN     V+   RL       ++L++FP D Q   + + +  Y++ +L  E  EN      +   DG+   ++ L E           D  +  K      FTC        R+  Y+LI  ++ S +  +L++ SF I       R+AL +TT+LT  T       +LPKV Y+  +D      I+M +CL
Sbjct:   86 YRLNIFLRQKWNDPRLAYSEYPDDSLDLDPSMLDSIWKPDLFFANEKGANFHEVTTDNKLLRI-FKDGN-----VLYSIRLTLTLSCPMDLKNFPMDVQTCIMQLESFGYTMNDLIFEWQEN----GPVQIADGLTLPQFVLKEE---------KDLRYCTKHYNTGKFTCIEVRFHLERQMGYYLIQMYIPSLLIVILSWVSFWINMDAAPARVALGITTVLTMTTQSSGSRASLPKVSYVKAID------IWMAVCL 319          
BLAST of Neur_chan_LBD domain-containing protein vs. Ensembl Xenopus
Match: ENSXETT00000004017.1 (gamma-aminobutyric acid (GABA) A receptor, beta 1 [Source:NCBI gene;Acc:100489344])

HSP 1 Score: 50.0618 bits (118), Expect = 4.498e-6
Identity = 67/291 (23.02%), Postives = 130/291 (44.67%), Query Frame = 3
Query:  117 VYLRCVFIKIFKVDTVNEFYSGEIFLHAKWRE--------PL---LDNK-SDLKDISLSTFWNPKLSIENIFQITKSTTSLEVSFDEGNNKRAFVVEKTRLKAAFRETLELQHFPFDCQDLSISVGT-EYSIEELEMAENPNDISKLNTLDGIESQEWNLYEHVEVENKIVINDCNFGPKERQIMTFTCRATRRFKYFLINHXXXXXXXXXXXXXXXXXXXXNTYGRLALCMTTLLTSVTFKVAVSNNLPKVPYLTYLDKAILGN-IFMIMCLCLWHAATSVYFYDSTTLQ 947
            V +R     I  V  VN  Y+  ++    WR+        PL   LDN+ +D   +  + F N K S   +  +T     + +  D        V+   R+       ++L+ +P D Q+ ++ + +  Y+ ++++   N  D      + G+E  E  L +   ++ K+V  +  F       ++ + R  R   YF++  +M S++  +L++ SF I    +  R+AL +TT+LT  T    +   LPK+PY+  +D  ++G  +F+ + L  +     ++F     LQ
Sbjct:   63 VGMRIDVASIDMVSEVNMDYTLTMYFQQSWRDKRLSYSGIPLNLTLDNRVADQLWVPDTYFLNDKRSF--VHGVTVKNRMIRLHPD------GTVLYGLRITTTAACMMDLRRYPLDEQNCTLEIESYGYTTDDIKFYWNGGD----KAITGVEKIE--LPQFSIIDYKMVSRNVIFSTGAYPRLSLSFRLKRNIGYFILQTYMPSTLITILSWVSFWINYDASAARVALGITTVLTMTTISTHLRETLPKIPYVKAIDIYLMGCFVFVFLALLEYAFVNYIFFGKGPQLQ 339          
BLAST of Neur_chan_LBD domain-containing protein vs. Ensembl Mouse
Match: Glra3 (glycine receptor, alpha 3 subunit [Source:MGI Symbol;Acc:MGI:95749])

HSP 1 Score: 51.2174 bits (121), Expect = 1.680e-6
Identity = 67/257 (26.07%), Postives = 107/257 (41.63%), Query Frame = 3
Query:  174 YSGEIFLHAKWREPLL------DNKSDLKDISLSTFWNPKLSI-----ENIFQITKSTTSLEVSFDEGNNKRAFVVEKTRLKAAFRETLELQHFPFDCQDLSISVGT-EYSIEELEMAENPNDISKLNTLDGIESQEWNLYEHVEVENKIVINDCNFGPKERQIMTFTC-----RATRRFKYFLINHXXXXXXXXXXXXXXXXXXXXNTYGRLALCMTTLLTSVTFKVAVSNNLPKVPYLTYLDKAILGNIFMIMCL 893
            Y   IFL  KW +P L      D+  DL    L + W P L        N  ++T     L + F  GN     V+   RL       ++L++FP D Q   + + +  Y++ +L       D + +   +G+   ++ L E           D  +  K      FTC        R+  Y+LI  ++ S +  +L++ SF I       R+AL +TT+LT  T       +LPKV Y+  +D      I+M +CL
Sbjct:  107 YRVNIFLRQKWNDPRLAYSEYPDDSLDLDPSMLDSIWKPDLFFANEKGANFHEVTTDNKLLRI-FKNGN-----VLYSIRLTLTLSCPMDLKNFPMDVQTCIMQLESFGYTMNDLIFEW--QDEAPVQVAEGLTLPQFLLKEE---------KDLRYCTKHYNTGKFTCIEVRFHLERQMGYYLIQMYIPSLLIVILSWVSFWINMDAAPARVALGITTVLTMTTQSSGSRASLPKVSYVKAID------IWMAVCL 340          
BLAST of Neur_chan_LBD domain-containing protein vs. Ensembl Mouse
Match: Gabrb3 (gamma-aminobutyric acid (GABA) A receptor, subunit beta 3 [Source:MGI Symbol;Acc:MGI:95621])

HSP 1 Score: 49.6766 bits (117), Expect = 5.636e-6
Identity = 64/280 (22.86%), Postives = 125/280 (44.64%), Query Frame = 3
Query:  138 IKIFKVDTVNEF---YSGEIFLHAKWRE--------PL---LDNK-SDLKDISLSTFWNPKLSIENIFQITKSTTSLEVSFDEGNNKRAFVVEKTRLKAAFRETLELQHFPFDCQDLSISVGT-EYSIEELEMAENPNDISKLNTLDGIESQEWNLYEHVEVENKIVINDCNFGPKERQIMTFTCRATRRFKYFLINHXXXXXXXXXXXXXXXXXXXXNTYGRLALCMTTLLTSVTFKVAVSNNLPKVPYLTYLDKAILGNIFMIMCLCLWHAATSVYFY 929
            I I  +D V+E    Y+  ++    WR+        PL   LDN+ +D   +  + F N K S   +  +T     + +  D        V+   R+       ++L+ +P D Q+ ++ + +  Y+ +++E      D   +  ++ IE  ++++ EH  V   +V     F       ++ + R  R   YF++  +M S +  +L++ SF I    +  R+AL +TT+LT  T    +   LPK+PY+  +D  ++G    +    L +A  +  F+
Sbjct:   67 IDIASIDMVSEVNMDYTLTMYFQQYWRDKRLAYSGIPLNLTLDNRVADQLWVPDTYFLNDKKSF--VHGVTVKNRMIRLHPD------GTVLYGLRITTTAACMMDLRRYPLDEQNCTLEIESYGYTTDDIEFYWRGGD-KAVTGVERIELPQFSIVEHRLVSRNVV-----FATGAYPRLSLSFRLKRNIGYFILQTYMPSILITILSWVSFWINYDASAARVALGITTVLTMTTINTHLRETLPKIPYVKAIDMYLMGCFVFVFLALLEYAFVNYIFF 332          
BLAST of Neur_chan_LBD domain-containing protein vs. Ensembl Mouse
Match: Gabrb3 (gamma-aminobutyric acid (GABA) A receptor, subunit beta 3 [Source:MGI Symbol;Acc:MGI:95621])

