low density lipoprotein receptor-1

Overview
Namelow density lipoprotein receptor-1 (AFJ24773.1)
Smed IDSMED30015642
Length (bp)2673
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of low density lipoprotein receptor-1 (SMED30015642) t-SNE clustered cells

Violin plots show distribution of expression levels for low density lipoprotein receptor-1 (SMED30015642) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of low density lipoprotein receptor-1 (SMED30015642) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for low density lipoprotein receptor-1 (SMED30015642) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30015642

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 6

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
neuronSMED30015642SMESG000027826.1 SMESG000027815.1 dd_Smed_v4_1581_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
parenchymal cellSMED30015642SMESG000027826.1 SMESG000027815.1 dd_Smed_v4_1581_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
parenchymaSMED30015642SMESG000027826.1 SMESG000027815.1 Contig48072uc_Smed_v2PMID:27612384
Roberts-Galbraith et al., 2016
whole organism asexual adult colorimetric in situ hybridization evidence
parenchymaSMED30015642SMESG000027826.1 SMESG000027815.1 Contig48072newmark_estsPMID:27612384
Roberts-Galbraith et al., 2016
whole organism asexual adult colorimetric in situ hybridization evidence
pigment cellSMED30015642SMESG000027826.1 SMESG000027815.1 dd_Smed_v6_1581_0dd_Smed_v6PMID:29674432
Plass et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
parenchymal cellSMED30015642SMESG000027826.1 SMESG000027815.1 dd_Smed_v6_1581_0dd_Smed_v6PMID:29674432
Plass et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of low density lipoprotein receptor-1 vs. Ensembl Human
Match: HSPG2 (heparan sulfate proteoglycan 2 [Source:HGNC Symbol;Acc:HGNC:5273])

HSP 1 Score: 127.102 bits (318), Expect = 6.404e-29
Identity = 77/216 (35.65%), Postives = 97/216 (44.91%), Query Frame = 3
Query: 1923 CPPGYRFCQNGECLENAKFCDKINHCADKSDEDPITCRECDPISRKCEINNQILPKKNYFLIHWICDGEEDCGNGYDEQNCDGFSLNN-CGGKFFTC-SDNKTIPRGYVCDENIDCSQGEDETGCTSPQIXXXXXXXXXXXXXQLVTLTCEATGKPLPVLVWRFNWGCIQNSTRFSTNFFSTDCNSVTSSLTIKDFKAGDDGIYNCEALSSRQRSF 2564
            C P    C+NG C+     CD    C D SDE      +C P    CE N       +  L  W CDG+ DC +  DE NC        CG   F C S N  IP  + CDE  DC    DE GC  PQ+       + A++ Q VT TC A G P P++ WR NWG I +  R +             +L I+D K  D G Y CEA+++R   F
Sbjct:  285 CGPQEAACRNGHCIPRDYLCDGQEDCEDGSDE-----LDCGP-PPPCEPNEFPCGNGHCALKLWRCDGDFDCEDRTDEANCPTKRPEEVCGPTQFRCVSTNMCIPASFHCDEESDCPDRSDEFGCMPPQVVTPPRESIQASRGQTVTFTCVAIGVPTPIINWRLNWGHIPSHPRVTVT-----SEGGRGTLIIRDVKESDQGAYTCEAMNARGMVF 489          

HSP 2 Score: 51.9878 bits (123), Expect = 7.008e-6
Identity = 91/401 (22.69%), Postives = 159/401 (39.65%), Query Frame = 3
Query:  642 LQIPVVDESVVGRYICQYKSKETSKIYEAATYVNLKQS--VSYKIK---IITNP--ALFRYGERFSLRCEVEPFYQNIKYTWYKKDEFIG-------NDQELVIKSFKKDNVGTYKCVASLQLPSGKLDLMEESIQQFAFFRESKIELTTKPGPQVYVHRGEKKELHCEIETSSGNRGKEAEWYINGKKFKNGDIPLVNRLDGQYVS--MLVISDISQINEGNYEC----RVGSSIKEVNLIVLLDEGLIETSPPILKVKE-------GQSVEFHCRVENIPSVKNVNLKWNFESKEGLVRNNIPDSRWQ--LMNDEIADQTSFIVLMKAEVSDSGYYIC--TEPNGQTARSELIVIPDKDKNSLTITPREIRVRAGQRVDIECFSKNTQGRASGNPEFSF 1751
            L++ +V  +  G Y+C+  S    +  EA+  V +  S   SY+++   I  +P  +  + G+  S +C +      I   W  +++ +        N   + I   +  N GTY+CVAS          + +S+   +      + +  + GP V+V  G+   L C    S+G     A W     +  +    L  R  G   S  +L IS     + G Y C     +G++ K+V +IV  D G +    P ++ +E       G +    C     P+     + W+       +R+ +P   WQ  L  D +       ++ +    DSG YIC  T P G    +  I++  +     T  P    V+AG+ V ++C        A G P  +F
Sbjct: 2976 LRLHLVSPADSGEYVCRAASGPGPE-QEASFTVTVPPSEGSSYRLRSPVISIDPPSSTVQQGQDASFKCLIHDGAAPISLEWKTRNQELEDNVHISPNGSIITIVGTRPSNHGTYRCVASNAYG------VAQSVVNLSVHGPPTVSVLPE-GP-VWVKVGKAVTLEC---VSAGEPRSSARW----TRISSTPAKLEQRTYGLMDSHAVLQISSAKPSDAGTYVCLAQNALGTAQKQVEVIV--DTGAMAPGAPQVQAEEAELTVEAGHTATLRCSATGSPAP---TIHWS------KLRSPLP---WQHRLEGDTL-------IIPRVAQQDSGQYICNATSPAGHAEAT--IILHVESPPYATTVPEHASVQAGETVQLQCL-------AHGTPPLTF 3330          
BLAST of low density lipoprotein receptor-1 vs. Ensembl Human
Match: LRP4 (LDL receptor related protein 4 [Source:HGNC Symbol;Acc:HGNC:6696])

HSP 1 Score: 75.485 bits (184), Expect = 4.574e-13
Identity = 50/127 (39.37%), Postives = 64/127 (50.39%), Query Frame = 3
Query: 1923 CPPGYRFCQNGECLENAKFCDKINHCADKSDEDPITCRECDPISRKCEINNQILPKKNYFLIH--WICDGEEDCGNGYDEQNCDGFSLNNCGGKFFTCSDNKTIPRGYVCDENIDCSQGEDETGCTS 2297
            C P    C NG+C+  +  CD  N C D SDE     ++C P  R+CE +    P +N + I   W CDG+ DCG+  DEQ CD   +  C  K F CSD   I   + CD + DC  G DE  C S
Sbjct:   71 CSPLDFHCDNGKCIRRSWVCDGDNDCEDDSDE-----QDCPP--RECEEDE--FPCQNGYCIRSLWHCDGDNDCGDNSDEQ-CD---MRKCSDKEFRCSDGSCIAEHWYCDGDTDCKDGSDEENCPS 184          

HSP 2 Score: 55.0694 bits (131), Expect = 6.913e-7
Identity = 38/127 (29.92%), Postives = 53/127 (41.73%), Query Frame = 3
Query: 1923 CPPGYRFCQNGECLENAKFCDKINHCADKSDEDPITCRECDPISRKCEINNQILPKKNYFLIHWICDGEEDCGNGYDEQNCDGFSLNNCGGKFFTCSDNKTIPRGYVCDENIDCSQGEDETGCTSPQ 2303
            C  G   C +G C+     CD    C D+SDE   T   C     +C     +        + W CDGE+DC +  DE+NC+      C    F C + + I +  +C+   DC    DE    SPQ
Sbjct:  231 CRSGEFMCDSGLCINAGWRCDGDADCDDQSDERNCTTSMCTAEQFRCHSGRCVR-------LSWRCDGEDDCADNSDEENCENTGSPQCALDQFLCWNGRCIGQRKLCNGVNDCGDNSDE----SPQ 346          

HSP 3 Score: 54.6842 bits (130), Expect = 9.456e-7
Identity = 45/159 (28.30%), Postives = 55/159 (34.59%), Query Frame = 3
Query: 1944 CQNGECLENAKFCDKINHCADKSDEDPITCRECDPISRKCEINNQILPKKNYFLIHWICDGEEDCGNGYDEQNC-----------------------------------------DGFSLNNCGGKFFTCSDNKTIPRGYVCDENIDCSQGEDETGCTS 2297
            CQNG C+ +   CD  N C D SDE      +CD   RKC          +    HW CDG+ DC +G DE+NC                                         D  S   C    F C     I  G+ CD + DC    DE  CT+
Sbjct:  117 CQNGYCIRSLWHCDGDNDCGDNSDE------QCD--MRKCSDKEFRCSDGSCIAEHWYCDGDTDCKDGSDEENCPSAVPAPPCNLEEFQCAYGRCILDIYHCDGDDDCGDWSDESDCSSHQPCRSGEFMCDSGLCINAGWRCDGDADCDDQSDERNCTT 267          
BLAST of low density lipoprotein receptor-1 vs. Ensembl Human
Match: LRP1 (LDL receptor related protein 1 [Source:HGNC Symbol;Acc:HGNC:6692])

HSP 1 Score: 74.7146 bits (182), Expect = 7.837e-13
Identity = 42/126 (33.33%), Postives = 60/126 (47.62%), Query Frame = 3
Query: 1923 CPPGYRFCQNGECLENAKFCDKINHCADKSDEDPITCRECDPISRKCEINNQILPKKNYFLIH---WICDGEEDCGNGYDEQNCDGFSLNNCGGKFFTCSDNKTIPRGYVCDENIDCSQGEDETGC 2291
            C  G   C++G C+ N+  C++   C D SDE   +  +C    R         P +   L +   W+CDG  DCG+  DE++C G     C   +F C   + IP  + CD+  DC  GEDET C
Sbjct: 2605 CGVGEFRCRDGTCIGNSSRCNQFVDCEDASDEMNCSATDCSSYFRLGVKGVLFQPCERTSLCYAPSWVCDGANDCGDYSDERDCPGVKRPRCPLNYFACPSGRCIPMSWTCDKEDDCEHGEDETHC 2730          

HSP 2 Score: 74.3294 bits (181), Expect = 9.521e-13
Identity = 48/129 (37.21%), Postives = 62/129 (48.06%), Query Frame = 3
Query: 1923 CPPGYRFCQNGECLENAKFCDKINHCADKSDEDPITCRE--CDPISRKCEINNQILPKKNYFLIHWICDGEEDCGNGYDEQNCDGFSLNNCGGKFFTCSDNKTIPRGYVCDENIDCSQGEDETG-CTSP 2300
            C PG   C N  C++    CD  N C D SDE P  C +  C     KCE NN+ +P +      W+CDG+ DCGN  DE N    S   C    F+C+  + IP  + CD + DC    DE+  C  P
Sbjct:  854 CQPGEFACANSRCIQERWKCDGDNDCLDNSDEAPALCHQHTCPSDRFKCE-NNRCIPNR------WLCDGDNDCGNSEDESNAT-CSARTCPPNQFSCASGRCIPISWTCDLDDDCGDRSDESASCAYP 974          

HSP 3 Score: 71.2478 bits (173), Expect = 9.667e-12
Identity = 42/131 (32.06%), Postives = 65/131 (49.62%), Query Frame = 3
Query: 1902 KIYVSDICPPGYRFCQNGECLENAKFCDKINHCADKSDEDPITC--RECDPISRKCEINNQILPKKNYFLIHWICDGEEDCGNGYDEQNCDGFSLNN-CGGKFFTCSDNKTIPRGYVCDENIDCSQGEDET 2285
            + + +  C      CQN  C+     CD  + C D SDE    C  + C P S  C   +  +P++      W+CDG++DC +G DE    G   N+ C  + F C + + IP+ +VCD + DC+ G DE+
Sbjct: 2727 ETHCNKFCSEAQFECQNHRCISKQWLCDGSDDCGDGSDE-AAHCEGKTCGPSSFSCPGTHVCVPER------WLCDGDKDCADGADESIAAGCLYNSTCDDREFMCQNRQCIPKHFVCDHDRDCADGSDES 2850          

HSP 4 Score: 65.855 bits (159), Expect = 4.059e-10
Identity = 43/120 (35.83%), Postives = 60/120 (50.00%), Query Frame = 3
Query: 1944 CQNGECLENAKFCDKINHCADKSDEDPITC--RECDPISRKCEINNQILPKKNYFLIHWICDGEEDCGNGYDEQNCDGFSLNNCGGKFFTCSDNKTIPRGYVCDENIDCSQGEDETGCTS 2297
            C NGEC+  +  CD + HC DKSDE P  C  R C    R+C  N + +       + W C+G +DCG+G DE  C+  +   CG   F C D   I     C++ +DC    DE  C++
Sbjct: 2532 CANGECINFSLTCDGVPHCKDKSDEKPSYCNSRRCKKTFRQCS-NGRCVSN-----MLW-CNGADDCGDGSDEIPCNKTA---CGVGEFRCRDGTCIGNSSRCNQFVDCEDASDEMNCSA 2641          

HSP 5 Score: 64.6994 bits (156), Expect = 9.373e-10
Identity = 45/121 (37.19%), Postives = 58/121 (47.93%), Query Frame = 3
Query: 1923 CPPGYRFCQNGECLENAKFCDKINHCADKSDEDPITCRECDPISRKCEINNQILPKKNYFLIHWICDGEEDCGNGYDEQNCDGFSLNNCGGKFFTCSDNKT-IPRGYVCDENIDCSQGEDE 2282
            C PG   C  G C   A  CD  N C D SDE       C P   KC   N+ +P        + C+G+++CG+G DE++C   +   C    F CS  K  IPR +VCD + DC  G DE
Sbjct: 3374 CRPGQFQCSTGICTNPAFICDGDNDCQDNSDEANCDIHVCLPSQFKCTNTNRCIPGI------FRCNGQDNCGDGEDERDCPEVT---CAPNQFQCSITKRCIPRVWVCDRDNDCVDGSDE 3485          

HSP 6 Score: 64.3142 bits (155), Expect = 1.249e-9
Identity = 37/111 (33.33%), Postives = 54/111 (48.65%), Query Frame = 3
Query: 1959 CLENAKFCDKINHCADKSDEDPITCRECDPISR-KCEINNQILPKKNYFLIHWICDGEEDCGNGYDEQNCDGFSLNNCGGKFFTCSDNKTIPRGYVCDENIDCSQGEDETG 2288
            C   +  CD  N C D SDE     R+C  + R +C +N    P      + W CD E+DC +G DE +C+ F    C    F C +++ I + ++CD + DC  G DE  
Sbjct: 2666 CYAPSWVCDGANDCGDYSDE-----RDCPGVKRPRCPLNYFACPSGRCIPMSWTCDKEDDCEHGEDETHCNKF----CSEAQFECQNHRCISKQWLCDGSDDCGDGSDEAA 2767          

HSP 7 Score: 64.3142 bits (155), Expect = 1.348e-9
Identity = 41/123 (33.33%), Postives = 51/123 (41.46%), Query Frame = 3
Query: 1923 CPPGYRFCQNGECLENAKFCDKINHCADKSDEDPITCRECDPISRKCEINNQILPKKNYFLIHWICDGEEDCGNGYDEQNCDGFSLNNCGGKFFTCSDNKTIPRGYVCDENIDCSQGEDETGC 2291
            C P    C+N  C+     CD  N C D SDE+  T R C      C     I  +       W CDG+ DC +G DE++C       C    F C     IP  + CD + DC  G DE  C
Sbjct: 3536 CEPYQFRCKNNRCVPGRWQCDYDNDCGDNSDEESCTPRPCSESEFSCANGRCIAGR-------WKCDGDHDCADGSDEKDC----TPRCDMDQFQCKSGHCIPLRWRCDADADCMDGSDEEAC 3647          

HSP 8 Score: 62.3882 bits (150), Expect = 5.125e-9
Identity = 40/122 (32.79%), Postives = 62/122 (50.82%), Query Frame = 3
Query: 1935 YRFCQNGECLENAKFCDKINHCADKSDEDPITC--RECDPISRKCEINNQILPKKNYFLIHWICDGEEDCGNGYDEQNCDGFSLNNCGGKFFTCSDNKTIPRGYVCDENIDCSQGEDETGCT 2294
            +R   +G C+     CD  + C D SDE    C  R C+P   +C+ NN+ +P +      W CD + DCG+  DE++C   +   C    F+C++ + I   + CD + DC+ G DE  CT
Sbjct: 3499 FRCKDSGRCIPARWKCDGEDDCGDGSDEPKEECDERTCEPYQFRCK-NNRCVPGR------WQCDYDNDCGDNSDEESC---TPRPCSESEFSCANGRCIAGRWKCDGDHDCADGSDEKDCT 3610          

HSP 9 Score: 60.8474 bits (146), Expect = 1.343e-8
Identity = 40/117 (34.19%), Postives = 57/117 (48.72%), Query Frame = 3
Query: 1956 ECLENAKFCDKINHCADKSDEDPITCRE--CDPISRKCEINNQILPKKNYFLIHWICDGEEDCGNGYDE--QNCDGFSLNNCGGKFFTCSDNKTIPRGYVCDENIDCSQGEDETGCT 2294
             C+     CD+ N C D SDE P  C +  C     +C+ + + +P +      W CDGE+DCG+G DE  + CD      C    F C +N+ +P  + CD + DC    DE  CT
Sbjct: 3465 RCIPRVWVCDRDNDCVDGSDE-PANCTQMTCGVDEFRCKDSGRCIPAR------WKCDGEDDCGDGSDEPKEECDE---RTCEPYQFRCKNNRCVPGRWQCDYDNDCGDNSDEESCT 3571          

HSP 10 Score: 58.151 bits (139), Expect = 9.862e-8
Identity = 39/123 (31.71%), Postives = 59/123 (47.97%), Query Frame = 3
Query: 1923 CPPGYRFCQNGECLENAKFCDKINHCADKSDEDPITCR--ECDPISRKCEINNQILPKKNYFLIHWICDGEEDCGNGYDEQNCDGFSLNNCGGKFFTCSDNKTIPRGYVCDENIDCSQGEDET 2285
            CPP    C +G C+  +  CD  + C D+SDE   +C    C P+++    N + +       I+W CD + DCG+  DE  C     ++C    F C+  + IP  + CD + DC    DET
Sbjct:  936 CPPNQFSCASGRCIPISWTCDLDDDCGDRSDES-ASCAYPTCFPLTQFTCNNGRCIN------INWRCDNDNDCGDNSDEAGCS----HSCSSTQFKCNSGRCIPEHWTCDGDNDCGDYSDET 1047          

HSP 11 Score: 57.3806 bits (137), Expect = 1.530e-7
Identity = 52/171 (30.41%), Postives = 76/171 (44.44%), Query Frame = 3
Query: 1788 KISNVGPAHKRLTAPGGLSLSDNNMDVFCSLEGRQVSSKIYVSDICPPGYRFCQNGECLENAKFCDKINHCADKSDEDPITCRE--CDPISRKCEINNQILPKKNYFLIHWICDGEEDCGNGYDEQNCDGFSLNNCGGKFFTCSD-NKTIPRGYVCDENIDCSQGEDETGC 2291
            K++N G ++  L +PGG        + +   +GR   S    S         C+N +C+     CD  + C D SDE P  C E  C P   +C       P        +ICDG+ DC +  DE NCD   ++ C    F C++ N+ IP  + C+   +C  GEDE  C
Sbjct: 3295 KVNNGGCSNLCLLSPGGGHKCACPTNFYLGSDGRTCVSNCTASQF------VCKNDKCIPFWWKCDTEDDCGDHSDEPP-DCPEFKCRPGQFQCSTGICTNPA-------FICDGDNDCQDNSDEANCD---IHVCLPSQFKCTNTNRCIPGIFRCNGQDNCGDGEDERDC 3448          

HSP 12 Score: 56.225 bits (134), Expect = 3.501e-7
Identity = 38/127 (29.92%), Postives = 56/127 (44.09%), Query Frame = 3
Query: 1944 CQNGECLENAKFCDKINHCADKSDEDPITCRE--------CDPISRKCEINNQILPKKNYFLIHWICDGEEDCGNGYDEQNCDGFSLNNCGGKFFTCSDN-KTIPRGYVCDENIDCSQGEDETGCTS 2297
            C +G C+     CD  N C D SDE    C          C     +C ++   +P      + W CDG+ DC +  DE++C+G +        F C D+ + I + +VCD + DC    DE  C S
Sbjct: 1022 CNSGRCIPEHWTCDGDNDCGDYSDETHANCTNQATRPPGGCHTDEFQCRLDGLCIP------LRWRCDGDTDCMDSSDEKSCEGVTHVCDPSVKFGCKDSARCISKAWVCDGDNDCEDNSDEENCES 1142          

HSP 13 Score: 56.225 bits (134), Expect = 3.531e-7
Identity = 35/113 (30.97%), Postives = 52/113 (46.02%), Query Frame = 3
Query: 1944 CQNGECLENAKFCDKINHCADKSDEDPITCRECDPISRKCEINNQILPKKNYFLIHWICDGEEDCGNGYDEQNCDGFSLNNCGGKFFTCSDNKTIPRGYVCDENIDCSQGEDE 2282
            C NG C+     CD  + CAD SDE     ++C P   +C+++       +   + W CD + DC +G DE+ C G  +  C    F C++    P  + CD   DC    DE
Sbjct: 3582 CANGRCIAGRWKCDGDHDCADGSDE-----KDCTP---RCDMDQFQCKSGHCIPLRWRCDADADCMDGSDEEAC-GTGVRTCPLDEFQCNNTLCKPLAWKCDGEDDCGDNSDE 3685          

HSP 14 Score: 51.9878 bits (123), Expect = 7.199e-6
Identity = 39/123 (31.71%), Postives = 50/123 (40.65%), Query Frame = 3
Query: 1941 FCQNGECLENAKFCDKINHCADKSDEDPITCR--ECDPISRKCEINNQILPKKNYFLIHWICDGEEDCGNGYDEQ----NCDGFSLNNCGGKFFTCSDNKTIPRGYVCDENIDCSQGEDETGC 2291
             CQN +C+     CD    CAD SDE P  C    C P   +C  N + L  +      W CDGE DC +  DE     +C            F CS  + +    +C+   DC    DE GC
Sbjct: 2824 MCQNRQCIPKHFVCDHDRDCADGSDESP-ECEYPTCGPSEFRC-ANGRCLSSR-----QWECDGENDCHDQSDEAPKNPHCTSQEHKCNASSQFLCSSGRCVAEALLCNGQDDCGDSSDERGC 2939          
BLAST of low density lipoprotein receptor-1 vs. Ensembl Human
Match: LRP4 (LDL receptor related protein 4 [Source:HGNC Symbol;Acc:HGNC:6696])

HSP 1 Score: 67.3958 bits (163), Expect = 1.073e-12
Identity = 50/131 (38.17%), Postives = 65/131 (49.62%), Query Frame = 3
Query: 1905 IYVSDICPPGYRFCQNGECLENAKFCDKINHCADKSDEDPITCRECDPISRKCEINNQILPKKNYFLIH--WICDGEEDCGNGYDEQNCDGFSLNNCGGKFFTCSDNKTIPRGYVCDENIDCSQGEDETGC 2291
             +V   C P    C NG+C+  +  CD  N C D SDE     ++C P  R+CE +    P +N + I   W CDG+ DCG+  DEQ CD   +  C  K F CSD   I   + CD + DC  G DE  C
Sbjct:   16 AHVLPTCSPLDFHCDNGKCIRRSWVCDGDNDCEDDSDE-----QDCPP--RECEEDE--FPCQNGYCIRSLWHCDGDNDCGDNSDEQ-CD---MRKCSDKEFRCSDGSCIAEHWYCDGDTDCKDGSDEENC 133          
BLAST of low density lipoprotein receptor-1 vs. Ensembl Human
Match: VLDLR (very low density lipoprotein receptor [Source:HGNC Symbol;Acc:HGNC:12698])

HSP 1 Score: 73.1738 bits (178), Expect = 1.698e-12
Identity = 49/133 (36.84%), Postives = 62/133 (46.62%), Query Frame = 3
Query: 1911 VSDICPPGYRFCQNGECLENAKFCDKINHCADKSDEDPITC--RECDPISRKCEINN-QILPKKNYFLIHWICDGEEDCGNGYDEQNCDGFSLNNCGGKFFTCSDNKTIPRGYVCDENIDCSQGEDETGCTSP 2300
            V   C      C NG+C+ +   CD    C D SDE P  C  R C      C  ++ Q +P      + W CDGE DC +G DE+NC   +   C    FTCS  + I R +VC+   DCS G DE  C  P
Sbjct:   68 VKKTCAESDFVCNNGQCVPSRWKCDGDPDCEDGSDESPEQCHMRTCRIHEISCGAHSTQCIP------VSWRCDGENDCDSGEDEENCGNIT---CSPDEFTCSSGRCISRNFVCNGQDDCSDGSDELDCAPP 191          
BLAST of low density lipoprotein receptor-1 vs. Ensembl Celegans
Match: unc-52 (Basement membrane proteoglycan [Source:UniProtKB/Swiss-Prot;Acc:Q06561])

HSP 1 Score: 102.834 bits (255), Expect = 8.292e-22
Identity = 99/333 (29.73%), Postives = 148/333 (44.44%), Query Frame = 3
Query: 1641 LTITPREIRVRAGQRVDIECFSKNTQGRA--------SGNPEFSFTNNKPIGRDGRFKISNVGPAHKRLTAPGG-LSLSDNNMDVF--------CSLEGRQVSSKIYVSDICPPGYRFCQNGECLENAKFCDKINHCADKSDED--PITCRECDPISRKCEINNQILPKKNYFLIHWICDGEEDCGNGYDEQNCDG-FSLNNCGGKFFTCSDNKT-IPRGYVCDENIDCSQGEDETGCTSPQIXXXXXXXXXXXXXQLVTLTCEATGKPLPVLVWRFNWGCIQNSTR---FSTNFFSTDCNSVTSSLTIKDFKAGDDGIYNCEALSSRQRSFS 2567
            +T+ P E  VR G+ V  EC ++ +             G P  S  ++      GR  I+ V     +L+  G  + +SD N +           S   ++VS+ +  +  C    + C N EC++N   CD    C D+SDE   P   R C+P   KC  NN+ + K       W+CDG++DCG+  DE NC+   S ++C    F C D +  +P  + CD   DC  G DE GC  P +     T +   +    +LTC+A   P P + WR NWG +    R    S   + T        LTI D +  D G Y CEA++ + R  +
Sbjct:   47 ITVFPSEKEVRDGRDVSFECRARTSDNSVYPTVRWARVGGPLPSSAHDS----GGRLTINPV-----QLSDAGTYICVSDYNGNTVEARATLSVVSYGPQEVSNGLRQAGQCMADEKACGNNECVKNDYVCDGEPDCRDRSDEANCPAISRTCEPNEFKCN-NNKCVQKM------WLCDGDDDCGDNSDELNCNAKPSSSDCKPTEFQCHDRRQCVPSSFHCDGTNDCHDGSDEVGCVQPTVVDPPQTNLQVPRGTTFSLTCKAVAVPEPYINWRLNWGPVCEPPRCLQTSEGGYGT--------LTIHDAQPVDQGAYTCEAINVKGRVLA 355          
BLAST of low density lipoprotein receptor-1 vs. Ensembl Celegans
Match: unc-52 (Basement membrane proteoglycan [Source:UniProtKB/Swiss-Prot;Acc:Q06561])

HSP 1 Score: 100.138 bits (248), Expect = 4.566e-21
Identity = 100/334 (29.94%), Postives = 147/334 (44.01%), Query Frame = 3
Query: 1641 LTITPREIRVRAGQRVDIECFSKNTQGRASGNPEFSFTNNKPIG---------RDGRFKISNVGPAHKRLTAPGG-LSLSDNNMDVF--------CSLEGRQVSSKIYVSDICPPGYRFCQNGECLENAKFCDKINHCADKSDED--PITCRECDPISRKCEINNQILPKKNYFLIHWICDGEEDCGNGYDEQNCDG-FSLNNCGGKFFTCSDNKT-IPRGYVCDENIDCSQGEDETGCTSPQIXXXXXXXXXXXXXQLVTLTCEATGKPLPVLVWRFNWGCIQNSTR---FSTNFFSTDCNSVTSSLTIKDFKAGDDGIYNCEALSSRQRSFS 2567
            +T+ P E  VR G+ V  EC     + R S N  +       +G           GR  I+ V     +L+  G  + +SD N +           S   ++VS+ +  +  C    + C N EC++N   CD    C D+SDE   P   R C+P   KC  NN+ + K       W+CDG++DCG+  DE NC+   S ++C    F C D +  +P  + CD   DC  G DE GC  P +     T +   +    +LTC+A   P P + WR NWG +    R    S   + T        LTI D +  D G Y CEA++ + R  +
Sbjct:   47 ITVFPSEKEVRDGRDVSFEC-----RARTSDNSVYPTVRWARVGGPLPSSAHDSGGRLTINPV-----QLSDAGTYICVSDYNGNTVEARATLSVVSYGPQEVSNGLRQAGQCMADEKACGNNECVKNDYVCDGEPDCRDRSDEANCPAISRTCEPNEFKCN-NNKCVQKM------WLCDGDDDCGDNSDELNCNAKPSSSDCKPTEFQCHDRRQCVPSSFHCDGTNDCHDGSDEVGCVQPTVVDPPQTNLQVPRGTTFSLTCKAVAVPEPYINWRLNWGPVCEPPRCLQTSEGGYGT--------LTIHDAQPVDQGAYTCEAINVKGRVLA 355          
BLAST of low density lipoprotein receptor-1 vs. Ensembl Celegans
Match: unc-52 (Basement membrane proteoglycan [Source:UniProtKB/Swiss-Prot;Acc:Q06561])

HSP 1 Score: 100.138 bits (248), Expect = 4.636e-21
Identity = 100/334 (29.94%), Postives = 147/334 (44.01%), Query Frame = 3
Query: 1641 LTITPREIRVRAGQRVDIECFSKNTQGRASGNPEFSFTNNKPIG---------RDGRFKISNVGPAHKRLTAPGG-LSLSDNNMDVF--------CSLEGRQVSSKIYVSDICPPGYRFCQNGECLENAKFCDKINHCADKSDED--PITCRECDPISRKCEINNQILPKKNYFLIHWICDGEEDCGNGYDEQNCDG-FSLNNCGGKFFTCSDNKT-IPRGYVCDENIDCSQGEDETGCTSPQIXXXXXXXXXXXXXQLVTLTCEATGKPLPVLVWRFNWGCIQNSTR---FSTNFFSTDCNSVTSSLTIKDFKAGDDGIYNCEALSSRQRSFS 2567
            +T+ P E  VR G+ V  EC     + R S N  +       +G           GR  I+ V     +L+  G  + +SD N +           S   ++VS+ +  +  C    + C N EC++N   CD    C D+SDE   P   R C+P   KC  NN+ + K       W+CDG++DCG+  DE NC+   S ++C    F C D +  +P  + CD   DC  G DE GC  P +     T +   +    +LTC+A   P P + WR NWG +    R    S   + T        LTI D +  D G Y CEA++ + R  +
Sbjct:   47 ITVFPSEKEVRDGRDVSFEC-----RARTSDNSVYPTVRWARVGGPLPSSAHDSGGRLTINPV-----QLSDAGTYICVSDYNGNTVEARATLSVVSYGPQEVSNGLRQAGQCMADEKACGNNECVKNDYVCDGEPDCRDRSDEANCPAISRTCEPNEFKCN-NNKCVQKM------WLCDGDDDCGDNSDELNCNAKPSSSDCKPTEFQCHDRRQCVPSSFHCDGTNDCHDGSDEVGCVQPTVVDPPQTNLQVPRGTTFSLTCKAVAVPEPYINWRLNWGPVCEPPRCLQTSEGGYGT--------LTIHDAQPVDQGAYTCEAINVKGRVLA 355          
BLAST of low density lipoprotein receptor-1 vs. Ensembl Celegans
Match: unc-52 (Basement membrane proteoglycan [Source:UniProtKB/Swiss-Prot;Acc:Q06561])

HSP 1 Score: 100.138 bits (248), Expect = 5.055e-21
Identity = 100/334 (29.94%), Postives = 147/334 (44.01%), Query Frame = 3
Query: 1641 LTITPREIRVRAGQRVDIECFSKNTQGRASGNPEFSFTNNKPIG---------RDGRFKISNVGPAHKRLTAPGG-LSLSDNNMDVF--------CSLEGRQVSSKIYVSDICPPGYRFCQNGECLENAKFCDKINHCADKSDED--PITCRECDPISRKCEINNQILPKKNYFLIHWICDGEEDCGNGYDEQNCDG-FSLNNCGGKFFTCSDNKT-IPRGYVCDENIDCSQGEDETGCTSPQIXXXXXXXXXXXXXQLVTLTCEATGKPLPVLVWRFNWGCIQNSTR---FSTNFFSTDCNSVTSSLTIKDFKAGDDGIYNCEALSSRQRSFS 2567
            +T+ P E  VR G+ V  EC     + R S N  +       +G           GR  I+ V     +L+  G  + +SD N +           S   ++VS+ +  +  C    + C N EC++N   CD    C D+SDE   P   R C+P   KC  NN+ + K       W+CDG++DCG+  DE NC+   S ++C    F C D +  +P  + CD   DC  G DE GC  P +     T +   +    +LTC+A   P P + WR NWG +    R    S   + T        LTI D +  D G Y CEA++ + R  +
Sbjct:   47 ITVFPSEKEVRDGRDVSFEC-----RARTSDNSVYPTVRWARVGGPLPSSAHDSGGRLTINPV-----QLSDAGTYICVSDYNGNTVEARATLSVVSYGPQEVSNGLRQAGQCMADEKACGNNECVKNDYVCDGEPDCRDRSDEANCPAISRTCEPNEFKCN-NNKCVQKM------WLCDGDDDCGDNSDELNCNAKPSSSDCKPTEFQCHDRRQCVPSSFHCDGTNDCHDGSDEVGCVQPTVVDPPQTNLQVPRGTTFSLTCKAVAVPEPYINWRLNWGPVCEPPRCLQTSEGGYGT--------LTIHDAQPVDQGAYTCEAINVKGRVLA 355          
BLAST of low density lipoprotein receptor-1 vs. Ensembl Celegans
Match: unc-52 (Basement membrane proteoglycan [Source:UniProtKB/Swiss-Prot;Acc:Q06561])

HSP 1 Score: 100.138 bits (248), Expect = 5.173e-21
Identity = 100/334 (29.94%), Postives = 147/334 (44.01%), Query Frame = 3
Query: 1641 LTITPREIRVRAGQRVDIECFSKNTQGRASGNPEFSFTNNKPIG---------RDGRFKISNVGPAHKRLTAPGG-LSLSDNNMDVF--------CSLEGRQVSSKIYVSDICPPGYRFCQNGECLENAKFCDKINHCADKSDED--PITCRECDPISRKCEINNQILPKKNYFLIHWICDGEEDCGNGYDEQNCDG-FSLNNCGGKFFTCSDNKT-IPRGYVCDENIDCSQGEDETGCTSPQIXXXXXXXXXXXXXQLVTLTCEATGKPLPVLVWRFNWGCIQNSTR---FSTNFFSTDCNSVTSSLTIKDFKAGDDGIYNCEALSSRQRSFS 2567
            +T+ P E  VR G+ V  EC     + R S N  +       +G           GR  I+ V     +L+  G  + +SD N +           S   ++VS+ +  +  C    + C N EC++N   CD    C D+SDE   P   R C+P   KC  NN+ + K       W+CDG++DCG+  DE NC+   S ++C    F C D +  +P  + CD   DC  G DE GC  P +     T +   +    +LTC+A   P P + WR NWG +    R    S   + T        LTI D +  D G Y CEA++ + R  +
Sbjct:  836 ITVFPSEKEVRDGRDVSFEC-----RARTSDNSVYPTVRWARVGGPLPSSAHDSGGRLTINPV-----QLSDAGTYICVSDYNGNTVEARATLSVVSYGPQEVSNGLRQAGQCMADEKACGNNECVKNDYVCDGEPDCRDRSDEANCPAISRTCEPNEFKCN-NNKCVQKM------WLCDGDDDCGDNSDELNCNAKPSSSDCKPTEFQCHDRRQCVPSSFHCDGTNDCHDGSDEVGCVQPTVVDPPQTNLQVPRGTTFSLTCKAVAVPEPYINWRLNWGPVCEPPRCLQTSEGGYGT--------LTIHDAQPVDQGAYTCEAINVKGRVLA 1144          

HSP 2 Score: 61.6178 bits (148), Expect = 2.720e-9
Identity = 42/140 (30.00%), Postives = 62/140 (44.29%), Query Frame = 3
Query: 1767 IGRDGRFKISNVGPAHKRL------TAPGGLSLSDNNMDVFCSLEGRQVSSKIYV-SDICPPGYRFCQNGECLENAKFCDKINHCADKSDEDPITCRECDPISRKCEINNQILPKKNYFLIHWICDGEEDCGNGYDEQNC 2165
            +  DGR  +   G  H            G   +    ++V    E R  S ++   SD CP G R C++G CL  A+FCD+   C D  DE+  +  +C     +CE  N  +P         +CDG +DC +G DE+ C
Sbjct:  216 LAEDGRVTVYKKGDKHHLHIINATDADDGTYKMIVQGINVEADFEVRITSDRVATESDECPSGERACKSGHCLPVAQFCDRRVQCPDGDDEEHCSEVQCKSNEFRCESTNVCVPTV------VVCDGWKDCHDGSDEKKC 349          
BLAST of low density lipoprotein receptor-1 vs. Ensembl Fly
Match: trol (gene:FBgn0284408 transcript:FBtr0342809)

HSP 1 Score: 119.783 bits (299), Expect = 5.748e-27
Identity = 69/215 (32.09%), Postives = 100/215 (46.51%), Query Frame = 3
Query: 1944 CQNGECLENAKFCDKINHCADKSDEDPITCRECDPISRKCEINNQILPKKNYFLIHWICDGEEDCGNGYDEQNCDG-FSLNNCGGKFFTCSDNKTIPRGYVCDENIDCSQGEDETGCTSPQIXXXXXXXXXXXXXQLVTLTCEATGKPLPVLVWRFNWGCIQNSTRFSTNFFSTDCNSVTSSLTIKDFKAGDDGIYNCEALSSRQRSFSNDFQVI 2585
            C NGEC++ +  CD    C+D SDE   +      +  KC+ N  +          W CDGE DCG+  DE +CD   S   C    F C     IP+ + CD   DC+ G DE GC +P   +     V   + +++ LTC ATG P P +VWR NWG + +     +          T +L   D +  D G Y+CE +++R   F N   ++
Sbjct:  753 CMNGECIDKSSICDGNPDCSDASDEQSCS------LGLKCQPNQFMCSNSKCVDRTWRCDGENDCGDNSDETSCDPEPSGAPCRYNEFQCRSGHCIPKSFQCDNVPDCTDGTDEVGCMAPLPIRPPPQSVSLLEYEVLELTCVATGTPTPTIVWRLNWGHVPDKCESKS-------YGGTGTLRCPDMRPQDSGAYSCEIINTRGTHFVNPDTIV 954          

HSP 2 Score: 62.7734 bits (151), Expect = 1.553e-9
Identity = 100/409 (24.45%), Postives = 160/409 (39.12%), Query Frame = 3
Query:  318 IRWLDKDGKVAAANRYLYIKSLL-----KQDEGIYNCSVEKVKDPQ----IRFNRTLHLKITIPSISIDILPEESLKIGGQ-IKRQCSDLGLPQETIVDDFTYTWLNQQNKTIGNT---------NILQIPVVDESVVGRYICQYKSKETSKIYEAATYVNL----KQSVSYK--IKIITNPALFRYGERFSLRCEVEPF-YQNIKYTWYKKDEFIGNDQE-----LVIKSFKKDNVGTYKCVASLQLPSGKLDLMEESIQQFAFFRESKIELTTKPGPQVYVHRGEKKELHCEIETSSGNRGKEAEWY-INGKKFKNGDIPLVNRLDGQYVSMLVISDISQINEGNYECRVGSSIKE---VNLIVLLDEGLIETSPP--ILKVKEGQSVEFHCRVENIPSVKNVNLKW 1433
            + W   DG   A +   Y   L+     K DEG Y C  E  ++      I + ++   +       + I PEE   + G+  +  C      Q T V    Y W +   +++ ++         N L++    ES  G Y C      T + +  +  VN+    +Q    K  I+ +    L   GE +S+ CE     Y +IK  W K  +F+  +       L I   + +N G Y CVA     S   DL   SI      R S +++ + P     V  G    L+C +E   G      EW  ++G+       PL  R   Q    +VI DI   + G+YECR  + + E   V  I + +  L++  P    L++ EG  +   C    +P   N  ++W
Sbjct: 2118 VTWARVDGHADAQSTRTYDNRLIFDSPRKSDEGRYRCQAENDQNRDEKYVIVYVQSNPPQPPPQQDRLYITPEEINGLAGESFQLNC------QFTSVASLRYDW-SHNGRSLSSSPARNVEIRGNTLEVRDASESDSGVYTCVAYDVRTRRNFTESARVNIDRREEQPFGNKPIIESLEQNILIIQGEDYSITCEASGSPYPSIK--WAKVHDFMPENVHISGNVLTIYGARFENRGVYSCVAENDHGS---DLSSTSIDIEPRERPS-VKIVSAPLQTFSV--GAPASLYCTVE---GIPDPTVEWVRVDGQ-------PLSPRHKIQSPGYMVIDDIQLEDSGDYECRAKNIVGEATGVATITVQEPTLVQIIPDNRDLRLTEGDELSLTCVGSGVP---NPEVEW 2498          

HSP 3 Score: 53.9138 bits (128), Expect = 9.479e-7
Identity = 160/740 (21.62%), Postives = 269/740 (36.35%), Query Frame = 3
Query:  228 PLKNDSIVKSEMQFI--------NIACNVTNYALNETSIRWLDKDG----KVAAANRYLYIKSLLKQDEGIYNCSVEKVKDPQIRFNRTLHLKITIPSISIDILPEESLKIGGQIKRQCSDLGLPQETIVDDFTYTWLNQQNKTIGNTNILQIP---VVDESVV---GRYICQYKSKETSKIYEAATYVNLKQSVSYKIKIITNPALFRY--GERFSLRCEVEPFYQNIKYTW-----YKKDEFIGNDQELVIKSFK--KDNVGTYKCVASLQLPSG----KLDLMEESIQQFAFFRESKIELTTKPGPQVY---VHR-----------GEKKELHCEIETSSGNRGKEAEWYINGKKFKNGDIPLVNRLDGQYVSMLVISDISQINEGNYECR-VG--SSIKE--VNLIVLLDEGLIETSPPI-LKVKEGQSVEFHCRVENIPSVKNVNLKWNFESKEGLVRNNIPDSRWQLMNDEIADQTSFIVLMKAEVSDSGYYICTEPNGQTARSELIVIPDKDKNSLTITPRE--IRVRAGQRVDIECFSKNTQG-RASGNPEFSFTNNKPIGRDGRFKISNVGPAHKRLTAPGGLSLSD------NNMDVFCSLEGRQVSSKIYVSDICPPGYRFCQNGECLENAKFCDKINHCAD-KSDE---------DPITCRE------CDPISRKCEINNQILPKKNYFLIHWICDGEEDCGNGYDEQNC-----DGFSLNNCGGKFF 2204
            P  N  I++S  Q I        +I C  +       SI+W          V  +   L I     ++ G+Y+C  E      +            PS+ I   P ++  +G      C+  G+P      D T  W+    + +   + +Q P   V+D+  +   G Y C+ K+     + EA     +       ++II +    R   G+  SL C V     N +  W      K+D +       ++K ++  K + G Y C    +  S     ++++ E          +S  +      PQ     +H+           G+   L C++      R +     ++G         + NRL+        I  + Q N G Y C  +G   ++K   V  +VL+    I   P I L V+ GQ+++ HC+VEN   V+  ++ W+ +       NN P      +   +    S +  +    + +G Y C+  N    RS++  +  K        P+    R R G+ + ++C   +  G RA  N EF++       RD R  + N      ++     L   D      N+ DV    +  +VS  + V       Y   + G  L++   C  +  CAD KS +          P T R       C P   KC  +     + N      +CDG  DC +  DE NC      G S +N G   F
Sbjct: 2279 PFGNKPIIESLEQNILIIQGEDYSITCEASGSPY--PSIKWAKVHDFMPENVHISGNVLTIYGARFENRGVYSCVAENDHGSDLSSTSIDIEPRERPSVKIVSAPLQTFSVGAPASLYCTVEGIP------DPTVEWVRVDGQPLSPRHKIQSPGYMVIDDIQLEDSGDYECRAKNI----VGEATGVATITVQEPTLVQIIPDNRDLRLTEGDELSLTC-VGSGVPNPEVEWVNEMALKRDLYSPPSNTAILKIYRVTKADAGIYTCHGKNEAGSDEAHVRVEVQERRGDIGGVDDDSDRDPINYNPPQQQNPGIHQPGSNQLLATDIGDNVTLTCDMFQPLNTRWER----VDGAPLPRNAYTIKNRLE--------IVRVEQQNLGQYRCNGIGRDGNVKTYFVKELVLMPLPRIRFYPNIPLTVEAGQNLDVHCQVEN---VRPEDVHWSTD-------NNRP------LPSSVRIVGSVLRFVSITQAAAGEYRCSAFNQYGNRSQIARVAVKKPADFHQVPQSQLQRHREGENIQLQCTVTDQYGVRAQDNVEFNWF------RDDRRPLPNNARTDSQILVLTNLRPEDAGRYICNSYDVDRGQQLPEVSIDLQVLRAPQYPYNRFKGGVSLKDTP-CMVLYICADFKSSKLSSAKPIISGPATTRAPAISYVCQPNDFKCVSHPHTCVRAN-----MVCDGIYDCTDHSDEFNCIAGKGSGKSESNSGSGSF 2965          
BLAST of low density lipoprotein receptor-1 vs. Ensembl Fly
Match: trol (gene:FBgn0284408 transcript:FBtr0342811)

HSP 1 Score: 119.783 bits (299), Expect = 6.060e-27
Identity = 69/215 (32.09%), Postives = 100/215 (46.51%), Query Frame = 3
Query: 1944 CQNGECLENAKFCDKINHCADKSDEDPITCRECDPISRKCEINNQILPKKNYFLIHWICDGEEDCGNGYDEQNCDG-FSLNNCGGKFFTCSDNKTIPRGYVCDENIDCSQGEDETGCTSPQIXXXXXXXXXXXXXQLVTLTCEATGKPLPVLVWRFNWGCIQNSTRFSTNFFSTDCNSVTSSLTIKDFKAGDDGIYNCEALSSRQRSFSNDFQVI 2585
            C NGEC++ +  CD    C+D SDE   +      +  KC+ N  +          W CDGE DCG+  DE +CD   S   C    F C     IP+ + CD   DC+ G DE GC +P   +     V   + +++ LTC ATG P P +VWR NWG + +     +          T +L   D +  D G Y+CE +++R   F N   ++
Sbjct:  723 CMNGECIDKSSICDGNPDCSDASDEQSCS------LGLKCQPNQFMCSNSKCVDRTWRCDGENDCGDNSDETSCDPEPSGAPCRYNEFQCRSGHCIPKSFQCDNVPDCTDGTDEVGCMAPLPIRPPPQSVSLLEYEVLELTCVATGTPTPTIVWRLNWGHVPDKCESKS-------YGGTGTLRCPDMRPQDSGAYSCEIINTRGTHFVNPDTIV 924          

HSP 2 Score: 62.7734 bits (151), Expect = 1.549e-9
Identity = 100/409 (24.45%), Postives = 160/409 (39.12%), Query Frame = 3
Query:  318 IRWLDKDGKVAAANRYLYIKSLL-----KQDEGIYNCSVEKVKDPQ----IRFNRTLHLKITIPSISIDILPEESLKIGGQ-IKRQCSDLGLPQETIVDDFTYTWLNQQNKTIGNT---------NILQIPVVDESVVGRYICQYKSKETSKIYEAATYVNL----KQSVSYK--IKIITNPALFRYGERFSLRCEVEPF-YQNIKYTWYKKDEFIGNDQE-----LVIKSFKKDNVGTYKCVASLQLPSGKLDLMEESIQQFAFFRESKIELTTKPGPQVYVHRGEKKELHCEIETSSGNRGKEAEWY-INGKKFKNGDIPLVNRLDGQYVSMLVISDISQINEGNYECRVGSSIKE---VNLIVLLDEGLIETSPP--ILKVKEGQSVEFHCRVENIPSVKNVNLKW 1433
            + W   DG   A +   Y   L+     K DEG Y C  E  ++      I + ++   +       + I PEE   + G+  +  C      Q T V    Y W +   +++ ++         N L++    ES  G Y C      T + +  +  VN+    +Q    K  I+ +    L   GE +S+ CE     Y +IK  W K  +F+  +       L I   + +N G Y CVA     S   DL   SI      R S +++ + P     V  G    L+C +E   G      EW  ++G+       PL  R   Q    +VI DI   + G+YECR  + + E   V  I + +  L++  P    L++ EG  +   C    +P   N  ++W
Sbjct: 2088 VTWARVDGHADAQSTRTYDNRLIFDSPRKSDEGRYRCQAENDQNRDEKYVIVYVQSNPPQPPPQQDRLYITPEEINGLAGESFQLNC------QFTSVASLRYDW-SHNGRSLSSSPARNVEIRGNTLEVRDASESDSGVYTCVAYDVRTRRNFTESARVNIDRREEQPFGNKPIIESLEQNILIIQGEDYSITCEASGSPYPSIK--WAKVHDFMPENVHISGNVLTIYGARFENRGVYSCVAENDHGS---DLSSTSIDIEPRERPS-VKIVSAPLQTFSV--GAPASLYCTVE---GIPDPTVEWVRVDGQ-------PLSPRHKIQSPGYMVIDDIQLEDSGDYECRAKNIVGEATGVATITVQEPTLVQIIPDNRDLRLTEGDELSLTCVGSGVP---NPEVEW 2468          

HSP 3 Score: 51.9878 bits (123), Expect = 3.329e-6
Identity = 120/572 (20.98%), Postives = 220/572 (38.46%), Query Frame = 3
Query:   72 YQTNKVSSMISICKIFALICIYQSLVKAETEEFT--FGGASEEEETSPPNITFFPLKNDSIVK---SEMQFINIACNVTNYA--LNETSIRWLDKDGKVAAANRY-----LYIKSLLKQDEGIYNCS-VEKVKDPQIRFNRTLHLKITIPSISIDILPEESLKI--GGQIKRQCSDLGLPQETIVDDFTYTWLNQQNKTIGNT-----NILQIPVVDESVVGRYIC----QYKSKETSKIYEAATYVNLKQSVSYKIKIITNPALFRYGERFSLRCEVEPFY-----QNIKYTWYKKDE------FIGNDQELVIKSFKKDNVGTYKCVA-----SLQLPSGKLDLMEESIQQFAFFRESKIELTTKPGPQVYVH-----RGEKKELHCEIETSSGN-RGKEA---EWYINGKKF------KNGDIPLVNRLDGQYVSMLVISDISQINEGNYECRVGSSIKEVNLIVLLDEGLIETSPPILKVKEGQSVEFHCRVENIPSVKNVNLK--WNFESKEGLVRNNIPDSRWQLMNDEIADQTSF----IVLMKAEVSDSGYYICTE--PNGQTA 1598
            Y+  K  + I  C         ++ V+ E +E     GG  ++ +  P N      +N  I +   +++   +I  NVT         + RW   DG     N Y     L I  + +Q+ G Y C+ + +  + +  F + L   + +P   I   P   L +  G  +   C    +  E +       W    N+ + ++     ++L+   + ++  G Y C    QY ++  S+I   A    +K+   +     +     R GE   L+C V   Y      N+++ W++ D          + Q LV+ + + ++ G Y C +       QLP   +DL                 LT  P P   ++       + ++   +++  S N R  E+   E Y +   +      ++   PL N +  Q  + LVIS++S  + GNY C+  +           DEG + T+   L+V++        +   + S K V  K   N + + G   +  P  RW     ++    S     + L   + +D+G YICT    +G+TA
Sbjct: 2491 YRVTKADAGIYTCHGKNEAGSDEAHVRVEVQERRGDIGGVDDDSDRDPINYNPPQQQNPGIHQPGSNQLLATDIGDNVTLTCDMFQPLNTRWERVDGAPLPRNAYTIKNRLEIVRVEQQNLGQYRCNGIGRDGNVKTYFVKEL---VLMPLPRIRFYPNIPLTVEAGQNLDVHCQVENVRPEDV------HWSTDNNRPLPSSVRIVGSVLRFVSITQAAAGEYRCSAFNQYGNR--SQIARVA----VKKPADFHQVPQSQLQRHREGENIQLQCTVTDQYGVRAQDNVEFNWFRDDRRPLPNNARTDSQILVLTNLRPEDAGRYICNSYDVDRGQQLPEVSIDLQV---------------LTATPPPNSPIYLPPQLPAKSRDYSLKLDDQSSNLRAGESTDVECYSSDDTYTDVVWERSDGAPLSNNVR-QVGNRLVISNVSPSDAGNYVCKCKT-----------DEGDLYTTSYKLEVED--------QPHELKSSKIVYAKVGANADLQCGADESRQPTYRWSRQYGQLQAGRSLMNEKLSLDSVQANDAGTYICTAQYADGETA 3012          
BLAST of low density lipoprotein receptor-1 vs. Ensembl Fly
Match: trol (gene:FBgn0284408 transcript:FBtr0342825)

HSP 1 Score: 119.783 bits (299), Expect = 6.070e-27
Identity = 69/215 (32.09%), Postives = 100/215 (46.51%), Query Frame = 3
Query: 1944 CQNGECLENAKFCDKINHCADKSDEDPITCRECDPISRKCEINNQILPKKNYFLIHWICDGEEDCGNGYDEQNCDG-FSLNNCGGKFFTCSDNKTIPRGYVCDENIDCSQGEDETGCTSPQIXXXXXXXXXXXXXQLVTLTCEATGKPLPVLVWRFNWGCIQNSTRFSTNFFSTDCNSVTSSLTIKDFKAGDDGIYNCEALSSRQRSFSNDFQVI 2585
            C NGEC++ +  CD    C+D SDE   +      +  KC+ N  +          W CDGE DCG+  DE +CD   S   C    F C     IP+ + CD   DC+ G DE GC +P   +     V   + +++ LTC ATG P P +VWR NWG + +     +          T +L   D +  D G Y+CE +++R   F N   ++
Sbjct:  984 CMNGECIDKSSICDGNPDCSDASDEQSCS------LGLKCQPNQFMCSNSKCVDRTWRCDGENDCGDNSDETSCDPEPSGAPCRYNEFQCRSGHCIPKSFQCDNVPDCTDGTDEVGCMAPLPIRPPPQSVSLLEYEVLELTCVATGTPTPTIVWRLNWGHVPDKCESKS-------YGGTGTLRCPDMRPQDSGAYSCEIINTRGTHFVNPDTIV 1185          

HSP 2 Score: 63.1586 bits (152), Expect = 1.314e-9
Identity = 100/409 (24.45%), Postives = 160/409 (39.12%), Query Frame = 3
Query:  318 IRWLDKDGKVAAANRYLYIKSLL-----KQDEGIYNCSVEKVKDPQ----IRFNRTLHLKITIPSISIDILPEESLKIGGQ-IKRQCSDLGLPQETIVDDFTYTWLNQQNKTIGNT---------NILQIPVVDESVVGRYICQYKSKETSKIYEAATYVNL----KQSVSYK--IKIITNPALFRYGERFSLRCEVE-PFYQNIKYTWYKKDEFIGNDQE-----LVIKSFKKDNVGTYKCVASLQLPSGKLDLMEESIQQFAFFRESKIELTTKPGPQVYVHRGEKKELHCEIETSSGNRGKEAEWY-INGKKFKNGDIPLVNRLDGQYVSMLVISDISQINEGNYECRVGSSIKE---VNLIVLLDEGLIETSPP--ILKVKEGQSVEFHCRVENIPSVKNVNLKW 1433
            + W   DG   A +   Y   L+     K DEG Y C  E  ++      I + ++   +       + I PEE   + G+  +  C      Q T V    Y W +   +++ ++         N L++    ES  G Y C      T + +  +  VN+    +Q    K  I+ +    L   GE +S+ CE     Y +IK  W K  +F+  +       L I   + +N G Y CVA     S   DL   SI      R S +++ + P     V  G    L+C +E   G      EW  ++G+       PL  R   Q    +VI DI   + G+YECR  + + E   V  I + +  L++  P    L++ EG  +   C    +P   N  ++W
Sbjct: 2349 VTWARVDGHADAQSTRTYDNRLIFDSPRKSDEGRYRCQAENDQNRDEKYVIVYVQSNPPQPPPQQDRLYITPEEINGLAGESFQLNC------QFTSVASLRYDW-SHNGRSLSSSPARNVEIRGNTLEVRDASESDSGVYTCVAYDVRTRRNFTESARVNIDRREEQPFGNKPIIESLEQNILIIQGEDYSITCEASGSPYPSIK--WAKVHDFMPENVHISGNVLTIYGARFENRGVYSCVAENDHGS---DLSSTSIDIEPRERPS-VKIVSAPLQTFSV--GAPASLYCTVE---GIPDPTVEWVRVDGQ-------PLSPRHKIQSPGYMVIDDIQLEDSGDYECRAKNIVGEATGVATITVQEPTLVQIIPDNRDLRLTEGDELSLTCVGSGVP---NPEVEW 2729          

HSP 3 Score: 52.373 bits (124), Expect = 2.751e-6
Identity = 120/572 (20.98%), Postives = 220/572 (38.46%), Query Frame = 3
Query:   72 YQTNKVSSMISICKIFALICIYQSLVKAETEEFT--FGGASEEEETSPPNITFFPLKNDSIVK---SEMQFINIACNVTNYA--LNETSIRWLDKDGKVAAANRY-----LYIKSLLKQDEGIYNCS-VEKVKDPQIRFNRTLHLKITIPSISIDILPEESLKI--GGQIKRQCSDLGLPQETIVDDFTYTWLNQQNKTIGNT-----NILQIPVVDESVVGRYIC----QYKSKETSKIYEAATYVNLKQSVSYKIKIITNPALFRYGERFSLRCEVEPFY-----QNIKYTWYKKDE------FIGNDQELVIKSFKKDNVGTYKCVA-----SLQLPSGKLDLMEESIQQFAFFRESKIELTTKPGPQVYVH-----RGEKKELHCEIETSSGN-RGKEA---EWYINGKKF------KNGDIPLVNRLDGQYVSMLVISDISQINEGNYECRVGSSIKEVNLIVLLDEGLIETSPPILKVKEGQSVEFHCRVENIPSVKNVNLK--WNFESKEGLVRNNIPDSRWQLMNDEIADQTSF----IVLMKAEVSDSGYYICTE--PNGQTA 1598
            Y+  K  + I  C         ++ V+ E +E     GG  ++ +  P N      +N  I +   +++   +I  NVT         + RW   DG     N Y     L I  + +Q+ G Y C+ + +  + +  F + L   + +P   I   P   L +  G  +   C    +  E +       W    N+ + ++     ++L+   + ++  G Y C    QY ++  S+I   A    +K+   +     +     R GE   L+C V   Y      N+++ W++ D          + Q LV+ + + ++ G Y C +       QLP   +DL                 LT  P P   ++       + ++   +++  S N R  E+   E Y +   +      ++   PL N +  Q  + LVIS++S  + GNY C+  +           DEG + T+   L+V++        +   + S K V  K   N + + G   +  P  RW     ++    S     + L   + +D+G YICT    +G+TA
Sbjct: 2752 YRVTKADAGIYTCHGKNEAGSDEAHVRVEVQERRGDIGGVDDDSDRDPINYNPPQQQNPGIHQPGSNQLLATDIGDNVTLTCDMFQPLNTRWERVDGAPLPRNAYTIKNRLEIVRVEQQNLGQYRCNGIGRDGNVKTYFVKEL---VLMPLPRIRFYPNIPLTVEAGQNLDVHCQVENVRPEDV------HWSTDNNRPLPSSVRIVGSVLRFVSITQAAAGEYRCSAFNQYGNR--SQIARVA----VKKPADFHQVPQSQLQRHREGENIQLQCTVTDQYGVRAQDNVEFNWFRDDRRPLPNNARTDSQILVLTNLRPEDAGRYICNSYDVDRGQQLPEVSIDLQV---------------LTATPPPNSPIYLPPQLPAKSRDYSLKLDDQSSNLRAGESTDVECYSSDDTYTDVVWERSDGAPLSNNVR-QVGNRLVISNVSPSDAGNYVCKCKT-----------DEGDLYTTSYKLEVED--------QPHELKSSKIVYAKVGANADLQCGADESRQPTYRWSRQYGQLQAGRSLMNEKLSLDSVQANDAGTYICTAQYADGETA 3273          
BLAST of low density lipoprotein receptor-1 vs. Ensembl Fly
Match: trol (gene:FBgn0284408 transcript:FBtr0342821)

HSP 1 Score: 119.783 bits (299), Expect = 6.224e-27
Identity = 69/215 (32.09%), Postives = 100/215 (46.51%), Query Frame = 3
Query: 1944 CQNGECLENAKFCDKINHCADKSDEDPITCRECDPISRKCEINNQILPKKNYFLIHWICDGEEDCGNGYDEQNCDG-FSLNNCGGKFFTCSDNKTIPRGYVCDENIDCSQGEDETGCTSPQIXXXXXXXXXXXXXQLVTLTCEATGKPLPVLVWRFNWGCIQNSTRFSTNFFSTDCNSVTSSLTIKDFKAGDDGIYNCEALSSRQRSFSNDFQVI 2585
            C NGEC++ +  CD    C+D SDE   +      +  KC+ N  +          W CDGE DCG+  DE +CD   S   C    F C     IP+ + CD   DC+ G DE GC +P   +     V   + +++ LTC ATG P P +VWR NWG + +     +          T +L   D +  D G Y+CE +++R   F N   ++
Sbjct:  906 CMNGECIDKSSICDGNPDCSDASDEQSCS------LGLKCQPNQFMCSNSKCVDRTWRCDGENDCGDNSDETSCDPEPSGAPCRYNEFQCRSGHCIPKSFQCDNVPDCTDGTDEVGCMAPLPIRPPPQSVSLLEYEVLELTCVATGTPTPTIVWRLNWGHVPDKCESKS-------YGGTGTLRCPDMRPQDSGAYSCEIINTRGTHFVNPDTIV 1107          

