Small G protein signaling modulator 1

Overview
NameSmall G protein signaling modulator 1
Smed IDSMED30015622
Length (bp)3530
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Small G protein signaling modulator 1 (SMED30015622) t-SNE clustered cells

Violin plots show distribution of expression levels for Small G protein signaling modulator 1 (SMED30015622) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Small G protein signaling modulator 1 (SMED30015622) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Small G protein signaling modulator 1 (SMED30015622) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30015622

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 6

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
headSMED30015622SMESG000001901.1 SMESG000001889.1 SmedASXL_017341SmedAsxl_ww_GCZZ01PMID:27034770
Currie et al., 2016
whole organism asexual adult RNA-sequencing evidence
neuronSMED30015622SMESG000001901.1 SMESG000001889.1 SMESG000061056.1 SMESG000058180.1 SMESG000057533.1 SMESG000047874.1 SMESG000046659.1 dd_Smed_v4_12130_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
neuronSMED30015622SMESG000001901.1 SMESG000001889.1 SMESG000061056.1 SMESG000058180.1 SMESG000057533.1 SMESG000047874.1 SMESG000046659.1 dd_Smed_v4_12130_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult colorimetric in situ hybridization evidence
parapharyngeal cellSMED30015622SMESG000001901.1 SMESG000001889.1 SMESG000061056.1 SMESG000058180.1 SMESG000057533.1 SMESG000047874.1 SMESG000046659.1 dd_Smed_v4_12130_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
headSMED30015622SMESG000001901.1 SMESG000001889.1 SMESG000061056.1 SMESG000058180.1 SMESG000057533.1 SMESG000047874.1 SMESG000046659.1 dd_Smed_v6_12130_0_1dd_Smed_v6PMID:28171748
Stückemann et al., 2017
whole organism asexual adult RNA-sequencing evidence
headSMED30015622SMESG000001889.1 OX_Smed_1.0.14912ox_Smed_v2PMID:24238224
Kao et al., 2013
whole organism asexual adult RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Small G protein signaling modulator 1 vs. Ensembl Human
Match: SGSM1 (small G protein signaling modulator 1 [Source:HGNC Symbol;Acc:HGNC:29410])

HSP 1 Score: 364.385 bits (934), Expect = 7.575e-107
Identity = 225/639 (35.21%), Postives = 329/639 (51.49%), Query Frame = 3
Query:  711 IKHYWIRLALTEKVLDKIIDYLVKNSNRFYNHGSVIGDPCYGYILVSLLSGPCSLEYSRVKNPELIPDDPDAGELIQRQKIQNQSGSTGIEAGKSPNLSHAMSTSSLFWSSGSNQFLNKPALVNRQRRLTGIDLDEIPNSGNKSPFSTARQYVESLHQTSSSSLLFGKNNVYCQPREDVNKMPGYLSLHMAVNEMLIKWTPNELMSGGLNDAVFKENSVKVEWDCALMIWVNKVVYIHCHQQADKGETLVLVNHDGSQNPPFDFPQGGHLMSFLTCLENGLLPKCRLDPPLWLKKNREKLFQKSCENPINNSKE---LDQDGPKSAEF----IKPTNKNKTI---FLWSSSDRNSLKFSWFHQPFNKKLTIGNRKVLSQPLEHIVFDYRQAGRHNSQSDELLTDLVFRIVRPKNYNQTMSETHSGXXXXXXXXXITENPKSPNDLH----STVPQ-WHSDYTVLAMKRRCRLSSTEKSKTYG----KSSIRMLCSSMKKEIMARSFYGWLAYSRHMKTIRNHLSQLV--------LPVDLGTKSCKEFIKGLTKEKWTSAFNLNNQIEDNMSVLCYIYRGGCDPELRVQTWPYLLGLFEWNSTENERQATLRKWERRYHVAISDWMVIETVLNEEEDAS 2546
            IKH WIR AL EKVLDKI+ YLV+NS+++Y   +++ DP  G IL SLL GPC+LEY+++K  +    DP A EL+QR +I +               SH    S             +PAL  ++R  +G        S +  P  +AR YVESLHQ S ++LL+GKNNV  QPR+D+  +PGYLSLH   + M +KWTPN+LM+G + D  ++++   V WD A+ I + ++VY+HCHQQ D G T+VLV+ DG Q PPF FP+GGHL+ FL+CLENGLLP  +LDPPLW ++ + K+F K  +     S E    D+D  ++ ++    I P  +++ +   FL S+S   S+  +W   P  + + +  R                     SQ +    D       PK                       E P  P DL     S +P  W       +     +  S + S T G    ++ +++LC +MK +I++R+FYGWLAY RH+ T+R HLS LV        LP D G        +GLT   W    + +   E+   +L  IY GG  PE+R   WP+LLG +++  TE ER+    +    Y   +++W+  E ++ + E  S
Sbjct:  126 IKHLWIRTALFEKVLDKIVHYLVENSSKYYEKEALLMDPVDGPILASLLVGPCALEYTKMKTADHFWTDPSADELVQRHRIHS---------------SHVRQDSPT----------KRPALCIQKRHSSG--------SMDDRPSLSARDYVESLHQNSRATLLYGKNNVLVQPRDDMEAVPGYLSLHQTADVMTLKWTPNQLMNGSVGDLDYEKS---VYWDYAMTIRLEEIVYLHCHQQVDSGGTVVLVSQDGIQRPPFRFPKGGHLLQFLSCLENGLLPHGQLDPPLWSQRGKGKVFPKLRKRSPQGSAESTSSDKDDDEATDYVFRIIYPGMQSEFVAPDFLGSTSSV-SVGPAWMMVPAGRSMLVVAR--------------------GSQWEPARWDTTLPTPSPK-----------------------EQPPMPQDLMDVSVSNLPSLWQPSPRKSSCSSCSQSGSADGSSTNGCNHERAPLKLLCDNMKYQILSRAFYGWLAYCRHLSTVRTHLSALVNHMIVSPDLPCDAG--------QGLTARIWEQYLHDSTSYEEQ-ELLRLIYYGGIQPEIRKAVWPFLLGHYQFGMTETERKEVDEQIHACYAQTMAEWLGCEAIVRQRERES 675          