HSP 1 Score: 49.2914 bits (116), Expect = 6.315e-6
Identity = 65/280 (23.21%), Postives = 125/280 (44.64%), Query Frame = 3
Query:  138 IKIFKVDTVNEF---YSGEIFLHAKWRE--------PL---LDNK-SDLKDISLSTFWNPKLSIENIFQITKSTTSLEVSFDEGNNKRAFVVEKTRLKAAFRETLELQHFPFDCQDLSISVGT-EYSIEELEMAENPNDISKLNTLDGIESQEWNLYEHVEVENKIVINDCNFGPKERQIMTFTCRATRRFKYFLINHXXXXXXXXXXXXXXXXXXXXNTYGRLALCMTTLLTSVTFKVAVSNNLPKVPYLTYLDKAILGNIFMIMCLCLWHAATSVYFY 929
            I I  +D V+E    Y+  ++    WR+        PL   LDN+ +D   +  + F N K S   +  +T     + +  D        V+   R+       ++L+ +P D Q+ ++ + +  Y+ +++E      D      + G+E  E  L +   VE+++V  +  F       ++ + R  R   YF++  +M S +  +L++ SF I    +  R+AL +TT+LT  T    +   LPK+PY+  +D  ++G    +    L +A  +  F+
Sbjct:   89 IDIASIDMVSEVNMDYTLTMYFQQYWRDKRLAYSGIPLNLTLDNRVADQLWVPDTYFLNDKKSF--VHGVTVKNRMIRLHPD------GTVLYGLRITTTAACMMDLRRYPLDEQNCTLEIESYGYTTDDIEFYWRGGD----KAVTGVERIE--LPQFSIVEHRLVSRNVVFATGAYPRLSLSFRLKRNIGYFILQTYMPSILITILSWVSFWINYDASAARVALGITTVLTMTTINTHLRETLPKIPYVKAIDMYLMGCFVFVFLALLEYAFVNYIFF 354          
BLAST of Neur_chan_LBD domain-containing protein vs. Ensembl Mouse
Match: Gabrb3 (gamma-aminobutyric acid (GABA) A receptor, subunit beta 3 [Source:MGI Symbol;Acc:MGI:95621])

HSP 1 Score: 49.2914 bits (116), Expect = 7.203e-6
Identity = 65/280 (23.21%), Postives = 125/280 (44.64%), Query Frame = 3
Query:  138 IKIFKVDTVNEF---YSGEIFLHAKWRE--------PL---LDNK-SDLKDISLSTFWNPKLSIENIFQITKSTTSLEVSFDEGNNKRAFVVEKTRLKAAFRETLELQHFPFDCQDLSISVGT-EYSIEELEMAENPNDISKLNTLDGIESQEWNLYEHVEVENKIVINDCNFGPKERQIMTFTCRATRRFKYFLINHXXXXXXXXXXXXXXXXXXXXNTYGRLALCMTTLLTSVTFKVAVSNNLPKVPYLTYLDKAILGNIFMIMCLCLWHAATSVYFY 929
            I I  +D V+E    Y+  ++    WR+        PL   LDN+ +D   +  + F N K S   +  +T     + +  D        V+   R+       ++L+ +P D Q+ ++ + +  Y+ +++E      D      + G+E  E  L +   VE+++V  +  F       ++ + R  R   YF++  +M S +  +L++ SF I    +  R+AL +TT+LT  T    +   LPK+PY+  +D  ++G    +    L +A  +  F+
Sbjct:   67 IDIASIDMVSEVNMDYTLTMYFQQYWRDKRLAYSGIPLNLTLDNRVADQLWVPDTYFLNDKKSF--VHGVTVKNRMIRLHPD------GTVLYGLRITTTAACMMDLRRYPLDEQNCTLEIESYGYTTDDIEFYWRGGD----KAVTGVERIE--LPQFSIVEHRLVSRNVVFATGAYPRLSLSFRLKRNIGYFILQTYMPSILITILSWVSFWINYDASAARVALGITTVLTMTTINTHLRETLPKIPYVKAIDMYLMGCFVFVFLALLEYAFVNYIFF 332          
BLAST of Neur_chan_LBD domain-containing protein vs. TrEMBL
Match: A0A3R7CFX9 (Neuronal acetylcholine receptor subunit alpha-7 OS=Clonorchis sinensis OX=79923 GN=CHRNA7 PE=4 SV=1)

HSP 1 Score: 225.328 bits (573), Expect = 1.590e-65
Identity = 146/374 (39.04%), Postives = 210/374 (56.15%), Query Frame = 3
Query:  117 VYLRCVFIKIFKVDTVNEFYSGEIFLHAKWREPLLDN--------------------------KSDLKDISLST--FWNPKLSIENIFQITKSTTSLEVSFDEGNNKRAFVVEKTRLKAAFRETLELQHFPFDCQDLSISVGTEYSIEELEMAENPNDISKLNTLDGIESQEWNLYEHVEVENKIVINDCNFGPKERQ--IMTFTCRATRRFKYFLINHXXXXXXXXXXXXXXXXXXXXNTYGRLALCMTTLLTSVTFKVAVSNNLPKVPYLTYLDKAILGNIFMIMCLCLWHAATSVYFYDSTTLQSINDSIAIEKVKQVEKYLIPALLIFYVTAVVVFALVIYFDAGSRRREMHLKDIEFEQKIKRLKNEER 1148
            V L  +F+KI +VDTVNE Y  +IFL A+WREPLLD                           K  L  + L    FWNP+L ++N         S EV F E + + A++VEK R+K  F ETLEL+HFPFDCQDLS++V  + ++EE+E+  +P ++S+++     +SQEW ++ HV++ +  +    + G  +R+   + FT R+ RR  YF++N  +IS +  LL+FS FS+       RL L +  LLT+VTFK A S NLPK+ YLTYLDK +L N FM++ L +WH      F     L            K  E+Y++  LL  Y    VVF L +Y DAGSRRR M  KD++F Q  +R++ E++
Sbjct:   39 VELMLIFVKIGQVDTVNERYQADIFLQARWREPLLDATWNTSRPRNNFRTFKMVENPVMELAPKRHLHTLKLQDDEFWNPRLLLDNAQGEPIEIVSHEVEFVEPDFE-AYLVEKRRIKGVFHETLELKHFPFDCQDLSVTVTCDRTVEEVELVPSPTEVSQVDRRCAADSQEWKIFHHVDIASMEIQTAYSPGTCKRRHPGLVFTSRSARRAGYFMVNMALISCVLSLLSFSVFSVPVDG--NRLQLSLLLLLTTVTFKFAASQNLPKISYLTYLDKMVLANFFMLVILTVWHTIARSVFAKYPGL------------KDKEQYVVYTLLSAYCLGAVVFGLTVYLDAGSRRRLMKSKDMDFTQHKQRIELEKQ 397          
BLAST of Neur_chan_LBD domain-containing protein vs. TrEMBL
Match: A0A4E0RSR9 (Uncharacterized protein OS=Fasciola hepatica OX=6192 GN=D915_005714 PE=4 SV=1)

HSP 1 Score: 221.861 bits (564), Expect = 2.058e-64
Identity = 144/369 (39.02%), Postives = 207/369 (56.10%), Query Frame = 3
Query:  132 VFIKIFKVDTVNEFYSGEIFLHAKWREPLLDN--------------------------KSDLKDISLST--FWNPKLSIENIFQITKSTTSLEVSFDEGNNKRAFVVEKTRLKAAFRETLELQHFPFDCQDLSISVGTEYSIEELEMAENPNDISKLNTLDGIESQEWNLYEHVEVENKIVINDCNFGPKERQ--IMTFTCRATRRFKYFLINHXXXXXXXXXXXXXXXXXXXXNTYGRLALCMTTLLTSVTFKVAVSNNLPKVPYLTYLDKAILGNIFMIMCLCLWHAATSVYFYDSTTLQSINDSIAIEKVKQVEKYLIPALLIFYVTAVVVFALVIYFDAGSRRREMHLKDIEFEQKIKRLKNEER 1148
            +F+KI +VDTVNE Y  +IFL A+WREPLLD                           K  L  + L    FWNP+L ++N         S EV F E   + A++VEK R+K  F ETLEL+HFPFD QDLS++V  + S++E+ +  +P ++S+++     +SQEW ++ HV+VE   +    + G  +R+   + FT R+ RR  YF++N  +IS +  LL+F  FS+       RL   +  LLT+VTFK A S NLPK+ YLTYLDK +L N FM++ L +WH          T  +S+  S +  K+   EKY++  LL  Y    V+F L +Y DAGSRRR M  KD+EF Q   R++ E++
Sbjct:    3 IFVKIGQVDTVNERYQADIFLQARWREPLLDATWKSERAQKNWRGKSGVENPIQDLVPKRHLHTLGLQDDEFWNPRLLLDNAQGEPIEIVSHEVEFVEPTFE-AYLVEKRRIKGVFHETLELKHFPFDVQDLSVTVTCDRSVDEVLLVPSPTEVSQVDRRGAADSQEWKIFHHVDVERMEIQTAYSPGTSKRRHPGLVFTSRSARRSGYFMVNMVLISCVLCLLSFCIFSVPVDGN--RLQQALLLLLTTVTFKFAASQNLPKISYLTYLDKVVLANFFMLVILTVWH----------TIARSL--SASYPKLLDNEKYVVYTLLSSYCLGAVIFGLTVYLDAGSRRRLMQRKDVEFGQLKTRIEREKQ 356          
BLAST of Neur_chan_LBD domain-containing protein vs. TrEMBL
Match: R7VF52 (Neur_chan_LBD domain-containing protein OS=Capitella teleta OX=283909 GN=CAPTEDRAFT_228357 PE=3 SV=1)