HSP 2 Score: 63.1586 bits (152), Expect = 1.454e-9
Identity = 100/409 (24.45%), Postives = 160/409 (39.12%), Query Frame = 3
Query:  318 IRWLDKDGKVAAANRYLYIKSLL-----KQDEGIYNCSVEKVKDPQ----IRFNRTLHLKITIPSISIDILPEESLKIGGQ-IKRQCSDLGLPQETIVDDFTYTWLNQQNKTIGNT---------NILQIPVVDESVVGRYICQYKSKETSKIYEAATYVNL----KQSVSYK--IKIITNPALFRYGERFSLRCEVEPF-YQNIKYTWYKKDEFIGNDQE-----LVIKSFKKDNVGTYKCVASLQLPSGKLDLMEESIQQFAFFRESKIELTTKPGPQVYVHRGEKKELHCEIETSSGNRGKEAEWY-INGKKFKNGDIPLVNRLDGQYVSMLVISDISQINEGNYECRVGSSIKE---VNLIVLLDEGLIETSPP--ILKVKEGQSVEFHCRVENIPSVKNVNLKW 1433
            + W   DG   A +   Y   L+     K DEG Y C  E  ++      I + ++   +       + I PEE   + G+  +  C      Q T V    Y W +   +++ ++         N L++    ES  G Y C      T + +  +  VN+    +Q    K  I+ +    L   GE +S+ CE     Y +IK  W K  +F+  +       L I   + +N G Y CVA     S   DL   SI      R S +++ + P     V  G    L+C +E   G      EW  ++G+       PL  R   Q    +VI DI   + G+YECR  + + E   V  I + +  L++  P    L++ EG  +   C    +P   N  ++W
Sbjct: 2333 VTWARVDGHADAQSTRTYDNRLIFDSPRKSDEGRYRCQAENDQNRDEKYVIVYVQSNPPQPPPQQDRLYITPEEINGLAGESFQLNC------QFTSVASLRYDW-SHNGRSLSSSPARNVEIRGNTLEVRDASESDSGVYTCVAYDVRTRRNFTESARVNIDRREEQPFGNKPIIESLEQNILIIQGEDYSITCEASGSPYPSIK--WAKVHDFMPENVHISGNVLTIYGARFENRGVYSCVAENDHGS---DLSSTSIDIEPRERPS-VKIVSAPLQTFSV--GAPASLYCTVE---GIPDPTVEWVRVDGQ-------PLSPRHKIQSPGYMVIDDIQLEDSGDYECRAKNIVGEATGVATITVQEPTLVQIIPDNRDLRLTEGDELSLTCVGSGVP---NPEVEW 2713          

HSP 3 Score: 51.9878 bits (123), Expect = 3.229e-6
Identity = 120/572 (20.98%), Postives = 220/572 (38.46%), Query Frame = 3
Query:   72 YQTNKVSSMISICKIFALICIYQSLVKAETEEFT--FGGASEEEETSPPNITFFPLKNDSIVK---SEMQFINIACNVTNYA--LNETSIRWLDKDGKVAAANRY-----LYIKSLLKQDEGIYNCS-VEKVKDPQIRFNRTLHLKITIPSISIDILPEESLKI--GGQIKRQCSDLGLPQETIVDDFTYTWLNQQNKTIGNT-----NILQIPVVDESVVGRYIC----QYKSKETSKIYEAATYVNLKQSVSYKIKIITNPALFRYGERFSLRCEVEPFY-----QNIKYTWYKKDE------FIGNDQELVIKSFKKDNVGTYKCVA-----SLQLPSGKLDLMEESIQQFAFFRESKIELTTKPGPQVYVH-----RGEKKELHCEIETSSGN-RGKEA---EWYINGKKF------KNGDIPLVNRLDGQYVSMLVISDISQINEGNYECRVGSSIKEVNLIVLLDEGLIETSPPILKVKEGQSVEFHCRVENIPSVKNVNLK--WNFESKEGLVRNNIPDSRWQLMNDEIADQTSF----IVLMKAEVSDSGYYICTE--PNGQTA 1598
            Y+  K  + I  C         ++ V+ E +E     GG  ++ +  P N      +N  I +   +++   +I  NVT         + RW   DG     N Y     L I  + +Q+ G Y C+ + +  + +  F + L   + +P   I   P   L +  G  +   C    +  E +       W    N+ + ++     ++L+   + ++  G Y C    QY ++  S+I   A    +K+   +     +     R GE   L+C V   Y      N+++ W++ D          + Q LV+ + + ++ G Y C +       QLP   +DL                 LT  P P   ++       + ++   +++  S N R  E+   E Y +   +      ++   PL N +  Q  + LVIS++S  + GNY C+  +           DEG + T+   L+V++        +   + S K V  K   N + + G   +  P  RW     ++    S     + L   + +D+G YICT    +G+TA
Sbjct: 2736 YRVTKADAGIYTCHGKNEAGSDEAHVRVEVQERRGDIGGVDDDSDRDPINYNPPQQQNPGIHQPGSNQLLATDIGDNVTLTCDMFQPLNTRWERVDGAPLPRNAYTIKNRLEIVRVEQQNLGQYRCNGIGRDGNVKTYFVKEL---VLMPLPRIRFYPNIPLTVEAGQNLDVHCQVENVRPEDV------HWSTDNNRPLPSSVRIVGSVLRFVSITQAAAGEYRCSAFNQYGNR--SQIARVA----VKKPADFHQVPQSQLQRHREGENIQLQCTVTDQYGVRAQDNVEFNWFRDDRRPLPNNARTDSQILVLTNLRPEDAGRYICNSYDVDRGQQLPEVSIDLQV---------------LTATPPPNSPIYLPPQLPAKSRDYSLKLDDQSSNLRAGESTDVECYSSDDTYTDVVWERSDGAPLSNNVR-QVGNRLVISNVSPSDAGNYVCKCKT-----------DEGDLYTTSYKLEVED--------QPHELKSSKIVYAKVGANADLQCGADESRQPTYRWSRQYGQLQAGRSLMNEKLSLDSVQANDAGTYICTAQYADGETA 3257          
BLAST of low density lipoprotein receptor-1 vs. Ensembl Fly
Match: trol (gene:FBgn0284408 transcript:FBtr0342824)

HSP 1 Score: 119.783 bits (299), Expect = 6.297e-27
Identity = 69/215 (32.09%), Postives = 100/215 (46.51%), Query Frame = 3
Query: 1944 CQNGECLENAKFCDKINHCADKSDEDPITCRECDPISRKCEINNQILPKKNYFLIHWICDGEEDCGNGYDEQNCDG-FSLNNCGGKFFTCSDNKTIPRGYVCDENIDCSQGEDETGCTSPQIXXXXXXXXXXXXXQLVTLTCEATGKPLPVLVWRFNWGCIQNSTRFSTNFFSTDCNSVTSSLTIKDFKAGDDGIYNCEALSSRQRSFSNDFQVI 2585
            C NGEC++ +  CD    C+D SDE   +      +  KC+ N  +          W CDGE DCG+  DE +CD   S   C    F C     IP+ + CD   DC+ G DE GC +P   +     V   + +++ LTC ATG P P +VWR NWG + +     +          T +L   D +  D G Y+CE +++R   F N   ++
Sbjct:  828 CMNGECIDKSSICDGNPDCSDASDEQSCS------LGLKCQPNQFMCSNSKCVDRTWRCDGENDCGDNSDETSCDPEPSGAPCRYNEFQCRSGHCIPKSFQCDNVPDCTDGTDEVGCMAPLPIRPPPQSVSLLEYEVLELTCVATGTPTPTIVWRLNWGHVPDKCESKS-------YGGTGTLRCPDMRPQDSGAYSCEIINTRGTHFVNPDTIV 1029          

HSP 2 Score: 63.1586 bits (152), Expect = 1.154e-9
Identity = 100/409 (24.45%), Postives = 160/409 (39.12%), Query Frame = 3
Query:  318 IRWLDKDGKVAAANRYLYIKSLL-----KQDEGIYNCSVEKVKDPQ----IRFNRTLHLKITIPSISIDILPEESLKIGGQ-IKRQCSDLGLPQETIVDDFTYTWLNQQNKTIGNT---------NILQIPVVDESVVGRYICQYKSKETSKIYEAATYVNL----KQSVSYK--IKIITNPALFRYGERFSLRCEVEPF-YQNIKYTWYKKDEFIGNDQE-----LVIKSFKKDNVGTYKCVASLQLPSGKLDLMEESIQQFAFFRESKIELTTKPGPQVYVHRGEKKELHCEIETSSGNRGKEAEWY-INGKKFKNGDIPLVNRLDGQYVSMLVISDISQINEGNYECRVGSSIKE---VNLIVLLDEGLIETSPP--ILKVKEGQSVEFHCRVENIPSVKNVNLKW 1433
            + W   DG   A +   Y   L+     K DEG Y C  E  ++      I + ++   +       + I PEE   + G+  +  C      Q T V    Y W +   +++ ++         N L++    ES  G Y C      T + +  +  VN+    +Q    K  I+ +    L   GE +S+ CE     Y +IK  W K  +F+  +       L I   + +N G Y CVA     S   DL   SI      R S +++ + P     V  G    L+C +E   G      EW  ++G+       PL  R   Q    +VI DI   + G+YECR  + + E   V  I + +  L++  P    L++ EG  +   C    +P   N  ++W
Sbjct: 2193 VTWARVDGHADAQSTRTYDNRLIFDSPRKSDEGRYRCQAENDQNRDEKYVIVYVQSNPPQPPPQQDRLYITPEEINGLAGESFQLNC------QFTSVASLRYDW-SHNGRSLSSSPARNVEIRGNTLEVRDASESDSGVYTCVAYDVRTRRNFTESARVNIDRREEQPFGNKPIIESLEQNILIIQGEDYSITCEASGSPYPSIK--WAKVHDFMPENVHISGNVLTIYGARFENRGVYSCVAENDHGS---DLSSTSIDIEPRERPS-VKIVSAPLQTFSV--GAPASLYCTVE---GIPDPTVEWVRVDGQ-------PLSPRHKIQSPGYMVIDDIQLEDSGDYECRAKNIVGEATGVATITVQEPTLVQIIPDNRDLRLTEGDELSLTCVGSGVP---NPEVEW 2573          

HSP 3 Score: 52.373 bits (124), Expect = 2.185e-6
Identity = 121/579 (20.90%), Postives = 223/579 (38.51%), Query Frame = 3
Query:   72 YQTNKVSSMISICKIFALICIYQSLVKAETEEFT--FGGASEEEETSPPNITFFPLKNDSIVK---SEMQFINIACNVTNYA--LNETSIRWLDKDGKVAAANRY-----LYIKSLLKQDEGIYNCS-VEKVKDPQIRFNRTLHLKITIPSISIDILPEESLKI--GGQIKRQCSDLGLPQETIVDDFTYTWLNQQNKTIGNT-----NILQIPVVDESVVGRYIC----QYKSKETSKIYEAATYVNLKQSVSYKIKIITNPALFRYGERFSLRCEVEPFY-----QNIKYTWYKKDE------FIGNDQELVIKSFKKDNVGTYKCVA-----SLQLPSGKLDLMEESIQQFAFFRESKIELTTKPGPQVYVH-----RGEKKELHCEIETSSGN-RGKEA---EWYINGKKF------KNGDIPLVNRLDGQYVSMLVISDISQINEGNYECRVGSSIKEVNLIVLLDEGLIETSPPILKVKEGQSVEFHCRVENIPSVKNVNLK--WNFESKEGLVRNNIPDSRWQLMNDEIADQTSF----IVLMKAEVSDSGYYICTE--PNGQTARSELIVI 1619
            Y+  K  + I  C         ++ V+ E +E     GG  ++ +  P N      +N  I +   +++   +I  NVT         + RW   DG     N Y     L I  + +Q+ G Y C+ + +  + +  F + L   + +P   I   P   L +  G  +   C    +  E +       W    N+ + ++     ++L+   + ++  G Y C    QY ++  S+I   A    +K+   +     +     R GE   L+C V   Y      N+++ W++ D          + Q LV+ + + ++ G Y C +       QLP   +DL                 LT  P P   ++       + ++   +++  S N R  E+   E Y +   +      ++   PL N +  Q  + LVIS++S  + GNY C+  +           DEG + T+   L+V++        +   + S K V  K   N + + G   +  P  RW     ++    S     + L   + +D+G YICT    +G+TA    I++
Sbjct: 2596 YRVTKADAGIYTCHGKNEAGSDEAHVRVEVQERRGDIGGVDDDSDRDPINYNPPQQQNPGIHQPGSNQLLATDIGDNVTLTCDMFQPLNTRWERVDGAPLPRNAYTIKNRLEIVRVEQQNLGQYRCNGIGRDGNVKTYFVKEL---VLMPLPRIRFYPNIPLTVEAGQNLDVHCQVENVRPEDV------HWSTDNNRPLPSSVRIVGSVLRFVSITQAAAGEYRCSAFNQYGNR--SQIARVA----VKKPADFHQVPQSQLQRHREGENIQLQCTVTDQYGVRAQDNVEFNWFRDDRRPLPNNARTDSQILVLTNLRPEDAGRYICNSYDVDRGQQLPEVSIDLQV---------------LTATPPPNSPIYLPPQLPAKSRDYSLKLDDQSSNLRAGESTDVECYSSDDTYTDVVWERSDGAPLSNNVR-QVGNRLVISNVSPSDAGNYVCKCKT-----------DEGDLYTTSYKLEVED--------QPHELKSSKIVYAKVGANADLQCGADESRQPTYRWSRQYGQLQAGRSLMNEKLSLDSVQANDAGTYICTAQYADGETADFPNILV 3124          
BLAST of low density lipoprotein receptor-1 vs. Ensembl Zebrafish
Match: hspg2 (heparan sulfate proteoglycan 2 [Source:ZFIN;Acc:ZDB-GENE-080807-4])

HSP 1 Score: 126.716 bits (317), Expect = 6.424e-29
Identity = 78/211 (36.97%), Postives = 105/211 (49.76%), Query Frame = 3
Query: 1944 CQNGECLENAKFCDKINHCADKSDEDPI-TCRECDPISRKCEINNQILPKKNYFLIHWICDGEEDCGNGYDEQNCDGFSLNN-CGGKFFTC-SDNKTIPRGYVCDENIDCSQGEDETGCTSPQIXXXXXXXXXXXXXQLVTLTCEATGKPLPVLVWRFNWGCIQNSTRFSTNFFSTDCNSVTSSLTIKDFKAGDDGIYNCEALSSRQRSFS 2567
            CQNG+C+     CD  + C D SDE    T   C+P   KC+            L  W CDG+ DC +  DE NC        C  + F C SD K IP  Y CDE  DC+   DE GC  P +T +    + A++   VT TC A G P+P++ WR NWG I  + R +    S +      +LTI+D K GD G Y CEA++++   F+
Sbjct:  206 CQNGQCISREYLCDGESDCTDGSDESRCGTPSPCEPNEFKCQ-------NGRCALKLWRCDGDNDCQDNSDEMNCPTKRPGAACAPEQFVCLSDRKCIPASYQCDEEPDCADRSDEFGCAPPTVTVSPEESITASRGDTVTFTCSAIGVPVPIITWRLNWGHIPANNRIT--MISENGQ---GTLTIRDVKEGDQGAYTCEAINAKGLVFA 404          

HSP 2 Score: 82.0333 bits (201), Expect = 3.023e-15
Identity = 129/536 (24.07%), Postives = 202/536 (37.69%), Query Frame = 3
Query:  270 INIACNVTNYALNETSIRW--LDKDGKVAAANRYLYIKSLLKQ-------DEGIYNCSVEKVKDP-QIRFNRTLHLKITIPSISIDILPEESLKI--GGQIKRQCSDLGLPQETIVDDFTYTWLNQQNKTIGNTNILQIPVVDESVVGRYICQYKSKETSKIYEAATYVNLKQSVSYKIKIITNPALFRYGERFSLRCEVEPFYQNIKYTWYKKD-------EFIGNDQELVIKSFKKDNVGTYKCVASLQLPSGKLD-LMEESIQQFAFFRE-------SKIELTTKPGPQVYVHRGEKKELHCEIE-TSSGNRGKEAEWYINGKKFKNGDIPLVNRL-DGQYVSMLVISDISQINEGNYECRVGSSIKEVN-----LIVLLDEGLIETSPPILKVKEGQSVEFHCRVENIPSVKNVNLKWNFESKEGLVRNNIPDSRWQLMNDEIADQT----SFIVLMKAEVSDSGYYICTEPNGQTARSELIVIPDKDKNSLTITPREIRVRAGQRVDIECFSKNTQGRASGNPEFSFTNNK 1763
            IN+ C          S+RW  LD + K   ++      S + Q       D G Y CS +  +   + R    +     +P++    + E  + +  G      C   G P+ TI      + L  ++K + N+ IL  P V     G+Y+C      T+ +  +   + L+         + N    R GE   L+C +      ++Y W K +       +  G D  L I   K+++ GTY+CVAS ++  GK + L + S++ F  F         S   L+ K  PQV     E K L   +E T +   G + EW   G     G +P  + + DG    +L I ++ Q NEG Y CRV S  +        LI  L +  I     +  V  G SVEF C     P                      P  RW  +   + D      + + + +   SDSG Y CT  N   +    +V+  +    +   P    V  G    + C        ASG P  + T +K
Sbjct: 2166 INLECQAAGEP--RPSVRWHRLDNNRKTMLSSTVPVDSSAIIQVLVARPEDSGTYVCSAQNNQGTTETRVEVFVEGGPQVPTVPRASVREPMIIVVEGSTATLHCDAHGFPKPTITWFKERSSLPWRHKIVDNSLIL--PNVGRQDSGQYVC----NATNHLGTSEVTIMLEVDTPPYATSLPNDVSVRVGEVIRLQC-LAHGTPPLRYEWTKINGSLPSTAQLQGGD--LQINLAKENDAGTYRCVASNKV--GKSEALAKVSVRYFFTFPHLELCPVFSAASLSVKVSPQV-----EVKALGSAVEFTCAAKGGLQIEWLKEG-----GVLPPNHHIKDG----ILRIENLEQSNEGIYTCRVTSQFEHAQDSAKLLIQALPKVKINVRTSVQTVMVGNSVEFECHAIGDPE---------------------PTVRWSKVGAPLPDHVEIRGNILRIDQVFESDSGQYRCTATNDVGSEHSHVVLNIQSLPQIAALPESKEVTIGSDAVLPCI-------ASGYPVPTITWSK 2646          

HSP 3 Score: 71.633 bits (174), Expect = 3.839e-12
Identity = 84/339 (24.78%), Postives = 138/339 (40.71%), Query Frame = 3
Query:  768 IKIITNPALFRYGERFSLRCEVEPFYQNIKYTWYKKDEF-------IGNDQELV-IKSFKKDNVGTYKCVASLQLPSGKLDLMEESIQQFAFFRESKIELTTKPGPQVYVHRGEKKELHCEIETSSGNRGKEAEWYI---NGKKFKNGDIP---------LVNRLD--GQYVSMLVISDISQINEGNYECRVGSSIKEVNLIVLLDEGLIETSPPILKVKEGQSVEFHCRVENIPSVKNVNLKWNFESKEGLVRNNIPDSRWQLMNDEIADQTSFIVLMKAEVSDSGYYICTEPNGQTARSELIVIPDKDKNS-LTITPREIRVRAGQRVDIECFSKNT 1715
            I I  + A+ + GE  S RC+V    Q ++  W   +         +G D  ++ + + +  N GTY+CVAS       L  M  SI      RES   + T  GP V V  G+   L C+   ++G       W+    N K   +  +P         LV R +  G YV        +Q N+G  E RV   ++    +  +    +    P++ V EG +   HC     P      + W  E      R+++P   W+    +I D +  ++L      DSG Y+C   N     SE+ ++ + D     T  P ++ VR G+ + ++C +  T
Sbjct: 2059 ISIEPHSAVVKQGESASFRCKVHNGAQPVRLEWKLTNNLPLPDNVKVGPDSSIMTVTNAQAKNQGTYRCVAS------NLYGMTHSIVSL-IVRESPKAVVTPAGP-VRVRVGDPINLECQ---AAGEPRPSVRWHRLDNNRKTMLSSTVPVDSSAIIQVLVARPEDSGTYVCS------AQNNQGTTETRVEVFVEGGPQVPTVPRASVRE--PMIIVVEGSTATLHCDAHGFP---KPTITWFKE------RSSLP---WR---HKIVDNS--LILPNVGRQDSGQYVCNATN-HLGTSEVTIMLEVDTPPYATSLPNDVSVRVGEVIRLQCLAHGT 2360          

HSP 4 Score: 71.2478 bits (173), Expect = 5.386e-12
Identity = 120/560 (21.43%), Postives = 209/560 (37.32%), Query Frame = 3
Query:  216 ITFFPLKNDSIVKSEMQF-INIACNVTNYALNETSIRWLDKDGK--VAAANRY-----LYIKSLLKQDEGIYNCSVEKVKDPQIRFNRTLH--LKITIPSISIDILPEE----SLKIGGQIKRQCSDLGLPQETIVDDFTYTWLNQQNKTIGN-----TNILQIPVVDESVVGRYICQYKSKETSKIYEAATYVNLKQSVSYKIKIITNPALFRYGERFSLRCEVE----PFYQNIKYTWYK-KDEFIGNDQELVIKSFKKDNVGTYKCVASLQLPSGKLDLMEESIQQFAFFRESKIELTTKPGPQVYVHR-----GEKKELHCEIETSSGNRGKEAEWYINGKKFKNGDIPLVNRLDGQYVSMLVISDISQINEGNYEC----RVGSSIKEVNLIVLLDEGLIE---TSPPILKVKEGQSVEFHCRVENIPSVKNVNLKWNFESKEGLVRNNIPDSRWQLMNDEIADQTSFIVLMKAEVSDSGYYICTEPNGQTARSELIVIPDKDKNS------LTITPREIRVRAGQRVDIECFSKNTQGRASGNPEFSFTNNKPI 1769
            ITF  +  D  +  E     N  C V+    +    +W  +DG+   ++A R      L+   +   D G+Y C+       Q   NR+    +  T+PS  I++  EE    S+++G  +   C+      ++ +  +T  W  + N  + N       IL I  V     G Y+C   +        A  YV   + V     +       + G+    RC V     P  + I  +  +   + +  + +L I S  + + G Y C A        L+   E   +     +S  +    P  QV   R     GE   L+C    + G+     +W                R+D   +  LV+ +I   + G Y C      GSS   +++ V   E ++      PP   V EG++++ +C V   P     ++KW+     GL+ +N      Q++   +        +++A   D+G YICT  NG + +   + +      S      ++I P    V+ G+     C   N  G      E+  TNN P+
Sbjct: 1594 ITFIQILEDFAIPPEFNAKSNKMCQVSGSPPH--YFQWSREDGRPISSSAERRRQGEELHFPGIQSNDAGVYICTCRD----QRSSNRSKAEIVVATLPSKPIEVFIEEPKAQSVRVGSTVSFICT-----AKSKLPAYTLVWTRKGNGKLPNRAMDFNGILTIQNVQPEDAGIYVCTGSNMLGMDEGSAVLYVPAAEGVQPVATLSPPVQTVKEGDVAQFRCTVTGNPTPAVEWIGGSGKRISSKAVIRNGQLTISSVDRSDEGEYICKA--------LNTHGEHTARGVLHVQSTGQPNGLPHVQVSPQRVEIYEGETLRLYCR---AIGSPTPSLKWN-------------KARMDRTDIGTLVVPNIRLSDAGTYLCVGTNAAGSSEAHIDVSVTKGENILSGVIIQPPSASVIEGEALDLNCLV---PGTSTGSVKWSRAG--GLLSSN-----HQVLETRLR-------ILRASADDTGDYICTVENGPSPQKATVSVSVTSSASRLQTPIISIEPHSAVVKQGESASFRCKVHN--GAQPVRLEWKLTNNLPL 2099          
BLAST of low density lipoprotein receptor-1 vs. Ensembl Zebrafish
Match: hspg2 (heparan sulfate proteoglycan 2 [Source:ZFIN;Acc:ZDB-GENE-080807-4])

HSP 1 Score: 126.331 bits (316), Expect = 6.606e-29
Identity = 78/211 (36.97%), Postives = 105/211 (49.76%), Query Frame = 3
Query: 1944 CQNGECLENAKFCDKINHCADKSDEDPI-TCRECDPISRKCEINNQILPKKNYFLIHWICDGEEDCGNGYDEQNCDGFSLNN-CGGKFFTC-SDNKTIPRGYVCDENIDCSQGEDETGCTSPQIXXXXXXXXXXXXXQLVTLTCEATGKPLPVLVWRFNWGCIQNSTRFSTNFFSTDCNSVTSSLTIKDFKAGDDGIYNCEALSSRQRSFS 2567
            CQNG+C+     CD  + C D SDE    T   C+P   KC+            L  W CDG+ DC +  DE NC        C  + F C SD K IP  Y CDE  DC+   DE GC  P +T +    + A++   VT TC A G P+P++ WR NWG I  + R +    S +      +LTI+D K GD G Y CEA++++   F+
Sbjct:  271 CQNGQCISREYLCDGESDCTDGSDESRCGTPSPCEPNEFKCQ-------NGRCALKLWRCDGDNDCQDNSDEMNCPTKRPGAACAPEQFVCLSDRKCIPASYQCDEEPDCADRSDEFGCAPPTVTVSPEESITASRGDTVTFTCSAIGVPVPIITWRLNWGHIPANNRIT--MISENGQ---GTLTIRDVKEGDQGAYTCEAINAKGLVFA 469          

HSP 2 Score: 78.1814 bits (191), Expect = 4.749e-14
Identity = 125/528 (23.67%), Postives = 199/528 (37.69%), Query Frame = 3
Query:  270 INIACNVTNYALNETSIRW--LDKDGKVAAANRYLYIKSLLKQ-------DEGIYNCSVEKVKDP-QIRFNRTLHLKITIPSISIDILPEESLKI--GGQIKRQCSDLGLPQETIVDDFTYTWLNQQNKTIGNTNILQIPVVDESVVGRYICQYKSKETSKIYEAATYVNLKQSVSYKIKIITNPALFRYGERFSLRCEVEPFYQNIKYTWYKKD-------EFIGNDQELVIKSFKKDNVGTYKCVASLQLPSGKLDLMEESIQQFAFFRESKIELTTKPGPQVYVHRGEKKELHCEIE-TSSGNRGKEAEWYINGKKFKNGDIPLVNRL-DGQYVSMLVISDISQINEGNYECRVGSSIKEVN-----LIVLLDEGLIETSPPILKVKEGQSVEFHCRVENIPSVKNVNLKWNFESKEGLVRNNIPDSRWQLMNDEIADQT----SFIVLMKAEVSDSGYYICTEPNGQTARSELIVIPDKDKNSLTITPREIRVRAGQRVDIECFSKNTQGRASGNPEFSFTNNK 1763
            IN+ C          S+RW  LD + K   ++      S + Q       D G Y CS +  +   + R    +     +P++    + E  + +  G      C   G P+ TI      + L  ++K + N+ IL  P V     G+Y+C      T+ +  +   + L+         + N    R GE   L+C +      ++Y W K +       +  G D  L I   K+++ GTY+CVAS ++  GK     E++ + +     +  L+ K  PQV     E K L   +E T +   G + EW   G     G +P  + + DG    +L I ++ Q NEG Y CRV S  +        LI  L +  I     +  V  G SVEF C     P                      P  RW  +   + D      + + + +   SDSG Y CT  N   +    +V+  +    +   P    V  G    + C        ASG P  + T +K
Sbjct: 2225 INLECQAAGEP--RPSVRWHRLDNNRKTMLSSTVPVDSSAIIQVLVARPEDSGTYVCSAQNNQGTTETRVEVFVEGGPQVPTVPRASVREPMIIVVEGSTATLHCDAHGFPKPTITWFKERSSLPWRHKIVDNSLIL--PNVGRQDSGQYVC----NATNHLGTSEVTIMLEVDTPPYATSLPNDVSVRVGEVIRLQC-LAHGTPPLRYEWTKINGSLPSTAQLQGGD--LQINLAKENDAGTYRCVASNKV--GK----SEALAKVSV----RSSLSVKVSPQV-----EVKALGSAVEFTCAAKGGLQIEWLKEG-----GVLPPNHHIKDG----ILRIENLEQSNEGIYTCRVTSQFEHAQDSAKLLIQALPKVKINVRTSVQTVMVGNSVEFECHAIGDPE---------------------PTVRWSKVGAPLPDHVEIRGNILRIDQVFESDSGQYRCTATNDVGSEHSHVVLNIQSLPQIAALPESKEVTIGSDAVLPCI-------ASGYPVPTITWSK 2689          

HSP 3 Score: 72.4034 bits (176), Expect = 2.393e-12
Identity = 112/525 (21.33%), Postives = 198/525 (37.71%), Query Frame = 3
Query:  318 IRWLDKDGK--VAAANRY-----LYIKSLLKQDEGIYNCSVEKVKDPQIRFNRTLH--LKITIPSISIDILPEE----SLKIGGQIKRQCSDLGLPQETIVDDFTYTWLNQQNKTIGN-----TNILQIPVVDESVVGRYICQYKSKETSKIYEAATYVNLKQSVSYKIKIITNPALFRYGERFSLRCEVE----PFYQNIKYTWYK-KDEFIGNDQELVIKSFKKDNVGTYKCVASLQLPSGKLDLMEESIQQFAFFRESKIELTTKPGPQVYVHR-----GEKKELHCEIETSSGNRGKEAEWYINGKKFKNGDIPLVNRLDGQYVSMLVISDISQINEGNYEC----RVGSSIKEVNLIVLLDEGLIE---TSPPILKVKEGQSVEFHCRVENIPSVKNVNLKWNFESKEGLVRNNIPDSRWQLMNDEIADQTSFIVLMKAEVSDSGYYICTEPNGQTARSELIVIPDKDKNS------LTITPREIRVRAGQRVDIECFSKNTQGRASGNPEFSFTNNKPI 1769
             +W  +DG+   ++A R      L+   +   D G+Y C+       Q   NR+    +  T+PS  I++  EE    S+++G  +   C+      ++ +  +T  W  + N  + N       IL I  V     G Y+C   +        A  YV   + V     +       + G+    RC V     P  + I  +  +   + +  + +L I S  + + G Y C A        L+   E   +     +S  +    P  QV   R     GE   L+C    + G+     +W               N++D   +  LV+ +I   + G Y C      GSS   +++ V   E ++      PP   V EG++++ +C V   P     ++KW+     GL+ +N      Q++   +        +++A   D+G YICT  NG + +   + +      S      ++I P    V+ G+     C   N  G      E+  TNN P+
Sbjct: 1688 FQWSREDGRPISSSAERRRQGEELHFPGIQSNDAGVYICTCRD----QRSSNRSKAEIVVATLPSKPIEVFIEEPKAQSVRVGSTVSFICT-----AKSKLPAYTLVWTRKGNGKLPNRAMDFNGILTIQNVQPEDAGIYVCTGSNMLGMDEGSAVLYVPAAEGVQPVATLSPPVQTVKEGDVAQFRCTVTGNPTPAVEWIGGSGKRISSKAVIRNGQLTISSVDRSDEGEYICKA--------LNTHGEHTARGVLHVQSTGQPNGLPHVQVSPQRVEIYEGETLRLYCR---AIGSPTPSLKW---------------NKMDRTDIGTLVVPNIRLSDAGTYLCVGTNAAGSSEAHIDVSVTKGENILSGVIIQPPSASVIEGEALDLNCLV---PGTSTGSVKWSRAG--GLLSSN-----HQVLETRLR-------ILRASADDTGDYICTVENGPSPQKATVSVSVTSSASRLQTPIISIEPHSAVVKQGESASFRCKVHN--GAQPVRLEWKLTNNLPL 2158          

HSP 4 Score: 71.633 bits (174), Expect = 3.876e-12
Identity = 84/339 (24.78%), Postives = 138/339 (40.71%), Query Frame = 3
Query:  768 IKIITNPALFRYGERFSLRCEVEPFYQNIKYTWYKKDEF-------IGNDQELV-IKSFKKDNVGTYKCVASLQLPSGKLDLMEESIQQFAFFRESKIELTTKPGPQVYVHRGEKKELHCEIETSSGNRGKEAEWYI---NGKKFKNGDIP---------LVNRLD--GQYVSMLVISDISQINEGNYECRVGSSIKEVNLIVLLDEGLIETSPPILKVKEGQSVEFHCRVENIPSVKNVNLKWNFESKEGLVRNNIPDSRWQLMNDEIADQTSFIVLMKAEVSDSGYYICTEPNGQTARSELIVIPDKDKNS-LTITPREIRVRAGQRVDIECFSKNT 1715
            I I  + A+ + GE  S RC+V    Q ++  W   +         +G D  ++ + + +  N GTY+CVAS       L  M  SI      RES   + T  GP V V  G+   L C+   ++G       W+    N K   +  +P         LV R +  G YV        +Q N+G  E RV   ++    +  +    +    P++ V EG +   HC     P      + W  E      R+++P   W+    +I D +  ++L      DSG Y+C   N     SE+ ++ + D     T  P ++ VR G+ + ++C +  T
Sbjct: 2118 ISIEPHSAVVKQGESASFRCKVHNGAQPVRLEWKLTNNLPLPDNVKVGPDSSIMTVTNAQAKNQGTYRCVAS------NLYGMTHSIVSL-IVRESPKAVVTPAGP-VRVRVGDPINLECQ---AAGEPRPSVRWHRLDNNRKTMLSSTVPVDSSAIIQVLVARPEDSGTYVCS------AQNNQGTTETRVEVFVEGGPQVPTVPRASVRE--PMIIVVEGSTATLHCDAHGFP---KPTITWFKE------RSSLP---WR---HKIVDNS--LILPNVGRQDSGQYVCNATN-HLGTSEVTIMLEVDTPPYATSLPNDVSVRVGEVIRLQCLAHGT 2419          
BLAST of low density lipoprotein receptor-1 vs. Ensembl Zebrafish
Match: hspg2 (heparan sulfate proteoglycan 2 [Source:ZFIN;Acc:ZDB-GENE-080807-4])

HSP 1 Score: 126.331 bits (316), Expect = 6.929e-29
Identity = 78/211 (36.97%), Postives = 105/211 (49.76%), Query Frame = 3
Query: 1944 CQNGECLENAKFCDKINHCADKSDEDPI-TCRECDPISRKCEINNQILPKKNYFLIHWICDGEEDCGNGYDEQNCDGFSLNN-CGGKFFTC-SDNKTIPRGYVCDENIDCSQGEDETGCTSPQIXXXXXXXXXXXXXQLVTLTCEATGKPLPVLVWRFNWGCIQNSTRFSTNFFSTDCNSVTSSLTIKDFKAGDDGIYNCEALSSRQRSFS 2567
            CQNG+C+     CD  + C D SDE    T   C+P   KC+            L  W CDG+ DC +  DE NC        C  + F C SD K IP  Y CDE  DC+   DE GC  P +T +    + A++   VT TC A G P+P++ WR NWG I  + R +    S +      +LTI+D K GD G Y CEA++++   F+
Sbjct:  206 CQNGQCISREYLCDGESDCTDGSDESRCGTPSPCEPNEFKCQ-------NGRCALKLWRCDGDNDCQDNSDEMNCPTKRPGAACAPEQFVCLSDRKCIPASYQCDEEPDCADRSDEFGCAPPTVTVSPEESITASRGDTVTFTCSAIGVPVPIITWRLNWGHIPANNRIT--MISENGQ---GTLTIRDVKEGDQGAYTCEAINAKGLVFA 404          

HSP 2 Score: 78.1814 bits (191), Expect = 4.780e-14
Identity = 125/528 (23.67%), Postives = 199/528 (37.69%), Query Frame = 3
Query:  270 INIACNVTNYALNETSIRW--LDKDGKVAAANRYLYIKSLLKQ-------DEGIYNCSVEKVKDP-QIRFNRTLHLKITIPSISIDILPEESLKI--GGQIKRQCSDLGLPQETIVDDFTYTWLNQQNKTIGNTNILQIPVVDESVVGRYICQYKSKETSKIYEAATYVNLKQSVSYKIKIITNPALFRYGERFSLRCEVEPFYQNIKYTWYKKD-------EFIGNDQELVIKSFKKDNVGTYKCVASLQLPSGKLDLMEESIQQFAFFRESKIELTTKPGPQVYVHRGEKKELHCEIE-TSSGNRGKEAEWYINGKKFKNGDIPLVNRL-DGQYVSMLVISDISQINEGNYECRVGSSIKEVN-----LIVLLDEGLIETSPPILKVKEGQSVEFHCRVENIPSVKNVNLKWNFESKEGLVRNNIPDSRWQLMNDEIADQT----SFIVLMKAEVSDSGYYICTEPNGQTARSELIVIPDKDKNSLTITPREIRVRAGQRVDIECFSKNTQGRASGNPEFSFTNNK 1763
            IN+ C          S+RW  LD + K   ++      S + Q       D G Y CS +  +   + R    +     +P++    + E  + +  G      C   G P+ TI      + L  ++K + N+ IL  P V     G+Y+C      T+ +  +   + L+         + N    R GE   L+C +      ++Y W K +       +  G D  L I   K+++ GTY+CVAS ++  GK     E++ + +     +  L+ K  PQV     E K L   +E T +   G + EW   G     G +P  + + DG    +L I ++ Q NEG Y CRV S  +        LI  L +  I     +  V  G SVEF C     P                      P  RW  +   + D      + + + +   SDSG Y CT  N   +    +V+  +    +   P    V  G    + C        ASG P  + T +K
Sbjct: 2160 INLECQAAGEP--RPSVRWHRLDNNRKTMLSSTVPVDSSAIIQVLVARPEDSGTYVCSAQNNQGTTETRVEVFVEGGPQVPTVPRASVREPMIIVVEGSTATLHCDAHGFPKPTITWFKERSSLPWRHKIVDNSLIL--PNVGRQDSGQYVC----NATNHLGTSEVTIMLEVDTPPYATSLPNDVSVRVGEVIRLQC-LAHGTPPLRYEWTKINGSLPSTAQLQGGD--LQINLAKENDAGTYRCVASNKV--GK----SEALAKVSV----RSSLSVKVSPQV-----EVKALGSAVEFTCAAKGGLQIEWLKEG-----GVLPPNHHIKDG----ILRIENLEQSNEGIYTCRVTSQFEHAQDSAKLLIQALPKVKINVRTSVQTVMVGNSVEFECHAIGDPE---------------------PTVRWSKVGAPLPDHVEIRGNILRIDQVFESDSGQYRCTATNDVGSEHSHVVLNIQSLPQIAALPESKEVTIGSDAVLPCI-------ASGYPVPTITWSK 2624          

HSP 3 Score: 72.4034 bits (176), Expect = 2.781e-12
Identity = 112/525 (21.33%), Postives = 198/525 (37.71%), Query Frame = 3
Query:  318 IRWLDKDGK--VAAANRY-----LYIKSLLKQDEGIYNCSVEKVKDPQIRFNRTLH--LKITIPSISIDILPEE----SLKIGGQIKRQCSDLGLPQETIVDDFTYTWLNQQNKTIGN-----TNILQIPVVDESVVGRYICQYKSKETSKIYEAATYVNLKQSVSYKIKIITNPALFRYGERFSLRCEVE----PFYQNIKYTWYK-KDEFIGNDQELVIKSFKKDNVGTYKCVASLQLPSGKLDLMEESIQQFAFFRESKIELTTKPGPQVYVHR-----GEKKELHCEIETSSGNRGKEAEWYINGKKFKNGDIPLVNRLDGQYVSMLVISDISQINEGNYEC----RVGSSIKEVNLIVLLDEGLIE---TSPPILKVKEGQSVEFHCRVENIPSVKNVNLKWNFESKEGLVRNNIPDSRWQLMNDEIADQTSFIVLMKAEVSDSGYYICTEPNGQTARSELIVIPDKDKNS------LTITPREIRVRAGQRVDIECFSKNTQGRASGNPEFSFTNNKPI 1769
             +W  +DG+   ++A R      L+   +   D G+Y C+       Q   NR+    +  T+PS  I++  EE    S+++G  +   C+      ++ +  +T  W  + N  + N       IL I  V     G Y+C   +        A  YV   + V     +       + G+    RC V     P  + I  +  +   + +  + +L I S  + + G Y C A        L+   E   +     +S  +    P  QV   R     GE   L+C    + G+     +W               N++D   +  LV+ +I   + G Y C      GSS   +++ V   E ++      PP   V EG++++ +C V   P     ++KW+     GL+ +N      Q++   +        +++A   D+G YICT  NG + +   + +      S      ++I P    V+ G+     C   N  G      E+  TNN P+
Sbjct: 1623 FQWSREDGRPISSSAERRRQGEELHFPGIQSNDAGVYICTCRD----QRSSNRSKAEIVVATLPSKPIEVFIEEPKAQSVRVGSTVSFICT-----AKSKLPAYTLVWTRKGNGKLPNRAMDFNGILTIQNVQPEDAGIYVCTGSNMLGMDEGSAVLYVPAAEGVQPVATLSPPVQTVKEGDVAQFRCTVTGNPTPAVEWIGGSGKRISSKAVIRNGQLTISSVDRSDEGEYICKA--------LNTHGEHTARGVLHVQSTGQPNGLPHVQVSPQRVEIYEGETLRLYCR---AIGSPTPSLKW---------------NKMDRTDIGTLVVPNIRLSDAGTYLCVGTNAAGSSEAHIDVSVTKGENILSGVIIQPPSASVIEGEALDLNCLV---PGTSTGSVKWSRAG--GLLSSN-----HQVLETRLR-------ILRASADDTGDYICTVENGPSPQKATVSVSVTSSASRLQTPIISIEPHSAVVKQGESASFRCKVHN--GAQPVRLEWKLTNNLPL 2093          

HSP 4 Score: 71.633 bits (174), Expect = 4.105e-12
Identity = 84/339 (24.78%), Postives = 138/339 (40.71%), Query Frame = 3
Query:  768 IKIITNPALFRYGERFSLRCEVEPFYQNIKYTWYKKDEF-------IGNDQELV-IKSFKKDNVGTYKCVASLQLPSGKLDLMEESIQQFAFFRESKIELTTKPGPQVYVHRGEKKELHCEIETSSGNRGKEAEWYI---NGKKFKNGDIP---------LVNRLD--GQYVSMLVISDISQINEGNYECRVGSSIKEVNLIVLLDEGLIETSPPILKVKEGQSVEFHCRVENIPSVKNVNLKWNFESKEGLVRNNIPDSRWQLMNDEIADQTSFIVLMKAEVSDSGYYICTEPNGQTARSELIVIPDKDKNS-LTITPREIRVRAGQRVDIECFSKNT 1715
            I I  + A+ + GE  S RC+V    Q ++  W   +         +G D  ++ + + +  N GTY+CVAS       L  M  SI      RES   + T  GP V V  G+   L C+   ++G       W+    N K   +  +P         LV R +  G YV        +Q N+G  E RV   ++    +  +    +    P++ V EG +   HC     P      + W  E      R+++P   W+    +I D +  ++L      DSG Y+C   N     SE+ ++ + D     T  P ++ VR G+ + ++C +  T
Sbjct: 2053 ISIEPHSAVVKQGESASFRCKVHNGAQPVRLEWKLTNNLPLPDNVKVGPDSSIMTVTNAQAKNQGTYRCVAS------NLYGMTHSIVSL-IVRESPKAVVTPAGP-VRVRVGDPINLECQ---AAGEPRPSVRWHRLDNNRKTMLSSTVPVDSSAIIQVLVARPEDSGTYVCS------AQNNQGTTETRVEVFVEGGPQVPTVPRASVRE--PMIIVVEGSTATLHCDAHGFP---KPTITWFKE------RSSLP---WR---HKIVDNS--LILPNVGRQDSGQYVCNATN-HLGTSEVTIMLEVDTPPYATSLPNDVSVRVGEVIRLQCLAHGT 2354          
BLAST of low density lipoprotein receptor-1 vs. Ensembl Zebrafish
Match: lrp2b (low density lipoprotein receptor-related protein 2b [Source:ZFIN;Acc:ZDB-GENE-111115-1])

HSP 1 Score: 82.8037 bits (203), Expect = 1.592e-15
Identity = 74/251 (29.48%), Postives = 103/251 (41.04%), Query Frame = 3
Query: 1575 TEPNGQTARSELIVIPDKDKNSLTITPRE-----IRVRAGQR--VDIECFSKNTQGRASGNPEFSFTNNKPIGRDGRFKISNVGPAHKRLTA-PGGLSLSDNNMDVFCSLEGRQVSSKIYVSDICPPGYRFCQNGECLENAKFCDKINHCADKSDEDPITC--RECDPISRKCEINNQILPKKNYFLIHWICDGEEDCGNGYDEQNCDGFSLNNCGGKFFTCSDNKTIPRGYVCDENIDCSQGEDETGCTS 2297
            T P   T  ++ + + D   NS+    +      I +R G    ++I+ +S + Q         S  N  P GR   F      PA  R+   P G+ L +N  D  C  +  +        D   P    C  G C+ N   CD +N C DK+DE   T     C P +  C  N   +P +      W CDG +DCG+G DE NC       C    F C++   IP+ +VCD   DC  G DE  C S
Sbjct:  909 THPFSLTIHTDHLFVSDWRTNSVFRMRKRDGGDNIMLRKGISGIMNIKAYSADLQDLFK-----SRCNMIPNGRCSHFCFPT--PASSRVCGCPFGMKLQENQRD--CVKDDSEPPPDDNCGDYAFP----CDGGRCVPNTYRCDGVNDCVDKTDEVNCTLPGATCSPYAFTCG-NKHCIPAR------WRCDGHDDCGDGSDETNCPTRGPTTCSSSQFACTNGNCIPKTWVCDAFNDCGDGSDERHCNS 1139          

HSP 2 Score: 69.707 bits (169), Expect = 1.656e-11
Identity = 44/118 (37.29%), Postives = 60/118 (50.85%), Query Frame = 3
Query: 1938 RFCQNGECLENAKFCDKINHCADKSDEDPITCRECDPISRKCEINNQILPKKNYFLIHWICDGEEDCGNGYDEQNCDGFSLNNCGGKFFTCSDNKTIPRGYVCDENIDCSQGEDETGC 2291
            + C NG C  NA+ C+ I  C D SDE   T R C     +C  N   +P      + ++CD  +DCG+  DEQNC+      C G  F CS+ + +P+ +VCD   DC    DE GC
Sbjct:  147 KTCANGACYNNAQHCNGILDCRDGSDESNCT-RHCQSHQFECA-NGFCIP------MPFVCDHWDDCGDNSDEQNCE---YRTCSGSEFACSNGRCMPQQWVCDGINDCGDFSDENGC 253          

HSP 3 Score: 67.781 bits (164), Expect = 6.298e-11
Identity = 45/137 (32.85%), Postives = 57/137 (41.61%), Query Frame = 3
Query: 1893 VSSKIYVSDICPPGYRFCQNGECLENAKFCDKINHCADKSDEDPITCRECDPISRKCEINNQILPKKNYFLIHWICDGEEDCGNGYDEQ-NCDGFSLNNCGGKFFTCSDNKTIPRGYVCDENIDCSQGEDETGCTSP 2300
            +     V   C  G   C NG+C+     CD    C D SDE       C     KC    + +P      + ++CDGE DC +G DEQ  C G     C    FTC + + IP+ Y CD   DC    DE  C  P
Sbjct:   15 IHGPYIVQGQCMSGEFQCSNGQCINQDWKCDGTKDCTDNSDELNCPLPTCSSQEFKCLTGGECIP------LEFVCDGEADCADGSDEQRTCSG---QTCSPDQFTCREGQCIPKQYNCDHVPDCVDNSDENNCNYP 142          

HSP 4 Score: 66.6254 bits (161), Expect = 1.371e-10
Identity = 44/117 (37.61%), Postives = 60/117 (51.28%), Query Frame = 3
Query: 1950 NGECLENAKFCDKINHCADKSDEDPITCRE--CDPISR-KCEINNQILPKKNYFLIHWICDGEEDCGNGYDEQNCDGFSLNNCGGKFFTCSDNKTIPRGYVCDENIDCSQGEDETGC 2291
            N  C+     CD  N C D SDE+  TC E  CDP+   +C+ N++ +P      I W CDG  DCG+G DE+NC+      C    + C + + IP  +VCD + DC    DE  C
Sbjct: 3682 NYRCIPLWAVCDGTNDCLDNSDEN--TCHELTCDPLGDFRCD-NHRCVP------IRWRCDGSNDCGDGSDERNCEP---RPCSESEYRCDNQQCIPGAWVCDHDNDCGDNSDERDC 3786          

HSP 5 Score: 63.5438 bits (153), Expect = 1.214e-9
Identity = 45/125 (36.00%), Postives = 53/125 (42.40%), Query Frame = 3
Query: 1923 CPPGY----RF-CQNGECLENAKFCDKINHCADKSDEDPITCRECDPISRKCEINNQILPKKNYFLIHWICDGEEDCGNGYDEQNCDGFSLNNCGGKFFTCSDNKTIPRGYVCDENIDCSQGEDE 2282
            CPP Y    +F CQ+G C      CD    C D SDED   C +      +C  N      K+   I W CDG  DC +G DE+  D      C    F C     IP+ YVCD   DC    DE
Sbjct: 3541 CPPHYCKTGQFQCQDGNCTNPFFLCDGHKDCFDGSDEDAALCSD-----HRCTENQFQCKNKHCIPITWHCDGVVDCSDGSDEET-DSCIDKTCKPGQFQCKKGGCIPQSYVCDAQNDCGDNSDE 3659          

HSP 6 Score: 63.5438 bits (153), Expect = 1.245e-9
Identity = 43/129 (33.33%), Postives = 60/129 (46.51%), Query Frame = 3
Query: 1911 VSDICPPGYRFCQNGECLENAKFCDKINHCADKSDEDPITCRECDPISRKCEINNQILPKKNYFLIH-W-ICDGEEDCGNGYDEQNCDGFSLNNCGGKFFTCSDNKTIPRGYVCDENIDCSQGEDETGC 2291
            +   C PG   C+ G C+  +  CD  N C D SDE    C   D    KC+ + +   K NY  I  W +CDG  DC +  DE  C   + +  G   F C +++ +P  + CD + DC  G DE  C
Sbjct: 3624 IDKTCKPGQFQCKKGGCIPQSYVCDAQNDCGDNSDEPYEVCMGPD---YKCDPDTEFPCKGNYRCIPLWAVCDGTNDCLDNSDENTCHELTCDPLGD--FRCDNHRCVPIRWRCDGSNDCGDGSDERNC 3747          

HSP 7 Score: 63.1586 bits (152), Expect = 1.564e-9
Identity = 50/161 (31.06%), Postives = 60/161 (37.27%), Query Frame = 3
Query: 1923 CPPGYRFCQNGECLENAKFCDKINHCADKSDEDP-------------ITCR-------ECDPIS---------------------RKCEINNQILPKKNYFLIHWICDGEEDCGNGYDEQNCDGFSLNNCGGKFFTCSDNKTIPRGYVCDENIDCSQGEDE 2282
            C P    C NG C++ +  CD  N C D SDE                TC         C P+S                     R C +N          L+ + CD   DCG+G DE NC     N C  + FTC +   IP  YVCD  IDC  G DE
Sbjct: 2899 CSPQQFNCANGNCIQQSWVCDGNNDCGDNSDEAQELQCGSRTCNPGDFTCPSWYPGSPRCIPLSYVCDGEKDCVDAADELHNCPNRTCHLNEFACANGRCILLPFHCDRVNDCGDGSDETNC---IYNTCSSREFTCQNGVCIPSTYVCDGYIDCQDGSDE 3056          

HSP 8 Score: 61.2326 bits (147), Expect = 6.921e-9
Identity = 45/149 (30.20%), Postives = 63/149 (42.28%), Query Frame = 3
Query: 1944 CQNGECLENAKFCDKINHCADKSDEDPITCRECDPISRKCEINNQILPKKNYFLIHWICDGEEDCGNGYDEQNCDGFSLNNCGGKFFTCSDNKTIPRGYVCDENIDCSQGEDETGCTSPQIXXXXXXXXXXXXXQLVTLTCEATGKPLP 2390
            C NG C+     CD  + C D SDE     R C      C  N + +P++      W+CDG  DCG+  DE  CD    +   G++     +  +P   VCDE+ DC  G DE+  T+          +     Q   L+CE    P P
Sbjct:  187 CANGFCIPMPFVCDHWDDCGDNSDEQNCEYRTCSGSEFACS-NGRCMPQQ------WVCDGINDCGDFSDENGCDPGIRDCYPGEWPCPGSSLCVPVNKVCDEHPDCPGGTDESNATA---------HLTCDLHQCSALSCEYRCHPTP 319          

HSP 9 Score: 61.2326 bits (147), Expect = 7.039e-9
Identity = 41/127 (32.28%), Postives = 59/127 (46.46%), Query Frame = 3
Query: 1935 YRF-CQNG-ECLENAKFCDKINHCADKSDEDPITCRE---CDPISRKCEINNQILPKKNYFLIHWICDGEEDCGNGYDEQNCDGFSLNNCGGKFFTCSDNKTIPRGYVCDENIDCSQGEDETGCTSP 2300
            Y F C +G +C+  +  CD +  C D SDE     R    C     +C+++   +PK+      W CDG  DC +G DE N  G     C    F C++   + + +VCD   DC    DET C +P
Sbjct: 1185 YEFACASGDQCVSQSYRCDGVYDCKDHSDESGCPTRRPGLCHDNEFQCQVDGFCIPKE------WECDGHPDCVDGSDEHN--GCPPRTCSSVQFQCANGNCVSKNWVCDGENDCRDMSDETNCPTP 1303          

HSP 10 Score: 61.2326 bits (147), Expect = 7.039e-9
Identity = 41/125 (32.80%), Postives = 59/125 (47.20%), Query Frame = 3
Query: 1929 PGYRF-CQNGECLENAKFCDKINHCADKSDEDPITCRECDPISRKCEINNQILPKKNYFLIH-WICDGEEDCGNGYDEQ--NCDGFSLNNCGGKFFTCSDNKTIPRGYVCDENIDCSQGEDETGC 2291
            P ++F C N  C+     CD  N C D+SDE    C      +  CE+  +      Y +    +C+ ++DCG+G DE+   C   +L  C    F CS+   +P  YVCD N +C    DE GC
Sbjct: 3836 PAHQFQCNNKLCVNQQWVCDGFNDCGDRSDEQLSLC-----WNITCEMPTKFRCDNGYCIYSGLMCNQKDDCGDGSDEKEDQCQEPTLAPCTPNEFKCSNGHCVPLPYVCDHNNNCGDLTDELGC 3955          

HSP 11 Score: 59.6918 bits (143), Expect = 1.768e-8
Identity = 39/124 (31.45%), Postives = 59/124 (47.58%), Query Frame = 3
Query: 1923 CPPGYRFCQNGE-CLENAKFCDKINHCADKSDEDPITC--RECDPISRKCEINNQILPKKNYFLIHWICDGEEDCGNGYDEQNCDGFSLNNCGGKFFTCSDNKTIPRGYVCDENIDCSQGEDET 2285
            C PG   C     C+ ++  CD  N+C D SDE+P+ C  R C     +C+ + + +P+       W+CD   DC +G DE       +  C  + F C++   I + +VCD N DC    DE 
Sbjct: 2815 CAPGLVKCDTTNICIPSSSLCDGHNNCGDNSDENPLFCAGRTCSADEFRCD-SGKCIPQ------FWVCDRISDCLDGTDEPPTCEDHIYTCSPQQFNCANGNCIQQSWVCDGNNDCGDNSDEA 2931          

HSP 12 Score: 59.3066 bits (142), Expect = 2.417e-8
Identity = 40/124 (32.26%), Postives = 54/124 (43.55%), Query Frame = 3
Query: 1926 PPGYRFCQNGECLENAKFCDKINHCADKSDEDPITCRECDPISRKCEINNQILPKKNYFLIHWICDGEEDCGNGYDEQNCDGFSLNNCGGKFFTCSDNKTIPRGYVCDENIDCSQGEDETGCTS 2297
            P G   C N  C+     CD  N C D SDE     R C     +C+ N Q +P        W+CD + DCG+  DE++C+   L  C    F C+    IP    C+   DC    DE+ C +
Sbjct: 3714 PLGDFRCDNHRCVPIRWRCDGSNDCGDGSDERNCEPRPCSESEYRCD-NQQCIPGA------WVCDHDNDCGDNSDERDCE---LRTCRPGTFQCTSGHCIPEALKCNGYADCLDFSDESTCPT 3827          

HSP 13 Score: 55.8398 bits (133), Expect = 2.970e-7
Identity = 41/122 (33.61%), Postives = 51/122 (41.80%), Query Frame = 3
Query: 1944 CQNGECLENAKFCDKINHCADKSDEDPITCRE----CDPISRKCEINNQILPKKNYFLIHWICDGEEDCGNGYDEQNCDGFSLNNCGGKFFTC-----SDNKTIPRGYVCDENIDCSQGEDE 2282
            C +G+C+     CD+I+ C D +DE P TC +    C P    C   N I          W+CDG  DCG+  DE          C    FTC        + IP  YVCD   DC    DE
Sbjct: 2864 CDSGKCIPQFWVCDRISDCLDGTDEPP-TCEDHIYTCSPQQFNCANGNCIQQS-------WVCDGNNDCGDNSDEAQELQCGSRTCNPGDFTCPSWYPGSPRCIPLSYVCDGEKDCVDAADE 2977          

HSP 14 Score: 53.5286 bits (127), Expect = 1.581e-6
Identity = 39/120 (32.50%), Postives = 52/120 (43.33%), Query Frame = 3
Query: 1923 CPPGYRFCQNGECLENAKFCDKINHCADKSDEDPITCRECDPISRKCEINNQILPKKNYFLIHWICDGEEDCGNGYDEQNCDGFSLNNCGGKFFTCSDNKTIPRGYVCDENIDCSQGEDE 2282
            C PG   C +G C+  A  C+    C D SDE   TC    P  R C  +      K      W+CDG  DCG+  DEQ    +++       F C +   I  G +C++  DC  G DE
Sbjct: 3791 CRPGTFQCTSGHCIPEALKCNGYADCLDFSDES--TCPTRYPGGRWCPAHQFQCNNKLCVNQQWVCDGFNDCGDRSDEQLSLCWNITCEMPTKFRCDNGYCIYSGLMCNQKDDCGDGSDE 3908          

HSP 15 Score: 51.9878 bits (123), Expect = 4.247e-6
Identity = 48/179 (26.82%), Postives = 61/179 (34.08%), Query Frame = 3
Query: 1878 LEGRQVSSKIYVSDICPPGYRFCQNGECLENAKFCDKINHCADKSDE----------------------------------------DPITC--RECDPISRKCEINNQILPKKNYFLIHWICDGEEDCGNGYDEQN--CDGFSLNNCGGKFFTCSDNKTIPRGYVCDENIDCSQGEDE 2282
            L+G     ++     C P    C NG C+     CD  N C D SDE                                        D + C  R C P   KC+  N  +P  +      +CDG  +CG+  DE    C G     C    F C   K IP+ +VCD   DC  G DE
Sbjct: 2719 LDGSDELERVCAFHTCSPTEFTCDNGGCVPLYYVCDYTNDCGDNSDEHGCPFPTCNPSTEFTCANGRCISAAYVCDGINDCRDNGTTDEVNCPDRTCAPGLVKCDTTNICIPSSS------LCDGHNNCGDNSDENPLFCAG---RTCSADEFRCDSGKCIPQFWVCDRISDCLDGTDE 2888          

HSP 16 Score: 51.6026 bits (122), Expect = 5.565e-6
Identity = 53/161 (32.92%), Postives = 70/161 (43.48%), Query Frame = 3
Query: 1809 AHKRLTAPGGLSLSDNNMDVFCSLEGRQVSSKIY-VSDICPPGYRFCQNGECLENAKFCDKINHCADKSDEDPITC--RECDPISRKCEINNQILPKKNYFLIHWICDGEEDCGNGYDEQNCDGFSLNNCGGKFFTCSDNKTIPRGYVCDENIDCSQGEDE 2282
            +H  L  PGG        D F  L    +  KI  V+D     +R   N +C+     CD  + C D SDE P TC    C     +C+  N   P   +FL    CDG +DC +G DE +    S + C    F C +   IP  + CD  +DCS G DE
Sbjct: 3470 SHLCLIGPGGTEARCECPDHFIGLA---IGFKIQCVADCSSTQFRCGDNEKCIPIWWKCDGQSDCGDGSDE-PQTCPPHYCKTGQFQCQDGNCTNP---FFL----CDGHKDCFDGSDE-DAALCSDHRCTENQFQCKNKHCIPITWHCDGVVDCSDGSDE 3618          

HSP 17 Score: 51.6026 bits (122), Expect = 6.055e-6
Identity = 38/128 (29.69%), Postives = 51/128 (39.84%), Query Frame = 3
Query: 1923 CPPGYRFCQNGECLENAKFCDKINHCADKSDEDPITCRECDPISRKCEINNQILPKKNYFLIHWICDGEEDCGNGYDEQNCDGFSLNNCGGKFFTCS-DNKTIPRGYVCDENIDCSQGEDETGCTSPQ 2303
            C PG+  C +  C+ N+  CD    C D SDE       C      C   +Q + +       + CDG  DC +  DE  C       C    F C  D   IP+ + CD + DC  G DE     P+
Sbjct: 1144 CQPGFFLCPDHRCIYNSYVCDGDQDCLDGSDEKDCV-YTCGTYEFACASGDQCVSQS------YRCDGVYDCKDHSDESGCPTRRPGLCHDNEFQCQVDGFCIPKEWECDGHPDCVDGSDEHNGCPPR 1264          
BLAST of low density lipoprotein receptor-1 vs. Ensembl Zebrafish
Match: lrp2a (low density lipoprotein receptor-related protein 2a [Source:ZFIN;Acc:ZDB-GENE-050119-2])