HSP 2 Score: 277.715 bits (709), Expect = 1.188e-76
Identity = 131/270 (48.52%), Postives = 190/270 (70.37%), Query Frame = 3
Query: 2559 DNEERCAVQIERKSETNEKSNFGNSTSNNKNKKEAETKIVITQKILNVLKQNWTRIEKDVARCDRHFGFFGQTKTGEENLNILQRIMCTWVWENLELGYIQGMCDLLAPILVVFNGHEELTFACFSKYMERMISNFPVKDSTKMDLCFSRMRSAVQILDSDLLNHMQSYGDFTHFYFSYRWFLLDFKREFTYKDVFCLWETIWAADNVASPYFSLFVGLALLLSYRDVIIDNAMEFTDIIRFFNEMAEQHNVQKVLELARELVEKLQLLL 3368
            D+E+  + + E +S     ++   +TS N+    + + +  + ++L++   N  RIEKDV RCDR++ +F        NL  L+ IMC+++W+++E+GY+QGMCDLLAP+LV+ +  E L F+CF++ M+RM  NFP      MD  F+ MRS +QILDS+L   M   GD+THFYF YRWFLLDFKRE  Y DVF +WETIWAA +V+S ++ LF+ LAL+  YRD+I++N M+FTDII+FFNEMAE+HN ++VL+LAR+LV K+Q L+
Sbjct:  884 DSEDNLSEEPEMESLFPALASLAVTTSANEVSPVSSSGVTYSPELLDLYTVNLHRIEKDVQRCDRNYWYFTPA-----NLEKLRNIMCSYIWQHIEIGYVQGMCDLLAPLLVILDD-EALAFSCFTELMKRMNQNFP--HGGAMDTHFANMRSLIQILDSELFELMHQNGDYTHFYFCYRWFLLDFKRELVYDDVFLVWETIWAAKHVSSAHYVLFIALALVEVYRDIILENNMDFTDIIKFFNEMAERHNTKQVLKLARDLVYKVQTLI 1145          

HSP 3 Score: 60.077 bits (144), Expect = 3.235e-8
Identity = 35/83 (42.17%), Postives = 57/83 (68.67%), Query Frame = 3
Query:  246 KEILIKTIKRQVKLLMEEFVNKKYVHEYSSNVISLCASIEACXXXXXXXXXXXXFKESSSLALLEKIAKQNAAAKSICTLMSD 494
            ++ L++T+K++VK +MEE V +K+VHE SS++IS CA++EAC+L GL+RRA G  + +   AL  K+ K    A+ +   + D
Sbjct:   11 RQRLLRTVKKEVKQIMEEAVTRKFVHEDSSHIISFCAAVEACVLHGLRRRAAGFLRSNKIAALFMKVGKNFPPAEDLSRKVQD 93          
BLAST of Small G protein signaling modulator 1 vs. Ensembl Human
Match: SGSM1 (small G protein signaling modulator 1 [Source:HGNC Symbol;Acc:HGNC:29410])