HSP 1 Score: 220.32 bits (560), Expect = 4.811e-64
Identity = 126/335 (37.61%), Postives = 194/335 (57.91%), Query Frame = 3
Query:  114 LVYLRCVFIKIFKVDTVNEFYSGEIFLHAKWREPLLDNKS--DLKDISLSTFWNPKLSIENIFQITKSTTSLEVSFDEGNNKRAFVVEKTRLKAAFRETLELQHFPFDCQDLSISVGTEYSIEELEMAENPNDISKLNTLDGIESQEWNLYEHVEVENKIVINDCNFGPKERQIMTFTCRATRRFKYFLINHXXXXXXXXXXXXXXXXXXXXNTYGRLALCMTTLLTSVTFKVAVSNNLPKVPYLTYLDKAILGNIFMIMCLCLWHAATSVYFYDSTTLQSINDSIAIEKVKQVEKYLIPALLIFYVTAVVVFALVIYFDAGSRRREMHLKDIEF 1112
             V LR VF+KI ++DT+ E YS + F+ AKWREP LD K+  +LK I L  FWNP L IEN+   TK  T L  S    +   AFV+E+ R++  F E LEL  FP D QDL++++ +E    E+++  + N++S +N    ++ QEW L+EH+EV  K++  + +   +    ++ TCRA RR  YF  N F++      L+F++F++       RL L  T LLTS+TFK  ++ +LPK+ YLTY+DK +L ++ ++  +C+WHA  +V+ +             I  +  +E+ +  A  + Y+   VVF   +YFDA  RRR M  KD E+
Sbjct:   33 FVELRVVFLKIGEIDTLKEQYSADTFIQAKWREPALDGKTTEELKRIDLDRFWNPLLFIENVLSETKEATWLTAS--TNSRAEAFVLERRRVRGVFMENLELNDFPLDVQDLTVTITSERPDTEIDIIPDENEMSGINVQTFVDQQEWRLHEHIEVSKKVMTQEYSSSNRCHPALSVTCRAARRPGYFYWNVFLVMFFISALSFATFAVSPELPQNRLQLSFTLLLTSITFKFVINQSLPKISYLTYMDKYVLLSLVILCMVCVWHAVVTVFVHH-----------GINFLMTLERDVFIAFSVIYIGFHVVFIFWLYFDACKRRRLMKHKDKEY 354          
BLAST of Neur_chan_LBD domain-containing protein vs. TrEMBL
Match: A0A075A8W6 (Uncharacterized protein OS=Opisthorchis viverrini OX=6198 GN=T265_08254 PE=3 SV=1)

HSP 1 Score: 224.172 bits (570), Expect = 3.833e-63
Identity = 145/370 (39.19%), Postives = 207/370 (55.95%), Query Frame = 3
Query:  117 VYLRCVFIKIFKVDTVNEFYSGEIFLHAKWREPLLD--------------------------NKSDLKDISLST--FWNPKLSIENIFQITKSTTSLEVSFDEGNNKRAFVVEKTRLKAAFRETLELQHFPFDCQDLSISVGTEYSIEELEMAENPNDISKLNTLDGIESQEWNLYEHVEVENKIVINDCNFGPKERQ--IMTFTCRATRRFKYFLINHXXXXXXXXXXXXXXXXXXXXNTYGRLALCMTTLLTSVTFKVAVSNNLPKVPYLTYLDKAILGNIFMIMCLCLWHAATSVYFYDSTTLQSINDSIAIEKVKQVEKYLIPALLIFYVTAVVVFALVIYFDAGSRRREMHLKDIEFEQKIKRLK 1136
            V L  +F+KI +VDTVNE Y  +IFL A+WREPLLD                           K  L  + L    FWNP+L ++N         S EV F E + + A++VEK R+K  F ETLEL+HFPFDCQDLS++V  + ++EE+E+  +P ++S+++     +SQEW ++ HV++ +  +    + G  +R+   + FT R+ RR  YF++N  +IS +  LL+FS FS+       RL L +  LLT+VTFK A S NLPK+ YLTYLDK +L N FM++ L +WH      F     L            K  E+Y++  LL  Y    VVF L +Y DAGSRRR M  KD++F Q  +R++
Sbjct:  239 VELMLIFVKIGQVDTVNERYQADIFLQARWREPLLDATWNTSRPRNNFRTFNMVENPVMELAPKRHLHTLKLQDDEFWNPRLLLDNAQGEPIEIVSHEVEFVEPDFE-AYLVEKRRIKGIFHETLELKHFPFDCQDLSVTVTCDRTVEEVELVPSPTEVSQVDRRCAADSQEWKIFHHVDIASMEIQTAYSPGTCKRRHPGLVFTSRSARRAGYFMVNMALISCVLSLLSFSVFSVPVDG--NRLQLSLLLLLTTVTFKFAASQNLPKISYLTYLDKMVLANFFMLVILTVWHTIARSVFAKYPGL------------KDKEQYVVYTLLSAYCLGAVVFGLTVYLDAGSRRRLMKSKDMDFTQHKQRIE 593          
BLAST of Neur_chan_LBD domain-containing protein vs. TrEMBL
Match: A0A5K4FCR6 (Uncharacterized protein OS=Schistosoma mansoni OX=6183 PE=4 SV=1)

HSP 1 Score: 217.624 bits (553), Expect = 2.625e-60
Identity = 145/378 (38.36%), Postives = 212/378 (56.08%), Query Frame = 3
Query:  117 VYLRCVFIKIFKVDTVNEFYSGEIFLHAKWREPLLD----------------------------NKSDLKDISLST--FWNPKLSIENIFQITKSTTSLEVSFDEGNNKRAFVVEKTRLKAAFRETLELQHFPFDCQDLSISVGTEYSIEELEMAENPNDISKLNTLDGIESQEWNLYEHVEVENKIVINDCNFGP----KERQIMTFTCRATRRFKYFLINHXXXXXXXXXXXXXXXXXXXXNTYGRLALCMTTLLTSVTFKVAVSNNLPKVPYLTYLDKAILGNIFMIMCLCLWHAATSVYFYDSTTLQSINDSIAIEKVKQVEKYLIPALLIFYVTAVVVFALVIYFDAGSRRREMHLKDIEFEQKIKRLKNEER 1148
            V L  +F+K+ +VDTVNE Y  +IFL A+WREPLLD                            +K  L  + L    FWNP+L I+N         S EV F E + + A++VEK R+K  F ETLEL+HFPFDCQDLS+++  + + +E+E+  +P ++S+++     +SQEW ++ HV++  K +     + P    +    + FT R+ RR  YFL+N  +IS +  LL+FS+FS+ +     RL L +  LLT+VTFK A S NLPK+ YLTYLDK +L N FM++ L +WHA                 S +  K  + E Y++ +LL  Y    V+F L +Y DAGSRRR M  KDIEF Q  ++++ E++
Sbjct:  276 VELVLIFVKVGQVDTVNERYQADIFLQARWREPLLDAMWNKSSLKSKSSWQTNPSIENPFTDLTSKRQLNTLKLQDDEFWNPRLLIDNAEGEPIEIISHEVEFIEPDFE-AYLVEKRRIKGIFHETLELRHFPFDCQDLSVTITCDRTTDEVELVASPTEVSQVDVRCAADSQEWKIFHHVDI--KSIEIQTGYSPSTSKRHHPGLVFTSRSARRSGYFLVNMILISCVLCLLSFSAFSVPANE--NRLQLSLLLLLTTVTFKFAASQNLPKISYLTYLDKVVLVNFFMLVILTVWHAIARAV------------SASKPKFLEYEHYVMYSLLSCYCIGSVLFGLTVYLDAGSRRRLMKRKDIEFNQYKQQIEAEKQ 636          
BLAST of Neur_chan_LBD domain-containing protein vs. Ensembl Cavefish
Match: glra2 (glycine receptor, alpha 2 [Source:ZFIN;Acc:ZDB-GENE-090407-1])