HSP 1 Score: 80.4925 bits (197), Expect = 9.594e-15
Identity = 47/128 (36.72%), Postives = 64/128 (50.00%), Query Frame = 3
Query: 1923 CPPGYRFCQNGECLENAKFCDKINHCADKSDEDPITCRECDPISRKCEINNQILPKKNYFLIHWICDGEEDCGNGYDE-QNCDGFSLNNCGGKFFTCSDNKTIPRGYVCDENIDCSQGEDETGCTSPQ 2303
            C  G+  C  G C+  ++ CD  N C+D SDE       C+    +C  + + +P+      HW+CD EEDC +G DE Q+C G     C    FTC++   IP GY CD   DC  G DE  C  P+
Sbjct:    2 CESGFFRCGTGRCIPVSQRCDGTNDCSDNSDEIGCPQPTCESAQFQCLSDGECIPQ------HWVCDDEEDCEDGSDERQHCPG---RTCSSSQFTCTNGACIPGGYRCDRVPDCLDGADERNCFYPE 120          

HSP 2 Score: 80.1073 bits (196), Expect = 1.290e-14
Identity = 72/264 (27.27%), Postives = 111/264 (42.05%), Query Frame = 3
Query: 1521 SFIVLMKAEVSDS--GYYIC---TEPNGQTARSELIVIPDKDKNSLTITPREIRVRAGQRVDIECFSKNTQGRASGNPEFSFTNNKPIGRDGRFKISNVGPAHKRLTAPGGLSLSDNNMDVFCSLEGRQVSSKIYVSDICPPGYRFCQNGECLENAKFCDKINHCADKSDEDPITCRECDPISRKCEINNQILPKKNYFLIH-WICDGEEDCGNGYDEQNCDGFSLNNCGGKFFTCSDNKTIPRGYVCDENIDCSQGEDETGCT 2294
            S I+ +K+  +DS  G+  C   T PNG  +       P  +   +   P  +++ A Q+  ++  S        G+  FS +N K +     ++   V   H            DN+ +  C             ++ C P    C N  C+  +  CD  N C D SDE     R+C   +      +Q +   +Y +   W+CD + DCG+G DE NCD  S+  C    F C D++ I   YVCD + DC+ G DE GC 
Sbjct:  926 SHIMHVKSFNADSQIGFNFCSRQTNPNGDCSH---FCFPAPNSQRVCGCPYGMKLEANQQTCVDDPSNEPPTLQCGSNSFSCSNGKCVPHS--YQCDGVDDCH------------DNSDEAHCGAH----------NNTCSPLAFTCANQRCVPRSWHCDGHNDCFDGSDE-----RDCPTQTPGTCPADQFICANHYCIPRTWLCDTDNDCGDGSDENNCD--SIGTCYPGQFQCPDHRCIDPNYVCDGDRDCADGADEQGCV 1155          

HSP 3 Score: 75.485 bits (184), Expect = 2.739e-13
Identity = 41/120 (34.17%), Postives = 62/120 (51.67%), Query Frame = 3
Query: 1944 CQNGECLENAKFCDKINHCADKSDEDPITCRE--CDPISRKCEINNQILPKKNYFLIHWICDGEEDCGNGYDEQNCDGFSLNNCGGKFFTCSDNKTIPRGYVCDENIDCSQGEDETGCTS 2297
            C NG+C+ ++  CD ++ C D SDE         C P++  C  N + +P+       W CDG  DC +G DE++C   +   C    F C+++  IPR ++CD + DC  G DE  C S
Sbjct: 1004 CSNGKCVPHSYQCDGVDDCHDNSDEAHCGAHNNTCSPLAFTCA-NQRCVPRS------WHCDGHNDCFDGSDERDCPTQTPGTCPADQFICANHYCIPRTWLCDTDNDCGDGSDENNCDS 1116          

HSP 4 Score: 70.0922 bits (170), Expect = 1.201e-11
Identity = 46/129 (35.66%), Postives = 67/129 (51.94%), Query Frame = 3
Query: 1914 SDICPPGYRFCQNGECLENAKFCDKINHCADKSDEDPITCRECDPISRKCEINNQILPKKNYFLIH-W-ICDGEEDCGNGYDEQNCDGFSLNNCGGKFFTCSDNKTIPRGYVCDENIDCSQGEDETGCT 2294
            S  C PG   C+NG C+ N   CD  + C D SDE PI   EC   + +C+ + +   + NY  +  W +C+G  DC +  DEQNC+  +    G   F C +++ IP  + CD + DC  G DE  C+
Sbjct: 3628 SRTCRPGQFKCRNGRCIPNTWKCDVDDDCGDNSDE-PI--EECMGPAYRCDNHTEFDCRTNYRCVPLWAVCNGHNDCRDNSDEQNCEELTCEPSGD--FRCDNHQCIPLRWRCDGDNDCGDGSDELNCS 3751          

HSP 5 Score: 70.0922 bits (170), Expect = 1.286e-11
Identity = 43/120 (35.83%), Postives = 63/120 (52.50%), Query Frame = 3
Query: 1944 CQNGECLENAKFCDKINHCADKSDEDPITCRECDPISRKCEINNQILPKKNYFLIHWICDGEEDCGNGYDEQNCDGFSLNNCGGKFFTCSDNKTIPRGYVCDENIDCSQGEDETGCTSPQ 2303
            C NG C   ++ CD++ +C D SDE   T R C     +C  N + +P+       +ICD ++DCG+  DEQNC   +   C G +FTC   + I + ++CD   DC    DE GC + Q
Sbjct:  126 CANGACFNRSQRCDQVLNCRDGSDEANCTQR-CSSGQFQCS-NGECIPRG------YICDHDDDCGDRSDEQNC---TYPTCRGTYFTCPSGRCIHQVWLCDGEDDCEDNADEKGCDNVQ 234          

HSP 6 Score: 68.9366 bits (167), Expect = 2.969e-11
Identity = 44/121 (36.36%), Postives = 60/121 (49.59%), Query Frame = 3
Query: 1944 CQNGECLENAKFCDKINHCADKSDEDP---ITCRECDPISRKCEINNQILPKKNYFLIHWICDGEEDCGNGYDE-QNCDGFSLNNCGGKFFTCSDNKTIPRGYVCDENIDCSQGEDETGCT 2294
            C +G C+ ++  CD  N C D SDED       R C      C +NN+  P++      W+CDG+ DC + +DE QNC   +  +C    FTC++   I   Y CD   DC    DE GCT
Sbjct: 2910 CDDGRCIASSWICDGDNDCGDMSDEDQRHNCANRTCSAQEFTC-VNNRP-PQRKCIPRDWVCDGDADCSDAFDEHQNC---TRRSCSTNEFTCNNGLCIRSSYRCDRRNDCGDSSDEQGCT 3025          

HSP 7 Score: 68.1662 bits (165), Expect = 4.849e-11
Identity = 45/140 (32.14%), Postives = 60/140 (42.86%), Query Frame = 3
Query: 1878 LEGRQVSSKIYVSDICPPGYRFCQNGECLENAKFCDKINHCADKSDEDPITCRECDPISRKCEINNQILPKKNYFLIHWICDGEEDCGNGYDEQNCDGFSLNNCGGKFFTCSDNKTIPRGYVCDENIDCSQGEDETGCTS 2297
            L  R  S +   +  C  G   C NGEC+     CD  + C D+SDE   T   C      C       P        W+CDGE+DC +  DE+ CD        G++   S    IP  ++CD  + C  GEDET  T+
Sbjct:  142 LNCRDGSDEANCTQRCSSGQFQCSNGECIPRGYICDHDDDCGDRSDEQNCTYPTCRGTYFTC-------PSGRCIHQVWLCDGEDDCEDNADEKGCDNVQRECYPGEWPCPSSGVCIPFDHLCDGTVHCPDGEDETNITA 274          

HSP 8 Score: 68.1662 bits (165), Expect = 5.412e-11
Identity = 48/152 (31.58%), Postives = 69/152 (45.39%), Query Frame = 3
Query: 1851 DNNMDVFCSLEGRQVSSKIYVSDICPPGYRFCQNGECLENAKFCDKINHCADKSDEDPITCRE--CDPISR-KCEINNQILPKKNYFLIHWICDGEEDCGNGYDE--QNCDGFSLNNCGGKFFTCSDNKTIPRGYVCDENIDCSQGEDETGC 2291
            D N D     +     ++   S  CPP    C+N  C++    CD  N C D SDE+   C +  CDP  R +C+ N  I         H +C+  +DCG+G DE  ++C   +   C    + C + + IP  Y CD+  DC    DE GC
Sbjct: 3814 DGNADCLDFTDESSCPTRYPNSTYCPPFLFECKNHVCVQQHWICDGDNDCGDNSDEELHLCLDISCDPPFRFRCDNNRCIYS-------HEVCNSIDDCGDGTDERAEHCVTPTHGPCSADEYKCGNGQCIPLQYACDDYDDCEDQSDELGC 3958          

HSP 9 Score: 67.3958 bits (163), Expect = 9.457e-11
Identity = 45/122 (36.89%), Postives = 58/122 (47.54%), Query Frame = 3
Query: 1944 CQNGECLENAKFCDKINHCADKSDEDPITC----RECDPISRKCEINNQILPKKNYFLIHWICDGEEDCGNGYDEQNCDGFSLNNCGGKFFTCSDN-----KTIPRGYVCDENIDCSQGEDE 2282
            C +G C+    +CD    C D SDE PITC    R C+    +C+    I          WICDG+ DCG+  DE      +   C  + FTC +N     K IPR +VCD + DCS   DE
Sbjct: 2868 CSSGRCIPGHWYCDGGTDCNDGSDE-PITCTSLVRTCNSEQFRCDDGRCIASS-------WICDGDNDCGDMSDEDQRHNCANRTCSAQEFTCVNNRPPQRKCIPRDWVCDGDADCSDAFDE 2981          

HSP 10 Score: 62.7734 bits (151), Expect = 1.983e-9
Identity = 39/117 (33.33%), Postives = 56/117 (47.86%), Query Frame = 3
Query: 1944 CQNGECLENAKFCDKINHCADKSDEDPITCRECDPISRKCEINNQILPKKNYFLIHWICDGEEDCGNGYDE-QNCDGFSLNNCGGKFFTCSDNKTIPRGYVCDENIDCSQGEDETGC 2291
            C NG C+ ++  CD+ N C D SDE   T + C      C+ N + + +       ++CDG+ DCG+  DE  +        C    F C +   +P+  VCD N DCS   DE GC
Sbjct: 2997 CNNGLCIRSSYRCDRRNDCGDSSDEQGCTYQPCQQHQFTCQ-NGRCISRD------FLCDGDNDCGDESDELDHLCRMPAPTCPSGHFRCDNGNCVPQSQVCDRNDDCSDNSDEKGC 3106          

HSP 11 Score: 61.2326 bits (147), Expect = 6.752e-9
Identity = 39/124 (31.45%), Postives = 57/124 (45.97%), Query Frame = 3
Query: 1926 PPGYRFCQNGECLENAKFCDKINHCADKSDEDPITCRECDPISRKCEINNQILPKKNYFLIHWICDGEEDCGNGYDEQNCDGFSLNNCGGKFFTCSDNKTIPRGYVCDENIDCSQGEDETGCTS 2297
            P G   C N +C+     CD  N C D SDE   + R C     +C+ N   +P +      W+CD + DC +  DE++C+   L  C   +F C+    I   + CD N DC    DE+ C +
Sbjct: 3717 PSGDFRCDNHQCIPLRWRCDGDNDCGDGSDELNCSPRPCTESEYRCD-NLHCIPDR------WVCDHDNDCEDNSDERDCE---LRTCHPGYFQCASGHCIAERFKCDGNADCLDFTDESSCPT 3830          

HSP 12 Score: 60.8474 bits (146), Expect = 9.875e-9
Identity = 40/119 (33.61%), Postives = 53/119 (44.54%), Query Frame = 3
Query: 1944 CQNGECLENAKFCDKINHCADKSDEDPITCRECDPISRKCEINNQILPKKNYFLIHWICDGEEDCGNGYDEQNCDGFSLNNCGGKFFTCSDNKTIPRGYVCDENIDCSQGEDETGCTSP 2300
            C NG C+     CD++  C D +DE      EC  +  +C  N     +         CD   +C +G DE NC       C    F CS+ + IPRGY+CD + DC    DE  CT P
Sbjct:   89 CTNGACIPGGYRCDRVPDCLDGADERNCFYPECSEL--RCA-NGACFNRSQR------CDQVLNCRDGSDEANC----TQRCSSGQFQCSNGECIPRGYICDHDDDCGDRSDEQNCTYP 194          

HSP 13 Score: 60.4622 bits (145), Expect = 1.294e-8
Identity = 38/121 (31.40%), Postives = 50/121 (41.32%), Query Frame = 3
Query: 1923 CPPGYRFCQNGE-CLENAKFCDKINHCADKSDEDPITCRECDPISRKCEINNQILPKKNYFLIHWICDGEEDCGNGYDEQNCDGFSLNNCGGKFFTCSDNKTIPRGYVCDENIDCSQGEDE 2282
            C P +  CQ+   C+  +  CD  N C D SDE P  C      +  C  N            HW CDG  DC +G DE       +  C  + F C D + I   ++CD + DC    DE
Sbjct: 2819 CQPEHTKCQSTNICIPRSYLCDGDNDCGDNSDESPTHC-----ATSTCSHNEFRCSSGRCIPGHWYCDGGTDCNDGSDEPITCTSLVRTCNSEQFRCDDGRCIASSWICDGDNDCGDMSDE 2934          

HSP 14 Score: 58.9214 bits (141), Expect = 3.597e-8
Identity = 53/184 (28.80%), Postives = 71/184 (38.59%), Query Frame = 3
Query: 1887 RQVSSKIYVS--DICPPGYRFCQNGECLENAKFCDKINHCADKSDEDPITCRECDP-----------ISR-------------------------------KCEINNQILPKKNYFLIHWICDGEEDCGNGYDEQ--NCDGFSLNNCGGKFFTCSDNKTIPRGYVCDENIDCSQGEDE-TGCTS 2297
            RQ ++ I +S    C P    C NG C+     CD  N C D SDE     R CDP           I+R                               KC+  N  +P+       ++CDG+ DCG+  DE   +C   + + C    F CS  + IP  + CD   DC+ G DE   CTS
Sbjct: 2724 RQAAAFISLSAFHTCEPTVFTCGNGRCVPYHYRCDHYNDCGDNSDETGCIFRPCDPNTEFSCNNGRCIAREYICNGINNCYDNGTSDEQNCPERTCQPEHTKCQSTNICIPRS------YLCDGDNDCGDNSDESPTHC---ATSTCSHNEFRCSSGRCIPGHWYCDGGTDCNDGSDEPITCTS 2898          

HSP 15 Score: 58.5362 bits (140), Expect = 4.083e-8
Identity = 43/121 (35.54%), Postives = 55/121 (45.45%), Query Frame = 3
Query: 1944 CQNGECLENAKFCDKINHCADKSDEDPITC--RECDPISRKCEINNQILPKKNYFLIHWICDGEEDCGNGYDE--QNCDGFSLNNCGGKFFTCSDN-KTIPRGYVCDENIDCSQGEDETGC 2291
            C N  C+  A  CD  N C D SDEDP  C  R C P   KC  N + +P        W CD ++DCG+  DE  + C G +        F C  N + +P   VC+ + DC    DE  C
Sbjct: 3597 CANKRCISEAWQCDGENDCGDGSDEDPAHCSSRTCRPGQFKCR-NGRCIPNT------WKCDVDDDCGDNSDEPIEECMGPAYRCDNHTEFDCRTNYRCVPLWAVCNGHNDCRDNSDEQNC 3710          

HSP 16 Score: 58.5362 bits (140), Expect = 4.958e-8
Identity = 39/120 (32.50%), Postives = 50/120 (41.67%), Query Frame = 3
Query: 1923 CPPGYRFCQNGECLENAKFCDKINHCADKSDEDPITCRECDPISRKCEINNQILPKKNYFLIHWICDGEEDCGNGYDEQNCDGFSLNNCGGKFFTCSDNKTIPRGYVCDENIDCSQGEDE 2282
            C  G   C +G C      C+    C D SDED + C      + +CE +      K      W CDGE DCG+G DE      S   C    F C + + IP  + CD + DC    DE
Sbjct: 3549 CRLGQFQCNDGNCTSPHFLCNSNQDCPDGSDEDTVLC-----ATHQCESHQWQCANKRCISEAWQCDGENDCGDGSDEDPAH-CSSRTCRPGQFKCRNGRCIPNTWKCDVDDDCGDNSDE 3662          

HSP 17 Score: 57.7658 bits (138), Expect = 7.629e-8
Identity = 41/129 (31.78%), Postives = 60/129 (46.51%), Query Frame = 3
Query: 1932 GYRF-CQNG-ECLENAKFCDKINHCADKSDEDPITCRE---CDPISR-KCEINNQILPKKNYFLIHWICDGEEDCGNGYDEQNCDGFSLNNCGGKFFTCSDNKTIPRGYVCDENIDCSQGEDETGCTSP 2300
             Y F C NG +C+ +   CD +  C D+SDE     R    C   S  +C+ +   +P      ++W CDG  DC +G DE +        C    F C +   + RG++CD + DC  G DE  C +P
Sbjct: 1160 AYEFKCANGHQCVNSYYRCDGVFDCNDRSDESGCPTRPPGMCHHESEFQCQSDGSCVP------VNWECDGHPDCEDGSDEHH--ACPPRTCPTTQFRCDNGNCVYRGWICDGDNDCRDGSDERDCPTP 1280          

HSP 18 Score: 56.6102 bits (135), Expect = 1.577e-7
Identity = 45/136 (33.09%), Postives = 60/136 (44.12%), Query Frame = 3
Query: 1923 CPPGYRFCQNGECLENAKFCDKINHCADKSDEDPITCR-----ECDPISRKCEINNQILPKKNYFLI--HWICDGEEDCGNGYDEQNCDGFSLNNCGGKF-FTCSDNKTIPRGYVCDENIDCSQGEDETG--CTSP 2300
            C PGY  C +G C+     CD    C D +DE     R      C P   +C         KN+  +  HWICDG+ DCG+  DE+      + +C   F F C +N+ I    VC+   DC  G DE    C +P
Sbjct: 3794 CHPGYFQCASGHCIAERFKCDGNADCLDFTDESSCPTRYPNSTYCPPFLFEC---------KNHVCVQQHWICDGDNDCGDNSDEELHLCLDI-SCDPPFRFRCDNNRCIYSHEVCNSIDDCGDGTDERAEHCVTP 3919          
BLAST of low density lipoprotein receptor-1 vs. Ensembl Xenopus
Match: sel1l (SEL1L adaptor subunit of ERAD E3 ubiquitin ligase [Source:Xenbase;Acc:XB-GENE-973992])

HSP 1 Score: 124.79 bits (312), Expect = 2.981e-28
Identity = 80/220 (36.36%), Postives = 104/220 (47.27%), Query Frame = 3
Query: 1944 CQNGECLENAKFCDKINHCADKSDEDPITCRECDPISRKCEINNQILPKKNYFLIHWICDGEEDCGNGYDEQNC--DGFSLNNCGGKFFTCSDNKT-IPRGYVCDENIDCSQGEDETGCTSPQIXXXXXXXXXXXXXQLVTLTCEATGKPLPVLVWRFNWGCIQNSTRFSTNFFSTDCNSVTSSLTIKDFKAGDDGIYNCEALSSRQRSFS-NDFQVILK 2591
            C NG+C+     CD    C D SDE  + C    P    CE N          L  W CDG+ DCG+G DE NC   G S + C    F C   +T IP  Y CD+  DC    DE GC  PQ+       ++A++   V  TC A G P P++ WR NWG I  S+R S         +   +L I+D K  D G Y CEA++++   F   D  +ILK
Sbjct:  259 CPNGQCIPRDYLCDGEKDCKDGSDE--MHCGTPSP----CEPNEFKCKNGRCALKLWRCDGDNDCGDGSDELNCPTKGPS-DTCAPDQFVCVQARTCIPASYQCDDEADCPDRSDEVGCNPPQVITPPEESIMASRGDTVRFTCVAIGVPTPIITWRLNWGHIPTSSRVSMT-----SENGHGTLIIRDVKEADQGAYTCEAINAKGMVFGIPDGVLILK 466          

HSP 2 Score: 72.4034 bits (176), Expect = 4.037e-12
Identity = 93/436 (21.33%), Postives = 160/436 (36.70%), Query Frame = 3
Query:  492 IDILPEES-LKIGGQIKRQCSDLGLPQETIVDDFTYTWLNQQN-------KTIGNTNILQIPVVDESVVGRYICQYKSKETSKIYEAATYVNLKQSVSYKIKIITNPA-LFRYGERFSLRCEVEPFYQNIKYTWYKK------DEFIGNDQELVIKSFKKDNVGTYKCVASLQLPSGKLDLMEESIQQFAFFRESKIELTTKPGPQVYVHRGEKKELHCEIETSSGNRGKEAEWYINGKKFKNGDIPLVNRLDGQYVSMLVISDISQINEGNYECRV----GSSIKEVNLIVL---LDEGLIETSPPILKVKEGQSVEFHCRVENIPSVKNVNLKWNFESKEGLVRNNIPDSRWQLMNDEIADQTSFIVLMKAEVSDSGYYICTEPNGQTARSELIVI----------PDKDKNSLTITPREIRVRAGQRVDIECF 1703
            + I P+++ L  GG++  +C   G P       + + W  +         K +G    L    V  +  G YIC  +S ++    +A   V+   S    + +        R G   +  C  +         W ++      D  +  +  L I+  + ++ G Y C  S        D+ E +   +     +          Q+ V RG+  E  C   T++G      EW        NG +     + G    +L    +   +EG Y CRV    G     V+L V    L E  ++ SP   +V+EG +V  +CR    P+     + W    KEG    ++P   +           S + +++A  +DSG YIC   NG   +   I+I          P  +  +L I P    +  GQ +++ C 
Sbjct: 1590 LRIHPQKATLSPGGEVTLRCHVSGNP------PYYFYWTREDGRPIPPSAKAVGEGENLHFSRVQPTDSGVYICTCRSPDSVNTSKAEILVSAAPSKPITVTVEEQRVQTVRPGSDVTFICTAKSKSPAYTLVWTRQHNRKLPDRAMDFNGILTIRRVQPEDAGIYVCTGS-----NMYDMDEGNATLYVQAGTATSPNAAAEPRQLTVQRGQTAEFRC---TATGTPTPAVEW-----TGPNGGLSPRAVVQG---GVLRFHSVEPSDEGQYTCRVHNSAGQHFARVDLRVHSGSLPE--VQVSPERTEVREGDTVRLYCRAGGTPAA---TISWR---KEG---GSLPPQAY----------GSKLRILQASTADSGEYICRVTNGAATQQASIIITITRSSGPQQPSGNVPALRIEPSSDTLVEGQTLELNCL 1982          

HSP 3 Score: 59.3066 bits (142), Expect = 3.528e-8
Identity = 92/432 (21.30%), Postives = 158/432 (36.57%), Query Frame = 3
Query:  510 ESLKIGGQIKRQCSDLGLPQETIVDDFTYTWLNQQNKTIGNTN--ILQIPVVDESVVGRYICQYKSKETSKIYEAATYVNLKQSV----------SYKIKIITNPALFRYGERFSLRCEVEPFYQNIKYTWYKKD--------EFIGNDQELVIKSFKKDNVGTYKCVASLQLPSGKLDLMEESIQQFAFFRESKIELTTKPGPQVYVHRGEKKELHCEIETSSGNRGKEAEWYINGKKFKNGDIPLVNRLDGQYVSMLVISDISQINEGNYECRV----GSSIKEVNLIV---LLDEG--LIETSPPILKVKEGQSVEFHCRVENIPSVKNVNLKWNFESKEGLVRNNIPDSRWQLMNDEIADQTSFIVLMKAEVSDSGYYICTEPNGQTARSELIVIPDKDKNSLTIT-PREIRVRAGQRVDIECFSKNT 1715
            E++++G  I+  C   G P   +    +       N  +  +   ILQ    D  +   YIC+  S   S+  EA+  +N+  S           S  I I  + A  + G+  + +C +    Q I+ TW  +             N   + I      N G+Y+C+AS         ++  S+      R S   ++  P  ++ V  GE   + C      G+      W   G + +N     +  LDG       I      + G+Y C      GS+   V + V   ++  G  L+    P+  V  G      C     P+     + W+       +R  +P   WQ    ++ + T  +++      DSG YIC   N     +E+ V  D +  +   T P E  V  G+ + I+C +  T
Sbjct: 2164 ETVELGQTIELNCLAEGHPGAVVTWHRSGGLPLPSNHQVSGSRMRILQASPADSGI---YICRVSSASGSQ--EASVTINVHSSAQGEPGDARLQSPVISIDPHSATVQRGQNATFKCRIHDGAQPIRVTWQMRHNQPMEDNVHISPNGSIITIVGATHKNQGSYRCMAS-----NAYGMVHSSVNLVVQGRPS---VSVIPHGKIRVKEGEPINVEC---MGIGDPRPIVSWRRTGAR-ENLKQHRLAPLDG------TIPSAKPADSGSYTCVAHNPHGSTQVHVEVHVEGHVISPGAPLVLADKPVHVVVTGGQATLSCSASGNPTP---TITWS------KLRAPLP---WQ---HQVVNNT--LIIPNVAQQDSGQYICNASNAD-GHAEVYVTLDVETPAYATTLPHEASVSPGEPIQIQCLAHGT 2554          

HSP 4 Score: 58.9214 bits (141), Expect = 4.864e-8
Identity = 92/434 (21.20%), Postives = 148/434 (34.10%), Query Frame = 3
Query:  357 NRYLYIKSLLKQDEGIYNCSVEKVKDPQIRFNRTLHLKITIPSISIDILPEESLKIGGQIKRQCSDLGLPQETIVDDFTYTWLNQQNKTIGNTNI----LQIPVVDESVVGRYICQYKSKETSKIYEAATYVNLKQSVSYKIKIITNPALFRYGERFSLRCEVEPFYQNIKYTWYKKDEFIGNDQELVIKSFKKDNVGTYKCVASLQLPSGKLDLMEESIQQFAFFRESKIELTTKPGPQVYVHRGEKKELHCEIETSSGNRGKEAEWYINGKKFKNGDIPLVNRLDGQYVSMLVISDISQINEGNYECRVGSSIKEVNLIVLL---DEGLIETSPPILKVKEGQSVEFHCRVENIPSVKNVNLKWNFESKEGLVRNNIPDSRW-QLMNDEIADQ---TSFIVLMKAEVSDSGYYICTEPNGQ---TARSELIV 1616
            N  L I ++ +QD G Y C+          +   + L +  P+ +  +  E S+  G  I+ QC   G P         + W        G  +I    L I     S  G Y C      ++K+  +  +  +  S             FRY   F +   +       K      D     D  L I   K  + GTY+CV   ++ S K      +  Q +     K+ +  +   Q  V  G   E  C    + G+   +  W   G +     +P    + G     L I  + Q + G Y C   + + EV   V+L       I   P + ++  G +  F C     P                     +PD  W +L  D  +D     + + ++  +  D+G Y+CT  N Q   TA S L V
Sbjct: 2489 NNTLIIPNVAQQDSGQYICNASNADGHAEVY---VTLDVETPAYATTLPHEASVSPGEPIQIQCLAHGTP------PIKFQWSRVDGTLPGQASIQDGVLHIDQASASDSGTYRC----VASNKVGSSEAFAQVTVSGGGAETGTAGSRFFRYC-FFPIIPIIRSGRLGSKVNGSLPDRATVRDSTLHINLAKAADAGTYRCVVGNKVGSSK------TFAQVSVLALPKVRINIRTSVQT-VLAGNSVEFEC---LALGDPRAKVTWSKVGSR-----LPADAVISG---GTLRIEQVKQSDAGQYRCTAANDVGEVQSHVILHVQSVPQIAAQPEMKEITAGSTAVFPCLASGFP---------------------VPDITWSKLEGDLPSDHQIDNNVLTILSVKPEDAGTYVCTAANRQGRVTAFSMLKV 2869          
BLAST of low density lipoprotein receptor-1 vs. Ensembl Xenopus
Match: sel1l (SEL1L adaptor subunit of ERAD E3 ubiquitin ligase [Source:Xenbase;Acc:XB-GENE-973992])

HSP 1 Score: 123.635 bits (309), Expect = 7.300e-28
Identity = 80/222 (36.04%), Postives = 105/222 (47.30%), Query Frame = 3
Query: 1944 CQNGECLENAKFCDKINHCADKSDEDPITCRECDPISRKCEINNQILPKKNYFLIHWICDGEEDCGNGYDEQNCD--GFSLNNCGGKFFTCSDNKT-IPRGYVCDENIDCSQGEDETGCTSPQIXXXXXXXXXXXXXQLVTLTCEATGKPLPVLVWRFNWGCIQNSTRFSTNFFSTDCNSVTSSLTIKDFKAGDDGIYNCEALSSRQRSFS-NDFQVILKNN 2597
            C NG+C+     CD    C D SDE  + C    P    CE N          L  W CDG+ DCG+G DE NC   G S + C    F C   +T IP  Y CD+  DC    DE GC  PQ+       ++A++   V  TC A G P P++ WR NWG I  S+R S         +   +L I+D K  D G Y CEA++++   F   D  +ILK +
Sbjct:  226 CPNGQCIPRDYLCDGEKDCKDGSDE--MHCGTPSP----CEPNEFKCKNGRCALKLWRCDGDNDCGDGSDELNCPTKGPS-DTCAPDQFVCVQARTCIPASYQCDDEADCPDRSDEVGCNPPQVITPPEESIMASRGDTVRFTCVAIGVPTPIITWRLNWGHIPTSSRVSMTS-----ENGHGTLIIRDVKEADQGAYTCEAINAKGMVFGIPDGVLILKPH 435          

HSP 2 Score: 73.9442 bits (180), Expect = 1.154e-12
Identity = 104/461 (22.56%), Postives = 168/461 (36.44%), Query Frame = 3
Query:  492 IDILPEES-LKIGGQIKRQCSDLGLPQETIVDDFTYTWLNQQN-------KTIGNTNILQIPVVDESVVGRYICQYKSKETSKIYEAATYVNLKQSVSYKIKIITNPA-LFRYGERFSLRCEVEPFYQNIKYTWYKK------DEFIGNDQELVIKSFKKDNVGTYKCVASLQLPSGKLDLMEESIQQFAFFRESKIELTTKPGPQVYVHRGEKKELHCEIETSSGNRGKEAEWYINGKKFKNGDIPLVNRLDGQYVSMLVISDISQINEGNYECRV----GSSIKEVNLIVL---LDEGLIETSPPILKVKEGQSVEFHCRVENIPSVKNVNLKWNFESKEGLVRNNIPDSRWQLMNDEIADQTSFIVLMKAEVSDSGYYIC---TEPNGQTARSELIVIPDK-DKNSLTITPREIRVRAGQRVDIECFSKN-----TQGRASGNPEFSFTNNKPIGRDG 1781
            + I P+++ L  GG++  +C   G P       + + W  +         K +G    L    V  +  G YIC  +S ++    +A   V+   S    + +        R G   +  C  +         W ++      D  +  +  L I+  + ++ G Y C  S        D+ E +   +     +          Q+ V RG+  E  C   T++G      EW        NG +     + G    +L    +   +EG Y CRV    G     V+L V    L E  ++ SP   +V+EG +V  +CR    P+     + W    KEG    ++P        D      S +V+     +D G Y+C   +      AR E+IVI       +L I P    V  GQ V++ C S N     T  R  G P    + N  +G  G
Sbjct: 1540 LRIHPQKATLSPGGEVTLRCHVSGNP------PYYFYWTREDGRPIPPSAKAVGEGENLHFSRVQPTDSGVYICTCRSPDSVNTSKAEILVSAAPSKPITVTVEEQRVQTVRPGSDVTFICTAKSKSPAYTLVWTRQHNRKLPDRAMDFNGILTIRRVQPEDAGIYVCTGS-----NMYDMDEGNATLYVQAGTATSPNAAAEPRQLTVQRGQTAEFRC---TATGTPTPAVEW-----TGPNGGLSPRAVVQG---GVLRFHSVEPSDEGQYTCRVHNSAGQHFARVDLRVHSGSLPE--VQVSPERTEVREGDTVRLYCRAGGTPA---ATISWR---KEG---GSLPPQARTERTD-----ISTLVIPSISAADGGTYLCVGTSSAGSAQARIEVIVIGAPIHGPTLRIEPSSDTVIEGQLVELNCVSANPYATVTWHRGGGRP---LSPNHQVGAYG 1959          

HSP 3 Score: 68.9366 bits (167), Expect = 3.851e-11
Identity = 100/492 (20.33%), Postives = 169/492 (34.35%), Query Frame = 3
Query:  321 RWLDKDGKVAAANRYLYIKSLLKQDEGIYNCSVEKVKDPQIRFNRTLHLKITIPSISIDILPEE----SLKIGGQIKRQCSDLGLPQETIVDDFTYTWLNQQNKTIGN-----TNILQIPVVDESVVGRYICQYKSKETSKIYEAATYVNLKQSVSYKIKIITNPALFRYGERFSLRCEVEPFYQNIKYTWYKKDEFIGNDQELVIKSFKKDNVGTYKCVASLQLPSGKLDLMEESIQQFAFFRESKIELTTKPGPQVYVHRGEKKE-----LHCEIETSSGNRGKEAEWYINGKKFKNGDIPLVNRLDGQYVSMLVISDISQINEGNYEC----RVGSSIKEVNLIVL---LDEGLIETSPPILKVKEGQSVEFHCRVENIPSVKNVNLKWNFESKEGLVRNNIPDSRWQLMNDEIADQTSFIVLMKAEVSDSGYYICTEPNGQTARSELIVI----------PDKDKNSLTITPREIRVRAGQRVDIECF 1703
            R +    K       L+   +   D G+Y C+        +  ++   L    PS  I +  EE    +++ G  +   C+      ++    +T  W  Q N+ + +       IL I  V     G Y+C   +        A  YV    + S            + G+    RC           T     E+ G +  L  ++  +  V  +  V           +   + Q FA   + ++   + P  QV   R E +E     L+C    + G       W   G     G +P   R +   +S LVI  IS  + G Y C      GS+   + +IV+   +    +   P    V EGQ VE +C   N        + W+      L  N+           ++    S + +++A  +DSG YIC   NG   +   I+I          P  +  +L I P    +  GQ +++ C 
Sbjct: 1577 RPIPPSAKAVGEGENLHFSRVQPTDSGVYICTCRSPDS--VNTSKAEILVSAAPSKPITVTVEEQRVQTVRPGSDVTFICT-----AKSKSPAYTLVWTRQHNRKLPDRAMDFNGILTIRRVQPEDAGIYVCTGSNMYDMDEGNATLYVQAGTATSPNAAAEPRQLTVQRGQTAEFRC-------TATGTPTPAVEWTGPNGGLSPRAVVQGGVLRFHSVEPSDEGQYTCRVHNSAGQHFARV-DLRVHSGSLPEVQVSPERTEVREGDTVRLYCR---AGGTPAATISWRKEG-----GSLPPQARTERTDISTLVIPSISAADGGTYLCVGTSSAGSAQARIEVIVIGAPIHGPTLRIEPSSDTVIEGQLVELNCVSAN----PYATVTWHRGGGRPLSPNH-----------QVGAYGSKLRILQASTADSGEYICRVTNGAATQQASIIITITRSSGPQQPSGNVPALRIEPSSDTLVEGQTLELNCL 2030          
BLAST of low density lipoprotein receptor-1 vs. Ensembl Xenopus
Match: sel1l (SEL1L adaptor subunit of ERAD E3 ubiquitin ligase [Source:Xenbase;Acc:XB-GENE-973992])

HSP 1 Score: 121.324 bits (303), Expect = 4.071e-27
Identity = 81/220 (36.82%), Postives = 103/220 (46.82%), Query Frame = 3
Query: 1944 CQNGECLENAKFCDKINHCADKSDEDPITCRECDPISRKCEINNQILPKKNYFLIHWICDGEEDCGNGYDEQNC--DGFSLNNCGGKFFTCSDNKT-IPRGYVCDENIDCSQGEDETGCTSPQIXXXXXXXXXXXXXQLVTLTCEATGKPLPVLVWRFNWGCIQNSTRFSTNFFSTDCNSVTSSLTIKDFKAGDDGIYNCEALSSRQRSFS-NDFQVILK 2591
            C NG+C+     CD    C D SDE  + C    P    CE N          L  W CDG+ DCG+G DE NC   G S + C    F C   +T IP  Y CD+  DC    DE GC  PQ+       ++A++   V  TC A G P P++ WR NWG I  S+  S N   T        L I+D K  D G Y CEA++++   F   D  +ILK
Sbjct:  202 CPNGQCIPRDYLCDGEKDCKDGSDE--MHCGTPSP----CEPNEFKCKNGRCALKLWRCDGDNDCGDGSDELNCPTKGPS-DTCAPDQFVCVQARTCIPASYQCDDEADCPDRSDEVGCNPPQVITPPEESIMASRGDTVRFTCVAIGVPTPIITWRLNWGHIPTSS--SENGHGT--------LIIRDVKEADQGAYTCEAINAKGMVFGIPDGVLILK 404          

HSP 2 Score: 71.633 bits (174), Expect = 6.880e-12
Identity = 111/513 (21.64%), Postives = 187/513 (36.45%), Query Frame = 3
Query:  492 IDILPEES-LKIGGQIKRQCSDLGLPQETIVDDFTYTWLNQQN-------KTIGNTNILQIPVVDESVVGRYICQYKSKETSKIYEAATYVNLKQSVSYKIKIITNPA-LFRYGERFSLRCEVEPFYQNIKYTWYKK------DEFIGNDQELVIKSFKKDNVGTYKCVASLQLPSGKLDLMEESIQQFAFFRESKIELTTKPGPQVYVHRGEKKELHCEIETSSGNRGKEAEWYINGKKFKNGDIPLVNRLDGQYVSMLVISDISQINEGNYECRV----GSSIKEVNLIVL---LDEGLIETSPPILKVKEGQSVEFHCRVENIPSVKNVNLKWNFESKEGLVRNNIPDSRWQLMNDEIADQTSFIVLMKAEVSDSGYYIC---TEPNGQTARSELIVIPDKDKNSLTITPREIRVRA-------GQRVDIECFSKNTQGRASGNPEFSFTNNKPIGR---------DGRFKISNVGPAHK-----RLTAPGGLSLSDNNMDVFCSLEGRQ 1892
            + I P+++ L  GG++  +C   G P       + + W  +         K +G    L    V  +  G YIC  +S ++    +A   V+   S    + +        R G   +  C  +         W ++      D  +  +  L I+  + ++ G Y C  S        D+ E +   +     +          Q+ V RG+  E  C   T++G      EW         G I L+  + G    +L    +   +EG Y CRV    G     V+L V    L E  ++ SP   +V+EG +V  +CR    P+     + W    KEG  R +I                S +V+     +D G Y+C   +      AR E+IVI  +  NSL   P  +R+         GQ +++ C         +G P+   T ++  GR           R +I    PA       R+++  G   +   ++V  S +G Q
Sbjct: 1495 VRIHPQKATLSPGGEVTLRCHVSGNP------PYYFYWTREDGRPIPPSAKAVGEGENLHFSRVQPTDSGVYICTCRSPDSVNTSKAEILVSAAPSKPITVTVEEQRVQTVRPGSDVTFICTAKSKSPAYTLVWTRQHNRKLPDRAMDFNGILTIRRVQPEDAGIYVCTGS-----NMYDMDEGNATLYVQAGTATSPNAAAEPRQLTVQRGQTAEFRC---TATGTPTPAVEW-------TGGSIGLIAVVQG---GVLRFHSVEPSDEGQYTCRVHNSAGQHFARVDLRVHSGSLPE--VQVSPERTEVREGDTVRLYCRAGGTPA---ATISWR---KEGGKRTDI----------------STLVIPSISAADGGTYLCVGTSSAGSAQARIEVIVIGGR-SNSLGNGP-AVRIETSSGSVVEGQTLELNCV-------VAGQPDAVVTWHR-AGRLLSPNHQVSGSRMRILQASPADSGIYICRVSSASGSQEASVTINVHSSAQGLQ 1949          

HSP 3 Score: 68.9366 bits (167), Expect = 4.466e-11
Identity = 99/463 (21.38%), Postives = 168/463 (36.29%), Query Frame = 3
Query:  366 LYIKSLLKQDEGIYNCSVEKVK-DPQIRFNRTLHLKITIPSISIDILPEESLKI---GGQIKRQCSDLGLPQETIVDDFTYTWLNQQNKTIGNTNILQIPVVDESVVGRYICQYKSKETSKIYEAATYVNLKQSVSYKIKIITNPALFRYGERFSLRCEVEPFYQNIKYTWYK-----KDEFIGNDQELVIKSFKKDNVGTYKCVASLQLPSGKLDLMEESIQQFAFFRESKIELTTKPGPQVYVHRGEKKELHCEIETSSGNRGKEAEWYINGKKFKNGDIPLVNRLDGQYVSMLVISDISQINEGNYECRV----GSSIKEVNLIV-LLDEGLIETSPPILKVKEGQSVEFHCRVENIPSVKNVNLKWNFESKEGLVRNNIPDSRWQLMNDEIADQTSFIVLMKAEVSDSGYYICTEPNGQTARSELIVIPDKDKNSLTITPREIRVRAGQRVDIECFSKN 1712
            L I S   +D G Y C+ +      Q++    +  ++  P +   +  E+ L +   G +    C+ +G P   I        L  Q++ + +T I+    + +S  G+YIC   + E      +  +V L          + +      GE   ++C        +K+ W K      D     D  L I   K  + GTY+CV   ++ S K       +  FA      I+     G           E  C   T  G+     +W   G     G +P  +++ G    +L I ++   NEG Y CRV    G + + V L++  L +  I     +  V  G SVEF C     P  K   + W   SK G           +L  D +    + + + + + SD+G Y CT  N        +++  +    +   P    + AG      C +  
Sbjct: 2097 LQILSARPEDSGSYTCTAQNPSGSTQVQVEVHVEGRVITPGVP-KVTAEQPLHVVVAGDRASLSCTAVGNPAPKITWSKLRAPLPWQHEIVNDTLIIPKAALQDS--GQYICNASNAEG----YSEVFVTLDVETPPYATTLPDEVSVSVGEVIQIQCLAH-GTSPLKFQWSKVNGSLPDRATVRDSTLHINLAKAADAGTYRCVVGNKVGSSKTFAQVSVLAPFAVRVSPLIDTKAVSG---------TAEFTC---TVVGDPRARIQWSKEG-----GQLPAGHQVQG---GVLRIPNLESGNEGTYTCRVSSRFGQAQESVRLVLQALPKVRINIRTSVQTVLAGNSVEFECLALGDPRAK---VTW---SKVG----------SRLPADAVISGGT-LRIEQVKQSDAGQYRCTAANDVGEVQSHVILHVQSVPQIAAQPEMKEITAGSTAVFPCLASG 2514          

HSP 4 Score: 64.3142 bits (155), Expect = 1.131e-9
Identity = 113/497 (22.74%), Postives = 189/497 (38.03%), Query Frame = 3
Query:  312 TSIRWLDKDGKVAAANRYLYIKSLLKQDEGIYNC-SVEKVKDPQIRF------NRTLHLKITIPSISIDILPEESLKIGGQIKRQCSDLGLPQETIVDDFTYTWLNQQNKTIGN-TNILQIPVVDESVVGRYICQYKSKETSKIYEAATYVNLKQSV----SYKIKIITNPALFRYGERFSLRCEVEPFYQNIKYTWYKKDEFIG-------NDQELVIKSFKKDNVGTYKCVASLQLPSGKLDLMEESIQQFAFFRESKIELTTKPGPQVYVHRGEKKELHCEIETSSGNRGKEAEWYINGKKFKNGDIPLVNRLDGQYVSMLVISDISQINEGNYECRV----GSSIKEVNLIV---LLDEGL--IETSPPILKVKEGQSVEFHCRVENIPSVKNVNLKWNFESKEGLVRNNIPDSRWQLMNDEIADQTSFIVLMKAEVSDSGYYICTEPNGQTARSELIVIPDKDKNSLTIT-PREIRVRAGQRVDIECFSKNT 1715
             +I W  + GK    +  L I S+   D G Y C         Q R        R+  L    P++ I+     S+  G  ++  C   G P   +        L+  ++  G+   ILQ    D  +   YIC+  S   S+  EA+  +N+  S     S  I I  + A  + G+  + +C +    Q I+        F         N   + I      N G+Y+C+AS         ++  S+       + K  ++  P  ++ V  GE   + C      G+      W   G + +N     +  LDG   ++L I      + G+Y C      GS+  +V + V   ++  G+  +    P+  V  G      C     P+ K   + W+       +R  +P   WQ    EI + T  +++ KA + DSG YIC   N +   SE+ V  D +      T P E+ V  G+ + I+C +  T
Sbjct: 1797 ATISWRKEGGKRTDIST-LVIPSISAADGGTYLCVGTSSAGSAQARIEVIVIGGRSNSLG-NGPAVRIET-SSGSVVEGQTLELNCVVAGQPDAVVTWHRAGRLLSPNHQVSGSRMRILQASPADSGI---YICRVSSASGSQ--EASVTINVHSSAQGLQSPVISIDPHSATVQRGQNATFKCRIHDGAQPIRAALTPLSLFPTDNVHISPNGSIITIVGATHKNQGSYRCMAS-----NAYGMVHSSVN---LVVQGKC-VSVIPHGKIRVKEGEPINVEC---MGIGDPRPIVSWRRTGAR-ENLKQHRLAPLDG--TAVLQILSARPEDSGSYTCTAQNPSGSTQVQVEVHVEGRVITPGVPKVTAEQPLHVVVAGDRASLSCTAVGNPAPK---ITWS------KLRAPLP---WQ---HEIVNDT--LIIPKAALQDSGQYICNASNAE-GYSEVFVTLDVETPPYATTLPDEVSVSVGEVIQIQCLAHGT 2252          
BLAST of low density lipoprotein receptor-1 vs. Ensembl Xenopus
Match: rabggtb (Rab geranylgeranyltransferase subunit beta [Source:Xenbase;Acc:XB-GENE-953600])

HSP 1 Score: 77.411 bits (189), Expect = 1.097e-13
Identity = 69/243 (28.40%), Postives = 97/243 (39.92%), Query Frame = 3
Query: 1575 TEPNGQTARSELIVIPDKDKNSLTITPREIRVRAGQRVDIECFSKNTQGRASGNPEFSFTNNKPIGRDGRFKISNVGPAHKRLTAPGGLSLSDNNMDVFCSLEGRQVSSKIYVSDICPPGYRFCQNGECLENAKFCDKINHCADKSDEDPITC---RECDPISRKCEINNQILPKKNYFLIHWICDGEEDCGNGYDEQNCDGFSLNNCGGKFFTCSDNKTIPRGYVCDENIDCSQGEDETGCT 2294
            T PNG  +       P  +   +   P  +R+R  Q+   +  +        G+  F   N K +            P + R    G     DN+ +  C       SS+ +           C NG+C+     CD  N C D+SDE        R C   S  C+ NN+ +P+       W+CD + DCG+G DE NC     N C    F C D++ I   YVCD + DC  G DE GCT
Sbjct:  958 TNPNGDCSH---FCYPVPNLQRVCGCPYGMRLRPDQQTCFDDPASEPPTMQCGSYSFPCANGKCV------------PVYDRCD--GVDDCHDNSDEANCGTRNNTCSSRAFT----------CGNGQCIPLNWRCDSHNDCVDRSDEQNCPTQGPRSCSSTSFTCQ-NNRCIPRI------WLCDTDNDCGDGSDELNCS----NTCEPGQFQCPDHRCIDPSYVCDGDKDCVDGSDEMGCT 1162          

HSP 2 Score: 70.0922 bits (170), Expect = 1.712e-11
Identity = 43/124 (34.68%), Postives = 60/124 (48.39%), Query Frame = 3
Query: 1944 CQNGECLENAKFCDKINHCADKSDEDP----ITCRECDPISRKCEINNQILPKKNYFLIHWICDGEEDCGNGYDE-QNCDGFSLNNCGGKFFTCSDNKTIPRGYVCDENIDCSQGEDETGCTSP 2300
            C +  C+  +  CD  N C D SDED     +  + C P    C INN+  P++      W+CDG+ DC + YDE QNC   +  +C    F C++   +   + CD   DC  G DE GC  P
Sbjct: 2890 CDDARCIPASWICDGDNDCGDMSDEDQRHNYLCLQSCAPTEFTC-INNR-PPERRCIPQSWVCDGDADCSDAYDEHQNC---TRRSCSSSEFACANGLCVRSNFRCDRRNDCGDGSDERGCIYP 3008          

HSP 3 Score: 63.1586 bits (152), Expect = 2.366e-9
Identity = 48/126 (38.10%), Postives = 58/126 (46.03%), Query Frame = 3
Query: 1923 CPPGYRFCQNGECLENAKFCDKINHCADKSDEDPITCRECDPISRKCEINNQILPKKNYFLIHWICDGEEDCGNGYDEQNCDGFSLNNCGGKFFTCSDNKTIPRGYVCDENIDCSQGEDETGCTSP 2300
            C  G   C NG C+  +  CD    C D SDE     R C     +C   + I          W+CD EEDC +G DEQ+C G     C  + FTCS  + IPR Y CD   DC+ G DE  C  P
Sbjct:   13 CSSGSFRCSNGRCIPLSWRCDGTADCTDNSDEAGCPPRTCSTSQFRCGDGDCITSS-------WVCDDEEDCDDGSDEQHCPG---RTCSAQQFTCSSGQCIPRAYRCDRMKDCTDGADERNCLYP 128          

HSP 4 Score: 62.3882 bits (150), Expect = 4.274e-9
Identity = 42/126 (33.33%), Postives = 66/126 (52.38%), Query Frame = 3
Query: 1923 CPPGYRFCQNGECLENAKFCDKINHCADKSDEDPITCRECDPISRKCEINNQILPKKNYFLI-HW-ICDGEEDCGNGYDEQNCDGFSLNNCGGKFFTCSDNKTIPRGYVCDENIDCSQGEDETGCT 2294
            C PG   C NG C+  +  CD  + C D SDE P   +EC   + +C+ +     + NY  +  W +C+G +DC +  DEQ C+  + +  G   F C +++ IP  + CD + DC+ G DE  C+
Sbjct: 3613 CNPGQFRCNNGRCIPQSWKCDVDDDCGDHSDE-PF--QECMGPAYRCDNHTDFDCRTNYRCVPMWSVCNGYDDCRDNSDEQGCEQRTCDPRGD--FRCDNHRCIPLRWKCDGDNDCNDGSDERNCS 3733          

HSP 5 Score: 61.2326 bits (147), Expect = 9.379e-9
Identity = 38/121 (31.40%), Postives = 50/121 (41.32%), Query Frame = 3
Query: 1923 CPPGYRFCQNGE-CLENAKFCDKINHCADKSDEDPITCRECDPISRKCEINNQILPKKNYFLIHWICDGEEDCGNGYDEQNCDGFSLNNCGGKFFTCSDNKTIPRGYVCDENIDCSQGEDE 2282
            C PGY  C++   C+     CD  N C D SDE P  C     ++  C  +            HW CD   DC +G DE       +  C    F C D + IP  ++CD + DC    DE
Sbjct: 2799 CQPGYTKCRSTNICIPRTYLCDGDNDCGDMSDESPTHC-----VTLTCTESEFRCSSGRCIPGHWYCDQGVDCSDGSDEPPTCVAHVRTCSSDQFRCDDARCIPASWICDGDNDCGDMSDE 2914          

HSP 6 Score: 60.8474 bits (146), Expect = 1.395e-8
Identity = 39/115 (33.91%), Postives = 56/115 (48.70%), Query Frame = 3
Query: 1950 NGECLENAKFCDKINHCADKSDEDPITCRECDPISR-KCEINNQILPKKNYFLIHWICDGEEDCGNGYDEQNCDGFSLNNCGGKFFTCSDNKTIPRGYVCDENIDCSQGEDETGC 2291
            N  C+     C+  + C D SDE     R CDP    +C+ N++ +P      + W CDG+ DC +G DE+NC   S   C    F C + + IP  ++CD + DC    DE  C
Sbjct: 3667 NYRCVPMWSVCNGYDDCRDNSDEQGCEQRTCDPRGDFRCD-NHRCIP------LRWKCDGDNDCNDGSDERNC---SPRECTESEFRCDNLRCIPGRWICDHDNDCEDNSDERDC 3771          

HSP 7 Score: 59.6918 bits (143), Expect = 3.193e-8
Identity = 49/176 (27.84%), Postives = 64/176 (36.36%), Query Frame = 3
Query: 1881 EGRQVSSKIYVSDICPPGYRFCQNGECLENAKFCDKINHCADKSDEDPITCRECDP-----------ISR-------------------------------KCEINNQILPKKNYFLIHWICDGEEDCGNGYDEQNCDGFSLNNCGGKFFTCSDNKTIPRGYVCDENIDCSQGEDE 2282
            +G     ++     CP     C NG C+     CD  N C D SDE     R CDP           ISR                               KC   N  +P+       ++CDG+ DCG+  DE      +L  C    F CS  + IP  + CD+ +DCS G DE
Sbjct: 2704 DGSDELERVCAFHTCPSTSFTCGNGRCVPYHYRCDHYNDCGDNSDELGCLFRTCDPNTEFTCNNGRCISRAYVCNGVNNCFDNGTSDERNCPDRTCQPGYTKCRSTNICIPRT------YLCDGDNDCGDMSDESPTHCVTL-TCTESEFRCSSGRCIPGHWYCDQGVDCSDGSDE 2872          

HSP 8 Score: 58.9214 bits (141), Expect = 4.710e-8
Identity = 40/122 (32.79%), Postives = 57/122 (46.72%), Query Frame = 3
Query: 1923 CPPGYRFCQNGECLENAKFCDKINHCADKSDEDPITC--RECDPISRKCEINNQILPKKNYFLIHWICDGEEDCGNGYDEQNCDGFSLNNCGGKFFTCSDNKTIPRGYVCDENIDCSQGEDE 2282
            C  G   C +G C  +   C+    C D SDED I C   +CD    +C  N + +P+       W CD E+DCG+  DE +    S   C    F C++ + IP+ + CD + DC    DE
Sbjct: 3531 CRVGQFQCNDGNCTSSYFMCNSYPDCPDGSDEDQILCANHQCDTHQWQCA-NKRCIPES------WQCDQEDDCGDNSDEDSAH-CSTRTCNPGQFRCNNGRCIPQSWKCDVDDDCGDHSDE 3644          

HSP 9 Score: 58.5362 bits (140), Expect = 5.672e-8
Identity = 42/120 (35.00%), Postives = 56/120 (46.67%), Query Frame = 3
Query: 1944 CQNGECLENAKFCDKINHCADKSDEDPITCRE-CDPISRKCEINNQILPKKNYFLIHWICDGEEDCGNGYDEQNCDGFSLNNCGGKFFTC-SDNKTIPRGYVCDENIDCSQGEDETGCTS 2297
            CQN  C+     CD  N C D SDE  + C   C+P   +C  +  I P        ++CDG++DC +G DE  C      NC    F C S ++ I  GY CD   DC+   DE  C +
Sbjct: 1096 CQNNRCIPRIWLCDTDNDCGDGSDE--LNCSNTCEPGQFQCPDHRCIDPS-------YVCDGDKDCVDGSDEMGC----TYNCSYSEFKCASGDQCISTGYQCDGVFDCNDHSDELNCPT 1202          

HSP 10 Score: 58.5362 bits (140), Expect = 5.672e-8
Identity = 46/126 (36.51%), Postives = 60/126 (47.62%), Query Frame = 3
Query: 1923 CPPGYRFCQNGECLENAKFCDKINHCADKSDEDPITCRECDPISRKCEINNQILPKKNYFLI--HWICDGEEDCGNGYDE--QNCDGFSLNNCGGKF-FTCSDNKTIPRGYVCDENIDCSQGEDET 2285
            C PGY  C +G C+     CD    C D SDE     R   P    C  +  +   KN+  I  +W CDG+ DCG+G DE  Q+ D      C   F F C +N+ + R  +C+   DCS G DET
Sbjct: 3776 CHPGYFQCNSGHCIAERFRCDGTADCLDVSDEAACPTRY--PNGTYCPAS--MFECKNHVCIQPYWRCDGDNDCGDGSDEELQHLD----IPCEPPFRFRCGNNRCVYRHEICNGVDDCSDGSDET 3893          

HSP 11 Score: 57.7658 bits (138), Expect = 1.069e-7
Identity = 39/124 (31.45%), Postives = 56/124 (45.16%), Query Frame = 3
Query: 1926 PPGYRFCQNGECLENAKFCDKINHCADKSDEDPITCRECDPISRKCEINNQILPKKNYFLIHWICDGEEDCGNGYDEQNCDGFSLNNCGGKFFTCSDNKTIPRGYVCDENIDCSQGEDETGCTS 2297
            P G   C N  C+     CD  N C D SDE   + REC     +C+ N + +P +      WICD + DC +  DE++C+   +  C   +F C+    I   + CD   DC    DE  C +
Sbjct: 3699 PRGDFRCDNHRCIPLRWKCDGDNDCNDGSDERNCSPRECTESEFRCD-NLRCIPGR------WICDHDNDCEDNSDERDCE---IRTCHPGYFQCNSGHCIAERFRCDGTADCLDVSDEAACPT 3812          

HSP 12 Score: 56.6102 bits (135), Expect = 2.551e-7
Identity = 42/129 (32.56%), Postives = 61/129 (47.29%), Query Frame = 3
Query: 1923 CPPGYRFCQNGECLENAKFCDKINHCADKSDED----PITCRECDPISRKCEINNQILPKKNYFLIHWICDGEEDCGNGYDE--QNCDGFSLNNCGGKFFTCSDNKTIPRGYVCDENIDCSQGEDETGC 2291
            CP     C+N  C++    CD  N C D SDE+     I C    P   +C  NN+ + +      H IC+G +DC +G DE  + C   +   C  + + C ++  +P  YVCD+  DC    DE GC
Sbjct: 3820 CPASMFECKNHVCIQPYWRCDGDNDCGDGSDEELQHLDIPCEP--PFRFRCG-NNRCVYR------HEICNGVDDCSDGSDETEEQCRPPTPRPCTDEEYKCGNHFCVPLHYVCDDYDDCGDHSDEAGC 3939          

HSP 13 Score: 55.4546 bits (132), Expect = 6.089e-7
Identity = 40/123 (32.52%), Postives = 53/123 (43.09%), Query Frame = 3
Query: 1944 CQNGECLENAKFCDKINHCADKSDED----PITCRECDPISRKCEINNQILPKKNYFLIHWICDGEEDCGNGYDEQNCDGFSLNNCGGKFFTCSDNKTIPRGYVCDENIDCSQGEDETGCTSP 2300
            C +G+C+  A  CD++  C D +DE     P+ C E    S  C   +Q             CDG  DC +  DE NC       C    F C   + IPR ++CD + DC    DE  CT P
Sbjct:   98 CSSGQCIPRAYRCDRMKDCTDGADERNCLYPV-CTELSCGSGACYNRSQR------------CDGIVDCRDSSDESNC----TQRCLSSQFQCPSGECIPRDFLCDHDDDCGDESDEKNCTYP 203          

HSP 14 Score: 52.7582 bits (125), Expect = 3.587e-6
Identity = 37/123 (30.08%), Postives = 54/123 (43.90%), Query Frame = 3
Query: 1944 CQNG-ECLENAKFCDKINHCADKSDEDPITCRE---CDPISRKCEINNQILPKKNYFLIHWICDGEEDCGNGYDEQNCDGFSLNNCGGKFFTCSDNKTIPRGYVCDENIDCSQGEDETGCTSP 2300
            C +G +C+     CD +  C D SDE     R    C     +C+ +   +P       +W CDG  DC +G DE N     + +C    F C +   I R ++CD + DC    DE  C +P
Sbjct: 1172 CASGDQCISTGYQCDGVFDCNDHSDELNCPTRPAGMCHQNEFQCQSDGACIPS------NWECDGHPDCIDGSDEHN--TCPVRSCPPSMFRCDNGNCIYRSWICDGDNDCRDMSDEKDCPTP 1286          
BLAST of low density lipoprotein receptor-1 vs. Ensembl Xenopus
Match: rabggtb (Rab geranylgeranyltransferase subunit beta [Source:Xenbase;Acc:XB-GENE-953600])

HSP 1 Score: 77.411 bits (189), Expect = 1.153e-13
Identity = 69/243 (28.40%), Postives = 97/243 (39.92%), Query Frame = 3
Query: 1575 TEPNGQTARSELIVIPDKDKNSLTITPREIRVRAGQRVDIECFSKNTQGRASGNPEFSFTNNKPIGRDGRFKISNVGPAHKRLTAPGGLSLSDNNMDVFCSLEGRQVSSKIYVSDICPPGYRFCQNGECLENAKFCDKINHCADKSDEDPITC---RECDPISRKCEINNQILPKKNYFLIHWICDGEEDCGNGYDEQNCDGFSLNNCGGKFFTCSDNKTIPRGYVCDENIDCSQGEDETGCT 2294
            T PNG  +       P  +   +   P  +R+R  Q+   +  +        G+  F   N K +            P + R    G     DN+ +  C       SS+ +           C NG+C+     CD  N C D+SDE        R C   S  C+ NN+ +P+       W+CD + DCG+G DE NC     N C    F C D++ I   YVCD + DC  G DE GCT
Sbjct:  958 TNPNGDCSH---FCYPVPNLQRVCGCPYGMRLRPDQQTCFDDPASEPPTMQCGSYSFPCANGKCV------------PVYDRCD--GVDDCHDNSDEANCGTRNNTCSSRAFT----------CGNGQCIPLNWRCDSHNDCVDRSDEQNCPTQGPRSCSSTSFTCQ-NNRCIPRI------WLCDTDNDCGDGSDELNCS----NTCEPGQFQCPDHRCIDPSYVCDGDKDCVDGSDEMGCT 1162          

HSP 2 Score: 63.1586 bits (152), Expect = 2.325e-9
Identity = 48/126 (38.10%), Postives = 58/126 (46.03%), Query Frame = 3
Query: 1923 CPPGYRFCQNGECLENAKFCDKINHCADKSDEDPITCRECDPISRKCEINNQILPKKNYFLIHWICDGEEDCGNGYDEQNCDGFSLNNCGGKFFTCSDNKTIPRGYVCDENIDCSQGEDETGCTSP 2300
            C  G   C NG C+  +  CD    C D SDE     R C     +C   + I          W+CD EEDC +G DEQ+C G     C  + FTCS  + IPR Y CD   DC+ G DE  C  P
Sbjct:   13 CSSGSFRCSNGRCIPLSWRCDGTADCTDNSDEAGCPPRTCSTSQFRCGDGDCITSS-------WVCDDEEDCDDGSDEQHCPG---RTCSAQQFTCSSGQCIPRAYRCDRMKDCTDGADERNCLYP 128          