HSP 1 Score: 357.066 bits (915), Expect = 1.366e-104
Identity = 220/610 (36.07%), Postives = 317/610 (51.97%), Query Frame = 3
Query:  711 IKHYWIRLALTEKVLDKIIDYLVKNSNRFYNHGSVIGDPCYGYILVSLLSGPCSLEYSRVKNPELIPDDPDAGELIQRQKIQNQSGSTGIEAGKSPNLSHAMSTSSLFWSSGSNQFLNKPALVNRQRRLTGIDLDEIPNSGNKSPFSTARQYVESLHQTSSSSLLFGKNNVYCQPREDVNKMPGYLSLHMAVNEMLIKWTPNELMSGGLNDAVFKENSVKVEWDCALMIWVNKVVYIHCHQQADKGETLVLVNHDGSQNPPFDFPQGGHLMSFLTCLENGLLPKCRLDPPLWLKKNREKLFQKSCENPINNSKE---LDQDGPKSAEF----IKPTNKNKTI---FLWSSSDRNSLKFSWFHQPFNKKLTIGNRKVLSQPLEHIVFDYRQAGRHNSQSDELLTDLVFRIVRPKNYNQTMSETHSGXXXXXXXXXITENPKSPNDLH----STVPQ-WHSDYTVLAMKRRCRLSSTEKSKTYG----KSSIRMLCSSMKKEIMARSFYGWLAYSRHMKTIRNHLSQLV--------LPVDLGTKSCKEFIKGLTKEKWTSAFNLNNQIEDNMSVLCYIYRGGCDPELRVQTWPYLLGLFEWNSTENERQAT 2459
            IKH WIR AL EKVLDKI+ YLV+NS+++Y   +++ DP  G IL SLL GPC+LEY+++K  +    DP A EL+QR +I +               SH    S             +PAL  ++R  +G        S +  P  +AR YVESLHQ S ++LL+GKNNV  QPR+D+  +PGYLSLH   + M +KWTPN+LM+G + D  ++++   V WD A+ I + ++VY+HCHQQ D G T+VLV+ DG Q PPF FP+GGHL+ FL+CLENGLLP  +LDPPLW ++ + K+F K  +     S E    D+D  ++ ++    I P  +++ +   FL S+S   S+  +W   P  + + +  R                     SQ +    D       PK                       E P  P DL     S +P  W       +     +  S + S T G    ++ +++LC +MK +I++R+FYGWLAY RH+ T+R HLS LV        LP D G        +GLT   W    + +   E+   +L  IY GG  PE+R   WP+LLG +++  TE ER+ +
Sbjct:  126 IKHLWIRTALFEKVLDKIVHYLVENSSKYYEKEALLMDPVDGPILASLLVGPCALEYTKMKTADHFWTDPSADELVQRHRIHS---------------SHVRQDSPT----------KRPALCIQKRHSSG--------SMDDRPSLSARDYVESLHQNSRATLLYGKNNVLVQPRDDMEAVPGYLSLHQTADVMTLKWTPNQLMNGSVGDLDYEKS---VYWDYAMTIRLEEIVYLHCHQQVDSGGTVVLVSQDGIQRPPFRFPKGGHLLQFLSCLENGLLPHGQLDPPLWSQRGKGKVFPKLRKRSPQGSAESTSSDKDDDEATDYVFRIIYPGMQSEFVAPDFLGSTSSV-SVGPAWMMVPAGRSMLVVAR--------------------GSQWEPARWDTTLPTPSPK-----------------------EQPPMPQDLMDVSVSNLPSLWQPSPRKSSCSSCSQSGSADGSSTNGCNHERAPLKLLCDNMKYQILSRAFYGWLAYCRHLSTVRTHLSALVNHMIVSPDLPCDAG--------QGLTARIWEQYLHDSTSYEEQ-ELLRLIYYGGIQPEIRKAVWPFLLGHYQFGMTETERKES 646          