HSP 1 Score: 51.9878 bits (123), Expect = 7.128e-7
Identity = 68/266 (25.56%), Postives = 111/266 (41.73%), Query Frame = 3
Query:  174 YSGEIFLHAKWREPLL------DNKSDLKDISLSTFWNPKL-----SIENIFQITKSTTSLEVSFDEGNNKRAFVVEKTRLKAAFRETLELQHFPFDCQDLSISVGT-EYSIEEL---EMAENPNDISKLNTLDGIESQEWNLYEHVEVENKIVINDCNFGPKERQIMTFTC-----RATRRFKYFLINHXXXXXXXXXXXXXXXXXXXXNTYGRLALCMTTLLTSVTFKVAVSNNLPKVPYLTYLDKAILGNIFMIMCLCLWHAA 911
            Y   IFL  KW +P L      D   DL    L + W P L        N   +T     L +S      K   V+   RL       ++L++FP D Q  ++ + +  Y++ +L    + E P  ++     +G+   ++ + E  E+          +  K      FTC     +  R+  Y+LI  ++ S +  +L++ SF I       R+AL +TT+LT  T       +LPKV Y+  +D      I+M +CL    AA
Sbjct:   80 YRVNIFLRQKWNDPRLAYSEYPDPSLDLDPSMLDSIWKPDLFFANEKGANFHDVTTDNKLLRIS------KDGTVLYSIRLTLILSCPMDLKNFPMDVQTCTMQLESFGYTMNDLIFEWLDEGPVQVA-----EGLTLPQFIMREEKEL---------GYCTKHYNTGKFTCIEVKFKLERQMGYYLIQMYIPSLLIVILSWVSFWINMDAAPARVALGITTVLTMTTQSSGSRASLPKVSYVKAID------IWMAVCLLFVFAA 319          
BLAST of Neur_chan_LBD domain-containing protein vs. Ensembl Sea Lamprey
Match: glra4a (glycine receptor, alpha 4a [Source:ZFIN;Acc:ZDB-GENE-010410-3])

HSP 1 Score: 48.1358 bits (113), Expect = 2.826e-6
Identity = 64/246 (26.02%), Postives = 109/246 (44.31%), Query Frame = 3
Query:  174 YSGEIFLHAKWREPLLDN--KS--------DLKDISLSTFWNPKLSIEN----IFQITKSTTSLEVSFDEGNNKRAFVVEKTRLKAAFRETLELQHFPFDCQDLSISVGTEYSIEELEMAENPNDISKLNTLDGIESQEWNLYEHVEVENKIVINDCNFGPKERQIMTFTC-RAT----RRFKYFLINHXXXXXXXXXXXXXXXXXXXXNTYGRLALCMTTLLTSVTFKVAVSNNLPKVPYLTYLD 854
            YS  IFL   W +P + N  KS        DL +  + + W P L  EN     FQ+ +  T  +  +        F+  +  L  A   +LE+  +P D Q  SI + + Y     ++    ND   ++   G+ + ++ L       N+  + +C    KE    TF+C +AT    R   Y+LI  ++ S +  ++++ SF +       R+ L +TT+LT  T   + +  LPKV Y+  +D
Sbjct:   90 YSINIFLRQTWNDPRILNVLKSIEYNTDFLDLGNSFVDSVWKPDLFFENEKSAAFQMYQLVTGFKYMYTFAMWITCFLCFRLSLVLACPMSLEV--YPMDAQYCSIYLES-YGYTTNDLIFQWNDTEPVSFGAGVSTPKFTL------SNETFLGECT---KEYTYGTFSCVKATFFLDRDMGYYLIQVYIPSCLLVIISWLSFWLNVEAAPARVGLGITTILTVTTQMTSANAALPKVSYIKAID 323          
BLAST of Neur_chan_LBD domain-containing protein vs. Ensembl Nematostella
Match: EDO32790 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SU26])

HSP 1 Score: 95.5153 bits (236), Expect = 1.282e-21
Identity = 71/258 (27.52%), Postives = 127/258 (49.22%), Query Frame = 3
Query:  117 VYLRCVFIKIFKVDTVNEFYSGEIFLHAKWREPLLDNKSDLKDISLSTFWNPKLSIENIFQITKSTTSLEVSFDEGNNKRAFVVEKTRLKAAFRETLELQHFPFDCQDLSISVGTEYSIEELEMAENPNDISKLNTLDGIESQEWNLYEHVEVENKIVINDCNFGPKERQ--IMTFTCRATRRFKYFLINHXXXXXXXXXXXXXXXXXXXXNTYGRLALCMTTLLTSVTFKVAVSNNLPKVPYLTYLDKAILGNIFMI 884
            V +RC    +  +D + + ++ E+++ A WREP L  K + +++     W+PK+S  N   + +      + ++E N+      E  +++  F+E   L+ FP D Q+LSI + +++S   +   ++      L        ++W LY HV  +      +   GP +R   +   T    RR  ++  N  ++ S+   L+F+SF+I    T  RL + +  LL SV +K   S +LP+  YLT+LDK  LGN+  I
Sbjct:   18 VLIRCGISFLGDIDVIRQQFTCELWMTASWREPKLAGKKN-EEVKWDNEWSPKISFSNSLLLDRVYKGRRLYYEE-NSTVPLAQEVYKIRGTFKEQFSLEQFPVDLQELSIIISSDWSDRTVTFEKDMAKPDYLRQQTFSSPRDWVLYPHVHTDTATQEGE-GLGPNDRSYPVYIITAHVRRRAVHYFWNTAVVMSVLTALSFASFAIPPQQTADRLTVTLLLLLISVAYKFVTSLHLPRTSYLTFLDKYQLGNLLFI 272          
BLAST of Neur_chan_LBD domain-containing protein vs. Ensembl Nematostella
Match: EDO43147 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RZH2])

HSP 1 Score: 51.2174 bits (121), Expect = 2.735e-7
Identity = 60/261 (22.99%), Postives = 112/261 (42.91%), Query Frame = 3
Query:  141 KIFKVDTVNEF---YSGEIFLHAKWREP-LLDNKSD---LKDISLSTFWNPKLSI-----ENIFQITKSTTSLEVSFDEGNNKRAFVVEKTRLKAAFRETLELQHFPFDCQDLSISVGT-EYSIEELEMAENPNDISKLNTLDGIESQEWNLYEHVEVENKIVINDCNFGPKERQIMTFTCRATRRFKYFLINHXXXXXXXXXXXXXXXXXXXXNTYGRLALCMTTLLTSVTFKVAVSNNLPKVPYLTYLDKAILGNIFMI 884
            K+  +  +NE    +S +IF    W EP    N S+   + + +   FW P          N  ++TK    + + +  GN     V    RL    +  + LQ FP D Q   + + +  Y+ E+++    P     +  +    +Q    +  VE   + +      G   + + TF+ +  RR +YF I     + +  +L++  F I+      R++L +TT+L+++     V+  +PKV Y+  +D  +LGN   I
Sbjct:   35 KVVSLGGINEASMEFSMDIFFRQWWHEPRFTHNYSEPFTMAEDAGKLFWIPDTYFINAKKSNFHKVTKENARI-IIYPSGN-----VYYSVRLTLTLQCNMNLQLFPMDVQACPLFIESYAYTSEDIKYKWTPRGTKGIEIISNETAQ----FVLVEARTEQIATAKISGHFSQLVATFSLK--RRLEYFAITVVTPAMILVVLSWCCFWIVPDAIPARISLSVTTILSTLLLSGTVNAQMPKVSYMKAIDVFVLGNFAFI 283          
BLAST of Neur_chan_LBD domain-containing protein vs. Ensembl Nematostella
Match: EDO35410 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SLK4])