HSP 3 Score: 62.3882 bits (150), Expect = 4.419e-9
Identity = 42/126 (33.33%), Postives = 66/126 (52.38%), Query Frame = 3
Query: 1923 CPPGYRFCQNGECLENAKFCDKINHCADKSDEDPITCRECDPISRKCEINNQILPKKNYFLI-HW-ICDGEEDCGNGYDEQNCDGFSLNNCGGKFFTCSDNKTIPRGYVCDENIDCSQGEDETGCT 2294
            C PG   C NG C+  +  CD  + C D SDE P   +EC   + +C+ +     + NY  +  W +C+G +DC +  DEQ C+  + +  G   F C +++ IP  + CD + DC+ G DE  C+
Sbjct: 3562 CNPGQFRCNNGRCIPQSWKCDVDDDCGDHSDE-PF--QECMGPAYRCDNHTDFDCRTNYRCVPMWSVCNGYDDCRDNSDEQGCEQRTCDPRGD--FRCDNHRCIPLRWKCDGDNDCNDGSDERNCS 3682          

HSP 4 Score: 61.2326 bits (147), Expect = 9.615e-9
Identity = 38/121 (31.40%), Postives = 50/121 (41.32%), Query Frame = 3
Query: 1923 CPPGYRFCQNGE-CLENAKFCDKINHCADKSDEDPITCRECDPISRKCEINNQILPKKNYFLIHWICDGEEDCGNGYDEQNCDGFSLNNCGGKFFTCSDNKTIPRGYVCDENIDCSQGEDE 2282
            C PGY  C++   C+     CD  N C D SDE P  C     ++  C  +            HW CD   DC +G DE       +  C    F C D + IP  ++CD + DC    DE
Sbjct: 2794 CQPGYTKCRSTNICIPRTYLCDGDNDCGDMSDESPTHC-----VTLTCTESEFRCSSGRCIPGHWYCDQGVDCSDGSDEPPTCVAHVRTCSSDQFRCDDARCIPASWICDGDNDCGDMSDE 2909          

HSP 5 Score: 60.8474 bits (146), Expect = 1.406e-8
Identity = 39/115 (33.91%), Postives = 56/115 (48.70%), Query Frame = 3
Query: 1950 NGECLENAKFCDKINHCADKSDEDPITCRECDPISR-KCEINNQILPKKNYFLIHWICDGEEDCGNGYDEQNCDGFSLNNCGGKFFTCSDNKTIPRGYVCDENIDCSQGEDETGC 2291
            N  C+     C+  + C D SDE     R CDP    +C+ N++ +P      + W CDG+ DC +G DE+NC   S   C    F C + + IP  ++CD + DC    DE  C
Sbjct: 3616 NYRCVPMWSVCNGYDDCRDNSDEQGCEQRTCDPRGDFRCD-NHRCIP------LRWKCDGDNDCNDGSDERNC---SPRECTESEFRCDNLRCIPGRWICDHDNDCEDNSDERDC 3720          

HSP 6 Score: 59.3066 bits (142), Expect = 3.219e-8
Identity = 49/176 (27.84%), Postives = 64/176 (36.36%), Query Frame = 3
Query: 1881 EGRQVSSKIYVSDICPPGYRFCQNGECLENAKFCDKINHCADKSDEDPITCRECDP-----------ISR-------------------------------KCEINNQILPKKNYFLIHWICDGEEDCGNGYDEQNCDGFSLNNCGGKFFTCSDNKTIPRGYVCDENIDCSQGEDE 2282
            +G     ++     CP     C NG C+     CD  N C D SDE     R CDP           ISR                               KC   N  +P+       ++CDG+ DCG+  DE      +L  C    F CS  + IP  + CD+ +DCS G DE
Sbjct: 2699 DGSDELERVCAFHTCPSTSFTCGNGRCVPYHYRCDHYNDCGDNSDELGCLFRTCDPNTEFTCNNGRCISRAYVCNGVNNCFDNGTSDERNCPDRTCQPGYTKCRSTNICIPRT------YLCDGDNDCGDMSDESPTHCVTL-TCTESEFRCSSGRCIPGHWYCDQGVDCSDGSDE 2867          

HSP 7 Score: 58.9214 bits (141), Expect = 4.589e-8
Identity = 40/122 (32.79%), Postives = 57/122 (46.72%), Query Frame = 3
Query: 1923 CPPGYRFCQNGECLENAKFCDKINHCADKSDEDPITC--RECDPISRKCEINNQILPKKNYFLIHWICDGEEDCGNGYDEQNCDGFSLNNCGGKFFTCSDNKTIPRGYVCDENIDCSQGEDE 2282
            C  G   C +G C  +   C+    C D SDED I C   +CD    +C  N + +P+       W CD E+DCG+  DE +    S   C    F C++ + IP+ + CD + DC    DE
Sbjct: 3480 CRVGQFQCNDGNCTSSYFMCNSYPDCPDGSDEDQILCANHQCDTHQWQCA-NKRCIPES------WQCDQEDDCGDNSDEDSAH-CSTRTCNPGQFRCNNGRCIPQSWKCDVDDDCGDHSDE 3593          

HSP 8 Score: 58.9214 bits (141), Expect = 5.480e-8
Identity = 46/126 (36.51%), Postives = 60/126 (47.62%), Query Frame = 3
Query: 1923 CPPGYRFCQNGECLENAKFCDKINHCADKSDEDPITCRECDPISRKCEINNQILPKKNYFLI--HWICDGEEDCGNGYDE--QNCDGFSLNNCGGKF-FTCSDNKTIPRGYVCDENIDCSQGEDET 2285
            C PGY  C +G C+     CD    C D SDE     R   P    C  +  +   KN+  I  +W CDG+ DCG+G DE  Q+ D      C   F F C +N+ + R  +C+   DCS G DET
Sbjct: 3725 CHPGYFQCNSGHCIAERFRCDGTADCLDVSDEAACPTRY--PNGTYCPAS--MFECKNHVCIQPYWRCDGDNDCGDGSDEELQHLD----IPCEPPFRFRCGNNRCVYRHEICNGVDDCSDGSDET 3842          

HSP 9 Score: 58.5362 bits (140), Expect = 5.527e-8
Identity = 42/120 (35.00%), Postives = 56/120 (46.67%), Query Frame = 3
Query: 1944 CQNGECLENAKFCDKINHCADKSDEDPITCRE-CDPISRKCEINNQILPKKNYFLIHWICDGEEDCGNGYDEQNCDGFSLNNCGGKFFTC-SDNKTIPRGYVCDENIDCSQGEDETGCTS 2297
            CQN  C+     CD  N C D SDE  + C   C+P   +C  +  I P        ++CDG++DC +G DE  C      NC    F C S ++ I  GY CD   DC+   DE  C +
Sbjct: 1096 CQNNRCIPRIWLCDTDNDCGDGSDE--LNCSNTCEPGQFQCPDHRCIDPS-------YVCDGDKDCVDGSDEMGC----TYNCSYSEFKCASGDQCISTGYQCDGVFDCNDHSDELNCPT 1202          

HSP 10 Score: 57.7658 bits (138), Expect = 1.024e-7
Identity = 39/124 (31.45%), Postives = 56/124 (45.16%), Query Frame = 3
Query: 1926 PPGYRFCQNGECLENAKFCDKINHCADKSDEDPITCRECDPISRKCEINNQILPKKNYFLIHWICDGEEDCGNGYDEQNCDGFSLNNCGGKFFTCSDNKTIPRGYVCDENIDCSQGEDETGCTS 2297
            P G   C N  C+     CD  N C D SDE   + REC     +C+ N + +P +      WICD + DC +  DE++C+   +  C   +F C+    I   + CD   DC    DE  C +
Sbjct: 3648 PRGDFRCDNHRCIPLRWKCDGDNDCNDGSDERNCSPRECTESEFRCD-NLRCIPGR------WICDHDNDCEDNSDERDCE---IRTCHPGYFQCNSGHCIAERFRCDGTADCLDVSDEAACPT 3761          

HSP 11 Score: 56.6102 bits (135), Expect = 2.486e-7
Identity = 42/129 (32.56%), Postives = 61/129 (47.29%), Query Frame = 3
Query: 1923 CPPGYRFCQNGECLENAKFCDKINHCADKSDED----PITCRECDPISRKCEINNQILPKKNYFLIHWICDGEEDCGNGYDE--QNCDGFSLNNCGGKFFTCSDNKTIPRGYVCDENIDCSQGEDETGC 2291
            CP     C+N  C++    CD  N C D SDE+     I C    P   +C  NN+ + +      H IC+G +DC +G DE  + C   +   C  + + C ++  +P  YVCD+  DC    DE GC
Sbjct: 3769 CPASMFECKNHVCIQPYWRCDGDNDCGDGSDEELQHLDIPCEP--PFRFRCG-NNRCVYR------HEICNGVDDCSDGSDETEEQCRPPTPRPCTDEEYKCGNHFCVPLHYVCDDYDDCGDHSDEAGC 3888          

HSP 12 Score: 55.4546 bits (132), Expect = 5.140e-7
Identity = 40/128 (31.25%), Postives = 57/128 (44.53%), Query Frame = 3
Query: 1944 CQNGECLENAKFCDKINHCADKSDEDPITC----RECDPISRKCEINNQILPKKNYFLIHWICDGEEDCGNGYDEQNCDGFSLNNCGGKFFTCSDNKTIPRGY-----VCDENIDCSQGEDETGCTSP 2300
            C +G C+    +CD+   C+D SDE P TC    R C     +C+ + + +P        WICDG+ DCG+  DE         +C    F C++   +   +      CD   DC  G DE GC  P
Sbjct: 2843 CSSGRCIPGHWYCDQGVDCSDGSDEPP-TCVAHVRTCSSDQFRCD-DARCIPAS------WICDGDNDCGDMSDEDQ-----RRSCSSSEFACANGLCVRSNFRRGNSQCDRRNDCGDGSDERGCIYP 2957          

HSP 13 Score: 55.4546 bits (132), Expect = 5.984e-7
Identity = 40/123 (32.52%), Postives = 53/123 (43.09%), Query Frame = 3
Query: 1944 CQNGECLENAKFCDKINHCADKSDED----PITCRECDPISRKCEINNQILPKKNYFLIHWICDGEEDCGNGYDEQNCDGFSLNNCGGKFFTCSDNKTIPRGYVCDENIDCSQGEDETGCTSP 2300
            C +G+C+  A  CD++  C D +DE     P+ C E    S  C   +Q             CDG  DC +  DE NC       C    F C   + IPR ++CD + DC    DE  CT P
Sbjct:   98 CSSGQCIPRAYRCDRMKDCTDGADERNCLYPV-CTELSCGSGACYNRSQR------------CDGIVDCRDSSDESNC----TQRCLSSQFQCPSGECIPRDFLCDHDDDCGDESDEKNCTYP 203          

HSP 14 Score: 52.7582 bits (125), Expect = 3.646e-6
Identity = 37/123 (30.08%), Postives = 54/123 (43.90%), Query Frame = 3
Query: 1944 CQNG-ECLENAKFCDKINHCADKSDEDPITCRE---CDPISRKCEINNQILPKKNYFLIHWICDGEEDCGNGYDEQNCDGFSLNNCGGKFFTCSDNKTIPRGYVCDENIDCSQGEDETGCTSP 2300
            C +G +C+     CD +  C D SDE     R    C     +C+ +   +P       +W CDG  DC +G DE N     + +C    F C +   I R ++CD + DC    DE  C +P
Sbjct: 1172 CASGDQCISTGYQCDGVFDCNDHSDELNCPTRPAGMCHQNEFQCQSDGACIPS------NWECDGHPDCIDGSDEHN--TCPVRSCPPSMFRCDNGNCIYRSWICDGDNDCRDMSDEKDCPTP 1286          
BLAST of low density lipoprotein receptor-1 vs. Ensembl Mouse
Match: Hspg2 (perlecan (heparan sulfate proteoglycan 2) [Source:MGI Symbol;Acc:MGI:96257])

HSP 1 Score: 130.183 bits (326), Expect = 4.883e-30
Identity = 78/216 (36.11%), Postives = 97/216 (44.91%), Query Frame = 3
Query: 1923 CPPGYRFCQNGECLENAKFCDKINHCADKSDEDPITCRECDPISRKCEINNQILPKKNYFLIHWICDGEEDCGNGYDEQNCDGFSLNN-CGGKFFTC-SDNKTIPRGYVCDENIDCSQGEDETGCTSPQIXXXXXXXXXXXXXQLVTLTCEATGKPLPVLVWRFNWGCIQNSTRFSTNFFSTDCNSVTSSLTIKDFKAGDDGIYNCEALSSRQRSF 2564
            C P    C +G C+     CD    C D SDE  + C    P    CE N       +  L  W CDG+ DC +  DE NC        CG   F C S N+ IP  + CDE  DC    DE GC  PQ+       + A++ Q VT TC ATG P P++ WR NWG I    R +             +L I+D K  D G Y CEA++SR   F
Sbjct:  285 CGPQEASCHSGHCIPRDYLCDGQEDCRDGSDE--LGCASPPP----CEPNEFACENGHCALKLWRCDGDFDCEDRTDEANCSVKQPGEVCGPTHFQCVSTNRCIPASFHCDEESDCPDRSDEFGCMPPQVVTPPQQSIQASRGQTVTFTCVATGVPTPIINWRLNWGHIPAHPRVTMT-----SEGGRGTLIIRDVKEADQGAYTCEAMNSRGMVF 489          

HSP 2 Score: 65.855 bits (159), Expect = 2.688e-10
Identity = 119/544 (21.88%), Postives = 212/544 (38.97%), Query Frame = 3
Query:  207 PPNITFFPLK--NDSIVKSEMQFINIACNVTNYALNETSIRWLDKDGKVAAANR----YLYIKSLLKQDEGIYNCSVEKVKDPQ-----IRFNRTLHLKITIPSISIDILPEES---LKIGGQIKRQCSDLGLPQETIVDDFTYTWLNQQNKTIGNTNILQIPVVDESVVGRYICQYKSKETSKIYEAATYVNL--KQSVSYKIK---IITNP--ALFRYGERFSLRCEVEPFYQNIKYTWYKKDEFIG-------NDQELVIKSFKKDNVGTYKCVASLQLPSGKLDLMEESIQQFAFFRESKIELTTKPGPQVYVHRGEKKELHCEIETSSGNRGKEAEWYINGKKFKNGDIPLVNRLDGQYVS--MLVISDISQINEGNYECR----VGSSIKEVNLIVLLDEGLIETSPPILKVKE-------GQSVEFHCRVENIPSVKNVNLKWNFESKEGLVRNNIPDSRWQLMNDEIADQTSFIVLMKAEVSDSGYYICTEPNGQTARSELIVIPDKDKNSLTITPREIRVRAGQRVDIECFSKNT 1715
            P  + F P++    S   +E Q ++++C V   A     + W  + G + A ++     L +  +   D G Y+C V            +    +    I  P ++  +  E S   L  G  +  +C   G     +      + L  +++T G+  +L++  +  +  G Y+CQ       + +EA+  + +   Q+ S++++   I   P  +  + G+  S +C +      IK  W  +D+ +        N   + I   +  N G Y+CVAS       +  M +S+   +      + +  + GP V+V  G+   L C    SSG       W   G   K     L  R+ G   S  ML I+ +   + G Y C+    +G++ K+V LIV  D G +    P ++V+E       G +   HC     P      + W+       +R  +P   WQ     I   T  +V+ +    DSG YIC   N        +V+  +     TI P     + G  V ++C +  T
Sbjct: 2818 PGEVPFPPIRIETSSSRVAEGQTLDLSCVVPGQA--HAQVTWHKRGGSLPAGHQVHGHMLRLNRVSPADSGEYSCQVTGSSGTLEASVLVTIEASEPSPIPAPGLAQPVYIESSSSHLTEGQTVDLKCVVPGQAHAQVTWHKRGSSLPARHQTHGS--LLRLYQLSPADSGEYVCQVAGSSHPE-HEASFKLTVPSSQNSSFRLRSPVISIEPPSSTVQQGQDASFKCLIHEGATPIKVEWKIRDQELEDNVHISPNGSIITIVGTRPSNHGAYRCVAS------NVYGMAQSVVNLSVHGPPTVSVLPE-GP-VHVKMGKDITLEC---ISSGEPRSSPRWTRLGIPVK-----LEPRMFGLMNSHAMLKIASVKPSDAGTYVCQAQNALGTAQKQVELIV--DTGTVAPGAPQVQVEESELTLEAGHTATLHCSATGNPPP---TIHWS------KLRAPLP---WQ---HRIEGNT--LVIPRVAQQDSGQYICNATNSAGHTEATVVLHVESPPYATIIPEHTSAQPGNLVQLQCLAHGT 3321          

HSP 3 Score: 60.077 bits (144), Expect = 1.676e-8
Identity = 72/278 (25.90%), Postives = 121/278 (43.53%), Query Frame = 3
Query:  903 LVIKSFKKDNVGTYKCVAS--LQLPSGKLDLMEESIQQFAFFRESKIELTTKPGPQVYVHRGEKKELHCEIETSSGNRGKEAEWYINGKKFKNGDIPLVNRLDGQYVSMLVISDISQINEGNYECRVGSSI-KEVNLIVLLDEG----LIETSPPILKVKEGQSVEFHCRVENIPSVKNVNLKWNFESKEGLVRNNIPDSRWQLMNDEIADQTSFIVLMKAEVSDSGYYIC--TEPNGQT-ARSELIVIPDKDKNSLT--ITPREIRVRAGQRVDIEC 1700
            L I++ +  + GTY C  S    +  G   L             S   + +   PQ+ V  G++ E  C   +++GN     EW I G    +G +P   ++   +  +L +  I   ++G Y CR  SS  + V   +L   G     ++ SP   +V EG++V  +CR   +PS    ++ W    KEG    ++P    Q  ++     T  I  + A  +D+G+Y+C  T P G   AR +++V+     NS+   I      V  GQ +D+ C
Sbjct: 1824 LTIRNVQPSDAGTYVCTGSNMFAMDQGTATL------HVQVSGTSTAPVASIHPPQLTVQPGQQAEFRC---SATGNPTPMLEW-IGGP---SGQLPAKAQI---HNGILRLPAIEPSDQGQYLCRALSSAGQHVARAMLQVHGGSGPRVQVSPERTQVHEGRTVRLYCRAAGVPS---ASITWR---KEG---GSLPP---QARSENTDIPTLLIPAITA--ADAGFYLCVATSPTGTAQARIQVVVLSASGANSVPVRIESSSPSVTEGQTLDLNC 2071          

HSP 4 Score: 53.1434 bits (126), Expect = 2.175e-6
Identity = 123/494 (24.90%), Postives = 180/494 (36.44%), Query Frame = 3
Query:  366 LYIKSLLKQDEGIYNCSVEKVKDPQIRFNRTLHLKITIPSISIDILPEES---LKIGGQIKRQCSDLGLPQETIVDDFTYTWLNQQNKTIGNTNILQIPVVDESVVGRYICQYKSKETSKIYEAATYVNLKQSVSYKIKIITNPALFRYGERFSLRCEVEPFYQNIKYTW-----YKKDEFIGNDQELVIKSFKKDNVGTYKCVASLQLPSGKLDLMEESIQQFAFFRESKIELTTKPG---------PQVYVHR-GEKKELHCEIETSSGNRGKEAEWYINGKKFKNGDIPLVNRLDGQYVSMLVISDISQINEGNYECRV----GSSIKEVNLIV-LLDEGLIETSPPILKVKEGQSVEFHCRVENIPSVKNVNLKWNFESKEGLVRNNIPDSRWQLMNDEIADQTSFIVLMKAEVSDSGYYICTEPN--GQTARSELIVIPDKDKNSLTITPREIRVRAGQRVDIECFSKNTQGRASGNPEFSFTNNKPIG 1772
            L I S+   D G Y C  +       +    +    T+   +  +  EES   L+ G      CS  G P  TI        L  Q++  GNT  L IP V +   G+YIC   +   S  +  AT V   +S  Y   II      + G    L+C        + Y W        ++ +  +Q L ++    ++ G Y+C  S ++ S      E   Q       S +  T+ PG         PQ+     G   E HC +      RG    W   G +   G     +  DG    +L I ++ Q  +G Y C+     G +     LIV  L   LI     +  V  G SVEF C     P  +    K     + G+V++                  S I +   E++D+G Y C   N  G T    L+++    + S   TP EIRV AG      C        ASG P  + T +K  G
Sbjct: 3166 LKIASVKPSDAGTYVCQAQNALGTAQKQVELIVDTGTVAPGAPQVQVEESELTLEAGHTATLHCSATGNPPPTIHWSKLRAPLPWQHRIEGNT--LVIPRVAQQDSGQYIC---NATNSAGHTEATVVLHVESPPYA-TIIPEHTSAQPGNLVQLQCLAHG-TPPLTYQWSLVGGVLPEKAVARNQVLRLEPTVPEDSGRYRCQVSNRVGSA-----EAFAQVLVQGSSSNLPDTSIPGGSTPTVQVTPQLETRNIGASVEFHCAVPNE---RGTHLRWLKEGGQLPPGH----SVQDG----VLRIQNLDQSCQGTYVCQAHGPWGQAQATAQLIVQALPSVLINVRTSVHSVVVGHSVEFECLALGDPKPQVTWSKVGGHLRPGIVQSG-----------------SIIRIAHVELADAGQYRCAATNAAGTTQSHVLLLVQALPQIS---TPPEIRVPAGSAAVFPCM-------ASGYPTPAITWSKVDG 3609          
BLAST of low density lipoprotein receptor-1 vs. Ensembl Mouse
Match: Hspg2 (perlecan (heparan sulfate proteoglycan 2) [Source:MGI Symbol;Acc:MGI:96257])

HSP 1 Score: 130.183 bits (326), Expect = 4.923e-30
Identity = 78/216 (36.11%), Postives = 97/216 (44.91%), Query Frame = 3
Query: 1923 CPPGYRFCQNGECLENAKFCDKINHCADKSDEDPITCRECDPISRKCEINNQILPKKNYFLIHWICDGEEDCGNGYDEQNCDGFSLNN-CGGKFFTC-SDNKTIPRGYVCDENIDCSQGEDETGCTSPQIXXXXXXXXXXXXXQLVTLTCEATGKPLPVLVWRFNWGCIQNSTRFSTNFFSTDCNSVTSSLTIKDFKAGDDGIYNCEALSSRQRSF 2564
            C P    C +G C+     CD    C D SDE  + C    P    CE N       +  L  W CDG+ DC +  DE NC        CG   F C S N+ IP  + CDE  DC    DE GC  PQ+       + A++ Q VT TC ATG P P++ WR NWG I    R +             +L I+D K  D G Y CEA++SR   F
Sbjct:  285 CGPQEASCHSGHCIPRDYLCDGQEDCRDGSDE--LGCASPPP----CEPNEFACENGHCALKLWRCDGDFDCEDRTDEANCSVKQPGEVCGPTHFQCVSTNRCIPASFHCDEESDCPDRSDEFGCMPPQVVTPPQQSIQASRGQTVTFTCVATGVPTPIINWRLNWGHIPAHPRVTMT-----SEGGRGTLIIRDVKEADQGAYTCEAMNSRGMVF 489          

HSP 2 Score: 64.3142 bits (155), Expect = 9.156e-10
Identity = 115/526 (21.86%), Postives = 205/526 (38.97%), Query Frame = 3
Query:  255 SEMQFINIACNVTNYALNETSIRWLDKDGKVAAANR----YLYIKSLLKQDEGIYNCSVEKVKDPQ-----IRFNRTLHLKITIPSISIDILPEES---LKIGGQIKRQCSDLGLPQETIVDDFTYTWLNQQNKTIGNTNILQIPVVDESVVGRYICQYKSKETSKIYEAATYVNL--KQSVSYKIK---IITNP--ALFRYGERFSLRCEVEPFYQNIKYTWYKKDEFIG-------NDQELVIKSFKKDNVGTYKCVASLQLPSGKLDLMEESIQQFAFFRESKIELTTKPGPQVYVHRGEKKELHCEIETSSGNRGKEAEWYINGKKFKNGDIPLVNRLDGQYVS--MLVISDISQINEGNYECR----VGSSIKEVNLIVLLDEGLIETSPPILKVKE-------GQSVEFHCRVENIPSVKNVNLKWNFESKEGLVRNNIPDSRWQLMNDEIADQTSFIVLMKAEVSDSGYYICTEPNGQTARSELIVIPDKDKNSLTITPREIRVRAGQRVDIECFSKNT 1715
            +E Q ++++C V   A     + W  + G + A ++     L +  +   D G Y+C V            +    +    I  P ++  +  E S   L  G  +  +C   G     +      + L  +++T G+  +L++  +  +  G Y+CQ       + +EA+  + +   Q+ S++++   I   P  +  + G+  S +C +      IK  W  +D+ +        N   + I   +  N G Y+CVAS       +  M +S+   +      + +  + GP V+V  G+   L C    SSG       W   G   K     L  R+ G   S  ML I+ +   + G Y C+    +G++ K+V LIV  D G +    P ++V+E       G +   HC     P      + W+       +R  +P   WQ     I   T  +V+ +    DSG YIC   N        +V+  +     TI P     + G  V ++C +  T
Sbjct: 2828 AEGQTLDLSCVVPGQA--HAQVTWHKRGGSLPAGHQVHGHMLRLNRVSPADSGEYSCQVTGSSGTLEASVLVTIEASEPSPIPAPGLAQPVYIESSSSHLTEGQTVDLKCVVPGQAHAQVTWHKRGSSLPARHQTHGS--LLRLYQLSPADSGEYVCQVAGSSHPE-HEASFKLTVPSSQNSSFRLRSPVISIEPPSSTVQQGQDASFKCLIHEGATPIKVEWKIRDQELEDNVHISPNGSIITIVGTRPSNHGAYRCVAS------NVYGMAQSVVNLSVHGPPTVSVLPE-GP-VHVKMGKDITLEC---ISSGEPRSSPRWTRLGIPVK-----LEPRMFGLMNSHAMLKIASVKPSDAGTYVCQAQNALGTAQKQVELIV--DTGTVAPGAPQVQVEESELTLEAGHTATLHCSATGNPPP---TIHWS------KLRAPLP---WQ---HRIEGNT--LVIPRVAQQDSGQYICNATNSAGHTEATVVLHVESPPYATIIPEHTSAQPGNLVQLQCLAHGT 3313          

HSP 3 Score: 55.8398 bits (133), Expect = 3.568e-7
Identity = 70/276 (25.36%), Postives = 119/276 (43.12%), Query Frame = 3
Query:  903 LVIKSFKKDNVGTYKCVAS--LQLPSGKLDLMEESIQQFAFFRESKIELTTKPGPQVYVHRGEKKELHCEIETSSGNRGKEAEWYINGKKFKNGDIPLVNRLDGQYVSMLVISDISQINEGNYECRVGSSI-KEVNLIVLLDEG----LIETSPPILKVKEGQSVEFHCRVENIPSVKNVNLKWNFESKEGLVRNNIPDSRWQLMNDEIADQTSFIVLMKAEVSDSGYYIC--TEPNGQT-ARSELIVIPDKDKNSLTITPREIRVRAGQRVDIEC 1700
            L I++ +  + GTY C  S    +  G   L             S   + +   PQ+ V  G++ E  C   +++GN     EW I G    +G +P   ++   +  +L +  I   ++G Y CR  SS  + V   +L   G     ++ SP   +V EG++V  +CR   +PS    ++ W    KEG    ++P    Q  ++     T  I  + A  +D+G+Y+C  T P G   AR +++V+       + I      V  GQ +D+ C
Sbjct: 1824 LTIRNVQPSDAGTYVCTGSNMFAMDQGTATL------HVQVSGTSTAPVASIHPPQLTVQPGQQAEFRC---SATGNPTPMLEW-IGGP---SGQLPAKAQI---HNGILRLPAIEPSDQGQYLCRALSSAGQHVARAMLQVHGGSGPRVQVSPERTQVHEGRTVRLYCRAAGVPS---ASITWR---KEG---GSLPP---QARSENTDIPTLLIPAITA--ADAGFYLCVATSPTGTAQARIQVVVL----SVPVRIESSSPSVTEGQTLDLNC 2065          

HSP 4 Score: 53.1434 bits (126), Expect = 2.250e-6
Identity = 123/494 (24.90%), Postives = 180/494 (36.44%), Query Frame = 3
Query:  366 LYIKSLLKQDEGIYNCSVEKVKDPQIRFNRTLHLKITIPSISIDILPEES---LKIGGQIKRQCSDLGLPQETIVDDFTYTWLNQQNKTIGNTNILQIPVVDESVVGRYICQYKSKETSKIYEAATYVNLKQSVSYKIKIITNPALFRYGERFSLRCEVEPFYQNIKYTW-----YKKDEFIGNDQELVIKSFKKDNVGTYKCVASLQLPSGKLDLMEESIQQFAFFRESKIELTTKPG---------PQVYVHR-GEKKELHCEIETSSGNRGKEAEWYINGKKFKNGDIPLVNRLDGQYVSMLVISDISQINEGNYECRV----GSSIKEVNLIV-LLDEGLIETSPPILKVKEGQSVEFHCRVENIPSVKNVNLKWNFESKEGLVRNNIPDSRWQLMNDEIADQTSFIVLMKAEVSDSGYYICTEPN--GQTARSELIVIPDKDKNSLTITPREIRVRAGQRVDIECFSKNTQGRASGNPEFSFTNNKPIG 1772
            L I S+   D G Y C  +       +    +    T+   +  +  EES   L+ G      CS  G P  TI        L  Q++  GNT  L IP V +   G+YIC   +   S  +  AT V   +S  Y   II      + G    L+C        + Y W        ++ +  +Q L ++    ++ G Y+C  S ++ S      E   Q       S +  T+ PG         PQ+     G   E HC +      RG    W   G +   G     +  DG    +L I ++ Q  +G Y C+     G +     LIV  L   LI     +  V  G SVEF C     P  +    K     + G+V++                  S I +   E++D+G Y C   N  G T    L+++    + S   TP EIRV AG      C        ASG P  + T +K  G
Sbjct: 3158 LKIASVKPSDAGTYVCQAQNALGTAQKQVELIVDTGTVAPGAPQVQVEESELTLEAGHTATLHCSATGNPPPTIHWSKLRAPLPWQHRIEGNT--LVIPRVAQQDSGQYIC---NATNSAGHTEATVVLHVESPPYA-TIIPEHTSAQPGNLVQLQCLAHG-TPPLTYQWSLVGGVLPEKAVARNQVLRLEPTVPEDSGRYRCQVSNRVGSA-----EAFAQVLVQGSSSNLPDTSIPGGSTPTVQVTPQLETRNIGASVEFHCAVPNE---RGTHLRWLKEGGQLPPGH----SVQDG----VLRIQNLDQSCQGTYVCQAHGPWGQAQATAQLIVQALPSVLINVRTSVHSVVVGHSVEFECLALGDPKPQVTWSKVGGHLRPGIVQSG-----------------SIIRIAHVELADAGQYRCAATNAAGTTQSHVLLLVQALPQIS---TPPEIRVPAGSAAVFPCM-------ASGYPTPAITWSKVDG 3601          
BLAST of low density lipoprotein receptor-1 vs. Ensembl Mouse
Match: Vldlr (very low density lipoprotein receptor [Source:MGI Symbol;Acc:MGI:98935])

HSP 1 Score: 78.1814 bits (191), Expect = 3.329e-14
Identity = 48/132 (36.36%), Postives = 60/132 (45.45%), Query Frame = 3
Query: 1911 VSDICPPGYRFCQNGECLENAKFCDKINHCADKSDEDPITCRECDPISRKCEINNQILPKKNY--FLIHWICDGEEDCGNGYDEQNCDGFSLNNCGGKFFTCSDNKTIPRGYVCDENIDCSQGEDETGCTSP 2300
            V   C      C+NG+C+ N   CD    C D SDE P  C       R C IN      ++     + W CDGE DC NG DE+NC   +   C    FTCS  + + R +VC+   DC  G DE  C  P
Sbjct:   68 VKKTCAESDFVCKNGQCVPNRWQCDGDPDCEDGSDESPEQCH-----MRTCRINEISCGARSTQCIPVSWRCDGENDCDNGEDEENCGNIT---CSADEFTCSSGRCVSRNFVCNGQDDCDDGSDELDCAPP 191          

HSP 2 Score: 51.6026 bits (122), Expect = 5.100e-6
Identity = 45/137 (32.85%), Postives = 58/137 (42.34%), Query Frame = 3
Query: 1875 SLEGRQVSSKIYVSDICPPGYRFCQNGECLENAKFCDKINHCADKSDEDPITCRECDPISRKCEINNQILPKKNYFLIHWICDGEEDCGNGYDEQNCDGFSLNNC-GGKFFTCSDNKTIPRGYVCDENIDCSQGEDE 2282
            SLE  Q   +  +   CP     C +GEC+     CD    C D SDE     R C P   +CE  + I   +        C+G  DC +G DE NC   ++N C G   F C   + I    VCD+  DC    DE
Sbjct:  225 SLE--QCGRQPVIHTKCPTSEIQCGSGECIHKKWRCDGDPDCKDGSDEVNCPSRTCRPDQFECEDGSCIHGSRQ-------CNGIRDCVDGSDEVNCK--NVNQCLGPGKFKCRSGECIDMSKVCDQEQDCRDWSDE 350          
BLAST of low density lipoprotein receptor-1 vs. Ensembl Mouse
Match: Vldlr (very low density lipoprotein receptor [Source:MGI Symbol;Acc:MGI:98935])

HSP 1 Score: 77.7962 bits (190), Expect = 4.077e-14
Identity = 48/132 (36.36%), Postives = 60/132 (45.45%), Query Frame = 3
Query: 1911 VSDICPPGYRFCQNGECLENAKFCDKINHCADKSDEDPITCRECDPISRKCEINNQILPKKNY--FLIHWICDGEEDCGNGYDEQNCDGFSLNNCGGKFFTCSDNKTIPRGYVCDENIDCSQGEDETGCTSP 2300
            V   C      C+NG+C+ N   CD    C D SDE P  C       R C IN      ++     + W CDGE DC NG DE+NC   +   C    FTCS  + + R +VC+   DC  G DE  C  P
Sbjct:   68 VKKTCAESDFVCKNGQCVPNRWQCDGDPDCEDGSDESPEQCH-----MRTCRINEISCGARSTQCIPVSWRCDGENDCDNGEDEENCGNIT---CSADEFTCSSGRCVSRNFVCNGQDDCDDGSDELDCAPP 191          

HSP 2 Score: 51.2174 bits (121), Expect = 6.144e-6
Identity = 45/137 (32.85%), Postives = 58/137 (42.34%), Query Frame = 3
Query: 1875 SLEGRQVSSKIYVSDICPPGYRFCQNGECLENAKFCDKINHCADKSDEDPITCRECDPISRKCEINNQILPKKNYFLIHWICDGEEDCGNGYDEQNCDGFSLNNC-GGKFFTCSDNKTIPRGYVCDENIDCSQGEDE 2282
            SLE  Q   +  +   CP     C +GEC+     CD    C D SDE     R C P   +CE  + I   +        C+G  DC +G DE NC   ++N C G   F C   + I    VCD+  DC    DE
Sbjct:  225 SLE--QCGRQPVIHTKCPTSEIQCGSGECIHKKWRCDGDPDCKDGSDEVNCPSRTCRPDQFECEDGSCIHGSRQ-------CNGIRDCVDGSDEVNCK--NVNQCLGPGKFKCRSGECIDMSKVCDQEQDCRDWSDE 350          
BLAST of low density lipoprotein receptor-1 vs. Ensembl Mouse
Match: Lrp1b (low density lipoprotein-related protein 1B [Source:MGI Symbol;Acc:MGI:2151136])

HSP 1 Score: 75.8702 bits (185), Expect = 2.346e-13
Identity = 45/118 (38.14%), Postives = 61/118 (51.69%), Query Frame = 3
Query: 1944 CQNGECLENAKFCDKINHCADKSDEDPITC--RECDPISRKCEINNQILPKKNYFLIHWICDGEEDCGNGYDEQNCDGFSLNNCGGKFFTCSDNKTIPRGYVCDENIDCSQGEDETGC 2291
            C NG+C++    CD I HC DKSDE  + C  R C    + C  N + +P         +CDG  DCG+  DE +C    ++ C    F C+D   IPR   C++N+DCS   DE GC
Sbjct: 2404 CGNGDCVDYVLTCDGIPHCKDKSDEKLLYCENRSCRSGFKPC-YNRRCVPHGK------LCDGTNDCGDSSDELDC---KVSTCSTVEFRCADGTCIPRSARCNQNMDCSDASDEKGC 2511          

HSP 2 Score: 64.6994 bits (156), Expect = 6.795e-10
Identity = 43/124 (34.68%), Postives = 59/124 (47.58%), Query Frame = 3
Query: 1923 CPPGYRFCQNGECLENAKFCDKINHCADKSDEDPITCRECDPISRKCEINNQILPKKNYFLIHWICDGEEDCGNGYDEQNCDGFSLNNCGGKFFTCSDNKT-IPRGYVCDENIDCSQGEDETGC 2291
            C PG   C  G C   A  CD  N C D SDE       C     KC  N + +P      ++  C+G++DCG+  DE++C     N+C   +F C   K  I + +VCDE+ DC+   DE  C
Sbjct: 3243 CQPGRFQCGTGLCALPAFICDGENDCGDNSDELNCDTHVCLAGQFKCTKNKKCIP------VNLRCNGQDDCGDEEDEKDC---PENSCSPDYFQCKTTKHCISKLWVCDEDPDCADASDEANC 3357          

HSP 3 Score: 64.3142 bits (155), Expect = 7.779e-10
Identity = 45/121 (37.19%), Postives = 58/121 (47.93%), Query Frame = 3
Query: 1944 CQNGECLENAKFCDKINHCADKSDEDPITCRECDPISRKCEINN--QILPKKNYFLIHWICDGEEDCGNGYDEQNCDG-FSLNNCGGKFFTCSDNKTIPRGYVCDENIDCSQGEDETGCTS 2297
            C +G C+     CD  N C D SDE  I C + +  S    I N  Q  P  N     W CDGE+DC +G DE+ C+G   L +   KF   S  + I   +VCD ++DC    DE  C S
Sbjct:  899 CSSGRCIPGHWACDGDNDCGDFSDETHINCTKEEARSPAGCIGNEFQCRPDGNCIPDLWRCDGEKDCEDGSDEKGCNGTIRLCDHKTKFSCRSTGRCINNAWVCDGDVDCEDQSDEEDCDS 1019          

HSP 4 Score: 61.6178 bits (148), Expect = 5.440e-9
Identity = 41/123 (33.33%), Postives = 53/123 (43.09%), Query Frame = 3
Query: 1923 CPPGYRFCQNGECLENAKFCDKINHCADKSDEDPITCRECDPISRKCEINNQILPKKNYFLIHWICDGEEDCGNGYDEQN--CDGFSLNNCGGKFFTCSDNKT-IPRGYVCDENIDCSQGEDE 2282
            C   Y  C +G C+ N   CD    C D  DE       CD     C  N      K     HWICDGE+DCG+  DE +  C   +   C    F+C  +   +P+ ++CD   DC  G DE
Sbjct: 2568 CEENYFGCPSGRCILNTWVCDGQKDCEDGLDE-----LHCDS---SCSWNQFACSVKKCISKHWICDGEDDCGDSLDESDSICGAVT---CAADMFSCQGSHACVPQHWLCDGERDCPDGSDE 2679          

HSP 5 Score: 60.8474 bits (146), Expect = 9.750e-9
Identity = 45/125 (36.00%), Postives = 62/125 (49.60%), Query Frame = 3
Query: 1920 ICPPGYRFCQNGECLENAKFCDKINHCADKSDEDPITC--RECDPISRKCEINNQILPKKNYFLIHWICDGEEDCGNGYDEQNCDGFSLNNCGGKFFTCSDNKTIPRGYVCDENIDCSQGEDETG 2288
            IC PG   C+N  C++    CD  + C D SDED +TC    C     KC+ NN+ +PK+      W+CDG  DCG+  DE N    +   C    F+C + + IP  ++CD   DC    DE  
Sbjct:  730 ICKPGEFRCKNKHCIQARWKCDGDDDCLDGSDEDSVTCFNHSCPDDQFKCQ-NNRCIPKR------WLCDGANDCGSNEDESN-QTCTARTCQADQFSCGNGRCIPTAWLCDREDDCGDQTDEVA 846          

HSP 6 Score: 60.077 bits (144), Expect = 1.807e-8
Identity = 47/131 (35.88%), Postives = 62/131 (47.33%), Query Frame = 3
Query: 1923 CPPGYRF-CQNGECLENAKFCDKINHCADKSDEDPITC-RECDPISRKCEINNQILPKKNYFLIHWICDGEEDCGNGYDEQ--NC---DGFSLNNCGGKFFTCS-DNKTIPRGYVCDENIDCSQGEDETGC 2291
            C P  +F C++G C+ N   CD  + C D+SDE  + C   C     +C  + + +P       HW CDG+ DCG+  DE   NC   +  S   C G  F C  D   IP  + CD   DC  G DE GC
Sbjct:  853 CEPLTQFICKSGRCISNKWHCDTDDDCGDRSDE--VGCVHSCLDDQFRCS-SGRCIPG------HWACDGDNDCGDFSDETHINCTKEEARSPAGCIGNEFQCRPDGNCIPDLWRCDGEKDCEDGSDEKGC 974          

HSP 7 Score: 59.3066 bits (142), Expect = 2.689e-8
Identity = 53/170 (31.18%), Postives = 71/170 (41.76%), Query Frame = 3
Query: 1791 ISNVGPAHKRLTAPGGLSLSDNNMDVFCSLEGRQVSSKIYVSDICPPGYRFCQNGECLENAKFCDKINHCADKSDEDPITCRE--CDPISRKCEINNQILPKKNYFLIHWICDGEEDCGNGYDEQNCDGFSLNNCGGKFFTCSDNKT-IPRGYVCDENIDCSQGEDETGC 2291
            ++N G +H  L  PG         + + + + R   S       C      C+  +C+     CD ++ C D SDE P  C E  C P   +C      LP        +ICDGE DCG+  DE NCD    + C    F C+ NK  IP    C+   DC   EDE  C
Sbjct: 3165 VNNGGCSHLCLLGPGKTHTCACPTNFYLAADNRTCLSN------CTASQFRCKTDKCIPFWWKCDTVDDCGDGSDE-PDDCPEFKCQPGRFQCGTGLCALPA-------FICDGENDCGDNSDELNCD---THVCLAGQFKCTKNKKCIPVNLRCNGQDDCGDEEDEKDC 3317          

HSP 8 Score: 58.9214 bits (141), Expect = 3.350e-8
Identity = 48/169 (28.40%), Postives = 63/169 (37.28%), Query Frame = 3
Query: 1923 CPPGYRFCQNGECLENAKFCDKINHCADKSDEDPITCR--------------ECDPISRKCEIN--------------------NQILPKKNYF----------LIHWICDGEEDCGNGYDEQNCDGFSLNNCGGKFFTCSDNKTIPRGYVCDENIDCSQGEDETGCTS 2297
            C  G++ C N  C+ + K CD  N C D SDE  + C+               C P S +C  N                     ++  K   F          L  WICDG  DCG+  DE  C   + + C   +F C   + I   +VCD   DC  G DE  C S
Sbjct: 2438 CRSGFKPCYNRRCVPHGKLCDGTNDCGDSSDE--LDCKVSTCSTVEFRCADGTCIPRSARCNQNMDCSDASDEKGCNNTDCTHFYKLGVKSTGFIRCNSTSLCVLPSWICDGSNDCGDYSDELKCPVQNKHKCEENYFGCPSGRCILNTWVCDGQKDCEDGLDELHCDS 2604          
BLAST of low density lipoprotein receptor-1 vs. UniProt/SwissProt
Match: sp|Q05793|PGBM_MOUSE (Basement membrane-specific heparan sulfate proteoglycan core protein OS=Mus musculus OX=10090 GN=Hspg2 PE=1 SV=1)

HSP 1 Score: 129.798 bits (325), Expect = 5.417e-29
Identity = 78/216 (36.11%), Postives = 97/216 (44.91%), Query Frame = 3
Query: 1923 CPPGYRFCQNGECLENAKFCDKINHCADKSDEDPITCRECDPISRKCEINNQILPKKNYFLIHWICDGEEDCGNGYDEQNCDGFSLNN-CGGKFFTC-SDNKTIPRGYVCDENIDCSQGEDETGCTSPQIXXXXXXXXXXXXXQLVTLTCEATGKPLPVLVWRFNWGCIQNSTRFSTNFFSTDCNSVTSSLTIKDFKAGDDGIYNCEALSSRQRSF 2564
            C P    C +G C+     CD    C D SDE  + C    P    CE N       +  L  W CDG+ DC +  DE NC        CG   F C S N+ IP  + CDE  DC    DE GC  PQ+       + A++ Q VT TC ATG P P++ WR NWG I    R +             +L I+D K  D G Y CEA++SR   F
Sbjct:  285 CGPQEASCHSGHCIPRDYLCDGQEDCRDGSDE--LGCASPPP----CEPNEFACENGHCALKLWRCDGDFDCEDRTDEANCSVKQPGEVCGPTHFQCVSTNRCIPASFHCDEESDCPDRSDEFGCMPPQVVTPPQQSIQASRGQTVTFTCVATGVPTPIINWRLNWGHIPAHPRVTMT-----SEGGRGTLIIRDVKEADQGAYTCEAMNSRGMVF 489          

HSP 2 Score: 57.3806 bits (137), Expect = 7.323e-7
Identity = 69/283 (24.38%), Postives = 113/283 (39.93%), Query Frame = 3
Query:  903 LVIKSFKKDNVGTYKCVAS--LQLPSGKLDLMEESIQQFAFFRESKIELTTKPGPQVYVHRGEKKELHCEIETSSGNRGKEAEWYINGKKFKNGDIPLVNRLDGQYVSMLVISDISQINEGNYECRVGSSI-KEVNLIVLLDEG----LIETSPPILKVKEGQSVEFHCRVENIPSVKNVNLKWNFESKEGLVRNNIPDSRWQLMNDEIADQTSFIVLMKAEVSDSGYYICTEPNGQTARSELIVI---PDKD-------KNSLTITPREIRVRAGQRVDIEC 1700
            L I++ +  + GTY C  S    +  G   L             S   + +   PQ+ V  G++ E  C   +++GN     EW I G    +G +P   ++   +  +L +  I   ++G Y CR  SS  + V   +L   G     ++ SP   +V EG++V  +CR   +PS    ++ W  E      R+    SR +L +                V+DSG Y+C   N   A+   I+I   P  +          + I     RV  GQ +D+ C
Sbjct: 1824 LTIRNVQPSDAGTYVCTGSNMFAMDQGTATL------HVQVSGTSTAPVASIHPPQLTVQPGQQAEFRC---SATGNPTPMLEW-IGGP---SGQLPAKAQI---HNGILRLPAIEPSDQGQYLCRALSSAGQHVARAMLQVHGGSGPRVQVSPERTQVHEGRTVRLYCRAAGVPS---ASITWRKEGGSLPFRHQAHGSRLRLHH--------------MSVADSGEYVCRANNNIDAQETSIMISVSPSTNSPPAPASPAPIRIESSSSRVAEGQTLDLNC 2073          
BLAST of low density lipoprotein receptor-1 vs. UniProt/SwissProt
Match: sp|P98160|PGBM_HUMAN (Basement membrane-specific heparan sulfate proteoglycan core protein OS=Homo sapiens OX=9606 GN=HSPG2 PE=1 SV=4)

HSP 1 Score: 127.102 bits (318), Expect = 3.075e-28
Identity = 77/216 (35.65%), Postives = 97/216 (44.91%), Query Frame = 3
Query: 1923 CPPGYRFCQNGECLENAKFCDKINHCADKSDEDPITCRECDPISRKCEINNQILPKKNYFLIHWICDGEEDCGNGYDEQNCDGFSLNN-CGGKFFTC-SDNKTIPRGYVCDENIDCSQGEDETGCTSPQIXXXXXXXXXXXXXQLVTLTCEATGKPLPVLVWRFNWGCIQNSTRFSTNFFSTDCNSVTSSLTIKDFKAGDDGIYNCEALSSRQRSF 2564
            C P    C+NG C+     CD    C D SDE      +C P    CE N       +  L  W CDG+ DC +  DE NC        CG   F C S N  IP  + CDE  DC    DE GC  PQ+       + A++ Q VT TC A G P P++ WR NWG I +  R +             +L I+D K  D G Y CEA+++R   F
Sbjct:  285 CGPQEAACRNGHCIPRDYLCDGQEDCEDGSDE-----LDCGP-PPPCEPNEFPCGNGHCALKLWRCDGDFDCEDRTDEANCPTKRPEEVCGPTQFRCVSTNMCIPASFHCDEESDCPDRSDEFGCMPPQVVTPPRESIQASRGQTVTFTCVAIGVPTPIINWRLNWGHIPSHPRVTVT-----SEGGRGTLIIRDVKESDQGAYTCEAMNARGMVF 489          
BLAST of low density lipoprotein receptor-1 vs. UniProt/SwissProt
Match: sp|Q06561|UNC52_CAEEL (Basement membrane proteoglycan OS=Caenorhabditis elegans OX=6239 GN=unc-52 PE=1 SV=2)

HSP 1 Score: 100.523 bits (249), Expect = 4.250e-20
Identity = 100/334 (29.94%), Postives = 147/334 (44.01%), Query Frame = 3
Query: 1641 LTITPREIRVRAGQRVDIECFSKNTQGRASGNPEFSFTNNKPIG---------RDGRFKISNVGPAHKRLTAPGG-LSLSDNNMDVF--------CSLEGRQVSSKIYVSDICPPGYRFCQNGECLENAKFCDKINHCADKSDED--PITCRECDPISRKCEINNQILPKKNYFLIHWICDGEEDCGNGYDEQNCDG-FSLNNCGGKFFTCSDNKT-IPRGYVCDENIDCSQGEDETGCTSPQIXXXXXXXXXXXXXQLVTLTCEATGKPLPVLVWRFNWGCIQNSTR---FSTNFFSTDCNSVTSSLTIKDFKAGDDGIYNCEALSSRQRSFS 2567
            +T+ P E  VR G+ V  EC     + R S N  +       +G           GR  I+ V     +L+  G  + +SD N +           S   ++VS+ +  +  C    + C N EC++N   CD    C D+SDE   P   R C+P   KC  NN+ + K       W+CDG++DCG+  DE NC+   S ++C    F C D +  +P  + CD   DC  G DE GC  P +     T +   +    +LTC+A   P P + WR NWG +    R    S   + T        LTI D +  D G Y CEA++ + R  +
Sbjct:   47 ITVFPSEKEVRDGRDVSFEC-----RARTSDNSVYPTVRWARVGGPLPSSAHDSGGRLTINPV-----QLSDAGTYICVSDYNGNTVEARATLSVVSYGPQEVSNGLRQAGQCMADEKACGNNECVKNDYVCDGEPDCRDRSDEANCPAISRTCEPNEFKCN-NNKCVQKM------WLCDGDDDCGDNSDELNCNAKPSSSDCKPTEFQCHDRRQCVPSSFHCDGTNDCHDGSDEVGCVQPTVVDPPQTNLQVPRGTTFSLTCKAVAVPEPYINWRLNWGPVCEPPRCLQTSEGGYGT--------LTIHDAQPVDQGAYTCEAINVKGRVLA 355          
BLAST of low density lipoprotein receptor-1 vs. UniProt/SwissProt
Match: sp|P98156|VLDLR_MOUSE (Very low-density lipoprotein receptor OS=Mus musculus OX=10090 GN=Vldlr PE=1 SV=1)

HSP 1 Score: 78.1814 bits (191), Expect = 2.328e-13
Identity = 48/132 (36.36%), Postives = 60/132 (45.45%), Query Frame = 3
Query: 1911 VSDICPPGYRFCQNGECLENAKFCDKINHCADKSDEDPITCRECDPISRKCEINNQILPKKNY--FLIHWICDGEEDCGNGYDEQNCDGFSLNNCGGKFFTCSDNKTIPRGYVCDENIDCSQGEDETGCTSP 2300
            V   C      C+NG+C+ N   CD    C D SDE P  C       R C IN      ++     + W CDGE DC NG DE+NC   +   C    FTCS  + + R +VC+   DC  G DE  C  P
Sbjct:   68 VKKTCAESDFVCKNGQCVPNRWQCDGDPDCEDGSDESPEQCH-----MRTCRINEISCGARSTQCIPVSWRCDGENDCDNGEDEENCGNIT---CSADEFTCSSGRCVSRNFVCNGQDDCDDGSDELDCAPP 191          
BLAST of low density lipoprotein receptor-1 vs. UniProt/SwissProt
Match: sp|P98158|LRP2_RAT (Low-density lipoprotein receptor-related protein 2 OS=Rattus norvegicus OX=10116 GN=Lrp2 PE=1 SV=1)

HSP 1 Score: 78.1814 bits (191), Expect = 3.497e-13
Identity = 47/122 (38.52%), Postives = 59/122 (48.36%), Query Frame = 3
Query: 1923 CPPGYRFCQNGE-CLENAKFCDKINHCADKSDEDPITCRECDPISRKCEINN-QILPKKNYFLIHWICDGEEDCGNGYDEQNCDGFSLNNCGGKFFTCSDNKTIPRGYVCDENIDCSQGEDE 2282
            CPP +  CQ    C+  A  CD  N C D SDE+PI C      S  C  N  Q L  +     +W CDGE DC +G DE +  G S+N C    F C + + I   +VCD + DC    DE
Sbjct: 2823 CPPDFTKCQTTNICVPRAFLCDGDNDCGDGSDENPIYC-----ASHTCRSNEFQCLSPQRCIPSYWFCDGEADCADGSDEPDTCGHSVNTCRASQFQCDNGRCISGNWVCDGDNDCGDMSDE 2939          

HSP 2 Score: 72.7886 bits (177), Expect = 1.714e-11
Identity = 43/121 (35.54%), Postives = 63/121 (52.07%), Query Frame = 3
Query: 1944 CQNGECLENAKFCDKINHCADKSDEDP--ITCRECDPISRKCEINNQILPKKNYFLIHWICDGEEDCGNGYDEQNCDGFSLNN-CGGKFFTCSDNKTIPRGYVCDENIDCSQGEDETGCTS 2297
            C NG+C+ +   CD ++ C D SDE    +    C P +  C    Q +P +      W CD + DC +G DEQNC   + ++ C    FTC ++  IP+ +VCD + DCS G DE  C +
Sbjct: 1032 CNNGKCVPSFFRCDGVDDCHDNSDEHQCGVFNNTCSPSAFACVRGGQCIPGQ------WHCDRQNDCLDGSDEQNCPTHATSSTCPSTSFTCDNHVCIPKDWVCDTDNDCSDGSDEKNCQA 1146          

HSP 3 Score: 70.0922 bits (170), Expect = 8.844e-11
Identity = 39/124 (31.45%), Postives = 58/124 (46.77%), Query Frame = 3
Query: 1926 PPGYRFCQNGECLENAKFCDKINHCADKSDEDPITCRECDPISRKCEINNQILPKKNYFLIHWICDGEEDCGNGYDEQNCDGFSLNNCGGKFFTCSDNKTIPRGYVCDENIDCSQGEDETGCTS 2297
            P G   C N  C+     CD  + C D SDE+    REC     +C  + Q +P +      W+CD E DCG+  DE++C+   +  C  + F C+    +P+   CD   DC    DE+ C +
Sbjct: 3723 PSGDFRCANHHCIPLRWKCDGTDDCGDNSDEENCVPRECSESEFRCA-DQQCIPSR------WVCDQENDCGDNSDERDCE---MKTCHPEHFQCTSGHCVPKALACDGRADCLDASDESACPT 3836          

HSP 4 Score: 70.0922 bits (170), Expect = 9.148e-11
Identity = 44/127 (34.65%), Postives = 61/127 (48.03%), Query Frame = 3
Query: 1926 PPGYRFCQNGECLENAKFCDKINHCADKSDED----PITCRECDPISRKCEINNQILPKKNYFLIHWICDGEEDCGNGYDEQNCDGFSLNNCGGKFFTCSDNKTIPRGYVCDENIDCSQGEDETGCT 2294
            P  +   + G+C+     CD+ N C D SDE       T   C   S  C+ N+  +PK       W+CD + DC +G DE+NC   +   C    F C D++ I   YVCD + DC+ G DE GC 
Sbjct: 1068 PSAFACVRGGQCIPGQWHCDRQNDCLDGSDEQNCPTHATSSTCPSTSFTCD-NHVCIPKD------WVCDTDNDCSDGSDEKNCQ--ASGTCQPTQFRCPDHRCISPLYVCDGDKDCADGSDEAGCV 1185          

HSP 5 Score: 68.5514 bits (166), Expect = 2.865e-10
Identity = 44/127 (34.65%), Postives = 56/127 (44.09%), Query Frame = 3
Query: 1923 CPPGYRFCQNGECLENAKFCDKINHCADKSDEDPITCRECDPISRKCEINNQILPKKNYFLIHWICDGEEDCGNGYDE-QNCDGFSLNNCGGKFFTCSDNKTIPRGYVCDENIDCSQGEDETGCTSP 2300
            C  G   C NG C+  +  CD    C D +DE     R C+     C      +P        W+CD ++DC +G DE QNC G     C  +  TCS+ + IP  Y CD   DC  G DE  C  P
Sbjct:   28 CGSGNFRCDNGYCIPASWRCDGTRDCLDDTDEIGCPPRSCESGLFLCPAEGTCIPSS------WVCDEDKDCSDGADEQQNCAG---TTCSAQQMTCSNGQCIPSEYRCDHVSDCPDGSDERNCHYP 145          

HSP 6 Score: 67.0106 bits (162), Expect = 9.517e-10
Identity = 42/133 (31.58%), Postives = 61/133 (45.86%), Query Frame = 3
Query: 1944 CQNGECLENAKFCDKINHCADKSDED-------------PITCRECDPISRKCEINNQILPKKNYFLIHWICDGEEDCGNGYDE-QNCDGFSLNNCGGKFFTCSDNKTIPRGYVCDENIDCSQGEDETGCTSP 2300
            C NG C+     CD  N C D SDED               TC    P +R+C      +P+      +W+CDG+ DC +  DE QNC   ++  C    F+C++ + + + + CD   DC    DE GC+ P
Sbjct: 2915 CDNGRCISGNWVCDGDNDCGDMSDEDQRHHCELQNCSSTQFTCVNSRPPNRRC------IPQ------YWVCDGDADCSDALDELQNC---TMRTCSAGEFSCANGRCVRQSFRCDRRNDCGDYSDERGCSYP 3032          

HSP 7 Score: 66.2402 bits (160), Expect = 1.663e-9
Identity = 49/149 (32.89%), Postives = 70/149 (46.98%), Query Frame = 3
Query: 1944 CQNGECLENAKFCDKINHCADKSDE--------DPITCR--ECDPISRKC-----------EINNQILPKKNYF--------LIHWICDGEEDCGNGYDEQNCDGFSLNNCGGKFFTCSDNKTIPRGYVCDENIDCSQGEDETGCTSPQ 2303
            C NG+C+ +   CD ++ C D SDE        D +TC    C   S++C           E N   L  +  F        L  ++CD + DC +  DE+NC+    + CGG  FTCS+ + I + +VCD + DC    DE GC S Q
Sbjct:  115 CSNGQCIPSEYRCDHVSDCPDGSDERNCHYPTCDQLTCANGACYNTSQRCDQKVDCRDSSDEANCTTLCSQKEFECGSGECILRAYVCDHDNDCEDNSDERNCN---YDTCGGHQFTCSNGQCINQNWVCDGDDDCQDSGDEDGCESNQ 260          

HSP 8 Score: 65.855 bits (159), Expect = 1.794e-9
Identity = 46/130 (35.38%), Postives = 62/130 (47.69%), Query Frame = 3
Query: 1911 VSDICPPGYRFCQNGECLENAKFCDKINHCADKSDEDPITCRECDPISRKCEINNQILPKKNYFLI-HW-ICDGEEDCGNGYDEQNCDGFSLNNCGGKFFTCSDNKTIPRGYVCDENIDCSQGEDETGCT 2294
             S  C PG   C NG C+  +  CD  N C D SDE PI   EC   +  C+ + +   K NY  I  W +C+G +DC +  DEQ C+    +  G   F C+++  IP  + CD   DC    DE  C 
Sbjct: 3633 ASRTCRPGQFKCNNGRCIPQSWKCDVDNDCGDYSDE-PID--ECTTAAYNCDNHTEFSCKTNYRCIPQWAVCNGFDDCRDNSDEQGCESVPCHPSGD--FRCANHHCIPLRWKCDGTDDCGDNSDEENCV 3757          

HSP 9 Score: 60.4622 bits (145), Expect = 7.712e-8
Identity = 40/116 (34.48%), Postives = 56/116 (48.28%), Query Frame = 3
Query: 1944 CQNGECLENAKFCDKINHCADKSDEDPITC--RECDPISRKCEINNQILPKKNYFLIHWICDGEEDCGNGYDEQNCDGFSLNNCGGKFFTC-SDNKTIPRGYVCDENIDCSQGEDE 2282
            C NG C+  +  C+ IN+C D    D   C    C P   KC+  N  +P+       ++CDG+ DCG+G DE N    + + C    F C S  + IP  + CD   DC+ G DE
Sbjct: 2789 CSNGRCIPLSYVCNGINNCHDNDTSDEKNCPPHTCPPDFTKCQTTNICVPRA------FLCDGDNDCGDGSDE-NPIYCASHTCRSNEFQCLSPQRCIPSYWFCDGEADCADGSDE 2897          