HSP 2 Score: 277.715 bits (709), Expect = 6.230e-77
Identity = 131/270 (48.52%), Postives = 190/270 (70.37%), Query Frame = 3
Query: 2559 DNEERCAVQIERKSETNEKSNFGNSTSNNKNKKEAETKIVITQKILNVLKQNWTRIEKDVARCDRHFGFFGQTKTGEENLNILQRIMCTWVWENLELGYIQGMCDLLAPILVVFNGHEELTFACFSKYMERMISNFPVKDSTKMDLCFSRMRSAVQILDSDLLNHMQSYGDFTHFYFSYRWFLLDFKREFTYKDVFCLWETIWAADNVASPYFSLFVGLALLLSYRDVIIDNAMEFTDIIRFFNEMAEQHNVQKVLELARELVEKLQLLL 3368
            D+E+  + + E +S     ++   +TS N+    + + +  + ++L++   N  RIEKDV RCDR++ +F        NL  L+ IMC+++W+++E+GY+QGMCDLLAP+LV+ +  E L F+CF++ M+RM  NFP      MD  F+ MRS +QILDS+L   M   GD+THFYF YRWFLLDFKRE  Y DVF +WETIWAA +V+S ++ LF+ LAL+  YRD+I++N M+FTDII+FFNEMAE+HN ++VL+LAR+LV K+Q L+
Sbjct:  823 DSEDNLSEEPEMESLFPALASLAVTTSANEVSPVSSSGVTYSPELLDLYTVNLHRIEKDVQRCDRNYWYFTPA-----NLEKLRNIMCSYIWQHIEIGYVQGMCDLLAPLLVILDD-EALAFSCFTELMKRMNQNFP--HGGAMDTHFANMRSLIQILDSELFELMHQNGDYTHFYFCYRWFLLDFKRELVYDDVFLVWETIWAAKHVSSAHYVLFIALALVEVYRDIILENNMDFTDIIKFFNEMAERHNTKQVLKLARDLVYKVQTLI 1084          

HSP 3 Score: 60.077 bits (144), Expect = 2.879e-8
Identity = 35/83 (42.17%), Postives = 57/83 (68.67%), Query Frame = 3
Query:  246 KEILIKTIKRQVKLLMEEFVNKKYVHEYSSNVISLCASIEACXXXXXXXXXXXXFKESSSLALLEKIAKQNAAAKSICTLMSD 494
            ++ L++T+K++VK +MEE V +K+VHE SS++IS CA++EAC+L GL+RRA G  + +   AL  K+ K    A+ +   + D
Sbjct:   11 RQRLLRTVKKEVKQIMEEAVTRKFVHEDSSHIISFCAAVEACVLHGLRRRAAGFLRSNKIAALFMKVGKNFPPAEDLSRKVQD 93          
BLAST of Small G protein signaling modulator 1 vs. Ensembl Human
Match: SGSM2 (small G protein signaling modulator 2 [Source:HGNC Symbol;Acc:HGNC:29026])

HSP 1 Score: 297.36 bits (760), Expect = 4.075e-84
Identity = 174/458 (37.99%), Postives = 252/458 (55.02%), Query Frame = 3
Query:  246 KEILIKTIKRQVKLLMEEFVNKKYVHEYSSNVISLCASIEACXXXXXXXXXXXXFKESSSLALLEKIAKQNAAAKSICTLMSDEKLHYCDXXXXXXXXXXXXXXXXXXXXXXXXXXTFGYSWSASSFLGFSNNKFFSSINQSSDNEFINLHWKNLIKHYWIRLALTEKVLDKIIDYLVKNSNRFYNHGSVIGDPCYGYILVSLLSGPCSLEYSRVKNPELIPDDPDAGELIQRQKIQNQSGSTGIEAGKSPNLSHAMSTSSLFWSSGSNQFLNKPALVNRQRRLTGIDLDEIPNSGNKSPFSTARQYVESLHQTSSSSLLFGKNNVYCQPREDVNKMPGYLSLHMAVNEMLIKWTPNELMSGGLNDAVFKENSVKVEWDCALMIWVNKVVYIHCHQQADKGETLVLVNHDGSQNPPFDFPQGGHLMSFLTCLENGLLPKCRLDPPLWLKKNREKLFQK 1619
            KE L+  +K++VK +MEE V +K+VHE SS++I+LC ++EACLL  L+RRA G  +     AL  K+ K    A  IC  + +                         +         G S  A    G ++ K  +   Q+             +KH W+R AL EKVLDK++ YL +N +++Y   +++ DP +G IL SLL GPC+LEY+++K  +    DP A EL+QR +I+         A                          +PAL  R+R  +G       ++      + AR+ VESLHQ S + LL+GKN+V  QP+ED+  +PGYLSLH +   + +KWTPN+LM+G L D+  +++   V WD AL++  ++VV IHCHQQ   G TLVLV+ DG Q PP  FPQGGHL+SFL+CLENGLLP+ +L+PPLW ++ + K+F K
Sbjct:    9 KEKLLWNVKKEVKQIMEEAVTRKFVHEDSSHIIALCGAVEACLLHQLRRRAAGFLRSDKMAALFTKVGKTCPVAGEICHKVQE------------------------LQQQAEGRKPSGVSQEALRRQGSASGKAPALSPQA-------------LKHVWVRTALIEKVLDKVVQYLAENCSKYYEKEALLADPVFGPILASLLVGPCALEYTKLKTADHYWTDPSADELVQRHRIRGPPTRQDSPA-------------------------KRPALGIRKRHSSG-------SASEDRLAACARECVESLHQNSRTRLLYGKNHVLVQPKEDMEAVPGYLSLHQSAESLTLKWTPNQLMNGTLGDSELEKS---VYWDYALVVPFSQVVCIHCHQQKSGG-TLVLVSQDGIQRPPLHFPQGGHLLSFLSCLENGLLPRGQLEPPLWTQQGKGKVFPK 393          