HSP 1 Score: 50.8322 bits (120), Expect = 4.746e-7
Identity = 69/277 (24.91%), Postives = 128/277 (46.21%), Query Frame = 3
Query:   93 SKKNNQRLVYLRCVFIKIFKVDTVNEFYSGEIFLHAKWREPLL--DNKSDLKDISLSTFWNPKLSIENI-FQITKSTTSLEVSFDE---GNNKRAFVVEKTRLKAAFRETLELQHFPFDCQDLSISVGTEYSIEELEMA----ENPNDISKLNTLDGIESQEWNLYEHVEVENKIVINDCNFGPKERQIMTFTCRATRRFKYFLINHXXXXXXXXXXXXXXXXXXXXNTYGRLALCMTTLLTSVTFKVAVSNNLPKVPYLTYLDKAILGNIFMIMCL 893
              K    +VY+      I+ +  +N  ++ +I+L   WR+  L  + ++    ++LS+  N ++ + +  F  TK     +V+ D           +    RL       L+L+ FP D Q  S+S+ + Y  +  ++     E  ++ S +   D +E  +   +E + V     +N  N G     +  F  R  RR  YFLI+ ++ S++  ++++ SF I       R+AL +TT+LT  T   +   NLPKV Y+    KAI  + ++++CL
Sbjct:   40 GSKGEPVVVYVDMYVSNIWAMQEMNMDFTIDIYLRQYWRDERLQFETQTPGAMLTLSSDINKQIWVPSTYFLATKKAYFHDVTTDNYLLQVKPDGSLFYSIRLTITTSCRLDLRDFPHDTQSCSLSLES-YGYQSTDVLYVWNERLDNTSAIYIHDDLELPQ---FEVLGVSRSAKMNKYNIGNHSSLVANF--RMKRRIGYFLIDTYIPSTIIVIISWISFWIDPETAPARVALGITTVLTMTTLISSARANLPKVSYV----KAI--DWYLLLCL 304          
BLAST of Neur_chan_LBD domain-containing protein vs. Ensembl Nematostella
Match: EDO40009 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S8L9])

HSP 1 Score: 48.1358 bits (113), Expect = 2.090e-6
Identity = 57/243 (23.46%), Postives = 113/243 (46.50%), Query Frame = 3
Query:  174 YSGEIFLHAKWREPLL-------DNKSDLKDISLSTFWNPKLSIENIFQ-ITKSTTSLEVSFDEGNNKRA-FVVEKTRLKAAFRETLELQHFPFDCQDLSISVGT-EYSIEEL--EMAENPNDISKLNTLDGIESQEWNLYEHVEVENKIVINDCNFGPKERQIMTFTCRATRRFKYFLINHXXXXXXXXXXXXXXXXXXXXNTYGRLALCMTTLLTSVTFKVAVSNNLPKVPYLTYLDKAIL 866
            YS  +++  +W +P L       ++   L    +S  W P   I N  Q +T S   + +      N    F  EKT +       ++L++FP D Q     + +  ++++++  +  ++P     + T +G+++ E+++     +EN  V N  NF       +T      RR  Y++I  ++  SM  +L++ SF +   +   R AL +TT+L   T    + ++LP VPY+  +D+ ++
Sbjct:    3 YSMTLYMRQRWLDPRLAYGDMFPEDFITLGQDMVSQIWTPDTYIVNKKQSMTNSGQGMSMFIRISRNGSVIFSAEKTLVIVC---QMDLRNFPMDEQQCDFKIESYGFTMKDVVYKWLDDPKQ-KTIETAEGLDATEFSIVSLKPMENISVFNLGNFSS-----LTMRIYLDRRTTYYVIQIYIPCSMIVMLSWISFWLDYKSVPARTALGITTVLAMTTLLFGIQSSLPGVPYIKAVDQFLI 236          
BLAST of Neur_chan_LBD domain-containing protein vs. Ensembl Nematostella
Match: EDO45564 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RSH5])

HSP 1 Score: 46.9802 bits (110), Expect = 9.096e-6
Identity = 59/254 (23.23%), Postives = 116/254 (45.67%), Query Frame = 3
Query:  117 VYLRCVFIKIFKVDTVNEFYSGEIFLHAKWREPLL----DNKSDLKDISLST--FWNPKLSIENIFQITKST------TSLEVSFDEGNNKRAFVVEKTRLKAAFRETLELQHFPFDCQDLSISVGT-EYSIEELEM--AENPNDISKLNTLDGIESQEWNLYEHVEVENKIVINDCNFGPKERQI-MTFTCRATRRFKYFLINHXXXXXXXXXXXXXXXXXXXXNTYGRLALCMTTLLTSVTFKVAVSNNLPK 830
            V L   + ++  +D  N+  S ++++   WR P L    D+   L+ I++++   W P + + N   I ++       T + +  D  N+  A     T +K+  +  +++ +FPFD Q   I  G+  Y+   L +  A N +D+SK  T+ G    EW L     V N +  + C    K   I +T+T    R+  ++L N+ ++  M   +      ++   +  R++L +T LL    F +  + ++P+
Sbjct:   29 VSLDIAYSQLIDLDGKNQILSSKVWIRQVWRNPFLSWNPDDYGGLESINVNSNLVWKPDIILYNNIGIGQTGAMYNFDTKVVIDSDGTNSWYA----PTEIKSICQ--IDITYFPFDAQSCPIIFGSWTYTGNYLNLVNARNQSDLSKY-TISG----EWELKSAPVVRNVVKYSCC----KHPYIDVTYTINIRRKVLFYL-NNLILPCMVLAILTVCSFLLPPASGERISLVITILLGLTVFMLVFTESVPR 266          
BLAST of Neur_chan_LBD domain-containing protein vs. Ensembl Medaka
Match: glra4a (glycine receptor subunit alpha-4-like [Source:NCBI gene;Acc:101156095])

HSP 1 Score: 51.2174 bits (121), Expect = 1.212e-6
Identity = 68/266 (25.56%), Postives = 112/266 (42.11%), Query Frame = 3
Query:  174 YSGEIFLHAKWREPLL------DNKSDLKDISLSTFWNPKLSI-----ENIFQITKSTTSLEVSFDEGNNKRAFVVEKTRLKAAFRETLELQHFPFDCQDLSISVGT-EYSIEEL---EMAENPNDISKLNTLDGIESQEWNLYEHVEVENKIVINDCNFGPKERQIMTFTC-----RATRRFKYFLINHXXXXXXXXXXXXXXXXXXXXNTYGRLALCMTTLLTSVTFKVAVSNNLPKVPYLTYLDKAILGNIFMIMCLCLWHAA 911
            Y   +FL   W +P L      DN  DL    L + W P L        N  ++T     L + F +G+     V+   RL       ++L++FP D Q  ++ + +  Y++ +L    +++NP  +          + +  L + V  E K    D  +  K      FTC        R+  Y+LI  ++ S +  +L++ SF I       R+ L +TT+LT  T       +LPKV Y+  +D      I+M +CL    AA
Sbjct:   91 YRLNVFLRQNWNDPRLAYSEYPDNSLDLDPSMLDSIWKPDLFFANEKGANFHEVTTDNKLLRI-FQDGS-----VLYSIRLTLILSCPMDLKNFPMDIQTCTMQLESFGYTMNDLIFEWLSDNPVQV----------ADDLTLPQFVLKEEK----DLGYCTKHYNTGKFTCIEVKFHLERQMGYYLIQMYIPSLLIVILSWVSFWINMDAAPARVGLGITTVLTMTTQSSGSRASLPKVSYVKAID------IWMAVCLLFVFAA 330          
BLAST of Neur_chan_LBD domain-containing protein vs. Ensembl Medaka
Match: glra2 (glycine receptor alpha 2 [Source:NCBI gene;Acc:101169154])

HSP 1 Score: 50.0618 bits (118), Expect = 2.619e-6
Identity = 68/271 (25.09%), Postives = 107/271 (39.48%), Query Frame = 3
Query:  174 YSGEIFLHAKWREPLL------DNKSDLKDISLSTFWNPKL-----SIENIFQITKSTTSLEVSFDEGNNKRAFVVEKTRLKAAFRETLELQHFPFDCQDLSISVGT-EYSIEELEMAENPNDISKLNTLDGIESQEWNLYEHVEVENKIVI--------NDCNFGPKERQIMTFTC-----RATRRFKYFLINHXXXXXXXXXXXXXXXXXXXXNTYGRLALCMTTLLTSVTFKVAVSNNLPKVPYLTYLDKAILGNIFMIMCLCLWHAA 911
            Y   IFL  KW +P L      D+  DL    L + W P L        N   +T     L + F +G      V+   RL       ++L++FP D Q  ++ + +  Y++ +L                     EW  Y  V+V   + +         +  +  K      FTC        R+  Y+LI  ++ S +  +L++ SF I       R+AL +TT+LT  T       +LPKV Y+  +D      I+M +CL    AA
Sbjct:   93 YRVNIFLRQKWNDPRLAYSKYPDSSLDLDPSMLDSIWKPDLFFANEKGANFHDVTTDNKLLRI-FKDGT-----VLYSIRLTLILSCPMDLKNFPMDVQTCTMQLESFGYTMNDLVF-------------------EWLEYGAVQVSEGLTLPQFIMKEEKELGYCTKHYNTGKFTCIEVKFHLERQMGYYLIQMYIPSLLIVILSWVSFWINMDAAPARVALGITTVLTMTTQSSGSRASLPKVSYVKAID------IWMAVCLLFVFAA 332          
BLAST of Neur_chan_LBD domain-containing protein vs. Planmine SMEST
Match: SMESG000041796.1 (SMESG000041796.1)