HSP 10 Score: 59.6918 bits (143), Expect = 1.516e-7
Identity = 43/131 (32.82%), Postives = 56/131 (42.75%), Query Frame = 3
Query: 1911 VSDICPPGYRFCQNGECLENAKFCDKINHCADKSDEDPITCR-ECDPISRKCEINNQILPKKNYFLIHWICDGEEDCGNGYDEQNCDGFSLNNCGGKFFTCSDNKT-IPRGYVCDENIDCSQGEDETGCTS 2297
             S  CP     C N  C+     CD  N C+D SDE        C P   +C  +  I P        ++CDG++DC +G DE  C    + NC    F C+D  + I   Y CD   DC    DE GC +
Sbjct: 1106 TSSTCPSTSFTCDNHVCIPKDWVCDTDNDCSDGSDEKNCQASGTCQPTQFRCPDHRCISPL-------YVCDGDKDCADGSDEAGC----VLNCTSAQFKCADGSSCINSRYRCDGVYDCRDNSDEAGCPT 1225          

HSP 11 Score: 59.3066 bits (142), Expect = 2.090e-7
Identity = 41/126 (32.54%), Postives = 60/126 (47.62%), Query Frame = 3
Query: 1923 CPPGYRFCQNGECLENAKFCDKINHCADKSDEDPITCRECDPISRKCEINNQILPKKNYFLI-HWICDGEEDCGNGYDE--QNCDGFSLNNCGGKFFTCSDNKTIPRGYVCDENIDCSQGEDETGC 2291
            CP     C+N  C+++   CD  N C D SDE+   C      +  CE   +     +  +  H +C+G +DCG+G DE  ++C   +   C    + CS+   I + YVCD   DC    DETGC
Sbjct: 3844 CPAAMFECKNHVCIQSFWICDGENDCVDGSDEEIHLC-----FNIPCESPQRFRCDNSRCVYGHQLCNGVDDCGDGSDEKEEHCRKPTHKPCTDTEYKCSNGNCISQHYVCDNVNDCGDLSDETGC 3964          

HSP 12 Score: 58.9214 bits (141), Expect = 2.785e-7
Identity = 44/123 (35.77%), Postives = 57/123 (46.34%), Query Frame = 3
Query: 1944 CQNGECLENAKFCDKINHCADKSDEDPITC--RECDPISRKCEINNQILPKKNYFLIHWICDGEEDCGNGYDE--QNCDGFSLNNCGGKFFTCSDN-KTIPRGYVCDENIDCSQGEDETGCTS 2297
            C N  C+  +  CD +N C D SDED   C  R C P   KC  N + +P+       W CD + DCG+  DE    C   + N      F+C  N + IP+  VC+   DC    DE GC S
Sbjct: 3603 CANKRCIPQSWQCDSVNDCLDNSDEDTSHCASRTCRPGQFKCN-NGRCIPQS------WKCDVDNDCGDYSDEPIDECTTAAYNCDNHTEFSCKTNYRCIPQWAVCNGFDDCRDNSDEQGCES 3718          

HSP 13 Score: 57.7658 bits (138), Expect = 5.293e-7
Identity = 41/124 (33.06%), Postives = 56/124 (45.16%), Query Frame = 3
Query: 1923 CPPGYRFCQNGECLENAKFCDKINHCADKSDEDPITCRECDPISRKCEINNQILPKKNYFLIHWICDGEEDCGNGYDEQNCDGFSLN-NCGGKFFTCSDNKTIPRGYVCDENIDCSQGEDETGC 2291
            C  G   C NG C+  +  CD+ N C D SDE   +   C      C+ N + +P+       ++CD + DCG+G DEQ     +    C    F C +   I  G VC+   DCS   DE GC
Sbjct: 2995 CSAGEFSCANGRCVRQSFRCDRRNDCGDYSDERGCSYPPCHANQFTCQ-NGRCIPR------FFVCDEDNDCGDGSDEQEHLCHTPEPTCPLHQFRCDNGHCIEMGRVCNHVDDCSDNSDEKGC 3111          

HSP 14 Score: 54.6842 bits (130), Expect = 4.561e-6
Identity = 40/129 (31.01%), Postives = 54/129 (41.86%), Query Frame = 3
Query: 1917 DICPPGYRFCQ-------NGECLENAKFCDKINHCADKSDEDPITCRECDPISRKCEINNQILPKKNYFLIHWICDGEEDCGNGYDEQNCDGFSLNNCGGKFFTCSDNKTIPRGYVCDENIDCSQGEDE 2282
            D+CP  +RFC+       +G C      C+    CAD SDED + C        +CE N      K      W CD   DC +  DE      S   C    F C++ + IP+ + CD + DC    DE
Sbjct: 3548 DLCP--HRFCRLGQFQCRDGNCTSPQALCNARQDCADGSDEDRVLCEH-----HRCESNEWQCANKRCIPQSWQCDSVNDCLDNSDEDTSHCAS-RTCRPGQFKCNNGRCIPQSWKCDVDNDCGDYSDE 3668          
BLAST of low density lipoprotein receptor-1 vs. TrEMBL
Match: A0A1Z1R275 (Low density lipoprotein receptor-related 1 (Fragment) OS=Schmidtea mediterranea OX=79327 PE=2 SV=1)

HSP 1 Score: 1665.97 bits (4313), Expect = 0.000e+0
Identity = 822/823 (99.88%), Postives = 823/823 (100.00%), Query Frame = 3
Query:  129 CIYQSLVKAETEEFTFGGASEEEETSPPNITFFPLKNDSIVKSEMQFINIACNVTNYALNETSIRWLDKDGKVAAANRYLYIKSLLKQDEGIYNCSVEKVKDPQIRFNRTLHLKITIPSISIDILPEESLKIGGQIKRQCSDLGLPQETIVDDFTYTWLNQQNKTIGNTNILQIPVVDESVVGRYICQYKSKETSKIYEAATYVNLKQSVSYKIKIITNPALFRYGERFSLRCEVEPFYQNIKYTWYKKDEFIGNDQELVIKSFKKDNVGTYKCVASLQLPSGKLDLMEESIQQFAFFRESKIELTTKPGPQVYVHRGEKKELHCEIETSSGNRGKEAEWYINGKKFKNGDIPLVNRLDGQYVSMLVISDISQINEGNYECRVGSSIKEVNLIVLLDEGLIETSPPILKVKEGQSVEFHCRVENIPSVKNVNLKWNFESKEGLVRNNIPDSRWQLMNDEIADQTSFIVLMKAEVSDSGYYICTEPNGQTARSELIVIPDKDKNSLTITPREIRVRAGQRVDIECFSKNTQGRASGNPEFSFTNNKPIGRDGRFKISNVGPAHKRLTAPGGLSLSDNNMDVFCSLEGRQVSSKIYVSDICPPGYRFCQNGECLENAKFCDKINHCADKSDEDPITCRECDPISRKCEINNQILPKKNYFLIHWICDGEEDCGNGYDEQNCDGFSLNNCGGKFFTCSDNKTIPRGYVCDENIDCSQGEDETGCTSPQIXXXXXXXXXXXXXQLVTLTCEATGKPLPVLVWRFNWGCIQNSTRFSTNFFSTDCNSVTSSLTIKDFKAGDDGIYNCEALSSRQRSFSNDFQVILKNN 2597
            CIYQSLVKAETEEFTFGGASEEEETSPPNITFFPLKNDSIVKSEMQFINIACNVTNYALNETSIRWLDKDGKVAAANRYLYIKSLLKQDEGIYNCSVEKVKDPQIRFNRTLHLKITIPSISIDILPEESLKIGGQIKRQCSDLGLPQETIVDDFTYTWLNQQNKTIGNTNILQIPVVDESVVGRYICQYKSKETSKIYEAATYVNLKQSVSYKIKIITNPALFRYGERFSLRCEVEPFYQNIKYTWYKKDEFIGNDQELVIKSFKKDNVGTYKCVASLQLPSGKLDLMEESIQQFAFFRESKIELTTKPGPQVYVHRGEKKELHCEIETSSGNRGKEAEWYINGKKFKNGDIPLVNRLDGQYVSMLVISDISQINEGNYECRVGSSIKEVNLIVLLDEGLIETSPPILKVKEGQSVEFHCRVENIPSVKNVNLKWNFESKEGLVRNNIPDSRWQLMNDEIADQTSFIVLMKAEVSDSGYYICTEPNGQTARSELIVIPDKDKNSLTITPREIRVRAGQRVDIECFSKNTQGRASGNPEFSFTNNKPIGRDGRFKISNVGPAHKRLTAPGGLSLSDNNMDVFCSLEGRQVSSKIYVSDICPPGYRFCQNGECLENAKFCDKINHCADKSDEDPITCRECDPISRKCEINNQ+LPKKNYFLIHWICDGEEDCGNGYDEQNCDGFSLNNCGGKFFTCSDNKTIPRGYVCDENIDCSQGEDETGCTSPQITKTSATKVVATKSQLVTLTCEATGKPLPVLVWRFNWGCIQNSTRFSTNFFSTDCNSVTSSLTIKDFKAGDDGIYNCEALSSRQRSFSNDFQVILKNN
Sbjct:    1 CIYQSLVKAETEEFTFGGASEEEETSPPNITFFPLKNDSIVKSEMQFINIACNVTNYALNETSIRWLDKDGKVAAANRYLYIKSLLKQDEGIYNCSVEKVKDPQIRFNRTLHLKITIPSISIDILPEESLKIGGQIKRQCSDLGLPQETIVDDFTYTWLNQQNKTIGNTNILQIPVVDESVVGRYICQYKSKETSKIYEAATYVNLKQSVSYKIKIITNPALFRYGERFSLRCEVEPFYQNIKYTWYKKDEFIGNDQELVIKSFKKDNVGTYKCVASLQLPSGKLDLMEESIQQFAFFRESKIELTTKPGPQVYVHRGEKKELHCEIETSSGNRGKEAEWYINGKKFKNGDIPLVNRLDGQYVSMLVISDISQINEGNYECRVGSSIKEVNLIVLLDEGLIETSPPILKVKEGQSVEFHCRVENIPSVKNVNLKWNFESKEGLVRNNIPDSRWQLMNDEIADQTSFIVLMKAEVSDSGYYICTEPNGQTARSELIVIPDKDKNSLTITPREIRVRAGQRVDIECFSKNTQGRASGNPEFSFTNNKPIGRDGRFKISNVGPAHKRLTAPGGLSLSDNNMDVFCSLEGRQVSSKIYVSDICPPGYRFCQNGECLENAKFCDKINHCADKSDEDPITCRECDPISRKCEINNQVLPKKNYFLIHWICDGEEDCGNGYDEQNCDGFSLNNCGGKFFTCSDNKTIPRGYVCDENIDCSQGEDETGCTSPQITKTSATKVVATKSQLVTLTCEATGKPLPVLVWRFNWGCIQNSTRFSTNFFSTDCNSVTSSLTIKDFKAGDDGIYNCEALSSRQRSFSNDFQVILKNN 823          
BLAST of low density lipoprotein receptor-1 vs. TrEMBL
Match: T1DBM0 (LDL-1 OS=Dendrocoelum lacteum OX=27895 PE=2 SV=1)

HSP 1 Score: 946.806 bits (2446), Expect = 0.000e+0
Identity = 459/815 (56.32%), Postives = 594/815 (72.88%), Query Frame = 3
Query:  162 EEFTFGGASEEEETSPPNITFFPLKNDSIVKSEMQFINIACNVTNYALNETSIRWLDKDGKVAAANRYLYIKSLLKQDEGIYNCSVEKVKDPQIRFNRTLHLKITIPSISIDILPEESLKIGGQIKRQCSDLGLPQETIVDDFTYTWLNQQNKTIGNTNILQIPVVDESVVGRYICQYKSKETSKIYEAATYVNLKQ---SVSYKIKIITNPALFRYGERFSLRCEVEPFYQNIKYTWYKKDEFIGNDQELVIKSFKKDNVGTYKCVASLQLPSGK-LDLMEESIQQFAFFRESKIELTTKPGPQVYVHRGEKKELHCEIETSSGNRGKEAEWYINGKKFKNGDIPLVNRLDGQYVSMLVISDISQINEGNYECRVGSSIKEVNLIVLLDEGLIETSPPILKVKEGQSVEFHCRVENIPSVKNVNLKWNFESKEGLVRNNIPDSRWQLMNDEIADQTSFIVLMKAEVSDSGYYICTEPNGQTARSELIVIPDKDKNSLTITPREIRVRAGQRVDIECFSKNTQGRASGNPEFSFTNNKPIGRDGRFKISNVGPAHKRLTAPGGLSLSDNNMDVFCSLEGRQVSSKIYVSDICPPGYRFCQNGECLENAKFCDKINHCADKSDEDPITCRECDPISRKCEINNQILPKKNYFLIHWICDGEEDCGNGYDEQNCDGFSLNNCGGKFFTCSDNKTIPRGYVCDENIDCSQGEDETGCTSPQIXXXXXXXXXXXXXQLVTLTCEATGKPLPVLVWRFNWGCIQNSTRFSTNFFSTDCNSVTSSLTIKDFKAGDDGIYNCEALSSRQRSFSNDFQVILKN 2594
            +EFTFGGA++EEE     +  F +KNDSIVKSEM+++ + CNVTN   N  + RWLDK+G V + N+ LY KSLLK  EGIY C VEK     ++ N+T  L ITIPSISI++LP+ESL+IGGQI R CSD      +I D  ++ W++++NKT+ N+N L IP+ DESV G Y C+ KS  TSK+Y A T VN+++   S +YKI+I T P    + + F+L C+V P    I+Y W K +  I  ++ + I SFKK+N+G YKC+A ++L +G  L L  ES+QQ   FR SK+EL   PG  + VH GEKKELHCEIE  +  RG E EWYIN   F+ GD   + RLD + VSMLVI +I   NEG YECR     KE+N++VL ++G+I+T+PP+L+VKEGQSVEFHCRV+N  +VKNV+LKW F SK+G V  +IP+ RW+  N +I ++TSF+ L  A ++D+GY ICTEPNGQ+A+SELIV    + N +TITP+EIRVR  QR DIECF+K  +GRASG P+F F+NNK +GRD RF  + VG +H RL+AP GL LS++NMDVFC    ++VSSKIY+ D CPPG+R+CQNG+CLENAKFCD    C DKSDEDP  C+ CDPIS+KCE++  I+P KNY+L+HW CDGEEDCGNGYDE+NC    L NCGGKFF CSD K IPRGY+CD+N DC  G+DE  CT P I KTS  ++ A ++Q VT+TCEA+GKPLP +VWRFNWGCIQ   RFS   +S++C +V+S+LTI +F+ GDDGIYNCEALSSRQR+FS+DFQV+L+N
Sbjct:   21 DEFTFGGAADEEEDEA--VINFNMKNDSIVKSEMEYLYVLCNVTNLKPNTFTARWLDKNGVVVSPNKILYFKSLLKHREGIYKCEVEK---DSVKSNKTFQLNITIPSISINVLPDESLQIGGQISRNCSDFKSMNLSITDTLSHEWVDEKNKTVSNSNFLVIPIKDESVSGTYECRLKSFATSKVYTAKTMVNVQRKVVSANYKIQISTTPGTITFAKMFTLNCDVTP-SNGIQYRWLKDNIEISTNKTIYIPSFKKENIGVYKCIAIVKLENGNNLTLEAESLQQLTLFRHSKVELDETPGYTIIVHSGEKKELHCEIEVEAKKRGVEVEWYINNTLFRRGDFRNIGRLDKELVSMLVIRNIVAQNEGKYECRYADKRKEINIVVLTEQGIIQTNPPLLRVKEGQSVEFHCRVDNFANVKNVDLKWKFRSKDGSVTYDIPNDRWETTNPDITEETSFLELNSAVMADNGYLICTEPNGQSAQSELIVTAG-EGNVITITPKEIRVRPHQRFDIECFTKTREGRASGQPKFFFSNNKAVGRDARFVETTVGQSHIRLSAPNGLPLSEDNMDVFCGSGDQRVSSKIYIKDTCPPGHRYCQNGQCLENAKFCDGKVDCEDKSDEDPNLCKACDPISKKCEVHRGIIPTKNYYLVHWACDGEEDCGNGYDEENCGEGYLENCGGKFFKCSDGKNIPRGYLCDQNADCDNGDDENLCTYPTIIKTSTKEIKAARTQQVTMTCEASGKPLPAIVWRFNWGCIQQLPRFSVRSYSSNCTTVSSTLTINNFQPGDDGIYNCEALSSRQRAFSDDFQVVLQN 828          
BLAST of low density lipoprotein receptor-1 vs. TrEMBL
Match: I1ZIB9 (Low density lipoprotein receptor-1 (Fragment) OS=Schmidtea mediterranea OX=79327 PE=2 SV=1)

HSP 1 Score: 720.694 bits (1859), Expect = 0.000e+0
Identity = 361/363 (99.45%), Postives = 361/363 (99.45%), Query Frame = 3
Query: 1509 ADQTSFIVLMKAEVSDSGYYICTEPNGQTARSELIVIPDKDKNSLTITPREIRVRAGQRVDIECFSKNTQGRASGNPEFSFTNNKPIGRDGRFKISNVGPAHKRLTAPGGLSLSDNNMDVFCSLEGRQVSSKIYVSDICPPGYRFCQNGECLENAKFCDKINHCADKSDEDPITCRECDPISRKCEINNQILPKKNYFLIHWICDGEEDCGNGYDEQNCDGFSLNNCGGKFFTCSDNKTIPRGYVCDENIDCSQGEDETGCTSPQIXXXXXXXXXXXXXQLVTLTCEATGKPLPVLVWRFNWGCIQNSTRFSTNFFSTDCNSVTSSLTIKDFKAGDDGIYNCEALSSRQRSFSNDFQVILKNN 2597
            ADQTSFIVLMKAEVSDSGYYICTEPNGQTARSELIVIPDKDKNSLTITPREIRVRAGQRVDIECFSKNTQGRASGNPEFSFTNNKPIGRDGRFKISNVGPAHKRLTAPGGLSLSDNNMDVFCSL GRQVSSKIYVSDICPPGYRFCQNGECLENAKFCDKINHCADKSDEDPITCRECDPISRKCEINNQILPKKNYFLIHWICDGEEDCGNGYDEQNCDGFSLNNCGGKFFTCSDNKTIPRGYVCDENIDCSQGEDETGCTSPQITKTSATKVVATKSQLVTLTCEATGKPLPVLVWRFNWGCIQNSTRFSTNFFSTDCN VTSSLTIKDFKAGDDGIYNCEALSSRQRSFSNDFQVILKNN
Sbjct:    1 ADQTSFIVLMKAEVSDSGYYICTEPNGQTARSELIVIPDKDKNSLTITPREIRVRAGQRVDIECFSKNTQGRASGNPEFSFTNNKPIGRDGRFKISNVGPAHKRLTAPGGLSLSDNNMDVFCSLXGRQVSSKIYVSDICPPGYRFCQNGECLENAKFCDKINHCADKSDEDPITCRECDPISRKCEINNQILPKKNYFLIHWICDGEEDCGNGYDEQNCDGFSLNNCGGKFFTCSDNKTIPRGYVCDENIDCSQGEDETGCTSPQITKTSATKVVATKSQLVTLTCEATGKPLPVLVWRFNWGCIQNSTRFSTNFFSTDCNFVTSSLTIKDFKAGDDGIYNCEALSSRQRSFSNDFQVILKNN 363          
BLAST of low density lipoprotein receptor-1 vs. TrEMBL
Match: A0A183A6H7 (Uncharacterized protein OS=Echinostoma caproni OX=27848 GN=ECPE_LOCUS2562 PE=4 SV=1)

HSP 1 Score: 442.965 bits (1138), Expect = 1.801e-138
Identity = 263/801 (32.83%), Postives = 409/801 (51.06%), Query Frame = 3
Query:  306 NETSIRWL----DKDGKVAAANRYLYIKSLLKQD-EGIYNCSVEKVKDPQIRFNRTLHLKI-----TIPS---ISIDILPEESLKIGGQIKRQCSDLGLPQETIVDDFTYTWLNQQNKTIGNTNILQIPVVDESVVGRYICQYKSKETSKIYEAATYV---NLKQSVSYKIKIITNPALFRYGERFSLRCEVEPF-YQNIKYTWYKKDEFIGNDQELVIKSFKKDNVGTYKCVASLQLPSGKLDLMEESIQ---QFAFFRESKIELTTKPGPQVYVHRGEKKELHCEIETSSGNRGKEAEWYINGKKFKNGDIPLVN------RLDGQYVSMLVISDISQINEGNYECRVGSSIKEVNLIVLLDEGLIETSPPILKVKEGQSVEFHCRVENIPSVKNVNLKWNFESKEGLVRNNI---PDSRWQLMNDEIADQTSFIVLMKAEVSDSGYYICTEPN-GQTARSELIVIPDKDKNSLTITPREIRVRAGQRVDIECFSKNTQGR-ASGNPEFSFTNNKPIGRDGRFKISNVGPAHKRLTAPGGLSLSDNNMDVFCSLEG--RQVSSKIYVSDICPPGYRFCQNGECLENAKFCDKINHCADKSDEDPITCRECDPISRKCEINNQILPKKNYFLIHWICDGEEDCGNGYDEQNCDGFSLNNCGGKFFTCSDN-KTIPRGYVCDENIDCSQGEDETGCTSPQIXXXXXXXXXXXXXQLVTLTCEATGKPLPVLVWRFNWGCI-QNSTRFSTNFFSTDCN----SVTSSLTIKDFKAGDDGIYNCEALSSRQRSFSNDFQVILK 2591
            +E S +W+    D   +  ++   LY+  +  +D +    C V ++ D Q+ F + L++++     ++P+   ++I  LP E L   G+I RQC  L    E I   F + WL+Q  + + N + L + + D + +G Y C+   + +S IY+A  +V   +  Q+  Y + I+ +      G  + + C VEP   + + + WY KD  +G+D  L + S    ++G+Y C A       +   M  +       A  +E++IE++  PG  +    GE +ELHCE    S       +W+  G+  +    P +N      R+D   VS++ +  +   + G YECRV   IK+ ++IV +++GL E +P    V EG  VEFHCR        N  ++W ++   G     +   P++ +   +   A  TSFI  ++A  SD G YIC  P+ G  AR  L V     +  + ITP  ++VR    +++EC+     GR A   P FS  +++      RF+   V     R     GL    N   V CS++G  R  +S I + D CP G+R C++G+CL   +FCD +  CAD SDEDP  C EC+P  RKCE      P K+  ++HWICDGE+DCGNG+DE NC       CG   FTC ++ + IPR +VCD++ DC  GEDE  C  P I  +   +        V LTC  TG PLP ++WRFNWGC+ +N  R+     + +C+    SV S+LTI + + GDDGIYNCE L+   R+ SND+ V+++
Sbjct:   69 HEYSFKWIRRLPDHSSQEVSSTAVLYLSDVRVEDMQHPLYCQVTRLSDGQV-FEKVLNIRMVGYGGSLPAELTLTIRSLPAEDLS-AGRIMRQC--LFENNEEINQQFDFRWLDQNGRVVTNGDALYLMLEDPADLGNYTCEATHRSSSNIYQAKYHVTRSSRAQASQYIVTIVPDTTQVLLGRPYEMLCRVEPMPSEPVSFRWYHKDRMVGSDARLRLPSLTYPDLGSYVCRAEWTPAYSRTGSMAANATVDLSLALTKEAEIEMSPPPGSVLVTLPGETRELHCEYGQLSN---PSVQWFFEGQPLERH--PTLNASSRVYRMDRLRVSIITLRGVEVGHGGTYECRVNGQIKQTHVIVRVEDGL-EVNPSEDTVDEGTPVEFHCRAHGADRNVNQEMQWFYQPFSGGPVEPVNLHPETGFVRQDHPYASHTSFISRLRARKSDEGIYICRLPSQGAEARGRLYVRATV-QYRVVITPSVVKVRVNNPIEMECYVMEDTGRPADVLPTFSLMDSRI-----RFEQERVAANRVRFIIRSGLGAEYNGTQVRCSVDGTDRFATSTIVIEDTCPHGFRRCRSGDCLPAGRFCDGVRDCADGSDEDPRLCNECEPTVRKCEYYQNRAPLKSTHMVHWICDGEDDCGNGFDEANCPDPLFAQCGDYMFTCPNSQRRIPRSFVCDKDQDCEYGEDERNCAGPTIESSGNYRHSVRAGTQVVLTCRVTGHPLPRVIWRFNWGCLPENDNRYRVTSVAQNCDSPMPSVVSTLTISNVRPGDDGIYNCEGLAGSMRAMSNDYFVMIE 853          
BLAST of low density lipoprotein receptor-1 vs. TrEMBL
Match: A0A4E0RPR1 (Basement membrane-specific heparan sulfate proteoglycan core protein OS=Fasciola hepatica OX=6192 GN=D915_000102 PE=4 SV=1)

HSP 1 Score: 426.787 bits (1096), Expect = 2.268e-132
Identity = 268/848 (31.60%), Postives = 422/848 (49.76%), Query Frame = 3
Query:  162 EEFTFGGASEEEETSPPNITFFPLKNDSIVKSEMQFINIACNVTNYALNETSIRWL----DKDGKVAAANRYLYIKSLLKQD-EGIYNCSVEKVKDPQIRFNRTLHLKI------TIPS---ISIDILPEESLKIGGQIKRQCSDLGLPQETIVDDFTYTWLNQQNKTIGNTNILQIPVVDESVVGRYICQYKSKETSKIYEAATYV---NLKQSVSYKIKIITNPA-LFRYGERFSLRCEVEPF-YQNIKYTWYKKDEFIGNDQELVIKSFKKDNVGTYKCVASLQLPSGKLDLMEESIQQFAFFRESKIELTTKPGPQVYVHRGEKKELHCEIETSSGNRGKEAEWYINGKKFKNGDIPLVN------RLDGQYVSMLVISDISQINEGNYECRVGSSIKEVNLIVLLDEGLIETSPPILKVKEGQSVEFHCRVENIPSVKNVNLKWNFESKEGLVRNNI---PDSRWQLMNDEIADQTSFIVLMKAEVSDSGYYICTEPN-GQTARSELIVIPDKDKNSLTITPREIRVRAGQRVDIECFSKNTQGR-ASGNPEFSFTNNKPIGRDGRFKISNVGPAHKRLTAPGGLSLSDNNMDVFCSLEG--RQVSSKIYVSDICPPGYRFCQNGECLENAKFCDKINHCADKSDEDPITCRECDPISRKCEINNQILPKKNYFLIHWICDGEEDCGNGYDEQNCDGFSLNNCGGKFFTCSDN-KTIPRGYVCDENIDCSQGEDETGCTSPQIXXXXXXXXXXXXXQLVTLTCEATGKPLPVLVWRFNWGCI-QNSTRFSTNFFSTDCN----SVTSSLTIKDFKAGDDGIYNCEALSSRQRSFSNDFQVILK 2591
            E+ +  G  +++E   P IT  P     +  +  + +   C V+N   +E S++W+    D   +  ++   LYI     ++ +    C   ++ D Q  F + L++++      ++P+   ++I  LP E L  G +I RQC   G   E + + F + WL+Q  + + N + L + + D + +G Y C+   + ++ IY+A  +V   +  Q+  Y + ++ + A     G  + + C VEP   + + Y WY  D  +G+D  L + S    ++G Y C A                   A+ R  K  ++  PG  +    GE +ELHCE    S       +W+  G+  +    P +N      R+D   VS++ +S +   + G YECR+   IK+ ++IV +++GL E +P    V EG  VEFHCR        N  ++W ++   G     +   P++ +   +   A  TSFI  ++A  SD G YIC  P+ G  AR  L V     +  + ITP  ++VR    ++ EC+     GR A   P FS  +++      RF    V     R     GL+   N   V C++EG  R  +S I + D CP G+R C++G+CL   +FCD    C D SDEDP  C EC+P  +KCE      P K+ ++IHW+CDGE+DCGNG+DE NC   S+  CG   FTC ++ + IPR +VCD++ DC  GEDE  C  P I   +  +        V LTC  TG PLP ++WRFNWGC+ +N  R+     + +C+    SV S+LTI + + GDDGIYNCE LS   R+ SND+ V+++
Sbjct:   26 EDISLAGYHQDDE---PEITLMPGDPGPLEVNLGEQVYSRCTVSNS--HEYSVKWIRRLPDHSTQEVSSTAMLYIPEARAEEMQHPLYCQATRLSDGQT-FEKALNIRMVGYGGASLPADLTLTIRSLPAEDLSTG-RIMRQCLFEG--NEEVNEQFDFRWLDQNGRVVTNGDALYLMLEDPADLGNYTCEATHRSSNNIYQAKYHVTRPSHAQASQYVVTVVPDAASQVLLGRPYEMLCRVEPMPSEPVTYRWYHNDRMVGSDARLRLPSLAYPDIGNYVCRAEWTP---------------AYSRSGK--MSPPPGSVLVTLPGETRELHCEFGQLSS---PSVQWFFEGQPLERH--PTLNASRRVYRMDRLRVSIVTLSGVEVGHGGTYECRINGQIKQTHVIVRVEDGL-EVNPSEDTVDEGTPVEFHCRAHGADQNVNREMQWFYQPFSGGPIQPVDLNPETGFVRQDHPYASHTSFISRLRARKSDEGIYICRLPSEGSEARGRLYVR-STVQYRVVITPPVLKVRVNNPIEFECYVVEDTGRQADVLPNFSVLDSR-----IRFDQERVAANRVRFLIRSGLTSEYNGTQVRCAVEGTDRYATSTIVIEDTCPHGFRRCRSGDCLPAGRFCDGRRDCPDGSDEDPRLCNECEPTVKKCEYYQNRPPLKSTYMIHWMCDGEDDCGNGFDEANCPDPSIAQCGDYMFTCPNSQRRIPRSFVCDKDQDCEYGEDERNCVGPTIESIADYRHSVRAGTQVILTCRVTGNPLPRVIWRFNWGCLPENDNRYRITNVAQNCDSPMPSVISTLTISNVRPGDDGIYNCEGLSGSMRAMSNDYFVMIE 835          
BLAST of low density lipoprotein receptor-1 vs. Ensembl Cavefish
Match: hspg2 (heparan sulfate proteoglycan 2 [Source:ZFIN;Acc:ZDB-GENE-080807-4])

HSP 1 Score: 128.642 bits (322), Expect = 1.114e-29
Identity = 80/228 (35.09%), Postives = 108/228 (47.37%), Query Frame = 3
Query: 1941 FCQNGECLENAKFCDKINHCADKSDEDPITCRECDPISRKCEINNQILPKKNYFLIHWICDGEEDCGNGYDEQNCDGFSLNN-CGGKFFTC-SDNKTIPRGYVCDENIDCSQGEDETGCTSPQIXXXXXXXXXXXXXQLVTLTCEATGKPLPVLVWRFNWGCIQNSTRFSTNFFSTDCNSVTSSLTIKDFKAGDDGIYNCEALSSRQRSFSNDFQVILKNN*STEFYY 2618
             CQNG+C+     CD    C D SDE  + C    P    CE N          L  W CDG+ DC +  DE +C      + C  + F C SD   IP  Y CDE  DC+   DE GC  P +T      V A +   VT TC+A G P P++ WR NWG I  S+R +         +   +LTI+D K GD G Y CEA++++   F+    V+  N  +  F++
Sbjct:  197 MCQNGQCISRDYLCDGERDCTDGSDE--MKCGTPSP----CEPNEFKCKNGRCALKLWRCDGDNDCKDNSDEMDCPVRRPGDACAPEQFVCLSDRACIPASYQCDEEPDCADRSDEYGCAPPTVTSPPEDSVTAMRGGTVTFTCKAVGVPTPIITWRLNWGHIPVSSRITMTS-----ENGQGTLTIRDVKEGDQGAYTCEAINAKGLVFAIPDGVLTLNRNAGPFFF 413          

HSP 2 Score: 78.9518 bits (193), Expect = 1.919e-14
Identity = 113/498 (22.69%), Postives = 196/498 (39.36%), Query Frame = 3
Query:  357 NRYLYIKSLLKQDEGIYNCSVEKVKDPQIRFNRTLHLK-------ITIPSISIDILPEESLKIGGQIKRQCSDLGLPQETIVDDFTYTWLNQQNKTIGNTNILQIPV-----VDESVVGRYICQYKSKETSKIYEAATYVNLKQSVSY---KIKIITNPALFRYGERFSLRCEVEPFYQNIKYTWYKKDEFIGNDQELVIKSFKKDNVGTYKCVASLQLPSGKLDLMEESIQQFAFFRESKIELTTKPGPQVYVH-------RGEKKELHCEIETSSGNRGKEAEWYINGKKFKNGDIPLVNRLDGQYVSMLVISDISQINEGNYECRV--GSSIKEVNLIVL-------LDEGLIETSPPILKVKEGQSVEFHCRVENIPSVKNVNLKWNFESKEGLVRNNIPDSRWQLMNDEIADQTSFIVLMKAEVSDSGYYICTEPNGQTARSELIVIPDKDKNSLTITPR-EIRVRAGQRVDIECFSKNTQGRASGNPEFSFT 1754
            N  L I+++  +D G+Y C+   +       +  LH++       I +P  +I   P  +++ G + + +C+  G P   +       W     K I +  +++  V     VD S  G YIC+  +        A  YV+   SV Y    +++         GE   L C       +   TW K+ E   +   L + + K+ + GTY CV +  + S                 E++IE+T   G  V +         GE  +L+C +    GN      W        NG +   +++ G   + L I   SQ + G Y CRV  G  +++ ++ V        L   +I   P    VK G+   F CRV +    + V L+W   + +      IPD      N +I+   S I +  A+  + G Y C   N       ++ +  ++    T+TP   + V+ G  +++EC       +A+G P  S +
Sbjct: 1674 NGILTIQNVQPEDYGVYVCTGSNMFG-MDESSAVLHVQGSSLIKTIQLPVATIQP-PVLTIQQGQRAEFRCTASGNPAPAV------EWTGGPGKRISSNAVIRGGVLTFTSVDRSDEGDYICRALNTHGEHTARAVLYVH-STSVPYLLPHVQVSPQQVELHEGETLRLYCRAG-GTPSPGLTWKKRVERT-DFGTLTVPNMKRSDGGTYLCVGTNAVGS----------------SEARIEVTVVKGNDVSIQPSEASVVEGETLDLNCFV---PGNPPPSVTW-----SRANGYLSPNHQVIG---TQLRILRASQEDSGEYICRVDGGPHVRQASVSVSVTSESSRLQSPIISIEPHSAAVKLGEPASFRCRVHS--GAQPVRLEWKLTNNQ-----PIPD------NAKISPDGSVITITNAQSKNKGTYRCVASNPFGITQSIVSLIVRESPRATVTPTGPVHVKVGDPINLEC-------QAAGEPRPSVS 2113          

HSP 3 Score: 77.411 bits (189), Expect = 5.674e-14
Identity = 115/526 (21.86%), Postives = 190/526 (36.12%), Query Frame = 3
Query:  270 INIACNVTNYALNETSIRWLDKDGKVAAA-------NRYLYIKSLLKQDEGIYNCSVEKVKDP-QIRFNRTLHLKITIPSISIDILPEESLKI---GGQIKRQCSDLGLPQETIVDDFTYTWLNQQNKTIGNTNILQIPVVDESVVGRYICQYKSKETSKIYEAATYVNLKQSVSYKIKIITNPALFRYGERFSLRCEVEPFYQNIKYTWYKKDEFIGNDQE-----LVIKSFKKDNVGTYKCVASLQLPSGKLDLMEE-SIQQFAFFRESKIELTTKPGPQVYVHR-GEKKELHCEIETSSGNRGKEAEWYINGKKFKNGDIPLVNRL-DGQYVSMLVISDISQINEGNYECRVGSSIKEVN-----LIVLLDEGLIETSPPILKVKEGQSVEFHCRVENIPSVKNVNLKWNFESKEGLVRNNIPDSRWQLMNDEIADQT----SFIVLMKAEVSDSGYYICTEPNGQTARSELIVIPDKDKNSLTITPREIRVRAGQRVDIECFSKNTQGRASGNPEFSFTNNK 1763
            IN+ C          S   LD   K   +       N  L I     +D G Y C+ +  +   + R    +     +P++    +  E +K+   G      C   G P+ TI        L  ++K +  + +L  P V     G+YIC      T+ +  +   + L    +    ++ +    R GE   L+C        +++ W K    +    E     L I     D+ GTYKCVAS ++  G  + M + S++           L+ +  PQV V   G   E  C   +++G    + EW   G     G +P  + + DG    +L I ++ + NEG Y CR  SS  +        I  L + +I     +  V  G SVEF C+    P                      P  RW  +  ++ D        + +++   +D+G Y CT  N   +    +V+  +    +   P    V  G      C        ASG P  + T +K
Sbjct: 2098 INLECQAAGEPRPSVSWHRLDNARKTMLSSPVPMESNAVLQILVARAEDSGTYVCTAQNNQGTTETRIEVIVEGGPAVPTVPRASV-REPMKVVVEGSTTTLHCDGYGFPKPTISWSKLRAPLPWRHKIVNGSLVL--PSVGRQDSGQYICNV----TNHMGTSEATIMLDVETTPYTTLLPDDVSVRVGEVIRLQCLAH-GTPPLRFEWSKVGGVLPATAEQQGGDLQINLASPDDAGTYKCVASNKV--GHSEAMAKVSVRLICNRVVCSAPLSVRVSPQVDVKALGSAAEFTC---SANGGPDIKLEWLKEG-----GALPPNHHVRDG----VLRIENLEKSNEGVYICRATSSYGQAQDSARLTIQALPKVMINVRTSVQTVMVGNSVEFECQAVGEPK---------------------PTIRWSKVGGKLPDHVQVKGGMLRIIQVTEADAGQYRCTATNDVGSVQSTVVLSIQSLPQIATQPETKEVTVGSNAVFPCI-------ASGYPVPTITWSK 2573          

HSP 4 Score: 71.2478 bits (173), Expect = 4.873e-12
Identity = 106/477 (22.22%), Postives = 186/477 (38.99%), Query Frame = 3
Query:  366 LYIKSLLKQDEGIYNC-SVEKVKDPQIRFNRTLHLKITIPSISIDILPEESLKIGGQ-IKRQCSDLGLPQETIVDDFTYTWLNQQNKTIGNTNILQIPVVDESVVGRYICQ-----YKSKETSKIYEAATYVNLKQSVSYKIKIITNPALFRYGERFSLRCEVEPFYQNIKYTW-------YKKDEFIGNDQELV-IKSFKKDNVGTYKCVASLQLPSGKLDLMEESIQQFAFFRESKIELTTKPGPQVYVHRGEKKELHCEIETSSGNRGKEAEWYI--NGKK-FKNGDIPLVNRLDGQYVSMLVISDISQINEGNYECRV--GSSIKEVNLIVLLDEG-LIETSP------PILKVKEGQSVEFHCRVENIPSVKNVNLKWNFESKEGLVRNNIPDSRWQLMNDEIADQTSFIVLMKAEVSDSGYYICTEPNGQTARSELIVIPDKDKNSLTITPREIRVRAGQRVDIECFSKNT 1715
            L + ++ + D G Y C     V   + R   T+     +    + I P E+  + G+ +   C   G P  ++       +L+  ++ IG    L+I    +   G YIC+     +  + +  +   +    L+  +   I I  + A  + GE  S RC V    Q ++  W          +  I  D  ++ I + +  N GTY+CVAS   P G    + +SI      RES     T  GP V+V  G+   L C+   ++G       W+   N +K   +  +P+ +       ++L I      + G Y C         E  + V+++ G  + T P      P+  V EG +   HC     P      + W+       +R  +P  R +++N  +       VL      DSG YIC   N        I++  +     T+ P ++ VR G+ + ++C +  T
Sbjct: 1860 LTVPNMKRSDGGTYLCVGTNAVGSSEARIEVTV-----VKGNDVSIQPSEASVVEGETLDLNCFVPGNPPPSVTWSRANGYLSPNHQVIGTQ--LRILRASQEDSGEYICRVDGGPHVRQASVSVSVTSESSRLQSPI---ISIEPHSAAVKLGEPASFRCRVHSGAQPVRLEWKLTNNQPIPDNAKISPDGSVITITNAQSKNKGTYRCVASN--PFG----ITQSIVSL-IVRESPRATVTPTGP-VHVKVGDPINLECQ---AAGEPRPSVSWHRLDNARKTMLSSPVPMESN------AVLQILVARAEDSGTYVCTAQNNQGTTETRIEVIVEGGPAVPTVPRASVREPMKVVVEGSTTTLHCDGYGFP---KPTISWS------KLRAPLP-WRHKIVNGSL-------VLPSVGRQDSGQYICNVTNHMGTSEATIMLDVETTPYTTLLPDDVSVRVGEVIRLQCLAHGT 2292          
BLAST of low density lipoprotein receptor-1 vs. Ensembl Cavefish
Match: hspg2 (heparan sulfate proteoglycan 2 [Source:ZFIN;Acc:ZDB-GENE-080807-4])

HSP 1 Score: 128.257 bits (321), Expect = 1.404e-29
Identity = 80/228 (35.09%), Postives = 108/228 (47.37%), Query Frame = 3
Query: 1941 FCQNGECLENAKFCDKINHCADKSDEDPITCRECDPISRKCEINNQILPKKNYFLIHWICDGEEDCGNGYDEQNCDGFSLNN-CGGKFFTC-SDNKTIPRGYVCDENIDCSQGEDETGCTSPQIXXXXXXXXXXXXXQLVTLTCEATGKPLPVLVWRFNWGCIQNSTRFSTNFFSTDCNSVTSSLTIKDFKAGDDGIYNCEALSSRQRSFSNDFQVILKNN*STEFYY 2618
             CQNG+C+     CD    C D SDE  + C    P    CE N          L  W CDG+ DC +  DE +C      + C  + F C SD   IP  Y CDE  DC+   DE GC  P +T      V A +   VT TC+A G P P++ WR NWG I  S+R +         +   +LTI+D K GD G Y CEA++++   F+    V+  N  +  F++
Sbjct:  197 MCQNGQCISRDYLCDGERDCTDGSDE--MKCGTPSP----CEPNEFKCKNGRCALKLWRCDGDNDCKDNSDEMDCPVRRPGDACAPEQFVCLSDRACIPASYQCDEEPDCADRSDEYGCAPPTVTSPPEDSVTAMRGGTVTFTCKAVGVPTPIITWRLNWGHIPVSSRITMTS-----ENGQGTLTIRDVKEGDQGAYTCEAINAKGLVFAIPDGVLTLNRNAGPFFF 413          

HSP 2 Score: 80.4925 bits (197), Expect = 7.433e-15
Identity = 111/491 (22.61%), Postives = 193/491 (39.31%), Query Frame = 3
Query:  357 NRYLYIKSLLKQDEGIYNCSVEKVKDPQIRFNRTLHLKITIPSISIDILPEESLKIGGQIKRQCSDLGLPQETIVDDFTYTWLNQQNKTIGNTNILQIPV-----VDESVVGRYICQYKSKETSKIYEAATYVNLKQSVSY---KIKIITNPALFRYGERFSLRCEVEPFYQNIKYTWYKKDEFIGNDQELVIKSFKKDNVGTYKCVASLQLPSGKLDLMEESIQQFAFFRESKIELTTKPGPQVYVH-------RGEKKELHCEIETSSGNRGKEAEWYINGKKFKNGDIPLVNRLDGQYVSMLVISDISQINEGNYECRV--GSSIKEVNLIVL-------LDEGLIETSPPILKVKEGQSVEFHCRVENIPSVKNVNLKWNFESKEGLVRNNIPDSRWQLMNDEIADQTSFIVLMKAEVSDSGYYICTEPNGQTARSELIVIPDKDKNSLTITPR-EIRVRAGQRVDIECFSKNTQGRASGNPEFSFT 1754
            N  L I+++  +D G+Y C+   +       +  LH    + +I   +L   +++ G + + +C+  G P   +       W     K I +  +++  V     VD S  G YIC+  +        A  YV+   SV Y    +++         GE   L C       +   TW K+ E   +   L + + K+ + GTY CV +  + S                 E++IE+T   G  V +         GE  +L+C +    GN      W        NG +   +++ G   + L I   SQ + G Y CRV  G  +++ ++ V        L   +I   P    VK G+   F CRV +    + V L+W   + +      IPD      N +I+   S I +  A+  + G Y C   N       ++ +  ++    T+TP   + V+ G  +++EC       +A+G P  S +
Sbjct: 1687 NGILTIQNVQPEDYGVYVCTGSNMFG-MDESSAVLHGSQPVATIQPPVL---TIQQGQRAEFRCTASGNPAPAV------EWTGGPGKRISSNAVIRGGVLTFTSVDRSDEGDYICRALNTHGEHTARAVLYVH-STSVPYLLPHVQVSPQQVELHEGETLRLYCRAG-GTPSPGLTWKKRVERT-DFGTLTVPNMKRSDGGTYLCVGTNAVGS----------------SEARIEVTVVKGNDVSIQPSEASVVEGETLDLNCFV---PGNPPPSVTW-----SRANGYLSPNHQVIG---TQLRILRASQEDSGEYICRVDGGPHVRQASVSVSVTSESSRLQSPIISIEPHSAAVKLGEPASFRCRVHS--GAQPVRLEWKLTNNQ-----PIPD------NAKISPDGSVITITNAQSKNKGTYRCVASNPFGITQSIVSLIVRESPRATVTPTGPVHVKVGDPINLEC-------QAAGEPRPSVS 2117          

HSP 3 Score: 77.411 bits (189), Expect = 6.073e-14
Identity = 116/532 (21.80%), Postives = 192/532 (36.09%), Query Frame = 3
Query:  270 INIACNVTNYALNETSIRWLDKDGKVAAA-------NRYLYIKSLLKQDEGIYNCSVEKVKDP-QIRFNRTLHLKITIPSISIDILPEESLKI---GGQIKRQCSDLGLPQETIVDDFTYTWLNQQNKTIGNTNILQIPVVDESVVGRYICQYKSKETSKIYEAATYVNLKQSVSYKIKIITNPALFRYGERFSLRCEVEPFYQNIKYTWYKKDEFIGNDQE-----LVIKSFKKDNVGTYKCVASLQLPSGKLDLMEE---SIQQFAFFRESKI----ELTTKPGPQVYVHR-GEKKELHCEIETSSGNRGKEAEWYINGKKFKNGDIPLVNRL-DGQYVSMLVISDISQINEGNYECRVGSSIKEVN-----LIVLLDEGLIETSPPILKVKEGQSVEFHCRVENIPSVKNVNLKWNFESKEGLVRNNIPDSRWQLMNDEIADQT----SFIVLMKAEVSDSGYYICTEPNGQTARSELIVIPDKDKNSLTITPREIRVRAGQRVDIECFSKNTQGRASGNPEFSFTNNK 1763
            IN+ C          S   LD   K   +       N  L I     +D G Y C+ +  +   + R    +     +P++    +  E +K+   G      C   G P+ TI        L  ++K +  + +L  P V     G+YIC      T+ +  +   + L    +    ++ +    R GE   L+C        +++ W K    +    E     L I     D+ GTYKCVAS ++  G  + M +       F F   +++     L+ +  PQV V   G   E  C   +++G    + EW   G     G +P  + + DG    +L I ++ + NEG Y CR  SS  +        I  L + +I     +  V  G SVEF C+    P                      P  RW  +  ++ D        + +++   +D+G Y CT  N   +    +V+  +    +   P    V  G      C        ASG P  + T +K
Sbjct: 2102 INLECQAAGEPRPSVSWHRLDNARKTMLSSPVPMESNAVLQILVARAEDSGTYVCTAQNNQGTTETRIEVIVEGGPAVPTVPRASV-REPMKVVVEGSTTTLHCDGYGFPKPTISWSKLRAPLPWRHKIVNGSLVL--PSVGRQDSGQYICNV----TNHMGTSEATIMLDVETTPYTTLLPDDVSVRVGEVIRLQCLAH-GTPPLRFEWSKVGGVLPATAEQQGGDLQINLASPDDAGTYKCVASNKV--GHSEAMAKVSVRCDTFTFLICNRVVCSAPLSVRVSPQVDVKALGSAAEFTC---SANGGPDIKLEWLKEG-----GALPPNHHVRDG----VLRIENLEKSNEGVYICRATSSYGQAQDSARLTIQALPKVMINVRTSVQTVMVGNSVEFECQAVGEPK---------------------PTIRWSKVGGKLPDHVQVKGGMLRIIQVTEADAGQYRCTATNDVGSVQSTVVLSIQSLPQIATQPETKEVTVGSNAVFPCI-------ASGYPVPTITWSK 2583          

HSP 4 Score: 71.2478 bits (173), Expect = 4.874e-12
Identity = 106/477 (22.22%), Postives = 186/477 (38.99%), Query Frame = 3
Query:  366 LYIKSLLKQDEGIYNC-SVEKVKDPQIRFNRTLHLKITIPSISIDILPEESLKIGGQ-IKRQCSDLGLPQETIVDDFTYTWLNQQNKTIGNTNILQIPVVDESVVGRYICQ-----YKSKETSKIYEAATYVNLKQSVSYKIKIITNPALFRYGERFSLRCEVEPFYQNIKYTW-------YKKDEFIGNDQELV-IKSFKKDNVGTYKCVASLQLPSGKLDLMEESIQQFAFFRESKIELTTKPGPQVYVHRGEKKELHCEIETSSGNRGKEAEWYI--NGKK-FKNGDIPLVNRLDGQYVSMLVISDISQINEGNYECRV--GSSIKEVNLIVLLDEG-LIETSP------PILKVKEGQSVEFHCRVENIPSVKNVNLKWNFESKEGLVRNNIPDSRWQLMNDEIADQTSFIVLMKAEVSDSGYYICTEPNGQTARSELIVIPDKDKNSLTITPREIRVRAGQRVDIECFSKNT 1715
            L + ++ + D G Y C     V   + R   T+     +    + I P E+  + G+ +   C   G P  ++       +L+  ++ IG    L+I    +   G YIC+     +  + +  +   +    L+  +   I I  + A  + GE  S RC V    Q ++  W          +  I  D  ++ I + +  N GTY+CVAS   P G    + +SI      RES     T  GP V+V  G+   L C+   ++G       W+   N +K   +  +P+ +       ++L I      + G Y C         E  + V+++ G  + T P      P+  V EG +   HC     P      + W+       +R  +P  R +++N  +       VL      DSG YIC   N        I++  +     T+ P ++ VR G+ + ++C +  T
Sbjct: 1864 LTVPNMKRSDGGTYLCVGTNAVGSSEARIEVTV-----VKGNDVSIQPSEASVVEGETLDLNCFVPGNPPPSVTWSRANGYLSPNHQVIGTQ--LRILRASQEDSGEYICRVDGGPHVRQASVSVSVTSESSRLQSPI---ISIEPHSAAVKLGEPASFRCRVHSGAQPVRLEWKLTNNQPIPDNAKISPDGSVITITNAQSKNKGTYRCVASN--PFG----ITQSIVSL-IVRESPRATVTPTGP-VHVKVGDPINLECQ---AAGEPRPSVSWHRLDNARKTMLSSPVPMESN------AVLQILVARAEDSGTYVCTAQNNQGTTETRIEVIVEGGPAVPTVPRASVREPMKVVVEGSTTTLHCDGYGFP---KPTISWS------KLRAPLP-WRHKIVNGSL-------VLPSVGRQDSGQYICNVTNHMGTSEATIMLDVETTPYTTLLPDDVSVRVGEVIRLQCLAHGT 2296          
BLAST of low density lipoprotein receptor-1 vs. Ensembl Cavefish
Match: hspg2 (heparan sulfate proteoglycan 2 [Source:ZFIN;Acc:ZDB-GENE-080807-4])

HSP 1 Score: 125.946 bits (315), Expect = 9.443e-29
Identity = 79/220 (35.91%), Postives = 104/220 (47.27%), Query Frame = 3
Query: 1941 FCQNGECLENAKFCDKINHCADKSDEDPITCRECDPISRKCEINNQILPKKNYFLIHWICDGEEDCGNGYDEQNCDGFSLNN-CGGKFFTC-SDNKTIPRGYVCDENIDCSQGEDETGCTSPQIXXXXXXXXXXXXXQLVTLTCEATGKPLPVLVWRFNWGCIQNSTRFSTNFFSTDCNSVTSSLTIKDFKAGDDGIYNCEALSSRQRSFSNDFQVILKN 2594
             CQNG+C+     CD    C D SDE  + C    P    CE N          L  W CDG+ DC +  DE +C      + C  + F C SD   IP  Y CDE  DC+   DE GC  P +T      V A +   VT TC+A G P P++ WR NWG I  S+R +         +   +LTI+D K GD G Y CEA++++   F+    V+  N
Sbjct:  202 MCQNGQCISRDYLCDGERDCTDGSDE--MKCGTPSP----CEPNEFKCKNGRCALKLWRCDGDNDCKDNSDEMDCPVRRPGDACAPEQFVCLSDRACIPASYQCDEEPDCADRSDEYGCAPPTVTSPPEDSVTAMRGGTVTFTCKAVGVPTPIITWRLNWGHIPVSSRITMT-----SENGQGTLTIRDVKEGDQGAYTCEAINAKGLVFAIPDGVLTLN 410          

HSP 2 Score: 75.8702 bits (185), Expect = 2.154e-13
Identity = 114/525 (21.71%), Postives = 188/525 (35.81%), Query Frame = 3
Query:  270 INIACNVTNYALNETSIRWLDKDGKVA-------AANRYLYIKSLLKQDEGIYNCSVEKVKDP-QIRFNRTLHLKITIPSISIDILPEESLKI---GGQIKRQCSDLGLPQETIVDDFTYTWLNQQNKTIGNTNILQIPVVDESVVGRYICQYKSKETSKIYEAATYVNLKQSVSYKIKIITNPALFRYGERFSLRCEVEPFYQNIKYTWYKKDEFIGNDQE-----LVIKSFKKDNVGTYKCVASLQLPSGKLDLMEESIQQFAFFRESKIELTTKPGPQVYVHR-GEKKELHCEIETSSGNRGKEAEWYINGKKFKNGDIPLVNRL-DGQYVSMLVISDISQINEGNYECRVGSSIKEVN-----LIVLLDEGLIETSPPILKVKEGQSVEFHCRVENIPSVKNVNLKWNFESKEGLVRNNIPDSRWQLMNDEIADQT----SFIVLMKAEVSDSGYYICTEPNGQTARSELIVIPDKDKNSLTITPREIRVRAGQRVDIECFSKNTQGRASGNPEFSFTNNK 1763
            IN+ C          S   LD   K          +N  L I     +D G Y C+ +  +   + R    +     +P++    +  E +K+   G      C   G P+ TI        L  ++K +  + +L  P V     G+YIC      T+ +  +   + L    +    ++ +    R GE   L+C        +++ W K    +    E     L I     D+ GTYKCVAS ++  G  + M +           +  L+ +  PQV V   G   E  C   +++G    + EW   G     G +P  + + DG    +L I ++ + NEG Y CR  SS  +        I  L + +I     +  V  G SVEF C+    P                      P  RW  +  ++ D        + +++   +D+G Y CT  N   +    +V+  +    +   P    V  G      C        ASG P  + T +K
Sbjct: 2243 INLECQAAGEPRPSVSWHRLDNARKTMLSSPVPMESNAVLQILVARAEDSGTYVCTAQNNQGTTETRIEVIVEGGPAVPTVPRASV-REPMKVVVEGSTTTLHCDGYGFPKPTISWSKLRAPLPWRHKIVNGSLVL--PSVGRQDSGQYICNV----TNHMGTSEATIMLDVETTPYTTLLPDDVSVRVGEVIRLQCLAH-GTPPLRFEWSKVGGVLPATAEQQGGDLQINLASPDDAGTYKCVASNKV--GHSEAMAKV--------SVRSPLSVRVSPQVDVKALGSAAEFTC---SANGGPDIKLEWLKEG-----GALPPNHHVRDG----VLRIENLEKSNEGVYICRATSSYGQAQDSARLTIQALPKVMINVRTSVQTVMVGNSVEFECQAVGEPK---------------------PTIRWSKVGGKLPDHVQVKGGMLRIIQVTEADAGQYRCTATNDVGSVQSTVVLSIQSLPQIATQPETKEVTVGSNAVFPCI-------ASGYPVPTITWSK 2709          

HSP 3 Score: 71.633 bits (174), Expect = 4.237e-12
Identity = 109/500 (21.80%), Postives = 192/500 (38.40%), Query Frame = 3
Query:  318 IRWLDKDGKVAAANRY-------LYIKSLLKQDEGIYNC-SVEKVKDPQIRFNRTLHLKITIPSISIDILPEESLKIGGQ-IKRQCSDLGLPQETIVDDFTYTWLNQQNKTIGNTNILQIPVVDESVVGRYICQ-----YKSKETSKIYEAATYVNLKQSVSYKIKIITNPALFRYGERFSLRCEVEPFYQNIKYTW-------YKKDEFIGNDQELV-IKSFKKDNVGTYKCVASLQLPSGKLDLMEESIQQFAFFRESKIELTTKPGPQVYVHRGEKKELHCEIETSSGNRGKEAEWYI--NGKK-FKNGDIPLVNRLDGQYVSMLVISDISQINEGNYECRV--GSSIKEVNLIVLLDEG-LIETSP------PILKVKEGQSVEFHCRVENIPSVKNVNLKWNFESKEGLVRNNIPDSRWQLMNDEIADQTSFIVLMKAEVSDSGYYICTEPNGQTARSELIVIPDKDKNSLTITPREIRVRAGQRVDIECFSKNT 1715
            + W  + G +    R        L + ++ + D G Y C     V   + R   T+     +    + I P E+  + G+ +   C   G P  ++       +L+  ++ IG    L+I    +   G YIC+     +  + +  +   +    L+  +   I I  + A  + GE  S RC V    Q ++  W          +  I  D  ++ I + +  N GTY+CVAS   P G    + +SI      RES     T  GP V+V  G+   L C+   ++G       W+   N +K   +  +P+ +       ++L I      + G Y C         E  + V+++ G  + T P      P+  V EG +   HC     P      + W+       +R  +P  R +++N  +       VL      DSG YIC   N        I++  +     T+ P ++ VR G+ + ++C +  T
Sbjct: 1982 LTWKKRGGTLPPQARVERTDFGTLTVPNMKRSDGGTYLCVGTNAVGSSEARIEVTV-----VKGNDVSIQPSEASVVEGETLDLNCFVPGNPPPSVTWSRANGYLSPNHQVIGTQ--LRILRASQEDSGEYICRVDGGPHVRQASVSVSVTSESSRLQSPI---ISIEPHSAAVKLGEPASFRCRVHSGAQPVRLEWKLTNNQPIPDNAKISPDGSVITITNAQSKNKGTYRCVASN--PFG----ITQSIVSL-IVRESPRATVTPTGP-VHVKVGDPINLECQ---AAGEPRPSVSWHRLDNARKTMLSSPVPMESN------AVLQILVARAEDSGTYVCTAQNNQGTTETRIEVIVEGGPAVPTVPRASVREPMKVVVEGSTTTLHCDGYGFP---KPTISWS------KLRAPLP-WRHKIVNGSL-------VLPSVGRQDSGQYICNVTNHMGTSEATIMLDVETTPYTTLLPDDVSVRVGEVIRLQCLAHGT 2437          

HSP 4 Score: 70.8626 bits (172), Expect = 6.692e-12
Identity = 100/450 (22.22%), Postives = 171/450 (38.00%), Query Frame = 3
Query:  504 PEESLKIGGQIKRQCSDLGLPQETIVDDFTYTWLNQQNKTIGNTNILQIPV-----VDESVVGRYICQYKSKETSKIYEAATYVNLKQSVSY---KIKIITNPALFRYGERFSLRCEVEPFYQNIKYTWYKKDEFIGNDQE--------LVIKSFKKDNVGTYKCVASLQLPSGKLDLMEESIQQFAFFRESKIELTTKPGPQVYVH-------RGEKKELHCEIETSSGNRGKEAEWYINGKKFKNGDIPLVNRLDGQYVSMLVISDISQINEGNYECRV--GSSIKEVNLIVL-------LDEGLIETSPPILKVKEGQSVEFHCRVENIPSVKNVNLKWNFESKEGLVRNNIPDSRWQLMNDEIADQTSFIVLMKAEVSDSGYYICTEPNGQTARSELIVIPDKDKNSLTITPR-EIRVRAGQRVDIECFSKNTQGRASGNPEFSFT 1754
            P  +++ G + + +C+  G P   +       W     K I +  +++  V     VD S  G YIC+  +        A  YV+   SV Y    +++         GE   L C       +   TW K+   +             L + + K+ + GTY CV +  + S                 E++IE+T   G  V +         GE  +L+C +    GN      W        NG +   +++ G   + L I   SQ + G Y CRV  G  +++ ++ V        L   +I   P    VK G+   F CRV +    + V L+W   + +      IPD      N +I+   S I +  A+  + G Y C   N       ++ +  ++    T+TP   + V+ G  +++EC       +A+G P  S +
Sbjct: 1864 PVLTIQQGQRAEFRCTASGNPAPAV------EWTGGPGKRISSNAVIRGGVLTFTSVDRSDEGDYICRALNTHGEHTARAVLYVH-STSVPYLLPHVQVSPQQVELHEGETLRLYCRAG-GTPSPGLTWKKRGGTLPPQARVERTDFGTLTVPNMKRSDGGTYLCVGTNAVGS----------------SEARIEVTVVKGNDVSIQPSEASVVEGETLDLNCFV---PGNPPPSVTW-----SRANGYLSPNHQVIG---TQLRILRASQEDSGEYICRVDGGPHVRQASVSVSVTSESSRLQSPIISIEPHSAAVKLGEPASFRCRVHS--GAQPVRLEWKLTNNQ-----PIPD------NAKISPDGSVITITNAQSKNKGTYRCVASNPFGITQSIVSLIVRESPRATVTPTGPVHVKVGDPINLEC-------QAAGEPRPSVS 2258          