HSP 2 Score: 235.728 bits (600), Expect = 3.056e-63
Identity = 112/234 (47.86%), Postives = 158/234 (67.52%), Query Frame = 3
Query: 2589 ERKSETNEKSNFGNSTSNNKNKKEAETKIVITQKILNVLKQNWTRIEKDVARCDRHFGFFGQTKTGEENLNILQRIMCTWVWENLELGYIQGMCDLLAPILVVFNGHEELTFACFSKYMERMISNFPVKDSTKMDLCFSRMRSAVQILDSDLLNHMQSYGDFTHFYFSYRWFLLDFKREFTYKDVFCLWETIWAADNVASPYFSLFVGLALLLSYRDVIIDNAMEFTDIIRFFN 3290
            E +  + EK   G   +  +    A      T ++L+ +  N  RI+KDV RCDR++ +F        NL  L+ +MC++VWE+L++GY+QGMCDLLAP+LV  + +++L ++CFS  M+RM  NFP  +   MD  F+ MRS +QILDS+L   M   GD+THFYF YRWFLLDFKRE  Y+DVF +WE IWAA +++S +F LF+ LAL+ +YR++I DN M+FTDII+FFN
Sbjct:  754 EPQDPSQEKPQAGELEAGEE--LAAVCAAAYTIELLDTVALNLHRIDKDVQRCDRNYWYFTPP-----NLERLRDVMCSYVWEHLDVGYVQGMCDLLAPLLVTLD-NDQLAYSCFSHLMKRMSQNFP--NGGAMDTHFANMRSLIQILDSELFELMHQNGDYTHFYFCYRWFLLDFKRELLYEDVFAVWEVIWAARHISSEHFVLFIALALVEAYREIIRDNNMDFTDIIKFFN 977          

HSP 3 Score: 100.523 bits (249), Expect = 1.071e-20
Identity = 50/149 (33.56%), Postives = 84/149 (56.38%), Query Frame = 3
Query: 2121 IRMLCSSMKKEIMARSFYGWLAYSRHMKTIRNHLSQL----VLPVDLGTKSCKEFIKGLTKEKWTSAFNLNNQIEDNMSVLCYIYRGGCDPELRVQTWPYLLGLFEWNSTENERQATLRKWERRYHVAISDWMVIETVLNEEEDASTPT 2555
            +R+LC SMK++I++R+FYGWLA+ RH+ T+R HLS L    V+P D    +      GLTK+ W S +  + +    + +L  +Y GG + E+R   WP+LLG +++  ++ E +        RY   +++W   E V+ + E  + P 
Sbjct:  484 LRLLCESMKRQIVSRAFYGWLAHCRHLSTVRTHLSALVHHSVIPPDRPPGAS----AGLTKDVW-SKYQKDKKNYKELELLRQVYYGGIEHEIRKDVWPFLLGHYKFGMSKKEMEQVDAVVAARYQQVLAEWKACEVVVRQREREAHPA 627          
BLAST of Small G protein signaling modulator 1 vs. Ensembl Human
Match: SGSM2 (small G protein signaling modulator 2 [Source:HGNC Symbol;Acc:HGNC:29026])