HSP 1 Score: 575.474 bits (1482), Expect = 0.000e+0
Identity = 299/365 (81.92%), Postives = 325/365 (89.04%), Query Frame = 3
Query:   66 FTMKNNSELSKKNNQRLVYLRCVFIKIFKVDTVNEFYSGEIFLHAKWREPLLDNKSDLKDISLSTFWNPKLSIENIFQITKSTTSLEVSFDEGNNKRAFVVEKTRLKAAFRETLELQHFPFDCQDLSISVGTEYSIEELEMAENPNDISKLNTLDGIESQEWNLYEHVEVENKIVINDCNFGPKERQIMTFTCRATRRFKYFLINHXXXXXXXXXXXXXXXXXXXXNTYGRLALCMTTLLTSVTFKVAVSNNLPKVPYLTYLDKAILGNIFMIMCLCLWHAATSVYFYDSTTLQSINDSIAIEKVKQVEKYLIPALLIFYVTAVVVFALVIYFDAGSRRREMHLKDIEFEQKIKRLKNEERFCDL 1160
            + M+NNS+ ++   +R VYLRCVFIKI+KVDTVNEFYSGEIFLHAKWREPLLDNKSDLKDISLSTFWNPKLSIENIFQITKSTTSLEVSFDEGNNKRAFVVEKTR+KAAFRETLELQHFPFDCQDLSISVGTEYSIEELEMAENPNDISKLNTLDGIESQEWNLYEHVEVENKIVINDCNFGPKERQIMTFTCRATRRFKYFLINHFMISSMFFLLTFSSFSIISTNTYGRLALCMTTLLTSVTFKVAVS NLPK+PYLTYLDK ILGNI MIM LC+WHA TS +F D +T    N ++A+  +  +E  LIP LL FY+ A++ FA +IY+DAGSRRREM  KD EF+    + +NE  FC+L
Sbjct:   52 YLMENNSKSNQIKTKRKVYLRCVFIKIYKVDTVNEFYSGEIFLHAKWREPLLDNKSDLKDISLSTFWNPKLSIENIFQITKSTTSLEVSFDEGNNKRAFVVEKTRIKAAFRETLELQHFPFDCQDLSISVGTEYSIEELEMAENPNDISKLNTLDGIESQEWNLYEHVEVENKIVINDCNFGPKERQIMTFTCRATRRFKYFLINHFMISSMFFLLTFSSFSIISTNTYGRLALCMTTLLTSVTFKVAVSQNLPKIPYLTYLDKTILGNILMIMLLCIWHAVTSFWFIDPST----NTTVAMSSLTNIENILIPTLLGFYLIAILTFAFIIYYDAGSRRREMTEKDNEFKSLSIKKENERLFCEL 412          
BLAST of Neur_chan_LBD domain-containing protein vs. Planmine SMEST
Match: SMESG000041740.1 (SMESG000041740.1)

HSP 1 Score: 531.176 bits (1367), Expect = 0.000e+0
Identity = 272/350 (77.71%), Postives = 305/350 (87.14%), Query Frame = 3
Query:  117 VYLRCVFIKIFKVDTVNEFYSGEIFLHAKWREPLLDNKSDLKDISLSTFWNPKLSIENIFQITKSTTSLEVSFDEGNNKRAFVVEKTRLKAAFRETLELQHFPFDCQDLSISVGTEYSIEELEMAENPNDISKLNTLDGIESQEWNLYEHVEVENKIVINDCNFGPKERQIMTFTCRATRRFKYFLINHXXXXXXXXXXXXXXXXXXXXNTYGRLALCMTTLLTSVTFKVAVSNNLPKVPYLTYLDKAILGNIFMIMCLCLWHAATSVYFYDSTTLQSINDSIAIEKVKQVEKYLIPALLIFYVTAVVVFALVIYFDAGSRRREMHLKDIEFEQKIKRLKNEERFCDLPY 1166
            V++RCVF+KIF+VDTVNE+Y+ EIFL AKWREP+LDNK + K+I LS FWNP+L IEN+F+    T  LEVS+ E     AFVV+K R+KA F ETLEL  FPFDCQDLS++V +EYS +E+E+ E P DISKLN+ D +ESQEW+L+ HV+VE K +I DCN GPKER  +TFTCRA RRF YFL+NHF+IS MFF LTF SFS+IS+NT+GRL LCM TLLTSVTFKVAVSNNLPKVPYLTYLDKAILGNIFMIMCLCLWHAATSVYFYDSTTLQSINDSIAIEKVKQVEKYLIPALLIFYVTAVVVFALVIYFDAGSRRREMHLKDIEFEQKIKRLKNEERFCDLPY
Sbjct:   16 VFIRCVFLKIFQVDTVNEYYNAEIFLQAKWREPILDNKLETKNIDLSKFWNPRLVIENLFKENNETVLLEVSYVEKEGV-AFVVQKRRVKAIFHETLELNQFPFDCQDLSVTVSSEYSSDEVELVEFPTDISKLNSSDAVESQEWDLHSHVDVEIKRIITDCNIGPKERTSITFTCRAGRRFGYFLVNHFLISCMFFFLTFCSFSVISSNTFGRLQLCMITLLTSVTFKVAVSNNLPKVPYLTYLDKAILGNIFMIMCLCLWHAATSVYFYDSTTLQSINDSIAIEKVKQVEKYLIPALLIFYVTAVVVFALVIYFDAGSRRREMHLKDIEFEQKIKRLKNEERFCDLPY 364          
BLAST of Neur_chan_LBD domain-containing protein vs. Planmine SMEST
Match: SMESG000041829.1 (SMESG000041829.1)

HSP 1 Score: 495.352 bits (1274), Expect = 1.326e-175
Identity = 247/364 (67.86%), Postives = 292/364 (80.22%), Query Frame = 3
Query:   72 MKNNSELSKKNNQRLVYLRCVFIKIFKVDTVNEFYSGEIFLHAKWREPLLDNKSDLKDISLSTFWNPKLSIENIFQITKSTTSLEVSFDEGNNKRAFVVEKTRLKAAFRETLELQHFPFDCQDLSISVGTEYSIEELEMAENPNDISKLNTLDGIESQEWNLYEHVEVENKIVINDCNFGPKERQIMTFTCRATRRFKYFLINHXXXXXX-XXXXXXXXXXXXXXNTYGRLALCMTTLLTSVTFKVAVSNNLPKVPYLTYLDKAILGNIFMIMCLCLWHAATSVYFYDSTTLQSINDSIAIEKVKQVEKYLIPALLIFYVTAVVVFALVIYFDAGSRRREMHLKDIEFEQKIKRLKNEERFCDL 1160
            M+NNS+   K   RLVYLRCVFIKIFKVDTVNEFYS EIFL +KWREPLLDN+SD+KDISLS+FWNPK+SIENIF  TKS+ S EVS+  G  + A++ EK R+   FRE LELQHFPFDCQDLSI+V TEY I E++M E P+D+SKLNT+DG+ESQEWNLYEHVEVE+K VINDCN GP+ERQ MTFTCRA+RRFKYFLINH MISSM F L   S      TNTY RL LCMTTLLTSVTFKVAVS NLPK+PYLTYLDKAILGNI MIMCLC+WHA+TS++F   T + S N +I    ++ +EKYLIP+L++FY  A++   L IYFDAG RRREM  KD+EF + IK+++ E+ FCD+
Sbjct:    1 MENNSKSVNKPVARLVYLRCVFIKIFKVDTVNEFYSAEIFLQSKWREPLLDNRSDIKDISLSSFWNPKISIENIFMETKSSISHEVSYS-GKAREAYITEKRRVSGGFREVLELQHFPFDCQDLSITVSTEYPINEVKMLECPHDLSKLNTIDGMESQEWNLYEHVEVESKTVINDCNIGPRERQTMTFTCRASRRFKYFLINHIMISSMFFLLTFTSFSIAPQTNTYYRLGLCMTTLLTSVTFKVAVSQNLPKIPYLTYLDKAILGNIVMIMCLCIWHASTSLFFL--TKIFSDNSTITTTAIEGIEKYLIPSLVVFYGLAILAVGLTIYFDAGKRRREMIAKDVEFSEMIKKIETEKLFCDV 361          
BLAST of Neur_chan_LBD domain-containing protein vs. Planmine SMEST
Match: SMESG000064433.1 (SMESG000064433.1)