HSP 5 Score: 64.6994 bits (156), Expect = 5.444e-10
Identity = 71/319 (22.26%), Postives = 131/319 (41.07%), Query Frame = 3
Query:  903 LVIKSFKKDNVGTYKCVAS-----------LQLPSGKLDLMEESIQQFAFFRE----SKIELTTKPGPQVYVHRGEKKELHCEIETSSGNRGKEAEWYIN-GKKFKNGDIPLVNRLDGQYVSMLVISDISQINEGNYECRVGSS-----------IKEVNLIVLLDEGLIETSPPILKVKEGQSVEFHCRVENIPSVKNVNLKWNFESKEGLVRNNIPDSRWQLMNDEIADQTSFIVLMKAEV--SDSGYYICTEPNGQTARSELIVIPDKDKNSLTITPREIRVRAGQRVDIECFSKNTQGRASGNPEFSFTNNKPIG 1772
            L I++ + ++ G Y C  S           L +     ++   + + F   R+    S+   T +P P + + +G++ E  C   T+SGN     EW    GK+  +  +     + G    +L  + + + +EG+Y CR  ++           +   ++  LL    ++ SP  +++ EG+++  +CR    PS     L W  + + G +    P +R         ++T F  L    +  SD G Y+C   N   +    I +     N ++I P E  V  G+ +D+ CF         GNP  S T ++  G
Sbjct: 1798 LTIQNVQPEDYGVYVCTGSNMFGMDESSAVLHVQEANAEMFYTAYEMFEGHRQPGEGSQPVATIQP-PVLTIQQGQRAEFRC---TASGNPAPAVEWTGGPGKRISSNAV-----IRG---GVLTFTSVDRSDEGDYICRALNTHGEHTARAVLYVHSTSVPYLLPH--VQVSPQQVELHEGETLRLYCRAGGTPS---PGLTW--KKRGGTLP---PQAR--------VERTDFGTLTVPNMKRSDGGTYLCVGTNAVGSSEARIEVTVVKGNDVSIQPSEASVVEGETLDLNCF-------VPGNPPPSVTWSRANG 2079          

HSP 6 Score: 53.9138 bits (128), Expect = 1.069e-6
Identity = 109/499 (21.84%), Postives = 183/499 (36.67%), Query Frame = 3
Query:  210 PNITFFPLKNDSIVKSEMQFINIACNVTNYALNETSIRWLDKDGKVA----AANRYLYIKSLLKQDEGIYNCSVEKVKDPQIRFNRTLHLKITIPSISIDI--------LPEE-SLKIGGQIKRQCSDLGLP----QETIVDDFTYTWLNQQNKTIGNTNILQIPVVDESVVGRYICQYKSKETSKIYEAATYVNLKQSVSYKIKIITNPALFRYGERFSLRCEVEPFYQNIKYTWYKKDEFIG-----NDQELVIKSFKKDNVGTYKCVASLQLPSGKLDLMEESIQQFAFFRESKIELTTKPGPQVYVHRGEKKELHCEIETSSGNRGKEAEWYINGKKFKNGDIPLVNRLDGQYVSMLVISDISQINEGNYECRVGSSIKEVNLIVLLD-EGL--IETSPPILKVKEGQSVEFHCRVENIPSVKNVNLKWNFESKEGLVRNNIPDSRWQLMNDEIADQTSFIVLMKAEVS--DSGYYICTEPNGQ---TARSELIV 1616
            P +    ++    V  E     + C+   Y   + +I W      +       N  L + S+ +QD G Y C+V            T H+  +  +I +D+        LP++ S+++G  I+ QC   G P    + + V         QQ         LQI +      G Y C   +K      EA   V+++  +S ++    +         F+      P   +IK  W K+   +       D  L I++ +K N G Y C A+      + D    +IQ        K+ +  +   Q  V  G   E  C+   + G       W   G     G +P   ++ G    ML I  +++ + G Y C   + +  V   V+L  + L  I T P   +V  G +  F C     P      + W+ +++  L   ++ D                 VL   +V+  DSG Y+CT  N Q    A ++LIV
Sbjct: 2321 PTVPRASVREPMKVVVEGSTTTLHCD--GYGFPKPTISWSKLRAPLPWRHKIVNGSLVLPSVGRQDSGQYICNV------------TNHMGTSEATIMLDVETTPYTTLLPDDVSVRVGEVIRLQCLAHGTPPLRFEWSKVGGVLPATAEQQGGD------LQINLASPDDAGTYKCVASNKVGHS--EAMAKVSVRSPLSVRVSPQVDVKALGSAAEFTCSANGGP---DIKLEWLKEGGALPPNHHVRDGVLRIENLEKSNEGVYICRATSSYGQAQ-DSARLTIQALP-----KVMINVRTSVQT-VMVGNSVEFECQ---AVGEPKPTIRWSKVG-----GKLPDHVQVKG---GMLRIIQVTEADAGQYRCTATNDVGSVQSTVVLSIQSLPQIATQPETKEVTVGSNAVFPCIASGYPVP---TITWSKDAE--LPPKSVQDGH---------------VLTVPDVTHEDSGTYVCTASNKQGKVQAFTKLIV 2756          
BLAST of low density lipoprotein receptor-1 vs. Ensembl Cavefish
Match: hspg2 (heparan sulfate proteoglycan 2 [Source:ZFIN;Acc:ZDB-GENE-080807-4])

HSP 1 Score: 125.561 bits (314), Expect = 1.091e-28
Identity = 77/211 (36.49%), Postives = 101/211 (47.87%), Query Frame = 3
Query: 1941 FCQNGECLENAKFCDKINHCADKSDEDPITCRECDPISRKCEINNQILPKKNYFLIHWICDGEEDCGNGYDEQNCDGFSLNN-CGGKFFTC-SDNKTIPRGYVCDENIDCSQGEDETGCTSPQIXXXXXXXXXXXXXQLVTLTCEATGKPLPVLVWRFNWGCIQNSTRFSTNFFSTDCNSVTSSLTIKDFKAGDDGIYNCEALSSRQRSFS 2567
             CQNG+C+     CD    C D SDE  + C    P    CE N          L  W CDG+ DC +  DE +C      + C  + F C SD   IP  Y CDE  DC+   DE GC  P +T      V A +   VT TC+A G P P++ WR NWG I  S+R +         +   +LTI+D K GD G Y CEA++++   F+
Sbjct:  202 MCQNGQCISRDYLCDGERDCTDGSDE--MKCGTPSP----CEPNEFKCKNGRCALKLWRCDGDNDCKDNSDEMDCPVRRPGDACAPEQFVCLSDRACIPASYQCDEEPDCADRSDEYGCAPPTVTSPPEDSVTAMRGGTVTFTCKAVGVPTPIITWRLNWGHIPVSSRITMT-----SENGQGTLTIRDVKEGDQGAYTCEAINAKGLVFA 401          

HSP 2 Score: 75.485 bits (184), Expect = 2.303e-13
Identity = 114/525 (21.71%), Postives = 188/525 (35.81%), Query Frame = 3
Query:  270 INIACNVTNYALNETSIRWLDKDGKVA-------AANRYLYIKSLLKQDEGIYNCSVEKVKDP-QIRFNRTLHLKITIPSISIDILPEESLKI---GGQIKRQCSDLGLPQETIVDDFTYTWLNQQNKTIGNTNILQIPVVDESVVGRYICQYKSKETSKIYEAATYVNLKQSVSYKIKIITNPALFRYGERFSLRCEVEPFYQNIKYTWYKKDEFIGNDQE-----LVIKSFKKDNVGTYKCVASLQLPSGKLDLMEESIQQFAFFRESKIELTTKPGPQVYVHR-GEKKELHCEIETSSGNRGKEAEWYINGKKFKNGDIPLVNRL-DGQYVSMLVISDISQINEGNYECRVGSSIKEVN-----LIVLLDEGLIETSPPILKVKEGQSVEFHCRVENIPSVKNVNLKWNFESKEGLVRNNIPDSRWQLMNDEIADQT----SFIVLMKAEVSDSGYYICTEPNGQTARSELIVIPDKDKNSLTITPREIRVRAGQRVDIECFSKNTQGRASGNPEFSFTNNK 1763
            IN+ C          S   LD   K          +N  L I     +D G Y C+ +  +   + R    +     +P++    +  E +K+   G      C   G P+ TI        L  ++K +  + +L  P V     G+YIC      T+ +  +   + L    +    ++ +    R GE   L+C        +++ W K    +    E     L I     D+ GTYKCVAS ++  G  + M +           +  L+ +  PQV V   G   E  C   +++G    + EW   G     G +P  + + DG    +L I ++ + NEG Y CR  SS  +        I  L + +I     +  V  G SVEF C+    P                      P  RW  +  ++ D        + +++   +D+G Y CT  N   +    +V+  +    +   P    V  G      C        ASG P  + T +K
Sbjct: 2206 INLECQAAGEPRPSVSWHRLDNARKTMLSSPVPMESNAVLQILVARAEDSGTYVCTAQNNQGTTETRIEVIVEGGPAVPTVPRASV-REPMKVVVEGSTTTLHCDGYGFPKPTISWSKLRAPLPWRHKIVNGSLVL--PSVGRQDSGQYICNV----TNHMGTSEATIMLDVETTPYTTLLPDDVSVRVGEVIRLQCLAH-GTPPLRFEWSKVGGVLPATAEQQGGDLQINLASPDDAGTYKCVASNKV--GHSEAMAKV--------SVRSPLSVRVSPQVDVKALGSAAEFTC---SANGGPDIKLEWLKEG-----GALPPNHHVRDG----VLRIENLEKSNEGVYICRATSSYGQAQDSARLTIQALPKVMINVRTSVQTVMVGNSVEFECQAVGEPK---------------------PTIRWSKVGGKLPDHVQVKGGMLRIIQVTEADAGQYRCTATNDVGSVQSTVVLSIQSLPQIATQPETKEVTVGSNAVFPCI-------ASGYPVPTITWSK 2672          

HSP 3 Score: 70.8626 bits (172), Expect = 6.357e-12
Identity = 106/477 (22.22%), Postives = 186/477 (38.99%), Query Frame = 3
Query:  366 LYIKSLLKQDEGIYNC-SVEKVKDPQIRFNRTLHLKITIPSISIDILPEESLKIGGQ-IKRQCSDLGLPQETIVDDFTYTWLNQQNKTIGNTNILQIPVVDESVVGRYICQ-----YKSKETSKIYEAATYVNLKQSVSYKIKIITNPALFRYGERFSLRCEVEPFYQNIKYTW-------YKKDEFIGNDQELV-IKSFKKDNVGTYKCVASLQLPSGKLDLMEESIQQFAFFRESKIELTTKPGPQVYVHRGEKKELHCEIETSSGNRGKEAEWYI--NGKK-FKNGDIPLVNRLDGQYVSMLVISDISQINEGNYECRV--GSSIKEVNLIVLLDEG-LIETSP------PILKVKEGQSVEFHCRVENIPSVKNVNLKWNFESKEGLVRNNIPDSRWQLMNDEIADQTSFIVLMKAEVSDSGYYICTEPNGQTARSELIVIPDKDKNSLTITPREIRVRAGQRVDIECFSKNT 1715
            L + ++ + D G Y C     V   + R   T+     +    + I P E+  + G+ +   C   G P  ++       +L+  ++ IG    L+I    +   G YIC+     +  + +  +   +    L+  +   I I  + A  + GE  S RC V    Q ++  W          +  I  D  ++ I + +  N GTY+CVAS   P G    + +SI      RES     T  GP V+V  G+   L C+   ++G       W+   N +K   +  +P+ +       ++L I      + G Y C         E  + V+++ G  + T P      P+  V EG +   HC     P      + W+       +R  +P  R +++N  +       VL      DSG YIC   N        I++  +     T+ P ++ VR G+ + ++C +  T
Sbjct: 1968 LTVPNMKRSDGGTYLCVGTNAVGSSEARIEVTV-----VKGNDVSIQPSEASVVEGETLDLNCFVPGNPPPSVTWSRANGYLSPNHQVIGTQ--LRILRASQEDSGEYICRVDGGPHVRQASVSVSVTSESSRLQSPI---ISIEPHSAAVKLGEPASFRCRVHSGAQPVRLEWKLTNNQPIPDNAKISPDGSVITITNAQSKNKGTYRCVASN--PFG----ITQSIVSL-IVRESPRATVTPTGP-VHVKVGDPINLECQ---AAGEPRPSVSWHRLDNARKTMLSSPVPMESN------AVLQILVARAEDSGTYVCTAQNNQGTTETRIEVIVEGGPAVPTVPRASVREPMKVVVEGSTTTLHCDGYGFP---KPTISWS------KLRAPLP-WRHKIVNGSL-------VLPSVGRQDSGQYICNVTNHMGTSEATIMLDVETTPYTTLLPDDVSVRVGEVIRLQCLAHGT 2400          

HSP 4 Score: 62.3882 bits (150), Expect = 2.272e-9
Identity = 74/335 (22.09%), Postives = 130/335 (38.81%), Query Frame = 3
Query:  903 LVIKSFKKDNVGTYKCVAS-----------LQLPSGKLDLMEESIQQFAFFRE----SKIELTTKPGPQVYVHRGEKKELHCEIETSSGNRGKEAEWYIN-GKKFKNGDIPLVNRLDGQYVSMLVISDISQINEGNYECRVGSS-----------IKEVNLIVLLDEGLIETSPPILKVKEGQSVEFHCRVENIPSVKNVNLKWNFESKEG--LVRNNIPDSRWQLMNDEIAD--------------QTSFIVLMKAEV--SDSGYYICTEPNGQTARSELIVIPDKDKNSLTITPREIRVRAGQRVDIECFSKNTQGRASGNPEFSFTNNKPIG 1772
            L I++ + ++ G Y C  S           L +     ++   + + F   R+    S+   T +P P + + +G++ E  C   T+SGN     EW    GK+  +  +     + G    +L  + + + +EG+Y CR  ++           +   ++  LL    ++ SP  +++ EG+++  +CR    PS     L W    K G  L    IP   +        D              +T F  L    +  SD G Y+C   N   +    I +     N ++I P E  V  G+ +D+ CF         GNP  S T ++  G
Sbjct: 1735 LTIQNVQPEDYGVYVCTGSNMFGMDESSAVLHVQEANAEMFYTAYEMFEGHRQPGEGSQPVATIQP-PVLTIQQGQRAEFRC---TASGNPAPAVEWTGGPGKRISSNAV-----IRG---GVLTFTSVDRSDEGDYICRALNTHGEHTARAVLYVHSTSVPYLLPH--VQVSPQQVELHEGETLRLYCRAGGTPS---PGLTWK---KRGGTLPPQAIPSHGFHQFKSNSLDVLQRRIEELQARVERTDFGTLTVPNMKRSDGGTYLCVGTNAVGSSEARIEVTVVKGNDVSIQPSEASVVEGETLDLNCF-------VPGNPPPSVTWSRANG 2042          

HSP 5 Score: 53.5286 bits (127), Expect = 1.153e-6
Identity = 109/499 (21.84%), Postives = 183/499 (36.67%), Query Frame = 3
Query:  210 PNITFFPLKNDSIVKSEMQFINIACNVTNYALNETSIRWLDKDGKVA----AANRYLYIKSLLKQDEGIYNCSVEKVKDPQIRFNRTLHLKITIPSISIDI--------LPEE-SLKIGGQIKRQCSDLGLP----QETIVDDFTYTWLNQQNKTIGNTNILQIPVVDESVVGRYICQYKSKETSKIYEAATYVNLKQSVSYKIKIITNPALFRYGERFSLRCEVEPFYQNIKYTWYKKDEFIG-----NDQELVIKSFKKDNVGTYKCVASLQLPSGKLDLMEESIQQFAFFRESKIELTTKPGPQVYVHRGEKKELHCEIETSSGNRGKEAEWYINGKKFKNGDIPLVNRLDGQYVSMLVISDISQINEGNYECRVGSSIKEVNLIVLLD-EGL--IETSPPILKVKEGQSVEFHCRVENIPSVKNVNLKWNFESKEGLVRNNIPDSRWQLMNDEIADQTSFIVLMKAEVS--DSGYYICTEPNGQ---TARSELIV 1616
            P +    ++    V  E     + C+   Y   + +I W      +       N  L + S+ +QD G Y C+V            T H+  +  +I +D+        LP++ S+++G  I+ QC   G P    + + V         QQ         LQI +      G Y C   +K      EA   V+++  +S ++    +         F+      P   +IK  W K+   +       D  L I++ +K N G Y C A+      + D    +IQ        K+ +  +   Q  V  G   E  C+   + G       W   G     G +P   ++ G    ML I  +++ + G Y C   + +  V   V+L  + L  I T P   +V  G +  F C     P      + W+ +++  L   ++ D                 VL   +V+  DSG Y+CT  N Q    A ++LIV
Sbjct: 2284 PTVPRASVREPMKVVVEGSTTTLHCD--GYGFPKPTISWSKLRAPLPWRHKIVNGSLVLPSVGRQDSGQYICNV------------TNHMGTSEATIMLDVETTPYTTLLPDDVSVRVGEVIRLQCLAHGTPPLRFEWSKVGGVLPATAEQQGGD------LQINLASPDDAGTYKCVASNKVGHS--EAMAKVSVRSPLSVRVSPQVDVKALGSAAEFTCSANGGP---DIKLEWLKEGGALPPNHHVRDGVLRIENLEKSNEGVYICRATSSYGQAQ-DSARLTIQALP-----KVMINVRTSVQT-VMVGNSVEFECQ---AVGEPKPTIRWSKVG-----GKLPDHVQVKG---GMLRIIQVTEADAGQYRCTATNDVGSVQSTVVLSIQSLPQIATQPETKEVTVGSNAVFPCIASGYPVP---TITWSKDAE--LPPKSVQDGH---------------VLTVPDVTHEDSGTYVCTASNKQGKVQAFTKLIV 2719          
BLAST of low density lipoprotein receptor-1 vs. Ensembl Cavefish
Match: lrp2a (low density lipoprotein receptor-related protein 2a [Source:ZFIN;Acc:ZDB-GENE-050119-2])

HSP 1 Score: 74.7146 bits (182), Expect = 4.522e-13
Identity = 47/123 (38.21%), Postives = 62/123 (50.41%), Query Frame = 3
Query: 1944 CQNGECLENAKFCDKINHCADKSDEDPI-----TCRECDPISRKCEINNQILPKKNYFLIHWICDGEEDCGNGYDE-QNCDGFSLNNCGGKFFTCSDNKTIPRGYVCDENIDCSQGEDETGCT 2294
            C +G C+ ++  CD  N C D SDED       + R C  +   C +NNQ  P++      W+CDG+ DC + YDE QNC   +  +C    FTCS+   I   Y CD   DC    DE GCT
Sbjct: 2899 CDDGRCIASSWICDGDNDCGDMSDEDQRHNCGESNRTCSSLEFTC-VNNQP-PQRKCIPRDWVCDGDADCSDAYDEHQNC---TRRSCSANEFTCSNGLCIRSSYRCDRRNDCGDSSDEQGCT 3016          

HSP 2 Score: 73.9442 bits (180), Expect = 7.450e-13
Identity = 41/120 (34.17%), Postives = 62/120 (51.67%), Query Frame = 3
Query: 1944 CQNGECLENAKFCDKINHCADKSDEDPITCRE--CDPISRKCEINNQILPKKNYFLIHWICDGEEDCGNGYDEQNCDGFSLNNCGGKFFTCSDNKTIPRGYVCDENIDCSQGEDETGCTS 2297
            C NG+C+  +  CD ++ C D SDE         C   +  C  N + +P+      +W CDG  DC +G DE+ C   +   C    F+C++++ IPR ++CD + DC  G DET C S
Sbjct: 1019 CSNGKCVPQSYRCDGVDDCHDNSDEASCGANNSTCSSTAFTCA-NQRCVPR------NWRCDGHNDCFDGSDERECPTQTPGTCQADQFSCANHRCIPRTWLCDTDNDCGDGSDETNCDS 1131          

HSP 3 Score: 69.707 bits (169), Expect = 1.426e-11
Identity = 43/121 (35.54%), Postives = 56/121 (46.28%), Query Frame = 3
Query: 1944 CQNGECLENAKFCDKINHCADKSDEDPITCRECDPISRKCEINNQILPKKNYFLIHWICDGEEDCGNGYDE-QNCDGFSLNNCGGKFFTCSDNKTIPRGYVCDENIDCSQGEDETGCTSPQ 2303
            C  G C+     CD    C D SDE       C+    +C  + + +P+       W+CD EEDC +G DE Q+C G     C    FTC++   IP  Y CD   DCS G DE  C  P+
Sbjct:   31 CGTGRCIPAGWHCDGTADCTDDSDESGCPQSTCEAGQFQCLSDGECIPEL------WLCDDEEDCEDGSDERQHCPG---RTCSSSQFTCTNGACIPGEYRCDHLPDCSDGADERNCHYPE 142          

HSP 4 Score: 69.707 bits (169), Expect = 1.619e-11
Identity = 42/120 (35.00%), Postives = 63/120 (52.50%), Query Frame = 3
Query: 1944 CQNGECLENAKFCDKINHCADKSDEDPITCRECDPISRKCEINNQILPKKNYFLIHWICDGEEDCGNGYDEQNCDGFSLNNCGGKFFTCSDNKTIPRGYVCDENIDCSQGEDETGCTSPQ 2303
            C NG C   ++ CD++ +C D SDE   T R C     +C  N + +P+       ++CD ++DCG+  DEQNC   +   C G +FTC   + I + ++CD   DC    DE GC + Q
Sbjct:  148 CANGACYNRSQHCDQVLNCRDGSDEANCTQR-CSSGQFQCS-NGECVPRG------YVCDHDDDCGDRSDEQNC---TYPTCRGTYFTCPSGRCIHQVWLCDGEDDCGDNADERGCDNVQ 256          

HSP 5 Score: 69.707 bits (169), Expect = 1.647e-11
Identity = 66/250 (26.40%), Postives = 95/250 (38.00%), Query Frame = 3
Query: 1560 GYYICTEPNGQTARSELIVIPDKDKNSLTITPREIRVRAGQRVDIECFSKNTQGRASGNPEFSFTNNKPIGRDGRFKISNVGPAHKRLTAPGGLSLSDNNMDVFCSLEGRQVSSKIYVSDICPPGYRFCQNGECLENAKFCDKINHCADKSDE------DPITCRECDPISRKCEINNQILPKKNYFLIHWICDGEEDCGNGYDEQNCDGFSLNNCGGKFFTCSDNKTIPRGYVCDENIDCSQGEDETGC 2291
            G   C  P+           P      +   P  +++   Q+  +E  S        G+  FS +N K + +   ++   V   H            DN+ +  C       SS  +           C N  C+     CD  N C D SDE       P TC+  D  S     N++ +P+       W+CD + DCG+G DE NCD  S+  C    F C D++ I   YVCD + DC  G DE  C
Sbjct:  956 GSNFCNRPSNPNGDCSHFCFPAPYSQRVCGCPYGMKLAPNQQTCLEDPSNEPPTLQCGSNSFSCSNGKCVPQS--YRCDGVDDCH------------DNSDEASCGANNSTCSSTAFT----------CANQRCVPRNWRCDGHNDCFDGSDERECPTQTPGTCQA-DQFSCA---NHRCIPRT------WLCDTDNDCGDGSDETNCD--SIGTCHPGQFQCPDHRCIDPAYVCDGDRDCVDGADEQDC 1169          

HSP 6 Score: 67.0106 bits (162), Expect = 1.006e-10
Identity = 49/125 (39.20%), Postives = 61/125 (48.80%), Query Frame = 3
Query: 1944 CQNGECLENAKFCDKINHCADKSDEDPITC----RECDPISRKCEINNQILPKKNYFLIHWICDGEEDCGNGYDE---QNCDGFSLNNCGGKFFTCSDN-----KTIPRGYVCDENIDCSQGEDE 2282
            C +G C+    +CD+   CAD SDE P TC    R C+    +C+    I          WICDG+ DCG+  DE    NC G S   C    FTC +N     K IPR +VCD + DCS   DE
Sbjct: 2857 CTSGRCIPAHWYCDEGTDCADGSDE-PSTCTTMVRTCNSDQFRCDDGRCIASS-------WICDGDNDCGDMSDEDQRHNC-GESNRTCSSLEFTCVNNQPPQRKCIPRDWVCDGDADCSDAYDE 2972          

HSP 7 Score: 67.0106 bits (162), Expect = 1.076e-10
Identity = 45/140 (32.14%), Postives = 59/140 (42.14%), Query Frame = 3
Query: 1878 LEGRQVSSKIYVSDICPPGYRFCQNGECLENAKFCDKINHCADKSDEDPITCRECDPISRKCEINNQILPKKNYFLIHWICDGEEDCGNGYDEQNCDGFSLNNCGGKFFTCSDNKTIPRGYVCDENIDCSQGEDETGCTS 2297
            L  R  S +   +  C  G   C NGEC+     CD  + C D+SDE   T   C      C       P        W+CDGE+DCG+  DE+ CD        G++   S    IP  ++CD    C  GEDE   T+
Sbjct:  164 LNCRDGSDEANCTQRCSSGQFQCSNGECVPRGYVCDHDDDCGDRSDEQNCTYPTCRGTYFTC-------PSGRCIHQVWLCDGEDDCGDNADERGCDNVQRECFPGEWPCPSSGVCIPMEHLCDGTPHCPDGEDENNSTA 296          

HSP 8 Score: 66.6254 bits (161), Expect = 1.318e-10
Identity = 45/129 (34.88%), Postives = 66/129 (51.16%), Query Frame = 3
Query: 1914 SDICPPGYRFCQNGECLENAKFCDKINHCADKSDEDPITCRECDPISRKCEINNQILPKKNYFLIH-W-ICDGEEDCGNGYDEQNCDGFSLNNCGGKFFTCSDNKTIPRGYVCDENIDCSQGEDETGCT 2294
            S  C PG   C NG C+  +  CD  + C D SDE PI   EC   + +C+ + +     NY  +  W +C+G  DC +  DEQNC+  + +  G   F C +++ IP  + CD + DC  G DE  C+
Sbjct: 3619 SRTCRPGQFKCSNGRCIPQSWKCDVDDDCGDNSDE-PID--ECMGPAYRCDNHTEFDCVTNYRCVPLWALCNGHNDCRDNSDEQNCEELTCDPAGD--FRCDNHQCIPLRWKCDGDNDCGDGSDERNCS 3742          

HSP 9 Score: 62.003 bits (149), Expect = 2.957e-9
Identity = 41/115 (35.65%), Postives = 55/115 (47.83%), Query Frame = 3
Query: 1950 NGECLENAKFCDKINHCADKSDEDPITCRECDPISR-KCEINNQILPKKNYFLIHWICDGEEDCGNGYDEQNCDGFSLNNCGGKFFTCSDNKTIPRGYVCDENIDCSQGEDETGC 2291
            N  C+     C+  N C D SDE       CDP    +C+ N+Q +P      + W CDG+ DCG+G DE+NC   S   C    + C +   IP  +VCD + DC    DE  C
Sbjct: 3676 NYRCVPLWALCNGHNDCRDNSDEQNCEELTCDPAGDFRCD-NHQCIP------LRWKCDGDNDCGDGSDERNC---SPRACTESEYRCDNLHCIPDRWVCDHDNDCEDNSDERDC 3780          

HSP 10 Score: 60.8474 bits (146), Expect = 7.364e-9
Identity = 40/119 (33.61%), Postives = 54/119 (45.38%), Query Frame = 3
Query: 1944 CQNGECLENAKFCDKINHCADKSDEDPITCRECDPISRKCEINNQILPKKNYFLIHWICDGEEDCGNGYDEQNCDGFSLNNCGGKFFTCSDNKTIPRGYVCDENIDCSQGEDETGCTSP 2300
            C NG C+     CD +  C+D +DE      EC  +  +C  N     +  +      CD   +C +G DE NC       C    F CS+ + +PRGYVCD + DC    DE  CT P
Sbjct:  111 CTNGACIPGEYRCDHLPDCSDGADERNCHYPECSEL--RCA-NGACYNRSQH------CDQVLNCRDGSDEANC----TQRCSSGQFQCSNGECVPRGYVCDHDDDCGDRSDEQNCTYP 216          

HSP 11 Score: 60.8474 bits (146), Expect = 7.618e-9
Identity = 38/121 (31.40%), Postives = 49/121 (40.50%), Query Frame = 3
Query: 1923 CPPGYRFCQNGE-CLENAKFCDKINHCADKSDEDPITCRECDPISRKCEINNQILPKKNYFLIHWICDGEEDCGNGYDEQNCDGFSLNNCGGKFFTCSDNKTIPRGYVCDENIDCSQGEDE 2282
            C P +  CQ+   C+  +  CD  N C D SDE P  C      S  C  N            HW CD   DC +G DE +     +  C    F C D + I   ++CD + DC    DE
Sbjct: 2808 CQPEHTKCQSTNICIPRSYLCDGDNDCGDMSDESPTHC-----ASSTCSQNEFRCTSGRCIPAHWYCDEGTDCADGSDEPSTCTTMVRTCNSDQFRCDDGRCIASSWICDGDNDCGDMSDE 2923          

HSP 12 Score: 60.077 bits (144), Expect = 1.412e-8
Identity = 38/124 (30.65%), Postives = 55/124 (44.35%), Query Frame = 3
Query: 1926 PPGYRFCQNGECLENAKFCDKINHCADKSDEDPITCRECDPISRKCEINNQILPKKNYFLIHWICDGEEDCGNGYDEQNCDGFSLNNCGGKFFTCSDNKTIPRGYVCDENIDCSQGEDETGCTS 2297
            P G   C N +C+     CD  N C D SDE   + R C     +C+ N   +P +      W+CD + DC +  DE++C+   L  C   +F C     +   + CD N DC    DE  C +
Sbjct: 3708 PAGDFRCDNHQCIPLRWKCDGDNDCGDGSDERNCSPRACTESEYRCD-NLHCIPDR------WVCDHDNDCEDNSDERDCE---LRTCHPGYFQCDSGHCVAERFKCDGNADCLDFTDEMSCPT 3821          

HSP 13 Score: 59.6918 bits (143), Expect = 1.744e-8
Identity = 48/175 (27.43%), Postives = 67/175 (38.29%), Query Frame = 3
Query: 1902 KIYVSDICPPGYRFCQNGECLENAKFCDKINHCADKSDEDPITCRECDP-----------ISR-------------------------------KCEINNQILPKKNYFLIHWICDGEEDCGNGYDEQNCDGFSLNNCGGKFFTCSDNKTIPRGYVCDENIDCSQGEDE-TGCTS 2297
            ++     C P    C NG C+     CD  N C D SDE+    R CDP           I+R                               KC+  N  +P+       ++CDG+ DCG+  DE      S + C    F C+  + IP  + CDE  DC+ G DE + CT+
Sbjct: 2720 RVCAFHTCEPTVFTCGNGRCVPYHYRCDHYNDCGDNSDEEGCVFRPCDPDTEFTCNNGRCIAREYVCNGFNNCYDNGTSDEQNCPERTCQPEHTKCQSTNICIPRS------YLCDGDNDCGDMSDESPTHCAS-STCSQNEFRCTSGRCIPAHWYCDEGTDCADGSDEPSTCTT 2887          

HSP 14 Score: 58.5362 bits (140), Expect = 4.127e-8
Identity = 39/120 (32.50%), Postives = 51/120 (42.50%), Query Frame = 3
Query: 1923 CPPGYRFCQNGECLENAKFCDKINHCADKSDEDPITCRECDPISRKCEINNQILPKKNYFLIHWICDGEEDCGNGYDEQNCDGFSLNNCGGKFFTCSDNKTIPRGYVCDENIDCSQGEDE 2282
            C  G   C +G C      C+    C D SDED + C      + +CE +      K      W CDGE DCG+  DE      S   C    F CS+ + IP+ + CD + DC    DE
Sbjct: 3540 CRLGQFQCNDGNCTSPHFLCNSNQDCPDGSDEDTVLC-----ATHQCEAHQWQCNNKRCIPEAWQCDGENDCGDNSDEDP-SHCSSRTCRPGQFKCSNGRCIPQSWKCDVDDDCGDNSDE 3653          

HSP 15 Score: 56.9954 bits (136), Expect = 1.081e-7
Identity = 41/125 (32.80%), Postives = 55/125 (44.00%), Query Frame = 3
Query: 1932 GYRF-CQNG-ECLENAKFCDKINHCADKSDEDPITCRECDPISRKCEINNQILPKKNYFLIHWICDGEEDCGNGYDEQNCDGFSLNNCGGKFFTCSDNKTIPRGYVCDENIDCSQGEDETGCTSP 2300
            GY F C NG +C+ +   CD +  C D+SDE  I C    P     E   Q     +     W CDG  DC +G DE +        C    F C +   + R ++CD + DC  G DE  C +P
Sbjct: 1175 GYEFKCANGHQCINSFYRCDGVFDCNDRSDE--IGCPTRPPGMCHHESEFQCQSDGSCIPAAWECDGHPDCEDGSDEHH--ACPPRTCPTSLFRCDNGNCVFRSWLCDGDNDCRDGSDERDCPTP 1295          

HSP 16 Score: 55.0694 bits (131), Expect = 4.701e-7
Identity = 36/117 (30.77%), Postives = 54/117 (46.15%), Query Frame = 3
Query: 1944 CQNGECLENAKFCDKINHCADKSDEDPITCRECDPISRKCEINNQILPKKNYFLIHWICDGEEDCGNGYDE-QNCDGFSLNNCGGKFFTCSDNKTIPRGYVCDENIDCSQGEDETGC 2291
            C NG C+ ++  CD+ N C D SDE   T + C      C+ N + +         ++CDG+ DCG+  DE  +        C    + C +   +P   VCD + DC+   DE GC
Sbjct: 2988 CSNGLCIRSSYRCDRRNDCGDSSDEQGCTYQSCQQHQFTCQ-NGRCISSD------FVCDGDNDCGDESDELDHLCRTPAPTCPPGNYRCENGNCVPASQVCDHSDDCNDNSDEKGC 3097          
BLAST of low density lipoprotein receptor-1 vs. Ensembl Sea Lamprey
Match: lrp1ab (low density lipoprotein receptor-related protein 1Ab [Source:ZFIN;Acc:ZDB-GENE-030131-7126])

HSP 1 Score: 72.7886 bits (177), Expect = 3.431e-13
Identity = 45/122 (36.89%), Postives = 60/122 (49.18%), Query Frame = 3
Query: 1923 CPPGYRFCQNGECLENAKFCDKINHCADKSDEDPITCRE--CDPISRKCEINNQILPKKNYFLIHWICDGEEDCGNGYDEQNCDGFSLNNCGGKFFTCSDNKTIPRGYVCDENIDCSQGEDE 2282
            C PG   C+NG C++    CD  N C D SDE P  C +  C     KC+ NN+ +P      + W+CDG+ DCGN  DE N    +   C    F+C+    IP  + CD + DC    DE
Sbjct:  827 CHPGEFACKNGRCIQERWRCDGDNDCLDNSDEAPEICHQHTCPSDRFKCQ-NNRCIP------LRWLCDGDNDCGNSEDESN-TTCAARTCPPNQFSCASGHCIPMSWKCDLDDDCGDRSDE 940          

HSP 2 Score: 69.707 bits (169), Expect = 3.120e-12
Identity = 45/121 (37.19%), Postives = 60/121 (49.59%), Query Frame = 3
Query: 1923 CPPGYRFCQNGECLENAKFCDKINHCADKSDEDPITCRECDPISRKCEINNQILPKKNYFLIHWICDGEEDCGNGYDEQNCDGFSLNNCGGKFFTCSDNKT-IPRGYVCDENIDCSQGEDE 2282
            C PG   C+NG C   A  CD  N C D SDE       C P   KC   ++ +P        + C+G+++CG+G DE++C   +   C    F CS  K  IPR +VCD + DC  G DE
Sbjct: 3343 CRPGQFQCKNGICTNPAFICDGDNDCGDGSDEANCDVHVCLPSQFKCRTTHRCIPGI------FRCNGQDNCGDGEDEKDCPEVT---CAPNQFQCSSTKRCIPRVWVCDRDNDCGDGSDE 3454          

HSP 3 Score: 66.6254 bits (161), Expect = 2.518e-11
Identity = 42/125 (33.60%), Postives = 55/125 (44.00%), Query Frame = 3
Query: 1923 CPPGYRFCQNGECLENAKFCDKINHCADKSDEDPITCRECDPISRKCEINNQILPKKNYFLIHWICDGEEDCGNGYDEQNCDGFSLNNCGGKFFTCSDNKTIPRGYVCDENIDCSQGEDETGCTS 2297
            C P    C+N  C+     CD  N C D SDE+  T R C      C     I  +       W CDG+ DC +G DE++C       C    F C +   IP+ + CD +IDC  G DE  C +
Sbjct: 3505 CEPYQFRCKNNRCVPGRWQCDYDNDCGDNSDEEGCTPRPCSESEFSCANGRCIAGR-------WRCDGDHDCSDGSDEKDCS----PRCDHDQFQCRNGHCIPQRWRCDADIDCIDGSDEDNCAA 3618          

HSP 4 Score: 64.3142 bits (155), Expect = 1.203e-10
Identity = 50/166 (30.12%), Postives = 66/166 (39.76%), Query Frame = 3
Query: 1923 CPPGYRFCQNGECLENAKFCDKINHCADKSDE----------DPITCRE---------------CDPISRK-------CEINNQILPKKNYF----------LIHWICDGEEDCGNGYDEQNCDGFSLN-NCGGKFFTCSDNKTIPRGYVCDENIDCSQGEDETGC 2291
            C  GY  C NG C+E  K C+ +N C D SDE          D   C +               CD IS +       C   +++  + + +          L  WICDG  DCG+  DE+NC   S +  C   +F C     IP  + CD   DC  G DE  C
Sbjct: 2543 CKNGYVNCLNGRCMETLKLCNGVNDCGDNSDEIACNNSTCGADEFRCGDGSCIANVTRCNQVVDCDDISDEIGCGPMNCTHYHRLGVQASGYVSCNSTSLCVLPAWICDGANDCGDYADEKNCKKKSGSPGCSPDYFNCPSGPCIPTAWKCDREPDCDDGADELNC 2708          

HSP 5 Score: 61.2326 bits (147), Expect = 1.199e-9
Identity = 55/172 (31.98%), Postives = 83/172 (48.26%), Query Frame = 3
Query: 1788 KISNVGPAHKRLTAPGGLSLSDNNMDVFCSLEGRQVSSKIYVSDICPPGYRF-CQNGECLENAKFCDKINHCADKSDEDPITCRE--CDPISRKCEINNQILPKKNYFLIHWICDGEEDCGNGYDEQNCDGFSLNNCGGKFFTC-SDNKTIPRGYVCDENIDCSQGEDETGC 2291
            K++N G ++  L +PGG        + + + +GR   S    S       RF C+N +C+     CD  + C D+SDE P  C +  C P   +C+  N I     +     ICDG+ DCG+G DE NCD   ++ C    F C + ++ IP  + C+   +C  GEDE  C
Sbjct: 3264 KVNNGGCSNLCLISPGGQYKCACPTNFYLASDGRTCLSNCTAS-------RFVCKNDKCIPFWWKCDTEDDCGDRSDE-PADCPDFKCRPGQFQCK--NGICTNPAF-----ICDGDNDCGDGSDEANCD---VHVCLPSQFKCRTTHRCIPGIFRCNGQDNCGDGEDEKDC 3417          

HSP 6 Score: 59.3066 bits (142), Expect = 5.040e-9
Identity = 49/131 (37.40%), Postives = 62/131 (47.33%), Query Frame = 3
Query: 1923 CPPGYRF-CQNGECLENAKFCDKINHCADKSDEDPITCRECDPISR-KCEINNQILPKKNYFLIHWICDGEEDCGNGYDEQNCDGFSL-----NNCGGKFFTC-SDNKTIPRGYVCDENIDCSQGEDETGC 2291
            C P  +F C NG C+     CD  N CAD SDE  I C     IS+ KC  + + +P       HW CDG+ DCG+  DE N +   L       C G  F C +D + IP  + CD + DC    DE  C
Sbjct:  949 CFPLTQFACNNGRCINMNWRCDADNDCADASDE--IGCNHSCSISQFKCN-SGRCIPS------HWTCDGDNDCGDFSDETNPNCTKLATRPPGGCHGDEFQCKADGQCIPLRWRCDGDTDCIDTSDEKEC 1070          

HSP 7 Score: 58.151 bits (139), Expect = 1.060e-8
Identity = 38/116 (32.76%), Postives = 51/116 (43.97%), Query Frame = 3
Query: 1944 CQNGECLENAKFCDKINHCADKSDEDPITCRECDPISRKCEINNQILPKKNYFLIHWICDGEEDCGNGYDEQNCDGFSLNNCGGKFFTCSDNKTIPRGYVCDENIDCSQGEDETGC 2291
            C NG+C+     CD +  C DKSDE P  C      SR+C+                +C+G  DCG+  DE  C+    + CG   F C D   I     C++ +DC    DE GC
Sbjct: 2509 CNNGDCIRYHLTCDGVADCKDKSDEKPFYC-----TSRQCKNGYVNCLNGRCMETLKLCNGVNDCGDNSDEIACNN---STCGADEFRCGDGSCIANVTRCNQVVDCDDISDEIGC 2616          

HSP 8 Score: 56.9954 bits (136), Expect = 2.174e-8
Identity = 40/128 (31.25%), Postives = 59/128 (46.09%), Query Frame = 3
Query: 1944 CQNGECLENAKFCDKINHCADKSDEDPITCRE--------CDPISRKCEINNQILPKKNYFLIHWICDGEEDCGNGYDEQNCDGFSLNNCGGKF-FTCSDN-KTIPRGYVCDENIDCSQGEDETGCTS 2297
            C +G C+ +   CD  N C D SDE    C +        C     +C+ + Q +P      + W CDG+ DC +  DE+ CDG  +  C     F+C D  + I + + CD + DC    DE GC +
Sbjct:  995 CNSGRCIPSHWTCDGDNDCGDFSDETNPNCTKLATRPPGGCHGDEFQCKADGQCIP------LRWRCDGDTDCIDTSDEKECDGV-VRTCDPTLQFSCRDTGRCISKTWFCDGDNDCEDNSDEEGCET 1115          

HSP 9 Score: 53.5286 bits (127), Expect = 2.333e-7
Identity = 41/142 (28.87%), Postives = 59/142 (41.55%), Query Frame = 3
Query: 1878 LEGRQVSSKIYVSDICPPGYRFCQNGECLENAKFCDKINHCADKSDEDPITCRECDPISRKCEINNQILPKKNYFLIHWICDGEEDCGNGYDE-QNC---DGFSLNNCGGKFFTCSDNKTIPRGYVCDENIDCSQGEDETGC 2291
            L+    + +I     CP     CQN  C+     CD  N C +  DE   TC      +R C  N       +   + W CD ++DCG+  DE  +C     F L       F C++ + I   + CD + DC+   DE GC
Sbjct:  853 LDNSDEAPEICHQHTCPSDRFKCQNNRCIPLRWLCDGDNDCGNSEDESNTTC-----AARTCPPNQFSCASGHCIPMSWKCDLDDDCGDRSDEPPSCAYPTCFPLTQ-----FACNNGRCINMNWRCDADNDCADASDEIGC 984          

HSP 10 Score: 50.8322 bits (120), Expect = 1.894e-6
Identity = 38/118 (32.20%), Postives = 48/118 (40.68%), Query Frame = 3
Query: 1932 GYRFCQNGE-CLENAKFCDKINHCADKSDEDPITCRECDPISRKCEINNQILPKKNYFLIHWICDGEEDCGNGYDEQNCDGFSLNNCGGKFFTCSDNKTIPRGYVCDENIDCSQGEDE 2282
            GY  C +   C+  A  CD  N C D +DE     +   P    C  +    P        W CD E DC +G DE NCD      C    F C + K I + ++CD   DC    DE
Sbjct: 2633 GYVSCNSTSLCVLPAWICDGANDCGDYADEKNCKKKSGSP---GCSPDYFNCPSGPCIPTAWKCDREPDCDDGADELNCDML----CAVDHFECDNGKCITKRWMCDGEDDCGDRSDE 2743          

HSP 11 Score: 49.6766 bits (117), Expect = 3.391e-6
Identity = 46/134 (34.33%), Postives = 60/134 (44.78%), Query Frame = 3
Query: 1911 VSDICPPGYRF-CQN-GECLENAKFCDKINHCADKSDEDPITCRECDPISRKCEINNQIL--PKKNYFLIHWICDGEEDCGNGYDE-QNCDGFSLNNCGGKFFTCSDNKTIP--RGYVCDENIDCSQGEDETGC 2291
            V   C P  +F C++ G C+    FCD  N C D SDE+      C P S  C  ++ I   PKK       +CDG  DC +G DE   CD   +NN G     C+ N T+    G VC        G+D+  C
Sbjct: 1073 VVRTCDPTLQFSCRDTGRCISKTWFCDGDNDCEDNSDEEGCETMLCKPPSHSCANDSSICLSPKK-------LCDGHSDCPDGSDEGMLCDQCQVNNGG-----CTHNCTVAPGEGVVCSCPSGMQLGKDKKSC 1194          
BLAST of low density lipoprotein receptor-1 vs. Ensembl Sea Lamprey
Match: lrp2a (low density lipoprotein receptor-related protein 2a [Source:ZFIN;Acc:ZDB-GENE-050119-2])

HSP 1 Score: 70.4774 bits (171), Expect = 1.896e-12
Identity = 48/145 (33.10%), Postives = 62/145 (42.76%), Query Frame = 3
Query: 1944 CQNGECLENAKFCDKINHCADKSDEDP-----ITC---------RECDPISRK--------------CEINNQILPKKNYFLIHWICDGEEDCGNGYDEQNCDGFSLNNCGGKFFTCSDNKTIPRGYVCDENIDCSQGEDETGCT 2294
            C NG C+     CD  + C D SDE       +TC         R C PI  +              C   N+ +P+      +WICD + DCG+G DE+ CD      C    F C D++ I   YVCD + DC  G DE GC 
Sbjct: 1010 CANGRCVPRLFLCDGYDDCHDGSDERGCGTGNVTCSPYAFTCTNRRCIPIDWRPTRLATTCRADQFTCASGNRCIPR------YWICDTDNDCGDGSDERGCD--MSGTCHPMQFQCPDHRCIDNAYVCDGDSDCVDGADERGCV 1146          

HSP 2 Score: 69.707 bits (169), Expect = 3.044e-12
Identity = 45/129 (34.88%), Postives = 60/129 (46.51%), Query Frame = 3
Query: 1929 PGYRF-CQNGECLENAKFCDKINHCADKSDED---PITCRECDPISRKCEINNQILPKKNYFLIHWICDGEEDCGNGYDE-QNCDGFSLNNCGGKFFTCSDNKTIPRGYVCDENIDCSQGEDETGCTSP 2300
            PG +F C +G C+  +  CD  N C D SDED       R C P    C   +   P++      ++CDG+ DC +  DE QNC   +  +C    F C +   +   Y CD   DC  G DE GCT P
Sbjct: 2869 PGTQFTCDSGRCIPGSWICDGDNDCGDGSDEDGRHACGARTCGPHEFTCA--DASPPRRRCIQRRFVCDGDADCSDALDEHQNC---TRRSCTAGEFACDNGLCVHSRYRCDRRNDCGDGSDERGCTYP 2992          

HSP 3 Score: 68.9366 bits (167), Expect = 4.686e-12
Identity = 41/127 (32.28%), Postives = 59/127 (46.46%), Query Frame = 3
Query: 1923 CPPGYRFCQNGECLENAKFCDKINHCADKSDEDPITCRECDPISRKCEINNQILPKKNYFLIHWICDGEEDCGNGYDE-QNCDGFSLNNCGGKFFTCSDNKTIPRGYVCDENIDCSQGEDETGCTSP 2300
            C  G   C +G C+  +  CD IN C+D SDE   +   C  +  +C  +N+ + +       ++CDGE DC +  DE QNC G   + C    FTC+    +   + CD   DC    DE  C  P
Sbjct:    1 CDSGQFRCGSGACIPRSWVCDSINDCSDDSDERGCSPATCTTLQFRCRSDNRCIARA------FVCDGEADCADRSDEHQNCPG---STCSSSHFTCASGHCVQSAFRCDHFQDCDDRSDEQSCQYP 118          

HSP 4 Score: 65.0846 bits (157), Expect = 8.514e-11
Identity = 43/118 (36.44%), Postives = 54/118 (45.76%), Query Frame = 3
Query: 1944 CQNGECLENAKFCDKINHCADKSDEDPITCRECDPISRKCEINNQILPKKNYFLIHWICDGEEDCGNGYDEQNCDGFSLNNCGGKFFTCSD-----NKTIPRGYVCDENIDCSQGEDE 2282
            C NG+C+  +  CD    C D +DE P +C   DP  R C                WICDG+ DCG+G DE          CG   FTC+D      + I R +VCD + DCS   DE
Sbjct: 2833 CGNGQCIPLSWVCDSEQDCTDNADE-PSSCS--DP-GRTCPGTQFTCDSGRCIPGSWICDGDNDCGDGSDEDGRHACGARTCGPHEFTCADASPPRRRCIQRRFVCDGDADCSDALDE 2946          

HSP 5 Score: 63.1586 bits (152), Expect = 3.377e-10
Identity = 45/161 (27.95%), Postives = 62/161 (38.51%), Query Frame = 3
Query: 1923 CPPGYRF-CQNGECLENAKFCDKINHCADKSDEDPITC--RECDPISRKCEINN-----------------------QILPKKNYFL-------------IHWICDGEEDCGNGYDEQNCDGFSLNNCGGKFFTCSDNKTIPRGYVCDENIDCSQGEDETG 2288
            C P   F C NG C+  ++ C+ +N+C D +  D   C  R C P   KC   N                         LP    F+             + W+CD E+DC +  DE +        C G  FTC   + IP  ++CD + DC  G DE G
Sbjct: 2741 CDPAAEFACTNGRCIARSQVCNGVNNCRDNATSDEQRCPERTCQPGLLKCLTTNICVLRHYLSGGAAEWRRNDLRRPPPLPLHTCFIANEFRCGNGQCIPLSWVCDSEQDCTDNADEPSSCSDPGRTCPGTQFTCDSGRCIPGSWICDGDNDCGDGSDEDG 2901          

HSP 6 Score: 62.7734 bits (151), Expect = 3.833e-10
Identity = 44/125 (35.20%), Postives = 58/125 (46.40%), Query Frame = 3
Query: 1923 CPPGYRFCQNGECLENAKFCDKINHCADKSDEDPITCRECDPISRKCEINNQILPKKNYFLIHWICDGEEDCGNGYDEQN--CDGFSLNNCGGKFFTCSDNKTIPRGYVCDENIDCSQGEDETGC 2291
            C  G   C NG C+ +   CD+ N C D SDE   T   C      CE N + +P+       + CDG+ DCG+G DE    C   S   C   FF C   + +    VC++  DC+ G DE GC
Sbjct: 2955 CTAGEFACDNGLCVHSRYRCDRRNDCGDGSDERGCTYPTCRQNQFTCE-NGRCIPRI------FACDGDNDCGDGSDEDTHLCHQPS-PTCAPGFFRCGAGECVAIHLVCNQANDCADGSDEKGC 3071          

HSP 7 Score: 62.7734 bits (151), Expect = 4.066e-10
Identity = 45/132 (34.09%), Postives = 61/132 (46.21%), Query Frame = 3
Query: 1923 CPPGYRFCQNGECLENAKFCDKINHCADKSDEDPITCRE--CDPISR-KCEINNQILPKKNYFLIHWICDGEEDCGNGYDE--QNCDGFSLNNCGGKFFTCSDNKTIPRGYVCDENIDCSQGEDETGCTSPQ 2303
            CPP    C N  C+  +  CD  N C D SDE+   C +  C+P  R +C+ N  I         H IC+  +DCG+G DE    C   +   C  + F C+  + IP   VC+   +C    DETGC   Q
Sbjct: 3807 CPPSSFECDNHVCIPPSWKCDGDNDCGDGSDEELHHCLDTPCNPPGRFRCDNNRCIYS-------HEICNAVDDCGDGSDETPDKCKEPTFAPCTEEEFKCASGRCIPMAAVCNNYNECRDNTDETGCNQGQ 3931          

HSP 8 Score: 62.3882 bits (150), Expect = 4.981e-10
Identity = 39/124 (31.45%), Postives = 56/124 (45.16%), Query Frame = 3
Query: 1926 PPGYRFCQNGECLENAKFCDKINHCADKSDEDPITCRECDPISRKCEINNQILPKKNYFLIHWICDGEEDCGNGYDEQNCDGFSLNNCGGKFFTCSDNKTIPRGYVCDENIDCSQGEDETGCTS 2297
            P G   C N  C+     CD+ + C D SDE     R C     +C  N + +P +      W+C+ E DCG+  DE++C+   L  C   +F C     IP    CD + DC    DE+ C +
Sbjct: 3686 PLGDYRCDNHRCIPLRWRCDRYDDCGDGSDERNCAPRPCSESEFRC-TNQRCIPGR------WVCNHENDCGDNSDERDCE---LQTCLPGYFQCGSGHCIPERLKCDGSADCQDFSDESLCPT 3799          

HSP 9 Score: 60.077 bits (144), Expect = 2.280e-9
Identity = 36/114 (31.58%), Postives = 54/114 (47.37%), Query Frame = 3
Query: 1950 NGECLENAKFCDKINHCADKSDEDPITCRECDPISRKCEINNQILPKKNYFLIHWICDGEEDCGNGYDEQNCDGFSLNNCGGKFFTCSDNKTIPRGYVCDENIDCSQGEDETGC 2291
            N  C+     C+ ++ C D SDE       CDP+      N++ +P      + W CD  +DCG+G DE+NC   +   C    F C++ + IP  +VC+   DC    DE  C
Sbjct: 3654 NYRCIPTWAVCNGMDDCRDNSDEQGCAEITCDPLGDYRCDNHRCIP------LRWRCDRYDDCGDGSDERNC---APRPCSESEFRCTNQRCIPGRWVCNHENDCGDNSDERDC 3758          

HSP 10 Score: 57.3806 bits (137), Expect = 1.791e-8
Identity = 45/128 (35.16%), Postives = 58/128 (45.31%), Query Frame = 3
Query: 1923 CPPGYRFCQNGECLENAKFCDKINHCADKSDEDPITCRE-----CDPISRKCEINNQILPKKNYFLIHWICDGEEDCGNGYDEQ--NCDGFSLNNCGGKFFTCSDNKTIPRGYVCDENIDCSQGEDET 2285
            C PGY  C +G C+     CD    C D SDE     R      C P S +C+ +  I P        W CDG+ DCG+G DE+  +C     N  G   F C +N+ I    +C+   DC  G DET
Sbjct: 3763 CLPGYFQCGSGHCIPERLKCDGSADCQDFSDESLCPTRYPNGTWCPPSSFECDNHVCIPPS-------WKCDGDNDCGDGSDEELHHCLDTPCNPPG--RFRCDNNRCIYSHEICNAVDDCGDGSDET 3881          

HSP 11 Score: 55.4546 bits (132), Expect = 7.278e-8
Identity = 44/140 (31.43%), Postives = 65/140 (46.43%), Query Frame = 3
Query: 1881 EGRQVSSKIYVSDICPPGYRFCQNGECLENAKFCDKINHCADKSDEDPITCRECDPISRKCEINNQILPKKNYFLI-HW-ICDGEEDCGNGYDEQNCDGFSLNNCGGKFFTCSDNKTIPRGYVCDENIDCSQGEDETGCT 2294
            +G    S    +  C PG   C NG C+  +  CD  + C D SDE   TC      S +C+ + +   + NY  I  W +C+G +DC +  DEQ C   + +  G   + C +++ IP  + CD   DC  G DE  C 
Sbjct: 3586 DGSDEDSATCAARTCAPGQFRCNNGRCIPRSWVCDVDDDCGDGSDEPHDTCMG---PSHRCDSHTEFACRTNYRCIPTWAVCNGMDDCRDNSDEQGCAEITCDPLGD--YRCDNHRCIPLRWRCDRYDDCGDGSDERNCA 3720          

HSP 12 Score: 54.6842 bits (130), Expect = 1.188e-7
Identity = 38/127 (29.92%), Postives = 54/127 (42.52%), Query Frame = 3
Query: 1935 YRF-CQNG-ECLENAKFCDKINHCADKSDEDPITCRE---CDPISRKCEINNQILPKKNYFLIHWICDGEEDCGNGYDEQNCDGFSLNNCGGKFFTCSDNKTIPRGYVCDENIDCSQGEDETGCTSP 2300
            Y+F C +G +C+     CD    C D+SDE     R    C     +C+ +   +P        W CDG  DC +G DE    G     C   +  C +   +P  + CD + DC  G DE  C +P
Sbjct: 1152 YQFSCSSGDQCIATYYRCDGAFDCRDRSDEVGCPTRAPGLCHNDEFQCQSDGLCIPAG------WECDGHPDCDDGSDEH--PGCPPRTCAAGYLRCDNGNCVPESWRCDGDNDCRDGTDERDCPTP 1270          

HSP 13 Score: 52.7582 bits (125), Expect = 4.398e-7
Identity = 39/125 (31.20%), Postives = 53/125 (42.40%), Query Frame = 3
Query: 1911 VSDICPPGYRFCQNGECLENAKFCDKINHCADKSDEDPITCRECDPISRKCEINNQILPKKNYFLIHWICDGEEDCGNGYDEQNCDGFSLNNCGGKFFTC-SDNKTIPRGYVCDENIDCSQGEDE 2282
            +S  C P    C +  C++NA  CD  + C D +DE       C      C   +Q +        ++ CDG  DC +  DE  C   +   C    F C SD   IP G+ CD + DC  G DE
Sbjct: 1107 MSGTCHPMQFQCPDHRCIDNAYVCDGDSDCVDGADERGCV-FNCTSYQFSCSSGDQCI------ATYYRCDGAFDCRDRSDEVGCPTRAPGLCHNDEFQCQSDGLCIPAGWECDGHPDCDDGSDE 1224          
BLAST of low density lipoprotein receptor-1 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000001137.1 (pep scaffold:Pmarinus_7.0:GL476464:95621:179961:-1 gene:ENSPMAG00000001008.1 transcript:ENSPMAT00000001137.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 68.1662 bits (165), Expect = 7.805e-12
Identity = 46/124 (37.10%), Postives = 59/124 (47.58%), Query Frame = 3
Query: 1944 CQNGECLENAKFCDKINHCADKSDEDPITC-------RECDPISRKCEINNQILPKKNYFLIHWICDGEEDCGNGYDEQNCDGFSLNNCGGKFFTCSDNKT-IPRGYVCDENIDCSQGEDETGC 2291
            C+NG C+ +   CD  N C D SDE   TC       R+C     +C IN   +P      + W CDG+ DC +  DE+ CDG       G  FTC  N   I + +VCD + DC    DE GC
Sbjct:  157 CKNGHCIPSQWVCDGDNDCGDVSDETH-TCEFPARPLRQCREDEFRCAINGNCIP------LRWRCDGDADCMDISDEKECDGQRRTCNPGTHFTCVSNGICIRKAWVCDGDNDCEDNSDEAGC 273          

HSP 2 Score: 63.929 bits (154), Expect = 1.609e-10
Identity = 44/125 (35.20%), Postives = 56/125 (44.80%), Query Frame = 3
Query: 1923 CPPGYRFCQNGECLENAKFCDKINHCADKSDEDPITCRECDPISRKCEINNQILPKKNYFLIHWICDGEEDCGNGYDEQNCDGFSLNNCGGKFFTCSDNKTIPRGYVCDENIDCSQGEDETGCTS 2297
            C P    C+N  C+     CD  N C D SDE+  T R C      C     I  +       W CDG+ DC +G DE++C   SL  C    F C +   IP+ + CD + DC  G DE  C S
Sbjct:  876 CEPYQFRCKNNRCIPGRWHCDYDNDCGDNSDEEGCTPRPCSESEFSCANGRCIAGR-------WRCDGDHDCMDGSDEKDC---SL-RCEQDQFQCQNGHCIPQRWRCDNDADCLDGSDEENCGS 989          

HSP 3 Score: 63.929 bits (154), Expect = 1.766e-10
Identity = 42/110 (38.18%), Postives = 59/110 (53.64%), Query Frame = 3
Query: 1959 CLENAKFCDKINHCADKSDEDPITCRECDPISR--KCEINNQILPKKNYFLIHWICDGEEDCGNGYDEQNCDGFSLNNCGGKFFTCSDNKTIPRGYVCDENIDCSQGEDE 2282
            C+++   CD  N C D SDE P  C++   IS   KC+ NN+ +P      + W+CDG+ DCG   DE N    ++  C  + FTC + K IP  + CD + DCS   DE
Sbjct:    1 CIQDQWRCDGDNDCQDGSDELPEICQQHTCISDRFKCK-NNRCIP------MRWLCDGDNDCGENEDESN-TTCTVRTCPAEQFTCGNGKCIPIAWKCDLDNDCSDNSDE 102          

HSP 4 Score: 60.4622 bits (145), Expect = 1.598e-9
Identity = 43/123 (34.96%), Postives = 59/123 (47.97%), Query Frame = 3
Query: 1923 CPPGYRFCQNGECLENAKFCDKINHCADKSDEDPITCR--ECDPISRKCEINNQILPKKNYFLIHWICDGEEDCGNGYDEQNCDGFSLNNCGGKFFTCSDNKTIPRGYVCDENIDCSQGEDET 2285
            CP     C NG+C+  A  CD  N C+D SDE P +C    C P+++    N + +       I W CD + DC +  DE  C+    N C    F+C +   IP  +VCD + DC    DET
Sbjct:   71 CPAEQFTCGNGKCIPIAWKCDLDNDCSDNSDEPP-SCAYPTCLPLTQFSCNNGRCIN------IRWRCDSDNDCADSSDEAGCN----NTCADSQFSCKNGHCIPSQWVCDGDNDCGDVSDET 182          
BLAST of low density lipoprotein receptor-1 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000003195.1 (pep scaffold:Pmarinus_7.0:GL476689:250750:275904:-1 gene:ENSPMAG00000002894.1 transcript:ENSPMAT00000003195.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 60.8474 bits (146), Expect = 1.375e-9
Identity = 45/125 (36.00%), Postives = 60/125 (48.00%), Query Frame = 3
Query: 1959 CLENAKFCDKINHCADKSDEDP-ITCRECDPISRKCEINNQILPKKNYFLIHWI--CDGEEDCGNGYDEQNCDGFSLNNCGGKFFTC--SDNKTIPRGYVCDENIDCSQGEDET----GCTSPQI 2306
            C+  + +CD +  CAD+SDE P   CR      + C  N       N   + WI  CDGE DC  G DE +C+      C    + C  S+N+ +   YVCD   DCS G DE+    GCT+ Q 
Sbjct:  477 CIRGSLYCDGVTDCADQSDETPDCACRS----DQGCTANQYACNNSNNECLEWIYVCDGEADCSGGSDESDCE---REGCTANQYACNNSNNECLEWIYVCDGEADCSGGSDESDCARGCTANQY 594          