HSP 1 Score: 296.975 bits (759), Expect = 7.025e-84
Identity = 174/458 (37.99%), Postives = 252/458 (55.02%), Query Frame = 3
Query:  246 KEILIKTIKRQVKLLMEEFVNKKYVHEYSSNVISLCASIEACXXXXXXXXXXXXFKESSSLALLEKIAKQNAAAKSICTLMSDEKLHYCDXXXXXXXXXXXXXXXXXXXXXXXXXXTFGYSWSASSFLGFSNNKFFSSINQSSDNEFINLHWKNLIKHYWIRLALTEKVLDKIIDYLVKNSNRFYNHGSVIGDPCYGYILVSLLSGPCSLEYSRVKNPELIPDDPDAGELIQRQKIQNQSGSTGIEAGKSPNLSHAMSTSSLFWSSGSNQFLNKPALVNRQRRLTGIDLDEIPNSGNKSPFSTARQYVESLHQTSSSSLLFGKNNVYCQPREDVNKMPGYLSLHMAVNEMLIKWTPNELMSGGLNDAVFKENSVKVEWDCALMIWVNKVVYIHCHQQADKGETLVLVNHDGSQNPPFDFPQGGHLMSFLTCLENGLLPKCRLDPPLWLKKNREKLFQK 1619
            KE L+  +K++VK +MEE V +K+VHE SS++I+LC ++EACLL  L+RRA G  +     AL  K+ K    A  IC  + +                         +         G S  A    G ++ K  +   Q+             +KH W+R AL EKVLDK++ YL +N +++Y   +++ DP +G IL SLL GPC+LEY+++K  +    DP A EL+QR +I+         A                          +PAL  R+R  +G       ++      + AR+ VESLHQ S + LL+GKN+V  QP+ED+  +PGYLSLH +   + +KWTPN+LM+G L D+  +++   V WD AL++  ++VV IHCHQQ   G TLVLV+ DG Q PP  FPQGGHL+SFL+CLENGLLP+ +L+PPLW ++ + K+F K
Sbjct:    9 KEKLLWNVKKEVKQIMEEAVTRKFVHEDSSHIIALCGAVEACLLHQLRRRAAGFLRSDKMAALFTKVGKTCPVAGEICHKVQE------------------------LQQQAEGRKPSGVSQEALRRQGSASGKAPALSPQA-------------LKHVWVRTALIEKVLDKVVQYLAENCSKYYEKEALLADPVFGPILASLLVGPCALEYTKLKTADHYWTDPSADELVQRHRIRGPPTRQDSPA-------------------------KRPALGIRKRHSSG-------SASEDRLAACARECVESLHQNSRTRLLYGKNHVLVQPKEDMEAVPGYLSLHQSAESLTLKWTPNQLMNGTLGDSELEKS---VYWDYALVVPFSQVVCIHCHQQKSGG-TLVLVSQDGIQRPPLHFPQGGHLLSFLSCLENGLLPRGQLEPPLWTQQGKGKVFPK 393          

HSP 2 Score: 264.618 bits (675), Expect = 6.875e-73
Identity = 125/260 (48.08%), Postives = 179/260 (68.85%), Query Frame = 3
Query: 2589 ERKSETNEKSNFGNSTSNNKNKKEAETKIVITQKILNVLKQNWTRIEKDVARCDRHFGFFGQTKTGEENLNILQRIMCTWVWENLELGYIQGMCDLLAPILVVFNGHEELTFACFSKYMERMISNFPVKDSTKMDLCFSRMRSAVQILDSDLLNHMQSYGDFTHFYFSYRWFLLDFKREFTYKDVFCLWETIWAADNVASPYFSLFVGLALLLSYRDVIIDNAMEFTDIIRFFNEMAEQHNVQKVLELARELVEKLQLLL 3368
            E +  + EK   G   +  +    A      T ++L+ +  N  RI+KDV RCDR++ +F        NL  L+ +MC++VWE+L++GY+QGMCDLLAP+LV  + +++L ++CFS  M+RM  NFP  +   MD  F+ MRS +QILDS+L   M   GD+THFYF YRWFLLDFKRE  Y+DVF +WE IWAA +++S +F LF+ LAL+ +YR++I DN M+FTDII+FFNE AE H+ Q++L +AR+LV K+Q+L+
Sbjct:  754 EPQDPSQEKPQAGELEAGEE--LAAVCAAAYTIELLDTVALNLHRIDKDVQRCDRNYWYFTPP-----NLERLRDVMCSYVWEHLDVGYVQGMCDLLAPLLVTLD-NDQLAYSCFSHLMKRMSQNFP--NGGAMDTHFANMRSLIQILDSELFELMHQNGDYTHFYFCYRWFLLDFKRELLYEDVFAVWEVIWAARHISSEHFVLFIALALVEAYREIIRDNNMDFTDIIKFFNERAEHHDAQEILRIARDLVHKVQMLI 1003          

HSP 3 Score: 100.523 bits (249), Expect = 1.144e-20
Identity = 50/149 (33.56%), Postives = 84/149 (56.38%), Query Frame = 3
Query: 2121 IRMLCSSMKKEIMARSFYGWLAYSRHMKTIRNHLSQL----VLPVDLGTKSCKEFIKGLTKEKWTSAFNLNNQIEDNMSVLCYIYRGGCDPELRVQTWPYLLGLFEWNSTENERQATLRKWERRYHVAISDWMVIETVLNEEEDASTPT 2555
            +R+LC SMK++I++R+FYGWLA+ RH+ T+R HLS L    V+P D    +      GLTK+ W S +  + +    + +L  +Y GG + E+R   WP+LLG +++  ++ E +        RY   +++W   E V+ + E  + P 
Sbjct:  484 LRLLCESMKRQIVSRAFYGWLAHCRHLSTVRTHLSALVHHSVIPPDRPPGAS----AGLTKDVW-SKYQKDKKNYKELELLRQVYYGGIEHEIRKDVWPFLLGHYKFGMSKKEMEQVDAVVAARYQQVLAEWKACEVVVRQREREAHPA 627          
BLAST of Small G protein signaling modulator 1 vs. Ensembl Human
Match: SGSM2 (small G protein signaling modulator 2 [Source:HGNC Symbol;Acc:HGNC:29026])