HSP 1 Score: 482.256 bits (1240), Expect = 1.351e-170
Identity = 248/348 (71.26%), Postives = 292/348 (83.91%), Query Frame = 3
Query:  117 VYLRCVFIKIFKVDTVNEFYSGEIFLHAKWREPLLDNKSDLKDISLSTFWNPKLSIENIFQITKSTTSLEVSFDEGNNKRAFVVEKTRLKAAFRETLELQHFPFDCQDLSISVGTEYSIEELEMAENPNDISKLNTLDGIESQEWNLYEHVEVENKIVINDCNFGPKERQIMTFTCRATRRFKYFLINHXXXXXXXXXXXXXXXXXXXXNTYGRLALCMTTLLTSVTFKVAVSNNLPKVPYLTYLDKAILGNIFMIMCLCLWHAATSVYFYDSTTLQSINDSIAIEKVKQVEKYLIPALLIFYVTAVVVFALVIYFDAGSRRREMHLKDIEFEQKIKRLKNEERFCDL 1160
            VYLRCVF+KI+KVDTVNEFYSGEIFL +KWREPLLD+K +LKD++L +FWNPKL IENIF   KS+ SLEV+F E     AF++EK R+KA+FRETLELQHFPFDCQDLS+SV TEYSI+E+++ E PND+SKLNTLDGIESQEWNLYEHVEVE K +INDCN GPKERQIMTFTCRA+RRFKYFLINHF+ISSMFFLLTF+SFSI  + TYGRLALCMTTLLTSVTFKVAVS NLPK+PYLTYLDK ILGNI  IM LC WHA+TS +F D+T    I+ + A   VKQVE Y+I   L  Y   +++F LVIYFDAGSRRREM  KD EF++ +++++NE+ FCD+
Sbjct:   16 VYLRCVFVKIYKVDTVNEFYSGEIFLQSKWREPLLDHKPNLKDVNLFSFWNPKLIIENIFTENKSSVSLEVTFTE--KYEAFIIEKRRVKASFRETLELQHFPFDCQDLSVSVATEYSIDEVDLVETPNDVSKLNTLDGIESQEWNLYEHVEVEAKTMINDCNIGPKERQIMTFTCRASRRFKYFLINHFLISSMFFLLTFTSFSIPPSPTYGRLALCMTTLLTSVTFKVAVSQNLPKIPYLTYLDKTILGNILFIMLLCFWHASTSFFFNDTT----ISSATATANVKQVETYIISCFLGVYGLVILIFGLVIYFDAGSRRREMSDKDREFKRLLEKIENEKLFCDV 357          
BLAST of Neur_chan_LBD domain-containing protein vs. Planmine SMEST
Match: SMESG000041818.1 (SMESG000041818.1)

HSP 1 Score: 462.996 bits (1190), Expect = 7.309e-163
Identity = 233/364 (64.01%), Postives = 290/364 (79.67%), Query Frame = 3
Query:   72 MKNNSELSKKNNQRLVYLRCVFIKIFKVDTVNEFYSGEIFLHAKWREPLLDNKSDLKDISLSTFWNPKLSIENIFQITKSTTSLEVSFDEGNNKRAFVVEKTRLKAAFRETLELQHFPFDCQDLSISVGTEYSIEELEMAENPNDISKLNTLDGIESQEWNLYEHVEVENKIVINDCNFGPKERQIMTFTCRATRRFKYFLINHXXXXXX-XXXXXXXXXXXXXXNTYGRLALCMTTLLTSVTFKVAVSNNLPKVPYLTYLDKAILGNIFMIMCLCLWHAATSVYFYDSTTLQSINDSIAIEKVKQVEKYLIPALLIFYVTAVVVFALVIYFDAGSRRREMHLKDIEFEQKIKRLKNEERFCDL 1160
            M+  S+ + K +++LVYLRCVFIKI+KVDT+NEFYSG+IFL AKWREPLLD+++D+KDI+LSTFWNPKL IEN+FQ +KS+   EVSF E  ++ A++ EK R+KA FRETLELQHFPFDCQDLSI V TEYSI E+++ E P+D+SKLNT+DG+ESQEWNLYEHVEVE+K +IN+CN GP+ERQIMTFTCRA+R+FKYFLINH MISSM F L   S     + NT+ RL LCMTTLLTSVTFKVAVS NLPK+PYLTYLDK ILGNI MIM LC+WHA TS++F  +TT  +   S+    +   E+ +IP LL FY  A++V  L IYFDAG RRREM LKD EF + + +++ E+ FC++
Sbjct:    1 MEVESKSNHKQSKKLVYLRCVFIKIYKVDTINEFYSGDIFLQAKWREPLLDDRTDMKDINLSTFWNPKLVIENMFQESKSSVVHEVSFSEKRHE-AYITEKRRIKACFRETLELQHFPFDCQDLSIPVATEYSINEVKLVELPHDLSKLNTIDGMESQEWNLYEHVEVESKTIINECNIGPRERQIMTFTCRASRKFKYFLINHIMISSMFFLLTFTSFSITPARNTFFRLGLCMTTLLTSVTFKVAVSQNLPKIPYLTYLDKTILGNILMIMSLCIWHACTSLFFKFTTTDDTTTASV----ISTAEQKIIPCLLGFYSIAILVSGLAIYFDAGKRRREMLLKDAEFAEALAKIEAEKLFCEV 359          
The following BLAST results are available for this feature:
BLAST of Neur_chan_LBD domain-containing protein vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
GLRA32.322e-626.07glycine receptor alpha 3 [Source:HGNC Symbol;Acc:H... [more]
GLRA32.416e-626.07glycine receptor alpha 3 [Source:HGNC Symbol;Acc:H... [more]
GABRB33.825e-624.43gamma-aminobutyric acid type A receptor beta3 subu... [more]
GABRB37.932e-624.43gamma-aminobutyric acid type A receptor beta3 subu... [more]
GABRB37.932e-624.43gamma-aminobutyric acid type A receptor beta3 subu... [more]
back to top
BLAST of Neur_chan_LBD domain-containing protein vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Neur_chan_LBD domain-containing protein vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 2
Match NameE-valueIdentityDescription
CG89166.817e-725.31gene:FBgn0030707 transcript:FBtr0301233[more]
CG89169.710e-725.31gene:FBgn0030707 transcript:FBtr0301232[more]
back to top
BLAST of Neur_chan_LBD domain-containing protein vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 2
Match NameE-valueIdentityDescription
glra31.795e-626.25glycine receptor, alpha 3 [Source:ZFIN;Acc:ZDB-GEN... [more]
glra22.856e-625.48glycine receptor, alpha 2 [Source:ZFIN;Acc:ZDB-GEN... [more]
back to top
BLAST of Neur_chan_LBD domain-containing protein vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
GLRA31.342e-727.03glycine receptor alpha 3 [Source:NCBI gene;Acc:100... [more]
GLRA31.510e-727.03glycine receptor alpha 3 [Source:NCBI gene;Acc:100... [more]
GLRA31.526e-726.79glycine receptor alpha 3 [Source:NCBI gene;Acc:100... [more]
GLRA31.638e-727.03glycine receptor alpha 3 [Source:NCBI gene;Acc:100... [more]
ENSXETT00000004017.14.498e-623.02gamma-aminobutyric acid (GABA) A receptor, beta 1 ... [more]
back to top
BLAST of Neur_chan_LBD domain-containing protein vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 4
Match NameE-valueIdentityDescription
Glra31.680e-626.07glycine receptor, alpha 3 subunit [Source:MGI Symb... [more]
Gabrb35.636e-622.86gamma-aminobutyric acid (GABA) A receptor, subunit... [more]
Gabrb36.315e-623.21gamma-aminobutyric acid (GABA) A receptor, subunit... [more]
Gabrb37.203e-623.21gamma-aminobutyric acid (GABA) A receptor, subunit... [more]
back to top
BLAST of Neur_chan_LBD domain-containing protein vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Neur_chan_LBD domain-containing protein vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A3R7CFX91.590e-6539.04Neuronal acetylcholine receptor subunit alpha-7 OS... [more]
A0A4E0RSR92.058e-6439.02Uncharacterized protein OS=Fasciola hepatica OX=61... [more]
R7VF524.811e-6437.61Neur_chan_LBD domain-containing protein OS=Capitel... [more]
A0A075A8W63.833e-6339.19Uncharacterized protein OS=Opisthorchis viverrini ... [more]
A0A5K4FCR62.625e-6038.36Uncharacterized protein OS=Schistosoma mansoni OX=... [more]
back to top
BLAST of Neur_chan_LBD domain-containing protein vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 1
Match NameE-valueIdentityDescription
glra27.128e-725.56glycine receptor, alpha 2 [Source:ZFIN;Acc:ZDB-GEN... [more]
back to top
BLAST of Neur_chan_LBD domain-containing protein vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 1
Match NameE-valueIdentityDescription
glra4a2.826e-626.02glycine receptor, alpha 4a [Source:ZFIN;Acc:ZDB-GE... [more]
back to top
BLAST of Neur_chan_LBD domain-containing protein vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Neur_chan_LBD domain-containing protein vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
EDO327901.282e-2127.52Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO431472.735e-722.99Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO354104.746e-724.91Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO400092.090e-623.46Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO455649.096e-623.23Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Neur_chan_LBD domain-containing protein vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 2
Match NameE-valueIdentityDescription
glra4a1.212e-625.56glycine receptor subunit alpha-4-like [Source:NCBI... [more]
glra22.619e-625.09glycine receptor alpha 2 [Source:NCBI gene;Acc:101... [more]
back to top
BLAST of Neur_chan_LBD domain-containing protein vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000041796.10.000e+081.92SMESG000041796.1[more]
SMESG000041740.10.000e+077.71SMESG000041740.1[more]
SMESG000041829.11.326e-17567.86SMESG000041829.1[more]
SMESG000064433.11.351e-17071.26SMESG000064433.1[more]
SMESG000041818.17.309e-16364.01SMESG000041818.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30015643 ID=SMED30015643|Name=Neur_chan_LBD domain-containing protein|organism=Schmidtea mediterranea sexual|type=transcript|length=1279bp
TTCAGGATATTTTATTTACATTTTATTTGTTTTAAATTTTCACTAGAACA
AAGAAAGAGATTGTTTTCACAATGAAAAATAATTCAGAATTATCCAAAAA
AAACAATCAGAGACTTGTATATCTTCGATGCGTCTTTATCAAAATATTCA
AAGTTGATACAGTCAATGAATTTTATTCTGGTGAAATATTTTTACATGCT
AAATGGAGAGAACCCCTTTTAGATAATAAATCAGATTTAAAGGATATCAG
TTTATCAACGTTTTGGAATCCTAAATTGTCAATCGAAAACATTTTTCAAA
TCACAAAATCAACGACTTCTCTCGAAGTATCATTCGATGAAGGTAATAAT
AAAAGAGCGTTTGTTGTTGAAAAAACTCGATTAAAGGCGGCTTTCCGCGA
GACATTAGAATTACAACACTTTCCTTTTGATTGCCAGGATCTATCAATTT
CCGTGGGAACTGAATATTCAATAGAAGAATTGGAGATGGCCGAAAATCCC
AATGATATCAGTAAATTAAATACTTTGGACGGAATTGAATCTCAAGAATG
GAACTTGTATGAACATGTAGAAGTTGAAAATAAAATTGTTATCAATGATT
GCAATTTCGGACCAAAGGAAAGACAGATAATGACATTTACTTGCCGAGCT
ACGAGAAGATTCAAATATTTTCTTATCAATCATTTTATGATTAGCTCAAT
GTTTTTTTTACTAACATTTTCCAGCTTTTCTATAATTTCGACAAATACTT
ATGGCCGCTTGGCGTTATGTATGACAACATTACTTACCAGTGTAACATTT
AAGGTTGCTGTCAGTAATAACTTGCCGAAGGTTCCATATTTAACATATCT
GGATAAAGCAATTCTCGGAAATATTTTCATGATAATGTGCTTATGCTTGT
GGCATGCGGCGACGTCAGTGTACTTCTACGATAGTACAACGCTACAGTCT
ATAAATGACAGCATTGCCATAGAAAAAGTTAAACAAGTAGAAAAATATTT
AATTCCTGCATTGCTCATTTTCTACGTAACAGCTGTCGTTGTGTTTGCAT
TGGTCATTTATTTTGATGCTGGAAGCAGAAGAAGAGAAATGCATTTAAAA
GACATTGAATTTGAACAAAAAATAAAGCGTCTTAAGAACGAAGAAAGATT
TTGCGATTTACCTTATTAAATACATATCCAAATTCAATGCCTTTTGGAGA
ATGTCAAAAATTAGCCATTCAACACTTTCATTTATTTATTTTACTTTACA
TAAGTTTTGAAACTCATTATTTTGTGAAT
back to top