HSP 2 Score: 53.9138 bits (128), Expect = 1.595e-7
Identity = 49/141 (34.75%), Postives = 59/141 (41.84%), Query Frame = 3
Query: 1905 IYVSDI--CPPGYRFCQNG--ECLENAKFCDKINHCADKSDEDPITCRECDPISRKCEINNQILPKKNYFLIHWI--CDGEEDCGNGYDEQNCDGFSLNNCGGKFFTC--SDNKTIPRGYVCDENIDCSQGEDETGCTSPQ 2303
            IYV D   C      C N   ECLE    CD    C+  SDE           +R C  N       N   + WI  CDGE DC  G DE +C+      C    + C  S+N+ +   YVCD   DCS G DE+ C   Q
Sbjct:  744 IYVCDGEGCTANQYACNNSNNECLEWIYVCDGEADCSGGSDESDC--------ARGCTANQYACNNSNNECLEWIYVCDGEADCSGGSDESDCE----RGCPANLYACNNSNNECLEWIYVCDGEADCSGGSDESDCERVQ 872          

HSP 3 Score: 53.5286 bits (127), Expect = 2.358e-7
Identity = 45/127 (35.43%), Postives = 56/127 (44.09%), Query Frame = 3
Query: 1950 NGECLENAKFCDKINHCADKSDEDPITCRECDPISRKCEINNQILPKKNYFLIHWI--CDGEEDCGNGYDEQNCDGFSLNNCGGKFFTC--SDNKTIPRGYVCDENIDCSQGEDET----GCTSPQI 2306
            N ECLE    CD    C+  SDE           +R C  N       N   + WI  CDGE DC  G DE +C+      C    + C  S+N+ +   YVCD   DCS G DE+    GCT+ Q 
Sbjct:  560 NNECLEWIYVCDGEADCSGGSDESDC--------ARGCTANQYACNNSNNECLEWIYVCDGEADCSGGSDESDCE----RGCTANQYACNNSNNECLEWIYVCDGEADCSGGSDESDCERGCTANQY 674          

HSP 4 Score: 51.9878 bits (123), Expect = 6.483e-7
Identity = 43/122 (35.25%), Postives = 53/122 (43.44%), Query Frame = 3
Query: 1950 NGECLENAKFCDKINHCADKSDEDPITCRECDPISRKCEINNQILPKKNYFLIHWI--CDGEEDCGNGYDEQNCDGFSLNNCGGKFFTC--SDNKTIPRGYVCDENIDCSQGEDETGCTSPQ 2303
            N ECLE    CD    C+  SDE            R C  N       N   + WI  CDGE DC  G DE +C+   +  C    + C  S+N+ +   YVCD   DCS G DE+ C   Q
Sbjct:  803 NNECLEWIYVCDGEADCSGGSDESDC--------ERGCPANLYACNNSNNECLEWIYVCDGEADCSGGSDESDCE--RVQGCPANLYACNNSNNECLEWIYVCDGEADCSGGSDESDCERVQ 914          

HSP 5 Score: 51.9878 bits (123), Expect = 6.594e-7
Identity = 42/120 (35.00%), Postives = 52/120 (43.33%), Query Frame = 3
Query: 1944 CQNGECLENAKFCDKINHCADKSDEDPITCRECDPISRKCEINNQILPKKNYFLIHWI--CDGEEDCGNGYDEQNCDGFSLNNCGGKFFTC--SDNKTIPRGYVCDENIDCSQGEDETGC 2291
            C NG CL     CD    C+  SDE            R C  N       N   + WI  CDGE DC  G DE +C+   +  C    + C  S+N+ +   YVCD   DCS G DE+ C
Sbjct:  354 CGNGSCLGWIYVCDGEADCSGGSDE--------SDCERGCTANQYACNNSNNECLEWIYVCDGEADCSGGSDESDCE--RVQGCTANQYACNNSNNECLEWIYVCDGEADCSGGSDESDC 463          

HSP 6 Score: 51.9878 bits (123), Expect = 7.179e-7
Identity = 48/139 (34.53%), Postives = 63/139 (45.32%), Query Frame = 3
Query: 1923 CPPGYRFCQNG--ECLENAKFCDKINHCADKSDEDPITCRECDPISRKCEINNQILPKKNYFLIHWI--CDGEEDCGNGYDEQNCDGFSLNNCGGKFFTC--SDNKTIPRGYVCDENIDCSQGEDET-----GCTSPQI 2306
            CP     C N   ECLE    CD    C+  SDE      +C+ + + C  N       N   + WI  CDGE DC  G DE +C+   +  C    + C  S+N+ +   YVCD   DCS G DE+     GCT+ Q 
Sbjct:  832 CPANLYACNNSNNECLEWIYVCDGEADCSGGSDE-----SDCERV-QGCPANLYACNNSNNECLEWIYVCDGEADCSGGSDESDCE--RVQGCTANQYACNNSNNECLEWIYVCDGEADCSGGSDESDCEREGCTANQY 962          

HSP 7 Score: 51.6026 bits (122), Expect = 9.030e-7
Identity = 42/119 (35.29%), Postives = 51/119 (42.86%), Query Frame = 3
Query: 1950 NGECLENAKFCDKINHCADKSDEDPITCRECDPISRKCEINNQILPKKNYFLIHWI--CDGEEDCGNGYDEQNCDGFSLNNCGGKFFTC--SDNKTIPRGYVCDENIDCSQGEDETGCT 2294
            N ECLE    CD    C+  SDE            R C  N       N   + WI  CDGE DC  G DE +C+      C    + C  S+N+ +   YVCD   DCS G DE+ C 
Sbjct:  600 NNECLEWIYVCDGEADCSGGSDESDC--------ERGCTANQYACNNSNNECLEWIYVCDGEADCSGGSDESDCE----RGCTANQYACNNSNNECLEWIYVCDGEADCSGGSDESDCA 706          

HSP 8 Score: 51.2174 bits (121), Expect = 1.136e-6
Identity = 44/121 (36.36%), Postives = 57/121 (47.11%), Query Frame = 3
Query: 1950 NGECLENAKFCDKINHCADKSDEDPITCRECDPISRKCEINNQILPKKNYFLIHWI--CDGEEDCGNGYDEQNCD-GF--SLNNCGGKFFTC--SDNKTIPRGYVCDENIDCSQGEDETGC 2291
            N ECLE    CD    C+  SDE      +C+ + + C  N       N   + WI  CDGE DC  G DE +C+ G    L  C    + C  S+N+ +   YVCD   DCS G DE+ C
Sbjct:   81 NNECLEWIYVCDGEADCSGGSDE-----SDCERV-QGCTANQYACNNSNNECLEWIYVCDGEADCSGGSDESDCERGMFEHLQGCTANQYACNNSNNECLEWIYVCDGEADCSGGSDESDC 195          

HSP 9 Score: 50.8322 bits (120), Expect = 1.312e-6
Identity = 45/127 (35.43%), Postives = 54/127 (42.52%), Query Frame = 3
Query: 1950 NGECLENAKFCDKINHCADKSDEDPITCRECDPISRKCEINNQILPKKNYFLIHWI--CDGEEDCGNGYDEQNCDGFSLNNCGGKFFTC--SDNKTIPRGYVCDENIDCSQGEDET----GCTSPQI 2306
            N ECLE    CD    C+  SDE        D     C  N       N   + WI  CDGE DC  G DE +C       C    + C  S+N+ +   YVCD   DCS G DE+    GCT+ Q 
Sbjct:  519 NNECLEWIYVCDGEADCSGGSDES-------DCEREGCTANQYACNNSNNECLEWIYVCDGEADCSGGSDESDC----ARGCTANQYACNNSNNECLEWIYVCDGEADCSGGSDESDCERGCTANQY 634          

HSP 10 Score: 50.8322 bits (120), Expect = 1.346e-6
Identity = 43/120 (35.83%), Postives = 51/120 (42.50%), Query Frame = 3
Query: 1956 ECLENAKFCDKINHCADKSDEDPITCRECDPISRKCEINNQILPKKNYFLIHWI--CDGEEDCGNGYDEQNCDGFSLNNCGGKFFTC--SDNKTIPRGYVCDENIDCSQGEDETGCTSPQ 2303
            ECLE    CD    C+  SDE        D     C  N       N   + WI  CDGE DC  G DE NC+      C    + C  S+N+ +   YVCD   DCS G DE+ C   Q
Sbjct:    1 ECLEWIYVCDGEADCSGGSDES-------DCEREGCTANQYACNNSNNECLEWIYVCDGEADCSGGSDESNCE---REGCTANQYACNNSNNECLEWIYVCDGEADCSGGSDESDCERVQ 110          

HSP 11 Score: 50.0618 bits (118), Expect = 2.702e-6
Identity = 43/118 (36.44%), Postives = 53/118 (44.92%), Query Frame = 3
Query: 1950 NGECLENAKFCDKINHCADKSDEDPITCRECDPISRKCEINNQILPKKNYFLIHWI--CDGEEDCGNGYDEQNCDGFSLNNCGGKFFTC--SDNKTIPRGYVCDENIDCSQGEDETGC 2291
            N ECLE    CD    C+  SDE     RE       C  N       N   + WI  CDGE DC  G DE +C+   +  C    + C  S+N+ +   YVCD   DCS G DE+ C
Sbjct:   40 NNECLEWIYVCDGEADCSGGSDESNCE-RE------GCTANQYACNNSNNECLEWIYVCDGEADCSGGSDESDCE--RVQGCTANQYACNNSNNECLEWIYVCDGEADCSGGSDESDC 148          

HSP 12 Score: 50.0618 bits (118), Expect = 2.725e-6
Identity = 43/140 (30.71%), Postives = 56/140 (40.00%), Query Frame = 3
Query: 1944 CQNGECLENAKFCDKINHCADKSDEDPITCRECDPISRKCEINNQILPKKNYFLIHWI--CDGEEDCGNGYDEQNCDGFSLN--------------------NCGGKFFTC--SDNKTIPRGYVCDENIDCSQGEDETGC 2291
            C NG CL  A  CD +N C D +DE   +       ++ C  N       N   + WI  CDGE DC  G DE +C+                          C    + C  S+N+ +   YVCD   DCS G DE+ C
Sbjct:  208 CGNGSCLGIASLCDGVNDCGDFTDESNCS-------NQGCTENQYACNNSNNECLEWIYVCDGEADCSGGSDESDCERGMFEQLCMPLRPNTLWQWELPGNKGCTANQYACNNSNNECLEWIYVCDGEADCSGGSDESNC 340          
BLAST of low density lipoprotein receptor-1 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000003181.1 (pep scaffold:Pmarinus_7.0:GL476689:240399:277283:-1 gene:ENSPMAG00000002894.1 transcript:ENSPMAT00000003181.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 60.8474 bits (146), Expect = 1.464e-9
Identity = 43/120 (35.83%), Postives = 57/120 (47.50%), Query Frame = 3
Query: 1959 CLENAKFCDKINHCADKSDEDP-ITCRECDPISRKCEINNQILPKKNYFLIHWI--CDGEEDCGNGYDEQNCDGFSLNNCGGKFFTC--SDNKTIPRGYVCDENIDCSQGEDETGCTSPQ 2303
            C+  + +CD +  CAD+SDE P   CR      + C  N       N   + WI  CDGE DC  G DE +C    +  C    + C  S+N+ +   YVCD   DCS G DE+ C   Q
Sbjct: 1077 CIRGSLYCDGVTDCADQSDETPDCACRS----DQGCTANQYACNNSNNECLEWIYVCDGEADCSGGSDESDC--ARVQGCTANQYACNNSNNECLEWIYVCDGEADCSGGSDESDCERVQ 1190          

HSP 2 Score: 58.151 bits (139), Expect = 1.010e-8
Identity = 46/128 (35.94%), Postives = 57/128 (44.53%), Query Frame = 3
Query: 1944 CQNGECLENAKFCDKINHCADKSDEDPITCRECDPISRKCEINNQILPKKNYFLIHWI--CDGEEDCGNGYDEQNCDGFSLNNCGGKFFTC--SDNKTIPRGYVCDENIDCSQGEDET----GCTSPQ 2303
            C NG CL  A  CD +N C D +DE            + C  N       N   + WI  CDGE DC  G DE +C+      C    + C  S+N+ +   YVCD   DCS G DE+    GCT  Q
Sbjct:  417 CGNGSCLGIASLCDGVNDCGDFTDESNCI--------QGCTANQYACNNSNNECLEWIYVCDGEADCSGGSDESDCE----RGCTANQYACNNSNNECLEWIYVCDGEADCSGGSDESDCERGCTENQ 532          

HSP 3 Score: 55.8398 bits (133), Expect = 4.758e-8
Identity = 42/123 (34.15%), Postives = 59/123 (47.97%), Query Frame = 3
Query: 1959 CLENAKFCDKINHCADKSDEDPITCRECDPISRKCEINNQILPKKNYFLIHWI--CDGEEDCGNGYDEQNCDGFSLNNCGGKFFTC--SDNKTIPRGYVCDENIDCSQGEDET----GCTSPQ 2303
            C+  + +CD +  CAD+SDE P            C   +  +   N   + WI  CDGE DC  G DE +C+   +  C    + C  S+N+ +   YVCD   DCS G DE+    GCT+ Q
Sbjct:  645 CIRGSLYCDGVTDCADQSDETP-----------DCACRSDQIRCGNGSCLGWIYVCDGEADCSGGSDESDCE--RVQGCTANQYACNNSNNECLEWIYVCDGEADCSGGSDESDCERGCTANQ 754          

HSP 4 Score: 55.4546 bits (132), Expect = 6.790e-8
Identity = 40/119 (33.61%), Postives = 56/119 (47.06%), Query Frame = 3
Query: 1959 CLENAKFCDKINHCADKSDEDPITCRECDPISRKCEINNQILPKKNYFLIHWI--CDGEEDCGNGYDEQNCDGFSLNNCGGKFFTC--SDNKTIPRGYVCDENIDCSQGEDETGCTSPQ 2303
            C+  + +CD +  CAD+SDE P            C   +  +   N   + WI  CDGE DC  G DE +C+   +  C    + C  S+N+ +   YVCD   DCS G DE+ C   Q
Sbjct:  880 CIRGSLYCDGVTDCADQSDETP-----------DCACRSDQIRCGNGSCLGWIYVCDGEADCSGGSDESDCE--RVQGCTANQYACNNSNNECLEWIYVCDGEADCSGGSDESDCERVQ 985          

HSP 5 Score: 55.4546 bits (132), Expect = 6.790e-8
Identity = 40/119 (33.61%), Postives = 56/119 (47.06%), Query Frame = 3
Query: 1959 CLENAKFCDKINHCADKSDEDPITCRECDPISRKCEINNQILPKKNYFLIHWI--CDGEEDCGNGYDEQNCDGFSLNNCGGKFFTC--SDNKTIPRGYVCDENIDCSQGEDETGCTSPQ 2303
            C+  + +CD +  CAD+SDE P            C   +  +   N   + WI  CDGE DC  G DE +C+   +  C    + C  S+N+ +   YVCD   DCS G DE+ C   Q
Sbjct: 1238 CIRGSLYCDGVTDCADQSDETP-----------DCACRSDQIRCGNGSCLGWIYVCDGEADCSGGSDESDCE--RVQGCTANQYACNNSNNECLEWIYVCDGEADCSGGSDESDCERVQ 1343          

HSP 6 Score: 55.0694 bits (131), Expect = 8.903e-8
Identity = 40/119 (33.61%), Postives = 56/119 (47.06%), Query Frame = 3
Query: 1959 CLENAKFCDKINHCADKSDEDPITCRECDPISRKCEINNQILPKKNYFLIHWI--CDGEEDCGNGYDEQNCDGFSLNNCGGKFFTC--SDNKTIPRGYVCDENIDCSQGEDETGCTSPQ 2303
            C+  + +CD +  CAD+SDE P            C   +  +   N   + WI  CDGE DC  G DE +C+   +  C    + C  S+N+ +   YVCD   DCS G DE+ C   Q
Sbjct: 1594 CIRGSLYCDGLTDCADQSDETP-----------DCACRSDQIRCGNGSCLGWIYVCDGEADCSGGSDESDCE--RVQGCTANQYACNNSNNECLEWIYVCDGEADCSGGSDESDCERVQ 1699          

HSP 7 Score: 53.1434 bits (126), Expect = 3.280e-7
Identity = 43/122 (35.25%), Postives = 53/122 (43.44%), Query Frame = 3
Query: 1950 NGECLENAKFCDKINHCADKSDEDPITCRECDPISRKCEINNQILPKKNYFLIHWI--CDGEEDCGNGYDEQNCDGFSLNNCGGKFFTC--SDNKTIPRGYVCDENIDCSQGEDETGCTSPQ 2303
            N ECLE    CD    C+  SDE            R C  N       N   + WI  CDGE DC  G DE +C+   +  C    + C  S+N+ +   YVCD   DCS G DE+ C   Q
Sbjct:  721 NNECLEWIYVCDGEADCSGGSDESDC--------ERGCTANQYACNNSNNECLEWIYVCDGEADCSGGSDESDCE--RVQGCTANQYACNNSNNECLEWIYVCDGEADCSGGSDESDCERVQ 832          

HSP 8 Score: 52.373 bits (124), Expect = 5.735e-7
Identity = 43/122 (35.25%), Postives = 56/122 (45.90%), Query Frame = 3
Query: 1950 NGECLENAKFCDKINHCADKSDEDPITCRECDPISRKCEINNQILPKKNYFLIHWI--CDGEEDCGNGYDEQNCDGFSLNNCGGKFFTC--SDNKTIPRGYVCDENIDCSQGEDETGCTSPQ 2303
            N ECLE    CD    C+  SDE      +C+ + + C  N       N   + WI  CDGE DC  G DE +C+      C    + C  S+N+ +   YVCD   DCS G DE+ C   Q
Sbjct: 1314 NNECLEWIYVCDGEADCSGGSDE-----SDCERV-QGCTANQYACNNSNNECLEWIYVCDGEADCSGGSDESDCE---REGCPANLYACNNSNNECLEWIYVCDGEADCSGGSDESDCERDQ 1426          

HSP 9 Score: 51.9878 bits (123), Expect = 6.402e-7
Identity = 43/122 (35.25%), Postives = 57/122 (46.72%), Query Frame = 3
Query: 1950 NGECLENAKFCDKINHCADKSDEDPITCRECDPISRKCEINNQILPKKNYFLIHWI--CDGEEDCGNGYDEQNCDGFSLNNCGGKFFTC--SDNKTIPRGYVCDENIDCSQGEDETGCTSPQ 2303
            N ECLE    CD    C+  SDE      +C+ + + C  N       N   + WI  CDGE DC  G DE +C+   +  C    + C  S+N+ +   YVCD   DCS G DE+ C   Q
Sbjct: 1433 NNECLEWIYVCDGEADCSGGSDE-----SDCERV-QGCTANQYACNNSNNECLEWIYVCDGEADCSGGSDESDCE--RVQGCTANQYACNNSNNECLEWIYVCDGEADCSGGSDESDCERVQ 1546          

HSP 10 Score: 51.9878 bits (123), Expect = 7.455e-7
Identity = 43/118 (36.44%), Postives = 55/118 (46.61%), Query Frame = 3
Query: 1950 NGECLENAKFCDKINHCADKSDEDPITCRECDPISRKCEINNQILPKKNYFLIHWI--CDGEEDCGNGYDEQNCDGFSLNNCGGKFFTC--SDNKTIPRGYVCDENIDCSQGEDETGC 2291
            N ECLE    CD    C+  SDE      +C+ + + C  N       N   + WI  CDGE DC  G DE NC+      C    + C  S+N+ +   YVCD   DCS G DE+ C
Sbjct: 1712 NNECLEWIYVCDGEADCSGGSDE-----SDCERV-QGCTANQYACNNSNNECLEWIYVCDGEADCSGGSDESNCE---REGCTANQYACNNSNNECLEWIYVCDGEADCSGGSDESDC 1820          

HSP 11 Score: 51.6026 bits (122), Expect = 8.183e-7
Identity = 45/129 (34.88%), Postives = 60/129 (46.51%), Query Frame = 3
Query: 1944 CQNGECLENAKFCDKINHCADKSDEDPITCRECDPISRKCEINNQILPKKNYFLIHWI--CDGEEDCGNGYDEQNCDGFSLNNCGGKFFTC--SDNKTIPRGYVCDENIDCSQGEDET-----GCTSPQ 2303
            C NG CL     CD    C+  SDE      +C+ + + C  N       N   + WI  CDGE DC  G DE +C+   +  C    + C  S+N+ +   YVCD   DCS G DE+     GCT+ Q
Sbjct:  912 CGNGSCLGWIYVCDGEADCSGGSDE-----SDCERV-QGCTANQYACNNSNNECLEWIYVCDGEADCSGGSDESDCE--RVQGCTANQYACNNSNNECLEWIYVCDGEADCSGGSDESDCAREGCTANQ 1032          

HSP 12 Score: 51.6026 bits (122), Expect = 8.906e-7
Identity = 43/124 (34.68%), Postives = 57/124 (45.97%), Query Frame = 3
Query: 1944 CQNGECLENAKFCDKINHCADKSDEDPITCRECDPISRKCEINNQILPKKNYFLIHWI--CDGEEDCGNGYDEQNCDGFSLNNCGGKFFTC--SDNKTIPRGYVCDENIDCSQGEDETGCTSPQ 2303
            C NG CL     CD    C+  SDE      +C+ + + C  N       N   + WI  CDGE DC  G DE +C+   +  C    + C  S+N+ +   YVCD   DCS G DE+ C   Q
Sbjct: 1626 CGNGSCLGWIYVCDGEADCSGGSDE-----SDCERV-QGCTANQYACNNSNNECLEWIYVCDGEADCSGGSDESDCE--RVQGCTANQYACNNSNNECLEWIYVCDGEADCSGGSDESDCERVQ 1741          

HSP 13 Score: 51.6026 bits (122), Expect = 9.370e-7
Identity = 42/122 (34.43%), Postives = 54/122 (44.26%), Query Frame = 3
Query: 1959 CLENAKFCDKINHCADKSDEDPITCRECDPISRKCEINNQILPKKNYFLIHWI--CDGEEDCGNGYDEQNCDGFSLNNCGGKFFTCSDNKTIPRGYV-CDENIDCSQGEDET---GCTSPQI 2306
            C+  + +CD +  CAD+SDE P            C   +  +   N   + WI  CDGE DC  G DE NC+           F C+D K   RG + CD   DC+   DET    C S QI
Sbjct:  117 CIRGSLYCDGVTDCADQSDETP-----------DCACRSDQIRCGNGSCLGWIYVCDGEADCSGGSDESNCE--------RGMFECADKKHCIRGSLYCDGVTDCADQSDETPDCACRSDQI 219          

HSP 14 Score: 51.6026 bits (122), Expect = 9.370e-7
Identity = 42/119 (35.29%), Postives = 56/119 (47.06%), Query Frame = 3
Query: 1950 NGECLENAKFCDKINHCADKSDEDPITCRECDPISRKCEINNQILPKKNYFLIHWI--CDGEEDCGNGYDEQNCDGFSLNNCGGKFFTC--SDNKTIPRGYVCDENIDCSQGEDETGCT 2294
            N ECLE    CD    C+  SDE      +C+ + + C  N       N   + WI  CDGE DC  G DE +C+   +  C    + C  S+N+ +   YVCD   DCS G DE+ C 
Sbjct:  761 NNECLEWIYVCDGEADCSGGSDE-----SDCERV-QGCTANQYACNNSNNECLEWIYVCDGEADCSGGSDESDCE--RVQGCTANQYACNNSNNECLEWIYVCDGEADCSGGSDESDCA 871          

HSP 15 Score: 51.2174 bits (121), Expect = 1.371e-6
Identity = 45/133 (33.83%), Postives = 56/133 (42.11%), Query Frame = 3
Query: 1923 CPPGYRFCQNG--ECLENAKFCDKINHCADKSDEDPITCRECDPISRKCEINNQILPKKNYFLIHWI--CDGEEDCGNGYDEQNCDGFSLNNCGGKFFTC--SDNKTIPRGYVCDENIDCSQGEDETGCTSPQ 2303
            CP     C N   ECLE    CD    C+  SDE              CE +       N   + WI  CDGE DC  G DE +C+   +  C    + C  S+N+ +   YVCD   DCS G DE+ C   Q
Sbjct: 1386 CPANLYACNNSNNECLEWIYVCDGEADCSGGSDE------------SDCERDQYACNNSNNECLEWIYVCDGEADCSGGSDESDCE--RVQGCTANQYACNNSNNECLEWIYVCDGEADCSGGSDESDCERVQ 1504          

HSP 16 Score: 50.8322 bits (120), Expect = 1.783e-6
Identity = 42/122 (34.43%), Postives = 55/122 (45.08%), Query Frame = 3
Query: 1959 CLENAKFCDKINHCADKSDEDPITCRECDPISRKCEINNQILPKKNYFLIHWI--CDGEEDCGNGYDEQNCDGFSLNNCGGKFFTCSDNKTIPRGYV-CDENIDCSQGEDET---GCTSPQI 2306
            C+  + +CD +  CAD+SDE P            C   +  +   N   + WI  CDGE DC  G DE +C+        G F  C+D K   RG + CD   DC+   DET    C S QI
Sbjct:  312 CIRGSLYCDGVTDCADESDETP-----------DCACRSDQIRCGNGSCLGWIYVCDGEADCSGGSDESDCE-------RGMFEHCADKKHCIRGSLYCDGVTDCADQSDETPDCACRSDQI 415          

HSP 17 Score: 50.447 bits (119), Expect = 1.876e-6
Identity = 42/118 (35.59%), Postives = 55/118 (46.61%), Query Frame = 3
Query: 1950 NGECLENAKFCDKINHCADKSDEDPITCRECDPISRKCEINNQILPKKNYFLIHWI--CDGEEDCGNGYDEQNCDGFSLNNCGGKFFTC--SDNKTIPRGYVCDENIDCSQGEDETGC 2291
            N ECLE    CD    C+  SDE      +C+ + + C  N       N   + WI  CDGE DC  G DE +C   +   C    + C  S+N+ +   YVCD   DCS G DE+ C
Sbjct:  956 NNECLEWIYVCDGEADCSGGSDE-----SDCERV-QGCTANQYACNNSNNECLEWIYVCDGEADCSGGSDESDC---AREGCTANQYACNNSNNECLEWIYVCDGEADCSGGSDESDC 1064          

HSP 18 Score: 50.447 bits (119), Expect = 2.076e-6
Identity = 43/124 (34.68%), Postives = 56/124 (45.16%), Query Frame = 3
Query: 1944 CQNGECLENAKFCDKINHCADKSDEDPITCRECDPISRKCEINNQILPKKNYFLIHWI--CDGEEDCGNGYDEQNCDGFSLNNCGGKFFTC--SDNKTIPRGYVCDENIDCSQGEDETGCTSPQ 2303
            C NG CL     CD    C+  SDE      +C+ + + C  N       N   + WI  CDGE DC  G DE +C+      C    + C  S+N+ +   YVCD   DCS G DE+ C   Q
Sbjct:  677 CGNGSCLGWIYVCDGEADCSGGSDE-----SDCERV-QGCTANQYACNNSNNECLEWIYVCDGEADCSGGSDESDCE----RGCTANQYACNNSNNECLEWIYVCDGEADCSGGSDESDCERVQ 790          

HSP 19 Score: 50.447 bits (119), Expect = 2.358e-6
Identity = 42/118 (35.59%), Postives = 51/118 (43.22%), Query Frame = 3
Query: 1950 NGECLENAKFCDKINHCADKSDEDPITCRECDPISRKCEINNQILPKKNYFLIHWI--CDGEEDCGNGYDEQNCDGFSLNNCGGKFFTC--SDNKTIPRGYVCDENIDCSQGEDETGC 2291
            N ECLE    CD    C+  SDE            R C  N       N   + WI  CDGE DC  G DE +C+     N     + C  S+N+ +   YVCD   DCS G DE+ C
Sbjct:  459 NNECLEWIYVCDGEADCSGGSDESDC--------ERGCTANQYACNNSNNECLEWIYVCDGEADCSGGSDESDCERGCTEN----QYACNNSNNECLEWIYVCDGEADCSGGSDESDC 564          

HSP 20 Score: 50.0618 bits (118), Expect = 2.746e-6
Identity = 44/122 (36.07%), Postives = 53/122 (43.44%), Query Frame = 3
Query: 1950 NGECLENAKFCDKINHCADKSDEDPITCRECDPISRKCEINNQILPKKNYFLIHWI--CDGEEDCGNGYDEQNC--DGFSLNNCGGKFFTCSDNKTIPRGYVCDENIDCSQGEDETGCTSPQ 2303
            N ECLE    CD    C+  SDE        D     C  N       N   + WI  CDGE DC  G DE +C  D ++ NN        S+N+ +   YVCD   DCS G DE+ C   Q
Sbjct: 1356 NNECLEWIYVCDGEADCSGGSDES-------DCEREGCPANLYACNNSNNECLEWIYVCDGEADCSGGSDESDCERDQYACNN--------SNNECLEWIYVCDGEADCSGGSDESDCERVQ 1462          
BLAST of low density lipoprotein receptor-1 vs. Ensembl Nematostella
Match: EDO45218 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RTH9])

HSP 1 Score: 81.2629 bits (199), Expect = 1.242e-15
Identity = 45/124 (36.29%), Postives = 65/124 (52.42%), Query Frame = 3
Query: 1923 CPPGYRFCQNGECLENAKFCDKINHCADKSDEDPITCRECDPISRKCEINNQILPKKNYFLIHWICDGEEDCGNGYDEQNCDGFSLNNCGGKFFTCSDNKTIPRGYVCDENIDCSQGEDETGCT 2294
            C PG   C NG+C+ ++  CD  N C D SDE+      C+P   KC+ N + +  K      W CD + DCG+  DE+NC   + + C   +F C++ + IP  +VCD + DC    DE  CT
Sbjct: 1027 CAPGQFKCGNGKCIPSSWKCDHDNDCGDNSDENNCPYSTCNPSQFKCD-NGRCISSK------WRCDHDNDCGDMSDERNC---TFSTCASNYFRCANQRCIPMRWVCDFDNDCRDNSDERDCT 1140          

HSP 2 Score: 76.6406 bits (187), Expect = 3.434e-14
Identity = 45/123 (36.59%), Postives = 60/123 (48.78%), Query Frame = 3
Query: 1923 CPPGYRFCQNGECLENAKFCDKINHCADKSDEDPITCRECDPISRKCEINNQILPKKNYFLIHWICDGEEDCGNGYDEQNCDGFSLNNCGGKFFTCSDNKTIPRGYVCDENIDCSQGEDETGC 2291
            C PG   C NG+C+ ++  CD  N C D SDE+      C+P   KC+ N + +  K      W CD + DCG+  DE+NC G     C    F C + K IP  + CD + DC    DE  C
Sbjct:  950 CAPGQFKCGNGKCIPSSWKCDHDNDCGDNSDENNCPYSTCNPSQFKCD-NGRCISSK------WRCDHDNDCGDMSDERNCTG----TCAPGQFKCGNGKCIPSSWKCDHDNDCGDNSDENNC 1061          

HSP 3 Score: 73.559 bits (179), Expect = 3.603e-13
Identity = 42/126 (33.33%), Postives = 59/126 (46.83%), Query Frame = 3
Query: 1923 CPPGYRFCQNGECLENAKFCDKINHCADKSDEDPITCRECDPISRKCEINNQILPKKNYFLIHWICDGEEDCGNGYDEQNCDGFSLNNCGGKFFTCSDNKTIPRGYVCDENIDCSQGEDETGCTSP 2300
            C   Y  C N  C+     CD  N C D SDE     R+C P    C  N      +    + W+CD + DC +  DE++C   +  +C    F+CS+ + I R +VCD + DC  G DE  C+ P
Sbjct: 1105 CASNYFRCANQRCIPMRWVCDFDNDCRDNSDE-----RDCTPTFSTCASNYFRCANQRCIPMRWVCDFDNDCRDNSDERDCTP-TGRSCNSGQFSCSNGRCISRSWVCDRDNDCGDGSDERNCSYP 1224          

HSP 4 Score: 65.855 bits (159), Expect = 7.860e-11
Identity = 45/140 (32.14%), Postives = 61/140 (43.57%), Query Frame = 3
Query: 1923 CPPGYRFCQNGECLENAKFCDKINHCADKSDE--------DPITCRECDPISRKCEINNQILPKKNYFLIHWICDGEEDCGNGYDEQNCDG----FSLNNCGGKFFTCSDNKTIPRGYVCDENIDCSQGEDETGCTSPQI 2306
            C  G   C NG C+  +  CD+ N C D SDE         P T R   PI          L  +  F    +CDG +DCG+  DE +C+     F   +C    F C++ + +     CD   DC    DETGC++P I
Sbjct: 1187 CNSGQFSCSNGRCISRSWVCDRDNDCGDGSDERNCSYPTTGPWTTRPWTPIFSCRSWEFSCLNGRCVFY-RLVCDGVDDCGDSSDEMSCNATATPFVPRSCHYWEFQCANRRCVYNSQRCDGQNDCGDWSDETGCSTPPI 1325          

HSP 5 Score: 64.3142 bits (155), Expect = 2.366e-10
Identity = 42/126 (33.33%), Postives = 55/126 (43.65%), Query Frame = 3
Query: 1944 CQNGECLENAKFCDKINHCADKSDED----PITCRECDPISRKCEINNQILPKKNYFLIHWICDGEEDCGNGYDEQ----NCDGFSLNNCGGKFFTCSDNKTIPRGYVCDENIDCSQGEDETGCTS 2297
            C N  C+ N++ CD  N C D SDE     P     C     +C  N+  L         W+C+G  DC + +DEQ             C  + + C +   IP  Y CD  I CS G DETGCT+
Sbjct: 1293 CANRRCVYNSQRCDGQNDCGDWSDETGCSTPPIPTTCPADWVRCFYNSSGL----CISTSWLCNGRVDCPDAWDEQPAQCRTSPAPTRTCSPQEYQCDNGACIPSRYECDGRIQCSDGSDETGCTA 1414          

HSP 6 Score: 50.447 bits (119), Expect = 3.573e-6
Identity = 41/144 (28.47%), Postives = 59/144 (40.97%), Query Frame = 3
Query: 1911 VSDICPPGYRFC---QNGECLENAKFCDKINHCADKSDEDPITCRE-------CDPISRKCEINNQILPKKNYFLIHWICDGEEDCGNGYDEQNCDG-FSLNNCGGKFFTCSDNKT-IPRGYVCDENIDCSQGEDETGCTSPQI 2306
            +   CP  +  C    +G C+  +  C+    C D  DE P  CR        C P   +C+ N   +P +      + CDG   C +G DE  C    S ++C G  F C  N   +P    CD + DC    DE  C+ P +
Sbjct: 1325 IPTTCPADWVRCFYNSSGLCISTSWLCNGRVDCPDAWDEQPAQCRTSPAPTRTCSPQEYQCD-NGACIPSR------YECDGRIQCSDGSDETGCTATISPSSCPG--FLCDGNTLCLPFYKRCDGSYDCKDYTDEFNCSMPLM 1459          
BLAST of low density lipoprotein receptor-1 vs. Ensembl Nematostella
Match: EDO49498 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RGB0])

HSP 1 Score: 73.1738 bits (178), Expect = 2.403e-13
Identity = 44/114 (38.60%), Postives = 59/114 (51.75%), Query Frame = 3
Query: 1944 CQNGECLENAKFCDKINHCADKSDEDPITCRECDPISRKCEINNQILPKKNYFLIHWICDGEEDCGNGYDEQNCDGFSLNNCGGKFFTCSD-NKTIPRGYVCDENIDCSQGEDE 2282
            C NG+C+  A  CD  + CADKSDE   T + C P    C      + +K      WICDGE DCG+  DE +C    L +CG   + CS+ ++ I +  VCD  +DC    DE
Sbjct:  171 CSNGQCISLAWRCDGDHDCADKSDERNCTGKTCKPFEFACANGRHCIQRK------WICDGENDCGDRSDEVDC---GLESCGNDRWRCSNTSRCIAKSQVCDGRVDCPDASDE 275          

HSP 2 Score: 68.5514 bits (166), Expect = 7.717e-12
Identity = 46/129 (35.66%), Postives = 60/129 (46.51%), Query Frame = 3
Query: 1923 CPPGYRFCQNGECLENAKFCDKINHCADKSDEDPIT-CRE--CDPISRKCEINNQILPKKNYFLIHWICDGEEDC--GNGYDEQNCDGFSLNNCGGKFFTCSDNKTIPRGYVCDENIDCSQGEDETGCT 2294
            C  G   C+NG C+     CD  N C D SDED    C E  C     +C+ + + +P      + W CDG+ DC   +  DE NC      NC    F C++ +  PR +VCD   DC  G DE GC 
Sbjct:    1 CSAGKFTCKNGHCISLRWKCDGENDCVDNSDEDEYAGCAEWSCRASEFRCQASRKCIP------LSWRCDGDYDCLAPDLSDEANCS--VATNCSASMFRCANGQCKPRDWVCDGFDDCGDGSDEKGCA 121          

HSP 3 Score: 65.0846 bits (157), Expect = 9.338e-11
Identity = 41/128 (32.03%), Postives = 54/128 (42.19%), Query Frame = 3
Query: 1911 VSDICPPGYRFCQNGECLENAKFCDKINHCADKSDEDPITCRECDPISRKCEINNQILPKKNYFLIHWICDGEEDCGNGYDEQNCDGFSLNNCGGKFFTCSDNKTIPRGYVCDENIDCSQGEDETGCT 2294
            V+  C      C NG+C      CD  + C D SDE       C P    C       P      + W CDG+ DC +G DE+ C      NC    F+CS+ + I   + CD + DC+   DE  CT
Sbjct:   82 VATNCSASMFRCANGQCKPRDWVCDGFDDCGDGSDEKGCANHSCTPAQFSC-------PSGRCIPLRWRCDGDGDCSDGADERGC---PPKNCTDSQFSCSNGQCISLAWRCDGDHDCADKSDERNCT 199          
BLAST of low density lipoprotein receptor-1 vs. Ensembl Nematostella
Match: EDO45747 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RS53])

HSP 1 Score: 63.5438 bits (153), Expect = 3.721e-12
Identity = 43/116 (37.07%), Postives = 52/116 (44.83%), Query Frame = 3
Query: 1944 CQNGECLENAKFCDKINHCADKSDEDPITCRECDPISRKCEINNQILPKKNYFLIHWICDGEEDCGNGYDEQNCDGFSLNNCGGKFFTCSDNKTIPRGYVCDENIDCSQGEDETGC 2291
            C NG C+     CD  N C D SDE   + R C P   +C       P        W+CDGE DC  G DE++C   + + C    F C     IPR  VCD   DC Q +DE  C
Sbjct:    7 CDNGRCISATWVCDTENDCGDNSDEMNCSQRSCSPDEYQC-------PNGECIRKRWVCDGEPDCEGGADEKDC---ANSKCKESQFRCMGGVCIPRDLVCDGFPDCKQKDDEDNC 112          
BLAST of low density lipoprotein receptor-1 vs. Ensembl Nematostella
Match: EDO43938 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RXB8])

HSP 1 Score: 68.1662 bits (165), Expect = 8.738e-12
Identity = 45/118 (38.14%), Postives = 56/118 (47.46%), Query Frame = 3
Query: 1944 CQNGECLENAKFCDKINHCADKSDEDPITCRECDPISRKCEINNQILPKKNYFLIH--WICDGEEDCGNGYDEQNCDGFSLNNCGGKFFTCSDNKTIPRGYVCDENIDCSQGEDETGC 2291
            C+NG C+     CD ++ C D SDED    R   P   KC  N ++    N   +H  WICDGE DC +G DE  C       C    FTC++ K IP    CD   +C  G DE  C
Sbjct:  128 CRNGRCVLKEWLCDGMDDCGDSSDEDNCLTRP-TPPPVKCRKNERMCADGN-GCVHRRWICDGERDCLDGSDEAGCGTIG---CSSDEFTCTNQKCIPLPQKCDGTDNCGDGSDEKMC 240          

HSP 2 Score: 52.7582 bits (125), Expect = 6.148e-7
Identity = 41/133 (30.83%), Postives = 57/133 (42.86%), Query Frame = 3
Query: 1911 VSDICPPGYRFCQ-NGECLENAKFCDKINHCADKSDEDPITCRECDPISRKCE-INNQILPKKNYFLIHWICDGEEDCGNGYDEQNCDGFSLN---NCGGKFFTCSD-NKTIPRGYVCDENIDCSQGEDETGC 2291
            V+  C P    C  +G C+     CD  + C D SDE     + C   ++ C  + +         L  W+CDG +DCG+  DE NC          C      C+D N  + R ++CD   DC  G DE GC
Sbjct:   74 VNKTCAPYEFTCAFSGRCIPGRFRCDHRSDCLDGSDE-----QNCQNAAKTCNPVTDHTCRNGRCVLKEWLCDGMDDCGDSSDEDNCLTRPTPPPVKCRKNERMCADGNGCVHRRWICDGERDCLDGSDEAGC 201          

HSP 3 Score: 51.2174 bits (121), Expect = 1.588e-6
Identity = 41/125 (32.80%), Postives = 52/125 (41.60%), Query Frame = 3
Query: 1923 CPPGYRFCQNGECLENAKFCDKINHCADKSDE-DPITCRECDPISRKCEINNQILPKKNYFLIHWICDGEEDCGNGYDEQNCDGFSLNNCGGKFFTCS-DNKTIPRGYVCDENIDCSQGEDETGC 2291
            CPP    C N +C+ N+  CD  N C D+SDE +P T          C  N             + CD E DC +  DE+ C       C    FTC+   + IP  + CD   DC  G DE  C
Sbjct:    1 CPPSDFTCANSQCVPNSFRCDGENDCGDRSDESEPTT---------TCSANEFRCDDGRCITSTFRCDREFDCTDRSDERGCVN---KTCAPYEFTCAFSGRCIPGRFRCDHRSDCLDGSDEQNC 113          
BLAST of low density lipoprotein receptor-1 vs. Ensembl Nematostella
Match: EDO43726 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RXU8])

HSP 1 Score: 68.1662 bits (165), Expect = 1.098e-11
Identity = 50/171 (29.24%), Postives = 68/171 (39.77%), Query Frame = 3
Query: 1911 VSDICPPGYRFCQNGECLENAKFCDKINHCADKSDEDPITC----------------RECDPISRKCEINN--------------QILPKK-----------NYFLIHWICDGEEDCGNGYDEQNCDGFSLNNCGGKFFTCSDNKTIPRGYVCDENIDCSQGEDETGCTSP 2300
            V   C      C NG+C+ N+  CD  N C D SDE    C                R+C P   KC+ +N               + P++              L HW CDGE+DC +G DE+ C     +NC    FTC++ + IP    CD   +C    DE  C +P
Sbjct:  116 VQRTCASNQFTCSNGDCISNSWTCDGDNDCNDGSDEKESLCASKSCKITEFTCRTSRRKCIPSQWKCDGDNDCPDSSDESGCPTASVSPRRCSVGMFKCRNGECVLGHWRCDGEKDCSDGSDEKGC---RKSNCASSEFTCANGQCIPSSQRCDGTSNCRDSSDEKACVTP 283          

HSP 2 Score: 57.3806 bits (137), Expect = 1.985e-8
Identity = 46/157 (29.30%), Postives = 63/157 (40.13%), Query Frame = 3
Query: 1890 QVSSKIYVSDICPPGYR----------------FCQNGECLENAKFCDKINHCADKSDEDPITCRECDPISRKCEINNQILPKKNYFLIHWICDGEEDCGNGYDEQNCDGFSLNNCGGKFFTC--SDNKTIPRGYVCDENIDCSQGEDETGCTSPQI 2306
            Q + K    D C  GYR                 C N +C+  +  CD  + C D SDED         + R C  N       +     W CDG+ DC +G DE+     +  +C    FTC  S  K IP  + CD + DC    DE+GC +  +
Sbjct:   54 QATWKCDGEDDCRDGYRSDESNCGNVTCGADEFMCSNRKCISRSWTCDNQDDCGDNSDEDR-------NVQRTCASNQFTCSNGDCISNSWTCDGDNDCNDGSDEKE-SLCASKSCKITEFTCRTSRRKCIPSQWKCDGDNDCPDSSDESGCPTASV 202          

HSP 3 Score: 52.7582 bits (125), Expect = 5.806e-7
Identity = 38/106 (35.85%), Postives = 49/106 (46.23%), Query Frame = 3
Query: 1980 CDKINHCADKSDED--PITCRECDPISRKCEINNQILPKKNYFL-IHWICDGEEDCGNGY--DEQNCDGFSLNNCGGKFFTCSDNKTIPRGYVCDENIDCSQGEDE 2282
            CD  + C+D SDE   P TC           + +Q   +    +   W CDGE+DC +GY  DE NC   +   CG   F CS+ K I R + CD   DC    DE
Sbjct:   21 CDGEDDCSDGSDEQGSPKTC-----------LQDQFTCRNGKCIQATWKCDGEDDCRDGYRSDESNCGNVT---CGADEFMCSNRKCISRSWTCDNQDDCGDNSDE 112          
BLAST of low density lipoprotein receptor-1 vs. Ensembl Medaka
Match: hspg2 (heparan sulfate proteoglycan 2 [Source:NCBI gene;Acc:101159991])

HSP 1 Score: 127.102 bits (318), Expect = 3.653e-29
Identity = 78/208 (37.50%), Postives = 99/208 (47.60%), Query Frame = 3
Query: 1944 CQNGECLENAKFCDKINHCADKSDEDPITCRECDPISRKCEINNQILPKKNYFLIHWICDGEEDCGNGYDEQNCDGFSLNNCGGKFFTC-SDNKTIPRGYVCDENIDCSQGEDETGCTSPQIXXXXXXXXXXXXXQLVTLTCEATGKPLPVLVWRFNWGCIQNSTRFSTNFFSTDCNSVTSSLTIKDFKAGDDGIYNCEALSSRQRSF 2564
            CQ+GEC+     CD    CAD SDE   T   C+P   +C+            L  W CDG+ DC +  DE +C       C  K F C SD K IP  Y CDE  DC+   DE GC  P +T      + A +   V  TC A G P P++ WR NWG I  S R S N       +   +LTI+D K  D G Y CEA++++   F
Sbjct:  190 CQSGECISRDYICDGERDCADGSDEFRCTPSPCEPNEFRCK-------NGRCALKLWRCDGDNDCEDNSDEMDCTKGPEEQCASKHFECVSDRKCIPASYQCDEEPDCADRSDEYGC-PPTVTTPPEESIQAVRGSTVMFTCRAVGVPTPMITWRLNWGHIPVSGRVSMNN-----KNGFGTLTIRDVKESDQGAYTCEAINAKGLVF 384          

HSP 2 Score: 66.2402 bits (160), Expect = 1.592e-10
Identity = 103/465 (22.15%), Postives = 176/465 (37.85%), Query Frame = 3
Query:  354 ANRYLYIKSLLKQDEGIYNCSVEKVKD-PQIRFNRTLHLKITIPSISIDILPEESLKIGGQIKRQCSDLGLPQETIVDDFTYTWLNQQNKTIGNTNILQIPVVDESVVGRYICQYKSKETSKIYEAATYVNLKQSVSYKIKIITNPALFRYGERFSLRCEVEPFYQNIKYTWYKKD-------EFIGNDQELVIKSFKKDNVGTYKCVASLQLPSGKLDLMEESIQQFAFFRESKIELTTKPGPQVYVH-RGEKKELHCEIETSSGNRGKEAEWYINGKKFKNGDIPLVNRL-DGQYVSMLVISDISQINEGNYECRVGSSIKEVN----LIVLLDEGLIETSPPILKVKEGQSVEFHCRVENIPSVKNVNLKWNFESKEGLVRNNIPDSRWQLMNDEIADQTSFIVLMKAEVSDSGYYICTEPNGQTARSELIVIPDKDKNSLTITPREIRVRAGQRVDIECFS 1706
            +N  L I     +D G Y C+ +      +      +     +P+  +   PE  + +   ++ Q   L  P   +      + L  ++K +  +  L++P V     G YIC    + T    EA   +++ ++  Y      N    R GE   L+C +      + + W K D       E  G D  L I     ++ G+YKCVAS ++ S +           AF + +   L  +  PQV V  RG   E  C   +++G    +  W   G     G +P  + + DG     ++I ++ Q NEG Y CR  S   E      L + L + +I     +  V  G SVEF C+    P      +KW+       V  ++P          I  +   + + +    D+G Y CT  N   +    +V+ +     +   P +  V  G    + C +
Sbjct: 2096 SNALLQILVARPEDSGTYVCTAQNSNGLSETNVEVIVQGGPLVPTAPMVTAPEPFMVV---VEGQSVTLHFPSPLMSWSKLRSPLPWRHKLVNGS--LELPSVGRQDSGEYIC--SGRNTMGTSEATIMLDV-EAPPYTTST-QNDVAVRVGEVIRLQC-LAHGTPPLTFVWTKVDGQLPPRAEVDGGD--LQINLATAEDAGSYKCVASNKVGSSE-----------AFVKVTVRPLAVRVSPQVEVKARGGTVEFTC---SAAGGVETKIRWLKEG-----GALPPNHHIKDG-----VLIENLEQSNEGVYICRASSVYGEAQDTARLTIQLPKVMINVRTSVQTVMIGTSVEFECQAVGDP---EPTIKWS------KVDGSLP--------AHIVVKGGMLKIERVTEVDAGQYRCTATNNVGSVQSQVVL-NVQLPQIATLPEKKEVTVGSDAVLPCVA 2506          

HSP 3 Score: 57.7658 bits (138), Expect = 5.680e-8
Identity = 92/387 (23.77%), Postives = 157/387 (40.57%), Query Frame = 3
Query:  675 GRYICQYK-SKETSKIYEAATYVNLKQSVSYKIKIIT---NPALFRYGERFSLRCEVEPFYQNIKYTWYKKD-------EFIGNDQELVIKSFKKDNVGTYKCVASLQLPSGKLDLMEESIQQFAFFRESKIELTTKPGPQVYVHRGEKKELHCEIETSSGNRGKEAEWYINGKKFKNGDIPLVNRLDGQYVSMLVISDISQINEGNYECRVGSS--IKEVNLIVLLDEG-LIETSP------PILKVKEGQSVEFHCRVENIPSVKNVNLKWNFESKEGLVRNNIPDSRWQLMNDEIADQTSFIVLMKAEVSDSGYYICTEPNGQTARSELIVIPDKDKNSLTITPREIRVRAGQRVDIECFSKNTQGRASGNPEFSFTNNKPIGR 1775
            G YIC+ + S   S  ++A+  V++    S +  II    + A    G+  S RC+V    + +K  W   +       +   +   L I + +++N G Y+C+AS       L  + +SI      +   + +T     QV V  G+   L C+   + G       W+   +   N    L + L  +  ++L I      + G Y C   +S  + E N+ V++  G L+ T+P      P + V EGQSV  H      PS     + W+       +R+ +P  R +L+N  +        L      DSG YIC+  N        I++  +     T T  ++ VR G+ + ++C        A G P  +F   K  G+
Sbjct: 1921 GEYICRVEGSPGNSHFHQASVSVSVTSPSSLQSPIIAIEPHSAAVEEGKSTSFRCKVYGGAEPVKLEWKMANNQPLPNAKVSPDGSVLTITNARRENYGPYRCIAS------NLFGVTQSIVSL-IVKSPVVTVTPVGPVQVRV--GDPITLECQ---AGGEPHPSVSWH---RLDNNRKTMLKSPLPMESNALLQILVARPEDSGTYVCTAQNSNGLSETNVEVIVQGGPLVPTAPMVTAPEPFMVVVEGQSVTLH-----FPSPL---MSWS------KLRSPLP-WRHKLVNGSLE-------LPSVGRQDSGEYICSGRNTMGTSEATIMLDVEAPPYTTSTQNDVAVRVGEVIRLQCL-------AHGTPPLTFVWTKVDGQ 2263          

HSP 4 Score: 57.7658 bits (138), Expect = 6.394e-8
Identity = 93/460 (20.22%), Postives = 169/460 (36.74%), Query Frame = 3
Query:  246 IVKSEMQFINIACNVTNYALNETSIRWLDKDGKVAAANRYLYIKSLLKQDEGIYNCSVEKVKDPQIRFNRTLHLKITIPSISIDILPEESLKIGGQIKRQCSDLGLPQETIVDDFTYTWLNQQNKTIGNTNI----LQIPVVDESVVGRYICQYKSK-ETSKIYEAATYVNLKQSVSYKIKIITNPALFRYGERFSLRCEVEPFYQNIKYTWYKKDEFIGNDQEL----VIKSFKKDNVGTYKCVASLQLPSGKLDLMEESIQQFAFFRESKIELTTKPGPQVYVHRGEKKELHCEIETSSGNRGKEAEWYINGKKFKNGDIPLVNRLDGQYVSMLVISDISQINEGNYECRVGSSIKEVNLIVLLDEGL--IETSPPILKVKEGQSVEFHCRVENIPSVKNVNLKWNFESKEGLVRNNIPDSRWQLMNDEIADQTSFIVLMKAEVSDSGYYICTEPNGQ 1592
            +V+ +   ++    + +++   + + W  K       N  L + S+ +QD G Y CS             T+ L +  P  +     + ++++G  I+ QC   G P        T+ W     +      +    LQI +      G Y C   +K  +S+ +   T   L   VS ++++         G      C      +  K  W K+   +  +  +    +I++ ++ N G Y C AS      + D    +IQ        +  + T       V  G   E  C+   + G+     +W        +G +P    + G    ML I  +++++ G Y C   +++  V   V+L+  L  I T P   +V  G      C     P+    N+KW+   +E      +P   +Q  N         + + +    DSG YICT  N Q
Sbjct: 2153 VVEGQSVTLHFPSPLMSWSKLRSPLPWRHK-----LVNGSLELPSVGRQDSGEYICSGRNTMGTS---EATIMLDVEAPPYTTSTQNDVAVRVGEVIRLQCLAHGTP------PLTFVWTKVDGQLPPRAEVDGGDLQINLATAEDAGSYKCVASNKVGSSEAFVKVTVRPLAVRVSPQVEVKAR------GGTVEFTCSAAGGVET-KIRWLKEGGALPPNHHIKDGVLIENLEQSNEGVYICRASSVYGEAQ-DTARLTIQLPKVMINVRTSVQT-------VMIGTSVEFECQ---AVGDPEPTIKW-----SKVDGSLPAHIVVKG---GMLKIERVTEVDAGQYRCTATNNVGSVQSQVVLNVQLPQIATLPEKKEVTVGSDAVLPCVASGYPA---PNIKWSKMEEE------LPSKCFQEAN--------VLTVPQVTHEDSGTYICTASNKQ 2555          
BLAST of low density lipoprotein receptor-1 vs. Ensembl Medaka
Match: lrp2b (low density lipoprotein receptor-related protein 2b [Source:ZFIN;Acc:ZDB-GENE-111115-1])

HSP 1 Score: 82.4185 bits (202), Expect = 1.578e-15
Identity = 44/118 (37.29%), Postives = 62/118 (52.54%), Query Frame = 3
Query: 1944 CQNGECLENAKFCDKINHCADKSDEDPITCRECDPISRKCEINNQILPKKNYFLIHWICDGEEDCGNGYDEQNCDGFSLNNCGGKFFTCSDNKTIPRGYVCDENIDCSQGEDETGCTS 2297
            C  G C  N+  CD I  C DK+DE    C  C P++  C  NN     K+     W CDG +DCG+G DE NC  +  + C  ++FTC + + + + ++CD + DC  G DE  C S
Sbjct:   56 CDEGRCRPNSYRCDGIFDCVDKTDE--ANCTSCSPLAFTC--NN-----KHCIYSSWRCDGMDDCGDGSDEVNCPTYIPSTCSSEYFTCDNKRCVSKAWLCDGDNDCGDGSDERNCNS 164          

HSP 2 Score: 72.4034 bits (176), Expect = 2.099e-12
Identity = 43/123 (34.96%), Postives = 62/123 (50.41%), Query Frame = 3
Query: 1923 CPPGYRFCQNGECLENAKFCDKINHCADKSDEDPITCRECDPISRKCEINNQILPKKNYFLIHWICDGEEDCGNGYDEQNCDGFSLNNCGGKFFTCSDNKTIPRGYVCDENIDCSQGEDETGC 2291
            C P    C N  C+ ++  CD ++ C D SDE  + C    P +  C         K      W+CDG+ DCG+G DE+NC+  S++ C   +F C D++ I   +VCD + DC  G DE  C
Sbjct:   86 CSPLAFTCNNKHCIYSSWRCDGMDDCGDGSDE--VNCPTYIPST--CSSEYFTCDNKRCVSKAWLCDGDNDCGDGSDERNCNS-SISTCRPGYFLCPDHRCISSYFVCDGDQDCLDGSDEKNC 203          

HSP 3 Score: 66.6254 bits (161), Expect = 1.076e-10
Identity = 44/135 (32.59%), Postives = 61/135 (45.19%), Query Frame = 3
Query: 1890 QVSSKIYVSDICPPGYRFCQNGECLENAKFCDKINHCADKSDEDPITCRECDPISRKCEINNQILPKKNYFLIHWICDGEEDCGNGYDEQNCDGFSLNNCGGKFFTC-SDNKTIPRGYVCDENIDCSQGEDETGC 2291
            +V+   Y+   C   Y  C N  C+  A  CD  N C D SDE     R C+     C     + P       +++CDG++DC +G DE+NC+ FS   C    F C S ++ +   Y CD   DC    DE  C
Sbjct:  117 EVNCPTYIPSTCSSEYFTCDNKRCVSKAWLCDGDNDCGDGSDE-----RNCNSSISTCRPGYFLCPDHRCISSYFVCDGDQDCLDGSDEKNCE-FS---CQSYQFACASGDQCVSSSYRCDGVFDCRDHSDERNC 242          

HSP 4 Score: 59.6918 bits (143), Expect = 1.341e-8
Identity = 39/125 (31.20%), Postives = 60/125 (48.00%), Query Frame = 3
Query: 1935 YRF-CQNG-ECLENAKFCDKINHCADKSDEDPITCRECDPISRKCEINNQILPKKNYFLIHWICDGEEDCGNGYDEQN-CDGFSLNNCGGKFFTCSDNKTIPRGYVCDENIDCSQGEDETGCTSP 2300
            Y+F C +G +C+ ++  CD +  C D SDE       C     +C+++   +P       +W CDG  DC +G DE N C   +   C   +F C++   IP  ++CD   DC    DE  C +P
Sbjct:  210 YQFACASGDQCVSSSYRCDGVFDCRDHSDERNCRPGLCHDDEFQCQMDGFCIPA------NWECDGHPDCEDGSDEHNTCPAVT---CLSSYFQCANKMCIPMSWLCDGENDCRDMSDEQNCPTP 325          
BLAST of low density lipoprotein receptor-1 vs. Ensembl Medaka
Match: ldlrb (low-density lipoprotein receptor [Source:NCBI gene;Acc:101161779])

HSP 1 Score: 77.7962 bits (190), Expect = 3.097e-14
Identity = 47/122 (38.52%), Postives = 62/122 (50.82%), Query Frame = 3
Query: 1944 CQNGECLENAKFCDKINHCADKSDEDPITC--RECDPISRKCEIN-NQILPKKNYFLIHWICDGEEDCGNGYDEQNCDGFSLNNCGGKFFTCSDNKTIPRGYVCDENIDCSQGEDETGCTSP 2300
            C NG C+     CD  + C D +DE   TC  + C P    C    NQ +PK       W CDG+ DC NG DE+NC   ++  C    F C++ + I   +VCD + DCS G DET C+ P
Sbjct:   37 CGNGRCVTRRWICDGTDDCGDGTDELLSTCASKTCLPSQFNCGAPINQCVPKS------WHCDGKADCSNGADEKNC---TVKQCKNDEFRCANGQCISLSFVCDNDNDCSDGSDETTCSKP 149          

HSP 2 Score: 71.633 bits (174), Expect = 2.735e-12
Identity = 44/122 (36.07%), Postives = 62/122 (50.82%), Query Frame = 3
Query: 1944 CQNGECLENAKFCDKINHCADKSDEDPITCRECDPISRKCEINNQILPKKNYFLIHWICDGEEDCGNGYDE--QNCDGFS-LNNCGGKFFTCSDNKTIPRGYVCDENIDCSQGEDETGCTSP 2300
            C NG+C+  +  CD  N C+D SDE   +   C+P+S +C  N+  +P        W CDG+EDC +G DE  + C G      C    F C++ + IP  + CD  IDC    DE  C+ P
Sbjct:  119 CANGQCISLSFVCDNDNDCSDGSDETTCSKPTCNPLSFQCN-NSVCVPSL------WRCDGDEDCADGSDEWPETCGGKKPAAKCSVSEFECANGQCIPGSWRCDGGIDCDDRSDELNCSRP 233          

HSP 3 Score: 55.4546 bits (132), Expect = 2.347e-7
Identity = 46/131 (35.11%), Postives = 56/131 (42.75%), Query Frame = 3
Query: 1923 CPPGYRFCQNGECLENAKFCDKINHCADKSDEDPITCRECDPISRKCEI------NNQILPKKNYFLIHWICDGEEDCGNGYDEQNCDGFSLNNCGGKFFTCSDNKTIPRGYVCDENIDCSQGEDETGCTS 2297
            C P    C N  C+ +   CD    CAD SDE P TC    P + KC +      N Q +P        W CDG  DC +  DE NC   S   C    F C D   +     C+   DCS G DET C++
Sbjct:  151 CNPLSFQCNNSVCVPSLWRCDGDEDCADGSDEWPETCGGKKPAA-KCSVSEFECANGQCIPGS------WRCDGGIDCDDRSDELNC---SRPVCLEGQFQCGDGSCLQGNLKCNSVRDCSDGSDETDCST 271          

HSP 4 Score: 50.447 bits (119), Expect = 9.470e-6
Identity = 29/72 (40.28%), Postives = 36/72 (50.00%), Query Frame = 3
Query: 2109 HWICDGEEDCGNGYDEQNCDGFSLNNCGGKF-----FTCSD--NKTIPRGYVCDENIDCSQGEDETGCTSPQ 2303
             WICDG +DCG+G DE       L+ C  K      F C    N+ +P+ + CD   DCS G DE  CT  Q
Sbjct:   46 RWICDGTDDCGDGTDEL------LSTCASKTCLPSQFNCGAPINQCVPKSWHCDGKADCSNGADEKNCTVKQ 111          
BLAST of low density lipoprotein receptor-1 vs. Ensembl Medaka
Match: lrp2a (LDL receptor related protein 2 [Source:NCBI gene;Acc:101157655])