HSP 1 Score: 297.36 bits (760), Expect = 8.892e-84
Identity = 180/497 (36.22%), Postives = 268/497 (53.92%), Query Frame = 3
Query:  246 KEILIKTIKRQVKLLMEEFVNKKYVHEYSSNVISLCASIEACXXXXXXXXXXXXFKESSSLALLEKIAKQNAAAKSICTLMSDEKLHYCDXXXXXXXXXXXXXXXXXXXXXXXXXXTFGYSWSASSFLGFSNNKFFSSINQSSDNEFINLHWKNLIKHYWIRLALTEKVLDKIIDYLVKNSNRFYNHGSVIGDPCYGYILVSLLSGPCSLEYSRVKNPELIPDDPDAGELIQRQKIQNQSGSTGIEAGKSPNLSHAMSTSSLFWSSGSNQFLNKPALVNRQRRLTGIDLDEIPNSGNKSPFSTARQYVESLHQTSSSSLLFGKNNVYCQPREDVNKMPGYLSLHMAVNEMLIKWTPNELMSGGLNDAVFKENSVKVEWDCALMIWVNKVVYIHCHQQADKGETLVLVNHDGSQNPPFDFPQGGHLMSFLTCLENGLLPKCRLDPPLWLKKNREKLFQKSCENPINNSKELDQDGPKSA-----EFIKPTNKNKTIFL 1721
            KE L+  +K++VK +MEE V +K+VHE SS++I+LC ++EACLL  L+RRA G  +     AL  K+ K    A  IC  + +                         +         G S  A    G ++ K  +   Q+             +KH W+R AL EKVLDK++ YL +N +++Y   +++ DP +G IL SLL GPC+LEY+++K  +    DP A EL+QR +I+         A                          +PAL  R+R  +G       ++      + AR+ VESLHQ S + LL+GKN+V  QP+ED+  +PGYLSLH +   + +KWTPN+LM+G L D+  +++   V WD AL++  ++VV IHCHQQ   G TLVLV+ DG Q PP  FPQGGHL+SFL+CLENGLLP+ +L+PPLW ++ + K+F K  +     S ++++ G   A       I P ++++ I +
Sbjct:    9 KEKLLWNVKKEVKQIMEEAVTRKFVHEDSSHIIALCGAVEACLLHQLRRRAAGFLRSDKMAALFTKVGKTCPVAGEICHKVQE------------------------LQQQAEGRKPSGVSQEALRRQGSASGKAPALSPQA-------------LKHVWVRTALIEKVLDKVVQYLAENCSKYYEKEALLADPVFGPILASLLVGPCALEYTKLKTADHYWTDPSADELVQRHRIRGPPTRQDSPA-------------------------KRPALGIRKRHSSG-------SASEDRLAACARECVESLHQNSRTRLLYGKNHVLVQPKEDMEAVPGYLSLHQSAESLTLKWTPNQLMNGTLGDSELEKS---VYWDYALVVPFSQVVCIHCHQQKSGG-TLVLVSQDGIQRPPLHFPQGGHLLSFLSCLENGLLPRGQLEPPLWTQQGKGKVFPKLRKRSSIRSVDMEEMGTGRATDYVFRIIYPGHRHEHITI 432          