protein sequence of SMED30015643-orf-1

>SMED30015643-orf-1 ID=SMED30015643-orf-1|Name=SMED30015643-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=366bp
MKNNSELSKKNNQRLVYLRCVFIKIFKVDTVNEFYSGEIFLHAKWREPLL
DNKSDLKDISLSTFWNPKLSIENIFQITKSTTSLEVSFDEGNNKRAFVVE
KTRLKAAFRETLELQHFPFDCQDLSISVGTEYSIEELEMAENPNDISKLN
TLDGIESQEWNLYEHVEVENKIVINDCNFGPKERQIMTFTCRATRRFKYF
LINHFMISSMFFLLTFSSFSIISTNTYGRLALCMTTLLTSVTFKVAVSNN
LPKVPYLTYLDKAILGNIFMIMCLCLWHAATSVYFYDSTTLQSINDSIAI
EKVKQVEKYLIPALLIFYVTAVVVFALVIYFDAGSRRREMHLKDIEFEQK
IKRLKNEERFCDLPY*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: molecular function
TermDefinition
GO:0004888transmembrane signaling receptor activity
GO:0005216ion channel activity
GO:0005230extracellular ligand-gated ion channel activity
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000418head
Vocabulary: INTERPRO
TermDefinition
IPR036734Neur_chan_lig-bd_sf
IPR006201Neur_channel
IPR036719Neuro-gated_channel_TM_sf
IPR006202Neur_chan_lig-bd
IPR006029Neurotrans-gated_channel_TM
Vocabulary: biological process
TermDefinition
GO:0006810transport
GO:0006811ion transport
GO:0034220ion transmembrane transport
Vocabulary: cellular component
TermDefinition
GO:0016020membrane
GO:0016021integral component of membrane
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR036734Neurotransmitter-gated ion-channel ligand-binding domain superfamilyGENE3DG3DSA:2.70.170.10coord: 1..168
e-value: 3.5E-14
score: 54.7
IPR036734Neurotransmitter-gated ion-channel ligand-binding domain superfamilySUPERFAMILYSSF63712Nicotinic receptor ligand binding domain-likecoord: 2..160
NoneNo IPR availableGENE3DG3DSA:1.20.58.390coord: 171..332
e-value: 7.7E-17
score: 63.4
NoneNo IPR availablePANTHERPTHR18945:SF768coord: 3..273
NoneNo IPR availableCDDcd19049LGIC_TM_anioncoord: 176..252
e-value: 1.48429E-11
score: 58.6175
NoneNo IPR availableCDDcd18988LGIC_ECD_bactcoord: 1..139
e-value: 1.57363E-13
score: 66.1622
NoneNo IPR availableTMHMMTMhelixcoord: 209..228
NoneNo IPR availableTMHMMTMhelixcoord: 286..308
NoneNo IPR availableTMHMMTMhelixcoord: 241..263
NoneNo IPR availableTMHMMTMhelixcoord: 177..199
IPR006202Neurotransmitter-gated ion-channel ligand-binding domainPFAMPF02931Neur_chan_LBDcoord: 2..168
e-value: 3.1E-6
score: 26.8
IPR006201Neurotransmitter-gated ion-channelPANTHERPTHR18945NEUROTRANSMITTER GATED ION CHANNELcoord: 3..273
IPR036719Neurotransmitter-gated ion-channel transmembrane domain superfamilySUPERFAMILYSSF90112Neurotransmitter-gated ion-channel transmembrane porecoord: 176..262