HSP 1 Score: 74.7146 bits (182), Expect = 3.653e-13
Identity = 49/128 (38.28%), Postives = 59/128 (46.09%), Query Frame = 3
Query: 1923 CPPGYRFCQNGECLENAKFCDKINHCADKSDEDPITCRECDPISRKCEINNQILPKKNYFLIHWICDGEEDCGNGYDE-QNCDGFSLNNCGGKFFTCSDNKTIPRGYVCDENIDCSQGEDETGCTSPQ 2303
            C  G   C  G C+     CD  + C D SDE       CD    +C  + + +P        W+CD EEDC +G DE QNC G     C G  FTCS+   IP  Y CD   DCS G DE  C  P+
Sbjct:    5 CELGQFRCGTGRCIPGDWHCDGTSDCVDDSDEQDCPQVTCDHSHFQCLSDGECIPDV------WVCDDEEDCEDGSDERQNCPG---RTCTGDQFTCSNGMCIPALYRCDHMADCSDGSDERHCNYPE 123          

HSP 2 Score: 67.781 bits (164), Expect = 4.675e-11
Identity = 42/120 (35.00%), Postives = 60/120 (50.00%), Query Frame = 3
Query: 1944 CQNGECLENAKFCDKINHCADKSDEDPITC----RECDPISRKCEINNQILPKKNYFLIHWICDGEEDCGNGYDEQNCDGFSLNNCGGKFFTCSDNKTIPRGYVCDENIDCSQGEDETGC 2291
            C NG+C+ N+  CD ++ C D SDE  ++C      C P +  C  N + +P      + W CDG  DC +  DE NC       C    FTC++++ IP  + CD + DC  G DE  C
Sbjct:  799 CGNGKCVPNSYRCDGVDDCHDNSDE--MSCGVNSTTCSPSAFTCA-NRRCVP------VGWRCDGHNDCLDDSDEINCPTRVPGTCPANQFTCANHRCIPHTWRCDTDNDCGDGSDEVDC 909          

HSP 3 Score: 64.3142 bits (155), Expect = 5.897e-10
Identity = 39/116 (33.62%), Postives = 60/116 (51.72%), Query Frame = 3
Query: 1944 CQNGECLENAKFCDKINHCADKSDEDPITCRECDPISRKCEINNQILPKKNYFLIHWICDGEEDCGNGYDEQNCDGFSLNNCGGKFFTCSDNKTIPRGYVCDENIDCSQGEDETGC 2291
            C NG C +  + CD +  C D SDE   T + C+    +C+ N   +P++      ++CD ++DCG+  DE NC   +   C G +FTC   + I + ++CD   DC    DE GC
Sbjct:  129 CTNGACYDRTQRCDHVLDCRDGSDEANCT-QHCNAGMFQCQ-NGLCIPQR------YVCDHDDDCGDRSDELNC---TYPTCKGNYFTCPSGRCIHQVWLCDGEDDCEDNADEKGC 233          

HSP 4 Score: 62.003 bits (149), Expect = 2.358e-9
Identity = 53/175 (30.29%), Postives = 75/175 (42.86%), Query Frame = 3
Query: 1872 CSLEGRQVSSKIYVSDICPPGYRFCQNGECLENAKFCDKINHCADKSDEDPITCRE-CDPISRKCEINNQILPKKNYFLIHWICDGEEDCGNGYDEQNCDGFSLNNCGGKFFTCSD-NKTIPRGYVCDENIDCSQGEDETGCTS--PQIXXXXXXXXXXXXXQLVTLTCEATGKP 2384
            C  +  +++    V   CP     C N  C+ +   CD  N C D SDE  + CR  C+P   +C  +  I P        +ICDG+ DC +G DEQ+C      NC    F C++ ++ I   Y CD   DCS   DE  C +  P +    +     +    V  T E  G P
Sbjct:  858 CLDDSDEINCPTRVPGTCPANQFTCANHRCIPHTWRCDTDNDCGDGSDE--VDCRNTCNPEQFQCPDHRCIDPN-------YICDGDRDCVDGADEQDCS----YNCTANEFKCTNGHQCISSYYHCDGVFDCSDRSDEHNCPTRPPGMCHHESEFQCQSDGSCVPSTWECDGHP 1019          

HSP 5 Score: 62.003 bits (149), Expect = 2.967e-9
Identity = 45/133 (33.83%), Postives = 60/133 (45.11%), Query Frame = 3
Query: 1914 SDICPPGYRFCQNGECLENAKFCDKINHCADKSDE------DPITCRECDPISRKCEINNQILPKKNYFLIHWICDGEEDCGNGYDEQNCDGFSLNNCGGKFFTCSDNKTIPRGYVCDENIDCSQGEDETGCT 2294
            S  C P    C N  C+     CD  N C D SDE       P TC    P ++    N++ +P        W CD + DCG+G DE +C     N C  + F C D++ I   Y+CD + DC  G DE  C+
Sbjct:  830 STTCSPSAFTCANRRCVPVGWRCDGHNDCLDDSDEINCPTRVPGTC----PANQFTCANHRCIPHT------WRCDTDNDCGDGSDEVDC----RNTCNPEQFQCPDHRCIDPNYICDGDRDCVDGADEQDCS 948          

HSP 6 Score: 55.4546 bits (132), Expect = 2.920e-7
Identity = 40/119 (33.61%), Postives = 51/119 (42.86%), Query Frame = 3
Query: 1944 CQNGECLENAKFCDKINHCADKSDEDPITCRECDPISRKCEINNQILPKKNYFLIHWICDGEEDCGNGYDEQNCDGFSLNNCGGKFFTCSDNKTIPRGYVCDENIDCSQGEDETGCTSP 2300
            C NG C+     CD +  C+D SDE      EC  +  +C  N     +         CD   DC +G DE NC      +C    F C +   IP+ YVCD + DC    DE  CT P
Sbjct:   92 CSNGMCIPALYRCDHMADCSDGSDERHCNYPECTQL--RC-TNGACYDRTQR------CDHVLDCRDGSDEANC----TQHCNAGMFQCQNGLCIPQRYVCDHDDDCGDRSDELNCTYP 197          

HSP 7 Score: 53.1434 bits (126), Expect = 1.570e-6
Identity = 37/124 (29.84%), Postives = 55/124 (44.35%), Query Frame = 3
Query: 1944 CQNG-ECLENAKFCDKINHCADKSDEDPITCRE---CDPISR-KCEINNQILPKKNYFLIHWICDGEEDCGNGYDEQNCDGFSLNNCGGKFFTCSDNKTIPRGYVCDENIDCSQGEDETGCTSP 2300
            C NG +C+ +   CD +  C+D+SDE     R    C   S  +C+ +   +P        W CDG  DC +G DE +        C    F C +   + R ++CD + DC    DE  C +P
Sbjct:  958 CTNGHQCISSYYHCDGVFDCSDRSDEHNCPTRPPGMCHHESEFQCQSDGSCVPST------WECDGHPDCEDGSDEHH--ACPPRTCSSSLFRCDNGNCVLRSWICDGDNDCRDMSDERDCPTP 1073          
BLAST of low density lipoprotein receptor-1 vs. Ensembl Medaka
Match: sorl1 (sortilin related receptor 1 [Source:NCBI gene;Acc:101160573])

HSP 1 Score: 74.3294 bits (181), Expect = 5.656e-13
Identity = 51/170 (30.00%), Postives = 78/170 (45.88%), Query Frame = 3
Query: 1806 PAHKRL-TAPGGL---SLSDNNMDVFCSLEGRQVSSK--IYVSDICPPGYRFCQNGECLENAKFCDKINHCADKSDEDPITCRECDPISR-KCEINNQILPKKNYFLIHWICDGEEDCGNGYDEQNCDGFSLNNCGGKFFTCSDNKTIPRGYVCDENIDCSQGEDETGCT 2294
            P HK     P G+   ++ +  +   C   G Q+ +K  +     C P    C+NG C+ +   CD  N C D SDE       CDP  + +C  +   +P      + + CD E+DCG+  DE+ C+    + CG   FTC+    I   ++CD + DC    DE+ CT
Sbjct:  931 PGHKHTCVCPDGVPMVTMPEGELQCKCPF-GYQLRNKTCVKTERTCLPNQYHCRNGRCISSIWKCDSDNDCGDMSDEQECPTTTCDPSHQFRCMASGSCIP------LAFKCDHEDDCGDNSDEEQCEA---HQCGPGEFTCARGVCIREAWLCDGDNDCRDWSDESNCT 1090          

HSP 2 Score: 58.151 bits (139), Expect = 4.209e-8
Identity = 41/127 (32.28%), Postives = 56/127 (44.09%), Query Frame = 3
Query: 1944 CQN-GECLENAKFCDKINHCADKSDEDPITC--------RECDPISRKCEINNQILPKKNYFLIHWICDGEEDCGNGYDEQNCDGFSLNNCGGKFFT--CSDNKTIPRGYVCDENIDCSQGEDETGC 2291
            C+N  +CL  +  CD I HC D SDED            + CD  + +C   N +        + W CDG +DCG+  DE NC   +      +FF   C + + IP  + CD   DC    DE  C
Sbjct: 1181 CRNRAQCLFQSLVCDGIKHCEDGSDEDAAYAGSTPSEFGKVCDAYTFQCA--NGVCVS-----LEWKCDGMDDCGDYSDEANCAAPTEAPGCSRFFQYECRNGRCIPTWWKCDGENDCGDWSDEALC 1300          

HSP 3 Score: 55.8398 bits (133), Expect = 2.230e-7
Identity = 43/132 (32.58%), Postives = 53/132 (40.15%), Query Frame = 3
Query: 1932 GYRF-CQNGECLENAKFCDKINHCADKSDED----PITCRECDPISRKCEINNQILPKKNYFLIHWICDGEEDCGNGYDEQNCDGFSLNN-------CGGKFFTCSDNKTIPRGYVCDENIDCSQGEDETGC 2291
             Y F C NG C+     CD ++ C D SDE     P     C    +    N + +P        W CDGE DCG+  DE  C G + +        C    F C     I   +VCD   DC  G DE GC
Sbjct: 1224 AYTFQCANGVCVSLEWKCDGMDDCGDYSDEANCAAPTEAPGCSRFFQYECRNGRCIP------TWWKCDGENDCGDWSDEALC-GVTPHTVTPGPTTCASNRFHCGSGACIINTWVCDGYADCRDGSDELGC 1348          
BLAST of low density lipoprotein receptor-1 vs. Planmine SMEST
Match: SMESG000027815.1 (SMESG000027815.1)

HSP 1 Score: 1645.56 bits (4260), Expect = 0.000e+0
Identity = 814/825 (98.67%), Postives = 817/825 (99.03%), Query Frame = 3
Query:  123 LICIYQSLVKAETEEFTFGGASEEEETSPPNITFFPLKNDSIVKSEMQFINIACNVTNYALNETSIRWLDKDGKVAAANRYLYIKSLLKQDEGIYNCSVEKVKDPQIRFNRTLHLKITIPSISIDILPEESLKIGGQIKRQCSDLGLPQETIVDDFTYTWLNQQNKTIGNTNILQIPVVDESVVGRYICQYKSKETSKIYEAATYVNLKQSVSYKIKIITNPALFRYGERFSLRCEVEPFYQNIKYTWYKKDEFIGNDQELVIKSFKKDNVGTYKCVASLQLPSGKLDLMEESIQQFAFFRESKIELTTKPGPQVYVHRGEKKELHCEIETSSGNRGKEAEWYINGKKFKNGDIPLVNRLDGQYVSMLVISDISQINEGNYECRVGSSIKEVNLIVLLDEGLIETSPPILKVKEGQSVEFHCRVENIPSVKNVNLKWNFESKEGLVRNNIPDSRWQLMNDEIADQTSFIVLMKAEVSDSGYYICTEPNGQTARSELIVIPDKDKNSLTITPREIRVRAGQRVDIECFSKNTQGRASGNPEFSFTNNKPIGRDGRFKISNVGPAHKRLTAPGGLSLSDNNMDVFCSLEGRQVSSKIYVSDICPPGYRFCQNGECLENAKFCDKINHCADKSDEDPITCRECDPISRKCEINNQILPKKNYFLIHWICDGEEDCGNGYDEQNCDGFSLNNCGGKFFTCSDNKTIPRGYVCDENIDCSQGEDETGCTSPQIXXXXXXXXXXXXXQLVTLTCEATGKPLPVLVWRFNWGCIQNSTRFSTNFFSTDCNSVTSSLTIKDFKAGDDGIYNCEALSSRQRSFSNDFQVILKNN 2597
            ++ I  S    +TEEFTFGGASEEEETSPPNITFFPLKNDSIVKSEMQFINIACNVTNYALNETSIRWLDKDGKVAAANRYLYIKSLLKQDEGIYNCSVEKVKDPQIRFNRTLHLKITIPSISIDILPEESLKIGGQIKRQCSDLGLPQETIVDDFTYTWLNQQNKTIGNTNILQIPVVDESVVGRYICQYKSKETSKIYEAATYVNLKQSVSYKIKIITNPALFRYGERFSLRCEVEPFYQNIKYTWYKKDEFIGNDQELVIKSFKKDNVGTYKCVASLQLPSGKLDLMEESIQQFAFFRESKIELTTKPGPQVYVHRGEKKELHCEIETSSGNRGKEAEWYINGKKFKNGDIPLVNRLDGQYVSMLVISDISQINEGNYECRVGSSIKEVNLIVLLDEGLIETSPPILKVKEGQSVEFHCRVENIPSVKNVNLKWNFESKEGLVRNNIPDSRWQLMNDEIADQTSFIVLMKAEVSDSGYYICTEPNGQTARSELIVIPDKDKNSLTITPREIRVRAGQRVDIECFSKNTQGRASGNPEFSFTNNKPIGRDGRFKISNVGPAHKRLTAPGGLSLSDNNMDVFCSLEGRQVSSKIYVSDICPPGYRFCQNGECLENAKFCDKINHCADKSDEDPITCRECDPISRKCEINNQILPKKNYFLIHWICDGEEDCGNGYDEQNCDGFSLNNCGGKFFTCSDNKTIPRGYVCDENIDCSQGEDETGCTSPQITKTSATKVVATKSQLVTLTCEATGKPLPVLVWRFNWGCIQNSTRFSTNFFSTDCN VTSSLTIKDFKAGDDGIYNCEALSSRQRSFSNDFQVILKNN
Sbjct:    1 MLIISPSFCIRKTEEFTFGGASEEEETSPPNITFFPLKNDSIVKSEMQFINIACNVTNYALNETSIRWLDKDGKVAAANRYLYIKSLLKQDEGIYNCSVEKVKDPQIRFNRTLHLKITIPSISIDILPEESLKIGGQIKRQCSDLGLPQETIVDDFTYTWLNQQNKTIGNTNILQIPVVDESVVGRYICQYKSKETSKIYEAATYVNLKQSVSYKIKIITNPALFRYGERFSLRCEVEPFYQNIKYTWYKKDEFIGNDQELVIKSFKKDNVGTYKCVASLQLPSGKLDLMEESIQQFAFFRESKIELTTKPGPQVYVHRGEKKELHCEIETSSGNRGKEAEWYINGKKFKNGDIPLVNRLDGQYVSMLVISDISQINEGNYECRVGSSIKEVNLIVLLDEGLIETSPPILKVKEGQSVEFHCRVENIPSVKNVNLKWNFESKEGLVRNNIPDSRWQLMNDEIADQTSFIVLMKAEVSDSGYYICTEPNGQTARSELIVIPDKDKNSLTITPREIRVRAGQRVDIECFSKNTQGRASGNPEFSFTNNKPIGRDGRFKISNVGPAHKRLTAPGGLSLSDNNMDVFCSLEGRQVSSKIYVSDICPPGYRFCQNGECLENAKFCDKINHCADKSDEDPITCRECDPISRKCEINNQILPKKNYFLIHWICDGEEDCGNGYDEQNCDGFSLNNCGGKFFTCSDNKTIPRGYVCDENIDCSQGEDETGCTSPQITKTSATKVVATKSQLVTLTCEATGKPLPVLVWRFNWGCIQNSTRFSTNFFSTDCNFVTSSLTIKDFKAGDDGIYNCEALSSRQRSFSNDFQVILKNN 825          
BLAST of low density lipoprotein receptor-1 vs. Planmine SMEST
Match: SMESG000027815.1 (SMESG000027815.1)

HSP 1 Score: 1644.02 bits (4256), Expect = 0.000e+0
Identity = 813/814 (99.88%), Postives = 813/814 (99.88%), Query Frame = 3
Query:  156 ETEEFTFGGASEEEETSPPNITFFPLKNDSIVKSEMQFINIACNVTNYALNETSIRWLDKDGKVAAANRYLYIKSLLKQDEGIYNCSVEKVKDPQIRFNRTLHLKITIPSISIDILPEESLKIGGQIKRQCSDLGLPQETIVDDFTYTWLNQQNKTIGNTNILQIPVVDESVVGRYICQYKSKETSKIYEAATYVNLKQSVSYKIKIITNPALFRYGERFSLRCEVEPFYQNIKYTWYKKDEFIGNDQELVIKSFKKDNVGTYKCVASLQLPSGKLDLMEESIQQFAFFRESKIELTTKPGPQVYVHRGEKKELHCEIETSSGNRGKEAEWYINGKKFKNGDIPLVNRLDGQYVSMLVISDISQINEGNYECRVGSSIKEVNLIVLLDEGLIETSPPILKVKEGQSVEFHCRVENIPSVKNVNLKWNFESKEGLVRNNIPDSRWQLMNDEIADQTSFIVLMKAEVSDSGYYICTEPNGQTARSELIVIPDKDKNSLTITPREIRVRAGQRVDIECFSKNTQGRASGNPEFSFTNNKPIGRDGRFKISNVGPAHKRLTAPGGLSLSDNNMDVFCSLEGRQVSSKIYVSDICPPGYRFCQNGECLENAKFCDKINHCADKSDEDPITCRECDPISRKCEINNQILPKKNYFLIHWICDGEEDCGNGYDEQNCDGFSLNNCGGKFFTCSDNKTIPRGYVCDENIDCSQGEDETGCTSPQIXXXXXXXXXXXXXQLVTLTCEATGKPLPVLVWRFNWGCIQNSTRFSTNFFSTDCNSVTSSLTIKDFKAGDDGIYNCEALSSRQRSFSNDFQVILKNN 2597
            ETEEFTFGGASEEEETSPPNITFFPLKNDSIVKSEMQFINIACNVTNYALNETSIRWLDKDGKVAAANRYLYIKSLLKQDEGIYNCSVEKVKDPQIRFNRTLHLKITIPSISIDILPEESLKIGGQIKRQCSDLGLPQETIVDDFTYTWLNQQNKTIGNTNILQIPVVDESVVGRYICQYKSKETSKIYEAATYVNLKQSVSYKIKIITNPALFRYGERFSLRCEVEPFYQNIKYTWYKKDEFIGNDQELVIKSFKKDNVGTYKCVASLQLPSGKLDLMEESIQQFAFFRESKIELTTKPGPQVYVHRGEKKELHCEIETSSGNRGKEAEWYINGKKFKNGDIPLVNRLDGQYVSMLVISDISQINEGNYECRVGSSIKEVNLIVLLDEGLIETSPPILKVKEGQSVEFHCRVENIPSVKNVNLKWNFESKEGLVRNNIPDSRWQLMNDEIADQTSFIVLMKAEVSDSGYYICTEPNGQTARSELIVIPDKDKNSLTITPREIRVRAGQRVDIECFSKNTQGRASGNPEFSFTNNKPIGRDGRFKISNVGPAHKRLTAPGGLSLSDNNMDVFCSLEGRQVSSKIYVSDICPPGYRFCQNGECLENAKFCDKINHCADKSDEDPITCRECDPISRKCEINNQILPKKNYFLIHWICDGEEDCGNGYDEQNCDGFSLNNCGGKFFTCSDNKTIPRGYVCDENIDCSQGEDETGCTSPQITKTSATKVVATKSQLVTLTCEATGKPLPVLVWRFNWGCIQNSTRFSTNFFSTDCN VTSSLTIKDFKAGDDGIYNCEALSSRQRSFSNDFQVILKNN
Sbjct:   16 ETEEFTFGGASEEEETSPPNITFFPLKNDSIVKSEMQFINIACNVTNYALNETSIRWLDKDGKVAAANRYLYIKSLLKQDEGIYNCSVEKVKDPQIRFNRTLHLKITIPSISIDILPEESLKIGGQIKRQCSDLGLPQETIVDDFTYTWLNQQNKTIGNTNILQIPVVDESVVGRYICQYKSKETSKIYEAATYVNLKQSVSYKIKIITNPALFRYGERFSLRCEVEPFYQNIKYTWYKKDEFIGNDQELVIKSFKKDNVGTYKCVASLQLPSGKLDLMEESIQQFAFFRESKIELTTKPGPQVYVHRGEKKELHCEIETSSGNRGKEAEWYINGKKFKNGDIPLVNRLDGQYVSMLVISDISQINEGNYECRVGSSIKEVNLIVLLDEGLIETSPPILKVKEGQSVEFHCRVENIPSVKNVNLKWNFESKEGLVRNNIPDSRWQLMNDEIADQTSFIVLMKAEVSDSGYYICTEPNGQTARSELIVIPDKDKNSLTITPREIRVRAGQRVDIECFSKNTQGRASGNPEFSFTNNKPIGRDGRFKISNVGPAHKRLTAPGGLSLSDNNMDVFCSLEGRQVSSKIYVSDICPPGYRFCQNGECLENAKFCDKINHCADKSDEDPITCRECDPISRKCEINNQILPKKNYFLIHWICDGEEDCGNGYDEQNCDGFSLNNCGGKFFTCSDNKTIPRGYVCDENIDCSQGEDETGCTSPQITKTSATKVVATKSQLVTLTCEATGKPLPVLVWRFNWGCIQNSTRFSTNFFSTDCNFVTSSLTIKDFKAGDDGIYNCEALSSRQRSFSNDFQVILKNN 829          
BLAST of low density lipoprotein receptor-1 vs. Planmine SMEST
Match: SMESG000027815.1 (SMESG000027815.1)

HSP 1 Score: 1633.23 bits (4228), Expect = 0.000e+0
Identity = 810/825 (98.18%), Postives = 814/825 (98.67%), Query Frame = 3
Query:  123 LICIYQSLVKAETEEFTFGGASEEEETSPPNITFFPLKNDSIVKSEMQFINIACNVTNYALNETSIRWLDKDGKVAAANRYLYIKSLLKQDEGIYNCSVEKVKDPQIRFNRTLHLKITIPSISIDILPEESLKIGGQIKRQCSDLGLPQETIVDDFTYTWLNQQNKTIGNTNILQIPVVDESVVGRYICQYKSKETSKIYEAATYVNLKQSVSYKIKIITNPALFRYGERFSLRCEVEPFYQNIKYTWYKKDEFIGNDQELVIKSFKKDNVGTYKCVASLQLPSGKLDLMEESIQQFAFFRESKIELTTKPGPQVYVHRGEKKELHCEIETSSGNRGKEAEWYINGKKFKNGDIPLVNRLDGQYVSMLVISDISQINEGNYECRVGSSIKEVNLIVLLDEGLIETSPPILKVKEGQSVEFHCRVENIPSVKNVNLKWNFESKEGLVRNNIPDSRWQLMNDEIADQTSFIVLMKAEVSDSGYYICTEPNGQTARSELIVIPDKDKNSLTITPREIRVRAGQRVDIECFSKNTQGRASGNPEFSFTNNKPIGRDGRFKISNVGPAHKRLTAPGGLSLSDNNMDVFCSLEGRQVSSKIYVSDICPPGYRFCQNGECLENAKFCDKINHCADKSDEDPITCRECDPISRKCEINNQILPKKNYFLIHWICDGEEDCGNGYDEQNCDGFSLNNCGGKFFTCSDNKTIPRGYVCDENIDCSQGEDETGCTSPQIXXXXXXXXXXXXXQLVTLTCEATGKPLPVLVWRFNWGCIQNSTRFSTNFFSTDCNSVTSSLTIKDFKAGDDGIYNCEALSSRQRSFSNDFQVILKNN 2597
            ++ I  S    +TEEFTFGGASEEEETSPPNITFFPLKNDSIVKSEMQFINIACNVTNYALNETSIRWLDKDGKVAAANRYLYIKSLLKQDEGIYNCSVEKVKDPQIRFNRTLHLKITIPSISIDILPEESLKIGGQIKRQCSDLGLPQETIVDDFTYTWLNQQNKTIGNTNILQIPVVDESVVGRYICQYKSKETSKIYEAATYVNLKQSVSYKIKIITNPALFRYGERFSLRCEVEPFYQNIKYTWYKKDEFIGNDQELVIKSFKKDNVGTYKCVASLQLPSGKLDLMEESIQQFAFFRE   +LTTKPGPQVYVHRGEKKELHCEIETSSGNRGKEAEWYINGKKFKNGDIPLVNRLDGQYVSMLVISDISQINEGNYECRVGSSIKEVNLIVLLDEGLIETSPPILKVKEGQSVEFHCRVENIPSVKNVNLKWNFESKEGLVRNNIPDSRWQLMNDEIADQTSFIVLMKAEVSDSGYYICTEPNGQTARSELIVIPDKDKNSLTITPREIRVRAGQRVDIECFSKNTQGRASGNPEFSFTNNKPIGRDGRFKISNVGPAHKRLTAPGGLSLSDNNMDVFCSLEGRQVSSKIYVSDICPPGYRFCQNGECLENAKFCDKINHCADKSDEDPITCRECDPISRKCEINNQILPKKNYFLIHWICDGEEDCGNGYDEQNCDGFSLNNCGGKFFTCSDNKTIPRGYVCDENIDCSQGEDETGCTSPQITKTSATKVVATKSQLVTLTCEATGKPLPVLVWRFNWGCIQNSTRFSTNFFSTDCN VTSSLTIKDFKAGDDGIYNCEALSSRQRSFSNDFQVILKNN
Sbjct:    1 MLIISPSFCIRKTEEFTFGGASEEEETSPPNITFFPLKNDSIVKSEMQFINIACNVTNYALNETSIRWLDKDGKVAAANRYLYIKSLLKQDEGIYNCSVEKVKDPQIRFNRTLHLKITIPSISIDILPEESLKIGGQIKRQCSDLGLPQETIVDDFTYTWLNQQNKTIGNTNILQIPVVDESVVGRYICQYKSKETSKIYEAATYVNLKQSVSYKIKIITNPALFRYGERFSLRCEVEPFYQNIKYTWYKKDEFIGNDQELVIKSFKKDNVGTYKCVASLQLPSGKLDLMEESIQQFAFFRE---KLTTKPGPQVYVHRGEKKELHCEIETSSGNRGKEAEWYINGKKFKNGDIPLVNRLDGQYVSMLVISDISQINEGNYECRVGSSIKEVNLIVLLDEGLIETSPPILKVKEGQSVEFHCRVENIPSVKNVNLKWNFESKEGLVRNNIPDSRWQLMNDEIADQTSFIVLMKAEVSDSGYYICTEPNGQTARSELIVIPDKDKNSLTITPREIRVRAGQRVDIECFSKNTQGRASGNPEFSFTNNKPIGRDGRFKISNVGPAHKRLTAPGGLSLSDNNMDVFCSLEGRQVSSKIYVSDICPPGYRFCQNGECLENAKFCDKINHCADKSDEDPITCRECDPISRKCEINNQILPKKNYFLIHWICDGEEDCGNGYDEQNCDGFSLNNCGGKFFTCSDNKTIPRGYVCDENIDCSQGEDETGCTSPQITKTSATKVVATKSQLVTLTCEATGKPLPVLVWRFNWGCIQNSTRFSTNFFSTDCNFVTSSLTIKDFKAGDDGIYNCEALSSRQRSFSNDFQVILKNN 822          
BLAST of low density lipoprotein receptor-1 vs. Planmine SMEST
Match: SMESG000027815.1 (SMESG000027815.1)

HSP 1 Score: 1631.69 bits (4224), Expect = 0.000e+0
Identity = 809/814 (99.39%), Postives = 810/814 (99.51%), Query Frame = 3
Query:  156 ETEEFTFGGASEEEETSPPNITFFPLKNDSIVKSEMQFINIACNVTNYALNETSIRWLDKDGKVAAANRYLYIKSLLKQDEGIYNCSVEKVKDPQIRFNRTLHLKITIPSISIDILPEESLKIGGQIKRQCSDLGLPQETIVDDFTYTWLNQQNKTIGNTNILQIPVVDESVVGRYICQYKSKETSKIYEAATYVNLKQSVSYKIKIITNPALFRYGERFSLRCEVEPFYQNIKYTWYKKDEFIGNDQELVIKSFKKDNVGTYKCVASLQLPSGKLDLMEESIQQFAFFRESKIELTTKPGPQVYVHRGEKKELHCEIETSSGNRGKEAEWYINGKKFKNGDIPLVNRLDGQYVSMLVISDISQINEGNYECRVGSSIKEVNLIVLLDEGLIETSPPILKVKEGQSVEFHCRVENIPSVKNVNLKWNFESKEGLVRNNIPDSRWQLMNDEIADQTSFIVLMKAEVSDSGYYICTEPNGQTARSELIVIPDKDKNSLTITPREIRVRAGQRVDIECFSKNTQGRASGNPEFSFTNNKPIGRDGRFKISNVGPAHKRLTAPGGLSLSDNNMDVFCSLEGRQVSSKIYVSDICPPGYRFCQNGECLENAKFCDKINHCADKSDEDPITCRECDPISRKCEINNQILPKKNYFLIHWICDGEEDCGNGYDEQNCDGFSLNNCGGKFFTCSDNKTIPRGYVCDENIDCSQGEDETGCTSPQIXXXXXXXXXXXXXQLVTLTCEATGKPLPVLVWRFNWGCIQNSTRFSTNFFSTDCNSVTSSLTIKDFKAGDDGIYNCEALSSRQRSFSNDFQVILKNN 2597
            ETEEFTFGGASEEEETSPPNITFFPLKNDSIVKSEMQFINIACNVTNYALNETSIRWLDKDGKVAAANRYLYIKSLLKQDEGIYNCSVEKVKDPQIRFNRTLHLKITIPSISIDILPEESLKIGGQIKRQCSDLGLPQETIVDDFTYTWLNQQNKTIGNTNILQIPVVDESVVGRYICQYKSKETSKIYEAATYVNLKQSVSYKIKIITNPALFRYGERFSLRCEVEPFYQNIKYTWYKKDEFIGNDQELVIKSFKKDNVGTYKCVASLQLPSGKLDLMEESIQQFAFFRE   +LTTKPGPQVYVHRGEKKELHCEIETSSGNRGKEAEWYINGKKFKNGDIPLVNRLDGQYVSMLVISDISQINEGNYECRVGSSIKEVNLIVLLDEGLIETSPPILKVKEGQSVEFHCRVENIPSVKNVNLKWNFESKEGLVRNNIPDSRWQLMNDEIADQTSFIVLMKAEVSDSGYYICTEPNGQTARSELIVIPDKDKNSLTITPREIRVRAGQRVDIECFSKNTQGRASGNPEFSFTNNKPIGRDGRFKISNVGPAHKRLTAPGGLSLSDNNMDVFCSLEGRQVSSKIYVSDICPPGYRFCQNGECLENAKFCDKINHCADKSDEDPITCRECDPISRKCEINNQILPKKNYFLIHWICDGEEDCGNGYDEQNCDGFSLNNCGGKFFTCSDNKTIPRGYVCDENIDCSQGEDETGCTSPQITKTSATKVVATKSQLVTLTCEATGKPLPVLVWRFNWGCIQNSTRFSTNFFSTDCN VTSSLTIKDFKAGDDGIYNCEALSSRQRSFSNDFQVILKNN
Sbjct:   16 ETEEFTFGGASEEEETSPPNITFFPLKNDSIVKSEMQFINIACNVTNYALNETSIRWLDKDGKVAAANRYLYIKSLLKQDEGIYNCSVEKVKDPQIRFNRTLHLKITIPSISIDILPEESLKIGGQIKRQCSDLGLPQETIVDDFTYTWLNQQNKTIGNTNILQIPVVDESVVGRYICQYKSKETSKIYEAATYVNLKQSVSYKIKIITNPALFRYGERFSLRCEVEPFYQNIKYTWYKKDEFIGNDQELVIKSFKKDNVGTYKCVASLQLPSGKLDLMEESIQQFAFFRE---KLTTKPGPQVYVHRGEKKELHCEIETSSGNRGKEAEWYINGKKFKNGDIPLVNRLDGQYVSMLVISDISQINEGNYECRVGSSIKEVNLIVLLDEGLIETSPPILKVKEGQSVEFHCRVENIPSVKNVNLKWNFESKEGLVRNNIPDSRWQLMNDEIADQTSFIVLMKAEVSDSGYYICTEPNGQTARSELIVIPDKDKNSLTITPREIRVRAGQRVDIECFSKNTQGRASGNPEFSFTNNKPIGRDGRFKISNVGPAHKRLTAPGGLSLSDNNMDVFCSLEGRQVSSKIYVSDICPPGYRFCQNGECLENAKFCDKINHCADKSDEDPITCRECDPISRKCEINNQILPKKNYFLIHWICDGEEDCGNGYDEQNCDGFSLNNCGGKFFTCSDNKTIPRGYVCDENIDCSQGEDETGCTSPQITKTSATKVVATKSQLVTLTCEATGKPLPVLVWRFNWGCIQNSTRFSTNFFSTDCNFVTSSLTIKDFKAGDDGIYNCEALSSRQRSFSNDFQVILKNN 826          
BLAST of low density lipoprotein receptor-1 vs. Planmine SMEST
Match: SMESG000027815.1 (SMESG000027815.1)

HSP 1 Score: 1282.7 bits (3318), Expect = 0.000e+0
Identity = 627/637 (98.43%), Postives = 630/637 (98.90%), Query Frame = 3
Query:  123 LICIYQSLVKAETEEFTFGGASEEEETSPPNITFFPLKNDSIVKSEMQFINIACNVTNYALNETSIRWLDKDGKVAAANRYLYIKSLLKQDEGIYNCSVEKVKDPQIRFNRTLHLKITIPSISIDILPEESLKIGGQIKRQCSDLGLPQETIVDDFTYTWLNQQNKTIGNTNILQIPVVDESVVGRYICQYKSKETSKIYEAATYVNLKQSVSYKIKIITNPALFRYGERFSLRCEVEPFYQNIKYTWYKKDEFIGNDQELVIKSFKKDNVGTYKCVASLQLPSGKLDLMEESIQQFAFFRESKIELTTKPGPQVYVHRGEKKELHCEIETSSGNRGKEAEWYINGKKFKNGDIPLVNRLDGQYVSMLVISDISQINEGNYECRVGSSIKEVNLIVLLDEGLIETSPPILKVKEGQSVEFHCRVENIPSVKNVNLKWNFESKEGLVRNNIPDSRWQLMNDEIADQTSFIVLMKAEVSDSGYYICTEPNGQTARSELIVIPDKDKNSLTITPREIRVRAGQRVDIECFSKNTQGRASGNPEFSFTNNKPIGRDGRFKISNVGPAHKRLTAPGGLSLSDNNMDVFCSLEGRQVSSKIYVSDICPPGYRFCQNGECLENAKFCDKINHCADKSDEDPITC 2033
            ++ I  S    +TEEFTFGGASEEEETSPPNITFFPLKNDSIVKSEMQFINIACNVTNYALNETSIRWLDKDGKVAAANRYLYIKSLLKQDEGIYNCSVEKVKDPQIRFNRTLHLKITIPSISIDILPEESLKIGGQIKRQCSDLGLPQETIVDDFTYTWLNQQNKTIGNTNILQIPVVDESVVGRYICQYKSKETSKIYEAATYVNLKQSVSYKIKIITNPALFRYGERFSLRCEVEPFYQNIKYTWYKKDEFIGNDQELVIKSFKKDNVGTYKCVASLQLPSGKLDLMEESIQQFAFFRESKIELTTKPGPQVYVHRGEKKELHCEIETSSGNRGKEAEWYINGKKFKNGDIPLVNRLDGQYVSMLVISDISQINEGNYECRVGSSIKEVNLIVLLDEGLIETSPPILKVKEGQSVEFHCRVENIPSVKNVNLKWNFESKEGLVRNNIPDSRWQLMNDEIADQTSFIVLMKAEVSDSGYYICTEPNGQTARSELIVIPDKDKNSLTITPREIRVRAGQRVDIECFSKNTQGRASGNPEFSFTNNKPIGRDGRFKISNVGPAHKRLTAPGGLSLSDNNMDVFCSLEGRQVSSKIYVSDICPPGYRFCQNGECLENAKFCDKINHCADKSDEDPITC
Sbjct:    1 MLIISPSFCIRKTEEFTFGGASEEEETSPPNITFFPLKNDSIVKSEMQFINIACNVTNYALNETSIRWLDKDGKVAAANRYLYIKSLLKQDEGIYNCSVEKVKDPQIRFNRTLHLKITIPSISIDILPEESLKIGGQIKRQCSDLGLPQETIVDDFTYTWLNQQNKTIGNTNILQIPVVDESVVGRYICQYKSKETSKIYEAATYVNLKQSVSYKIKIITNPALFRYGERFSLRCEVEPFYQNIKYTWYKKDEFIGNDQELVIKSFKKDNVGTYKCVASLQLPSGKLDLMEESIQQFAFFRESKIELTTKPGPQVYVHRGEKKELHCEIETSSGNRGKEAEWYINGKKFKNGDIPLVNRLDGQYVSMLVISDISQINEGNYECRVGSSIKEVNLIVLLDEGLIETSPPILKVKEGQSVEFHCRVENIPSVKNVNLKWNFESKEGLVRNNIPDSRWQLMNDEIADQTSFIVLMKAEVSDSGYYICTEPNGQTARSELIVIPDKDKNSLTITPREIRVRAGQRVDIECFSKNTQGRASGNPEFSFTNNKPIGRDGRFKISNVGPAHKRLTAPGGLSLSDNNMDVFCSLEGRQVSSKIYVSDICPPGYRFCQNGECLENAKFCDKINHCADKSDEDPITC 637          

HSP 2 Score: 192.2 bits (487), Expect = 6.233e-51
Identity = 109/139 (78.42%), Postives = 115/139 (82.73%), Query Frame = 3
Query: 2187 CGGKFFTCSDNKTIPRGYVCDENIDCSQGEDE--TGCTSPQIXXXXXXXXXXXXXQLVTLTCEATGKPLPVLVWRFNWGCIQNSTRFSTNFFSTDCNSVTSSLTIKDFKAGDDGIYNCEALSSRQRSFSNDFQVILKNN 2597
            C   +  C + + +     CD+   C+   DE    CTSPQITKTSATKVVATKSQLVTLTCEATGKPLPVLVWRFNWGCIQNSTRFSTNFFSTDCN VTSSLTIKDFKAGDDGIYNCEALSSRQRSFSNDFQVILKNN
Sbjct:  601 CPPGYRFCQNGECLENAKFCDKINHCADKSDEDPITCTSPQITKTSATKVVATKSQLVTLTCEATGKPLPVLVWRFNWGCIQNSTRFSTNFFSTDCNFVTSSLTIKDFKAGDDGIYNCEALSSRQRSFSNDFQVILKNN 739          
The following BLAST results are available for this feature:
BLAST of low density lipoprotein receptor-1 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
HSPG26.404e-2935.65heparan sulfate proteoglycan 2 [Source:HGNC Symbol... [more]
LRP44.574e-1339.37LDL receptor related protein 4 [Source:HGNC Symbol... [more]
LRP17.837e-1333.33LDL receptor related protein 1 [Source:HGNC Symbol... [more]
LRP41.073e-1238.17LDL receptor related protein 4 [Source:HGNC Symbol... [more]
VLDLR1.698e-1236.84very low density lipoprotein receptor [Source:HGNC... [more]
back to top
BLAST of low density lipoprotein receptor-1 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
unc-528.292e-2229.73Basement membrane proteoglycan [Source:UniProtKB/... [more]
unc-524.566e-2129.94Basement membrane proteoglycan [Source:UniProtKB/... [more]
unc-524.636e-2129.94Basement membrane proteoglycan [Source:UniProtKB/... [more]
unc-525.055e-2129.94Basement membrane proteoglycan [Source:UniProtKB/... [more]
unc-525.173e-2129.94Basement membrane proteoglycan [Source:UniProtKB/... [more]
back to top
BLAST of low density lipoprotein receptor-1 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
trol5.748e-2732.09gene:FBgn0284408 transcript:FBtr0342809[more]
trol6.060e-2732.09gene:FBgn0284408 transcript:FBtr0342811[more]
trol6.070e-2732.09gene:FBgn0284408 transcript:FBtr0342825[more]
trol6.224e-2732.09gene:FBgn0284408 transcript:FBtr0342821[more]
trol6.297e-2732.09gene:FBgn0284408 transcript:FBtr0342824[more]
back to top
BLAST of low density lipoprotein receptor-1 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
hspg26.424e-2936.97heparan sulfate proteoglycan 2 [Source:ZFIN;Acc:ZD... [more]
hspg26.606e-2936.97heparan sulfate proteoglycan 2 [Source:ZFIN;Acc:ZD... [more]
hspg26.929e-2936.97heparan sulfate proteoglycan 2 [Source:ZFIN;Acc:ZD... [more]
lrp2b1.592e-1529.48low density lipoprotein receptor-related protein 2... [more]
lrp2a9.594e-1536.72low density lipoprotein receptor-related protein 2... [more]
back to top
BLAST of low density lipoprotein receptor-1 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
sel1l2.981e-2836.36SEL1L adaptor subunit of ERAD E3 ubiquitin ligase ... [more]
sel1l7.300e-2836.04SEL1L adaptor subunit of ERAD E3 ubiquitin ligase ... [more]
sel1l4.071e-2736.82SEL1L adaptor subunit of ERAD E3 ubiquitin ligase ... [more]
rabggtb1.097e-1328.40Rab geranylgeranyltransferase subunit beta [Source... [more]
rabggtb1.153e-1328.40Rab geranylgeranyltransferase subunit beta [Source... [more]
back to top
BLAST of low density lipoprotein receptor-1 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Hspg24.883e-3036.11perlecan (heparan sulfate proteoglycan 2) [Source:... [more]
Hspg24.923e-3036.11perlecan (heparan sulfate proteoglycan 2) [Source:... [more]
Vldlr3.329e-1436.36very low density lipoprotein receptor [Source:MGI ... [more]
Vldlr4.077e-1436.36very low density lipoprotein receptor [Source:MGI ... [more]
Lrp1b2.346e-1338.14low density lipoprotein-related protein 1B [Source... [more]
back to top
BLAST of low density lipoprotein receptor-1 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q05793|PGBM_MOUSE5.417e-2936.11Basement membrane-specific heparan sulfate proteog... [more]
sp|P98160|PGBM_HUMAN3.075e-2835.65Basement membrane-specific heparan sulfate proteog... [more]
sp|Q06561|UNC52_CAEEL4.250e-2029.94Basement membrane proteoglycan OS=Caenorhabditis e... [more]
sp|P98156|VLDLR_MOUSE2.328e-1336.36Very low-density lipoprotein receptor OS=Mus muscu... [more]
sp|P98158|LRP2_RAT3.497e-1338.52Low-density lipoprotein receptor-related protein 2... [more]
back to top
BLAST of low density lipoprotein receptor-1 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A1Z1R2750.000e+099.88Low density lipoprotein receptor-related 1 (Fragme... [more]
T1DBM00.000e+056.32LDL-1 OS=Dendrocoelum lacteum OX=27895 PE=2 SV=1[more]
I1ZIB90.000e+099.45Low density lipoprotein receptor-1 (Fragment) OS=S... [more]
A0A183A6H71.801e-13832.83Uncharacterized protein OS=Echinostoma caproni OX=... [more]
A0A4E0RPR12.268e-13231.60Basement membrane-specific heparan sulfate proteog... [more]
back to top
BLAST of low density lipoprotein receptor-1 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
hspg21.114e-2935.09heparan sulfate proteoglycan 2 [Source:ZFIN;Acc:ZD... [more]
hspg21.404e-2935.09heparan sulfate proteoglycan 2 [Source:ZFIN;Acc:ZD... [more]
hspg29.443e-2935.91heparan sulfate proteoglycan 2 [Source:ZFIN;Acc:ZD... [more]
hspg21.091e-2836.49heparan sulfate proteoglycan 2 [Source:ZFIN;Acc:ZD... [more]
lrp2a4.522e-1338.21low density lipoprotein receptor-related protein 2... [more]
back to top
BLAST of low density lipoprotein receptor-1 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 5
Match NameE-valueIdentityDescription
lrp1ab3.431e-1336.89low density lipoprotein receptor-related protein 1... [more]
lrp2a1.896e-1233.10low density lipoprotein receptor-related protein 2... [more]
ENSPMAT00000001137.17.805e-1237.10pep scaffold:Pmarinus_7.0:GL476464:95621:179961:-1... [more]
ENSPMAT00000003195.11.375e-936.00pep scaffold:Pmarinus_7.0:GL476689:250750:275904:-... [more]
ENSPMAT00000003181.11.464e-935.83pep scaffold:Pmarinus_7.0:GL476689:240399:277283:-... [more]
back to top
BLAST of low density lipoprotein receptor-1 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of low density lipoprotein receptor-1 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
EDO452181.242e-1536.29Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO494982.403e-1338.60Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO457473.721e-1237.07Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO439388.738e-1238.14Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO437261.098e-1129.24Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of low density lipoprotein receptor-1 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
hspg23.653e-2937.50heparan sulfate proteoglycan 2 [Source:NCBI gene;A... [more]
lrp2b1.578e-1537.29low density lipoprotein receptor-related protein 2... [more]
ldlrb3.097e-1438.52low-density lipoprotein receptor [Source:NCBI gene... [more]
lrp2a3.653e-1338.28LDL receptor related protein 2 [Source:NCBI gene;A... [more]
sorl15.656e-1330.00sortilin related receptor 1 [Source:NCBI gene;Acc:... [more]
back to top
BLAST of low density lipoprotein receptor-1 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000027815.10.000e+098.67SMESG000027815.1[more]
SMESG000027815.10.000e+099.88SMESG000027815.1[more]
SMESG000027815.10.000e+098.18SMESG000027815.1[more]
SMESG000027815.10.000e+099.39SMESG000027815.1[more]
SMESG000027815.16.233e-5198.43SMESG000027815.1[more]
back to top
Cross References
External references for this transcript
DatabaseAccession
SmedGD GBrowseSMED30015642
GenBankAFJ24773.1
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30015642 ID=SMED30015642|Name=low density lipoprotein receptor-1|organism=Schmidtea mediterranea sexual|type=transcript|length=2673bp
GGATAACAGACCTGTTTTCGATAAATATTTATAAGTAGTTCCAGCGGCAT
TAATATCATCCATAAATCTGCTACCAAACAAATAAAGTTTCAAGTATGAT
TTCAATTTGTAAGATTTTTGCATTAATTTGCATTTATCAAAGTTTAGTTA
AAGCCGAAACTGAGGAATTCACTTTTGGAGGTGCATCTGAAGAAGAAGAG
ACTTCTCCTCCAAATATCACATTTTTTCCATTAAAAAATGATTCAATTGT
CAAATCTGAAATGCAATTTATAAATATTGCTTGCAATGTTACAAATTATG
CACTTAATGAAACTTCAATAAGATGGCTGGATAAAGATGGAAAGGTAGCA
GCTGCAAATAGATATCTTTACATAAAATCTCTCTTAAAACAAGACGAAGG
GATTTATAATTGTTCAGTTGAAAAAGTGAAAGACCCTCAAATTAGATTCA
ATAGGACGCTTCATTTGAAAATTACAATTCCTTCAATTTCAATTGACATT
CTTCCTGAGGAATCTTTGAAAATCGGTGGACAGATTAAAAGACAATGCTC
GGACTTGGGTCTGCCACAGGAAACGATCGTGGATGACTTTACATACACAT
GGCTAAATCAACAAAATAAAACTATCGGAAATACGAATATTTTGCAAATT
CCAGTCGTTGACGAATCTGTAGTCGGGCGATATATTTGTCAGTATAAGTC
AAAGGAAACCTCTAAAATCTACGAAGCCGCTACTTATGTAAATTTAAAAC
AGTCTGTTTCTTATAAAATCAAAATAATTACGAATCCTGCGTTATTTCGA
TACGGGGAACGTTTTAGTCTACGTTGTGAAGTCGAGCCCTTTTATCAGAA
TATTAAATACACTTGGTACAAAAAAGATGAATTTATTGGTAATGATCAAG
AACTAGTAATCAAATCTTTCAAAAAGGACAATGTCGGTACCTATAAATGT
GTGGCATCACTACAATTACCAAGTGGAAAGCTTGATCTTATGGAAGAGTC
AATACAACAATTTGCATTTTTCCGTGAAAGTAAAATAGAATTAACCACAA
AGCCCGGGCCTCAGGTTTATGTACACAGAGGTGAAAAAAAAGAGCTGCAT
TGCGAAATTGAAACTAGTTCTGGAAATCGTGGAAAAGAGGCAGAGTGGTA
TATAAATGGAAAAAAATTTAAAAATGGAGATATTCCTCTTGTTAATCGCT
TGGATGGGCAATACGTCAGTATGCTCGTCATCAGTGACATTAGCCAGATT
AATGAAGGCAATTATGAATGTCGAGTAGGATCTAGTATTAAGGAAGTCAA
CTTAATTGTTCTTTTGGATGAGGGTCTCATAGAAACCAGTCCACCGATTT
TGAAAGTAAAGGAAGGCCAGTCTGTAGAATTTCATTGTAGGGTTGAAAAT
ATTCCTAGTGTAAAAAATGTAAACTTGAAATGGAATTTTGAAAGCAAAGA
AGGTTTAGTACGAAATAATATACCTGATTCAAGATGGCAACTCATGAACG
ACGAAATTGCTGATCAAACAAGTTTTATTGTTTTAATGAAGGCCGAAGTG
TCAGATAGTGGATATTACATATGTACTGAACCGAATGGTCAAACTGCTAG
AAGTGAACTTATAGTAATCCCAGATAAAGATAAAAATTCTTTGACAATAA
CTCCAAGAGAAATAAGAGTTAGGGCGGGTCAAAGAGTCGACATAGAATGC
TTTTCAAAAAATACTCAGGGCAGAGCCTCGGGAAACCCGGAATTTAGTTT
CACAAATAATAAACCAATTGGAAGAGATGGGAGGTTTAAAATTAGCAATG
TCGGCCCAGCTCACAAACGTTTGACTGCTCCTGGTGGACTTTCTTTGTCG
GACAATAACATGGATGTTTTCTGCTCGTTAGAAGGTAGACAAGTAAGTTC
AAAAATTTATGTCAGCGACATTTGTCCACCCGGCTATCGGTTTTGTCAAA
ATGGTGAATGTTTAGAAAATGCAAAATTTTGTGATAAAATAAATCACTGC
GCTGATAAATCTGATGAAGATCCAATTACGTGCAGAGAGTGTGACCCAAT
ATCCAGAAAATGTGAAATAAATAATCAAATCTTACCAAAGAAAAATTACT
TTTTAATTCATTGGATTTGTGATGGAGAAGAAGACTGTGGAAATGGCTAC
GATGAACAAAATTGCGATGGCTTTTCTTTGAATAACTGTGGGGGTAAGTT
CTTCACTTGTTCTGATAACAAAACAATACCTCGTGGCTACGTCTGTGATG
AAAACATAGACTGTTCTCAAGGGGAGGACGAAACCGGTTGTACTTCTCCA
CAAATCACAAAAACATCGGCAACAAAAGTTGTGGCGACAAAATCGCAACT
GGTAACTCTAACCTGTGAAGCTACGGGTAAGCCATTGCCAGTTCTTGTTT
GGAGATTTAATTGGGGTTGCATTCAAAATTCCACACGTTTTTCAACCAAC
TTCTTTTCTACCGATTGTAATAGCGTTACAAGTTCACTGACAATAAAGGA
TTTCAAGGCCGGAGACGATGGGATATACAATTGCGAAGCTCTTAGTTCTC
GTCAAAGATCATTCTCAAACGATTTTCAAGTTATTCTTAAAAACAATTAA
TCAACAGAATTTTATTATCACATTTTAATTAGTTGTATTTTAATTAAATA
TATTATCAATATTTAAAAAAAAA
back to top

protein sequence of SMED30015642-orf-1

>SMED30015642-orf-1 ID=SMED30015642-orf-1|Name=SMED30015642-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=835bp
MISICKIFALICIYQSLVKAETEEFTFGGASEEEETSPPNITFFPLKNDS
IVKSEMQFINIACNVTNYALNETSIRWLDKDGKVAAANRYLYIKSLLKQD
EGIYNCSVEKVKDPQIRFNRTLHLKITIPSISIDILPEESLKIGGQIKRQ
CSDLGLPQETIVDDFTYTWLNQQNKTIGNTNILQIPVVDESVVGRYICQY
KSKETSKIYEAATYVNLKQSVSYKIKIITNPALFRYGERFSLRCEVEPFY
QNIKYTWYKKDEFIGNDQELVIKSFKKDNVGTYKCVASLQLPSGKLDLME
ESIQQFAFFRESKIELTTKPGPQVYVHRGEKKELHCEIETSSGNRGKEAE
WYINGKKFKNGDIPLVNRLDGQYVSMLVISDISQINEGNYECRVGSSIKE
VNLIVLLDEGLIETSPPILKVKEGQSVEFHCRVENIPSVKNVNLKWNFES
KEGLVRNNIPDSRWQLMNDEIADQTSFIVLMKAEVSDSGYYICTEPNGQT
ARSELIVIPDKDKNSLTITPREIRVRAGQRVDIECFSKNTQGRASGNPEF
SFTNNKPIGRDGRFKISNVGPAHKRLTAPGGLSLSDNNMDVFCSLEGRQV
SSKIYVSDICPPGYRFCQNGECLENAKFCDKINHCADKSDEDPITCRECD
PISRKCEINNQILPKKNYFLIHWICDGEEDCGNGYDEQNCDGFSLNNCGG
KFFTCSDNKTIPRGYVCDENIDCSQGEDETGCTSPQITKTSATKVVATKS
QLVTLTCEATGKPLPVLVWRFNWGCIQNSTRFSTNFFSTDCNSVTSSLTI
KDFKAGDDGIYNCEALSSRQRSFSNDFQVILKNN*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000099neuron
PLANA:0002075pigment cell
PLANA:0002142parenchyma
PLANA:0003116parenchymal cell
Vocabulary: INTERPRO
TermDefinition
IPR036055LDL_receptor-like_sf
IPR036179Ig-like_dom_sf
IPR002172LDrepeatLR_classA_rpt
IPR003598Ig_sub2
IPR003599Ig_sub
IPR013783Ig-like_fold
IPR013098Ig_I-set
IPR007110Ig-like_dom
IPR023415LDLR_class-A_CS
Vocabulary: molecular function
TermDefinition
GO:0005515protein binding
GO:0002020protease binding
GO:0005509calcium ion binding
GO:0008022protein C-terminus binding
GO:0046872metal ion binding
Vocabulary: biological process
TermDefinition
GO:0001525angiogenesis
GO:0001958endochondral ossification
GO:0002062chondrocyte differentiation
GO:0006024glycosaminoglycan biosynthetic process
GO:0007420brain development
GO:0008104protein localization
GO:0030198extracellular matrix organization
GO:0048704embryonic skeletal system morphogenesis
GO:0048738cardiac muscle tissue development
GO:0060351cartilage development involved in endochondral bone morphogenesis
Vocabulary: cellular component
TermDefinition
GO:0005576extracellular region
GO:0005578proteinaceous extracellular matrix
GO:0005604basement membrane
GO:0005605basal lamina
GO:0005615extracellular space
GO:0005796Golgi lumen
GO:0005925focal adhesion
GO:0031012extracellular matrix
GO:0070062extracellular exosome
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR002172Low-density lipoprotein (LDL) receptor class A repeatPRINTSPR00261LDLRECEPTORcoord: 666..687
score: 42.02
coord: 620..641
score: 40.47
coord: 708..729
score: 42.02
IPR002172Low-density lipoprotein (LDL) receptor class A repeatSMARTSM00192LDLa_2coord: 609..648
e-value: 5.9E-7
score: 39.1
coord: 697..734
e-value: 4.3E-7
score: 39.6
coord: 655..692
e-value: 0.07
score: 14.5
IPR002172Low-density lipoprotein (LDL) receptor class A repeatPFAMPF00057Ldl_recept_acoord: 697..732
e-value: 7.9E-6
score: 26.0
IPR002172Low-density lipoprotein (LDL) receptor class A repeatPROSITEPS50068LDLRA_2coord: 697..733
score: 10.45
IPR002172Low-density lipoprotein (LDL) receptor class A repeatPROSITEPS50068LDLRA_2coord: 648..691
score: 9.413
IPR002172Low-density lipoprotein (LDL) receptor class A repeatPROSITEPS50068LDLRA_2coord: 609..647
score: 9.8
IPR002172Low-density lipoprotein (LDL) receptor class A repeatCDDcd00112LDLacoord: 610..642
e-value: 1.23384E-6
score: 43.3494
IPR002172Low-density lipoprotein (LDL) receptor class A repeatCDDcd00112LDLacoord: 671..690
e-value: 1.31013E-4
score: 37.9566
IPR002172Low-density lipoprotein (LDL) receptor class A repeatCDDcd00112LDLacoord: 698..732
e-value: 3.16469E-6
score: 42.1938
IPR003599Immunoglobulin subtypeSMARTSM00409IG_3ccoord: 416..508
e-value: 2.6E-5
score: 33.7
coord: 520..592
e-value: 110.0
score: 2.5
coord: 136..218
e-value: 83.0
score: 3.5
coord: 321..406
e-value: 1.3E-5
score: 34.7
coord: 48..127
e-value: 0.4
score: 19.8
coord: 742..832
e-value: 1.6E-5
score: 34.3
coord: 229..301
e-value: 0.26
score: 20.4
IPR003598Immunoglobulin subtype 2SMARTSM00408igc2_5coord: 54..113
e-value: 3.6
score: 1.8
coord: 748..820
e-value: 0.0012
score: 28.2
coord: 327..399
e-value: 3.0
score: 2.6
coord: 422..500
e-value: 0.33
score: 11.7
coord: 235..292
e-value: 0.22
score: 13.5
IPR036055LDL receptor-like superfamilyGENE3DG3DSA:4.10.400.10coord: 692..733
e-value: 1.1E-7
score: 33.4
IPR036055LDL receptor-like superfamilyGENE3DG3DSA:4.10.400.10coord: 646..690
e-value: 8.8E-7
score: 31.0
IPR036055LDL receptor-like superfamilyGENE3DG3DSA:4.10.400.10coord: 612..645
e-value: 1.8E-6
score: 29.8
IPR036055LDL receptor-like superfamilySUPERFAMILYSSF57424LDL receptor-like modulecoord: 697..738
IPR036055LDL receptor-like superfamilySUPERFAMILYSSF57424LDL receptor-like modulecoord: 607..646
IPR013783Immunoglobulin-like foldGENE3DG3DSA:2.60.40.10coord: 119..219
e-value: 5.3E-5
score: 25.0
coord: 220..296
e-value: 2.7E-9
score: 38.8
IPR013783Immunoglobulin-like foldGENE3DG3DSA:2.60.40.10coord: 303..405
e-value: 7.2E-9
score: 37.4
IPR013783Immunoglobulin-like foldGENE3DG3DSA:2.60.40.10coord: 407..513
e-value: 4.5E-9
score: 38.2
IPR013783Immunoglobulin-like foldGENE3DG3DSA:2.60.40.10coord: 734..833
e-value: 3.2E-15
score: 57.9
IPR007110Immunoglobulin-like domainPFAMPF13895Ig_2coord: 232..289
e-value: 2.3E-8
score: 34.2
IPR007110Immunoglobulin-like domainPROSITEPS50835IG_LIKEcoord: 39..123
score: 10.426
IPR007110Immunoglobulin-like domainPROSITEPS50835IG_LIKEcoord: 735..824
score: 12.495
IPR007110Immunoglobulin-like domainPROSITEPS50835IG_LIKEcoord: 314..402
score: 9.246
IPR007110Immunoglobulin-like domainPROSITEPS50835IG_LIKEcoord: 237..304
score: 9.573
IPR007110Immunoglobulin-like domainPROSITEPS50835IG_LIKEcoord: 409..506
score: 8.847
IPR007110Immunoglobulin-like domainPROSITEPS50835IG_LIKEcoord: 129..222
score: 8.103
NoneNo IPR availablePFAMPF13927Ig_3coord: 735..815
e-value: 1.4E-11
score: 44.9
NoneNo IPR availablePANTHERPTHR11640:SF79HEPARAN SULFATE PROTEOGLYCAN 2coord: 610..823
NoneNo IPR availablePANTHERPTHR11640NEPHRINcoord: 610..823
NoneNo IPR availableCDDcd00096Igcoord: 240..288
e-value: 5.01457E-4
score: 37.2217
NoneNo IPR availableCDDcd00096Igcoord: 333..405
e-value: 9.69236E-4
score: 36.4513
NoneNo IPR availableSIGNALP_EUKSignalP-noTMSignalP-noTMcoord: 1..20
score: 0.597
IPR013098Immunoglobulin I-setPFAMPF07679I-setcoord: 413..497
e-value: 1.2E-5
score: 25.3
coord: 317..402
e-value: 3.3E-6
score: 27.1
IPR023415Low-density lipoprotein (LDL) receptor class A, conserved sitePROSITEPS01209LDLRA_1coord: 622..646
IPR036179Immunoglobulin-like domain superfamilySUPERFAMILYSSF48726Immunoglobulincoord: 413..498
IPR036179Immunoglobulin-like domain superfamilySUPERFAMILYSSF48726Immunoglobulincoord: 734..818
IPR036179Immunoglobulin-like domain superfamilySUPERFAMILYSSF48726Immunoglobulincoord: 229..290
IPR036179Immunoglobulin-like domain superfamilySUPERFAMILYSSF48726Immunoglobulincoord: 319..406
IPR036179Immunoglobulin-like domain superfamilySUPERFAMILYSSF48726Immunoglobulincoord: 49..111