HSP 2 Score: 265.003 bits (676), Expect = 8.242e-73
Identity = 120/229 (52.40%), Postives = 170/229 (74.24%), Query Frame = 3
Query: 2682 TQKILNVLKQNWTRIEKDVARCDRHFGFFGQTKTGEENLNILQRIMCTWVWENLELGYIQGMCDLLAPILVVFNGHEELTFACFSKYMERMISNFPVKDSTKMDLCFSRMRSAVQILDSDLLNHMQSYGDFTHFYFSYRWFLLDFKREFTYKDVFCLWETIWAADNVASPYFSLFVGLALLLSYRDVIIDNAMEFTDIIRFFNEMAEQHNVQKVLELARELVEKLQLLL 3368
            T ++L+ +  N  RI+KDV RCDR++ +F        NL  L+ +MC++VWE+L++GY+QGMCDLLAP+LV  + +++L ++CFS  M+RM  NFP  +   MD  F+ MRS +QILDS+L   M   GD+THFYF YRWFLLDFKRE  Y+DVF +WE IWAA +++S +F LF+ LAL+ +YR++I DN M+FTDII+FFNE AE H+ Q++L +AR+LV K+Q+L+
Sbjct:  828 TIELLDTVALNLHRIDKDVQRCDRNYWYFTPP-----NLERLRDVMCSYVWEHLDVGYVQGMCDLLAPLLVTLD-NDQLAYSCFSHLMKRMSQNFP--NGGAMDTHFANMRSLIQILDSELFELMHQNGDYTHFYFCYRWFLLDFKRELLYEDVFAVWEVIWAARHISSEHFVLFIALALVEAYREIIRDNNMDFTDIIKFFNERAEHHDAQEILRIARDLVHKVQMLI 1048          

HSP 3 Score: 100.523 bits (249), Expect = 1.122e-20
Identity = 50/149 (33.56%), Postives = 84/149 (56.38%), Query Frame = 3
Query: 2121 IRMLCSSMKKEIMARSFYGWLAYSRHMKTIRNHLSQL----VLPVDLGTKSCKEFIKGLTKEKWTSAFNLNNQIEDNMSVLCYIYRGGCDPELRVQTWPYLLGLFEWNSTENERQATLRKWERRYHVAISDWMVIETVLNEEEDASTPT 2555
            +R+LC SMK++I++R+FYGWLA+ RH+ T+R HLS L    V+P D    +      GLTK+ W S +  + +    + +L  +Y GG + E+R   WP+LLG +++  ++ E +        RY   +++W   E V+ + E  + P 
Sbjct:  529 LRLLCESMKRQIVSRAFYGWLAHCRHLSTVRTHLSALVHHSVIPPDRPPGAS----AGLTKDVW-SKYQKDKKNYKELELLRQVYYGGIEHEIRKDVWPFLLGHYKFGMSKKEMEQVDAVVAARYQQVLAEWKACEVVVRQREREAHPA 672          
BLAST of Small G protein signaling modulator 1 vs. Ensembl Celegans
Match: tbc-8 (TBC (Tre-2/Bub2/Cdc16) domain family [Source:UniProtKB/TrEMBL;Acc:I2HAA0])

HSP 1 Score: 258.07 bits (658), Expect = 4.186e-73
Identity = 155/422 (36.73%), Postives = 227/422 (53.79%), Query Frame = 3
Query: 2121 IRMLCSSMKKEIMARSFYGWLAYSRHMKTIRNHLSQLVLPVDLGTKSCKEFIKGLTKEKWTSAFNLNNQIEDNMSVLCYIYRGGCD----PELRVQTWPYLLGLFEWNSTENERQATLRKWERRYHVAISDWMVIETVLNEEEDASTPTDDNEERCAVQIERKSETNEKSNFGNSTSNNKNKKEAETKIVITQKILNVLKQNWTRIEKDVARCDRHFGFFGQTKTGEENLNILQRIMCTWVWENLELGYIQGMCDLLAPILVVFNGHEELTFACFSKYMERMISNFPVKDSTKMDLCFSRMRSAVQILDSDLLNHMQSYGDFTHFYFSYRWFLLDFKREFTYKDVFCLWETIWAADNV-ASPYFSLFVGLALLLSYRDVIIDNAMEFTDIIRFFNEMAEQHNVQKVLELARELVEKLQLLLH 3371
            I   C SM+ +IMAR+FYGWL Y RH++TIR HL  LV   D  T  C +    + ++ W  A     + E+    L  +Y  G +     E+R   WPYLLGLFEWN +   R   L ++  +Y   I +W V+E  +   ++ +       +  +   E   +  E  N    T +    +E          ++ + + N  RI+KDV RCDR+  FF    + ++NL  L+R+M T+V  NLE GY QGMCDLLAP+LV F   E LT  CFS  M R    FP +    M  C   +RS +Q++D  +   +          F++RWFLLDFKRE +Y+  + +WE IWAA  +  +  F++F GLA + +Y DV+I N  ++TD+I+FFNEMAE+H+  ++L  AR  V+ LQ L+ 
Sbjct:  286 IGTACQSMRNQIMARAFYGWLTYVRHLRTIRTHLLHLV---DTKTLICDDDCDPVDEKFWKQARAEPTE-ENEKEFLKRVYWRGIEGINTKEVRRMAWPYLLGLFEWNESPESR---LEQFTSQYWQDIEEWRVLEAEVRRRDEEAFRAARARKAASPVREESCDVFEDPN--EPTCSQHYDRE---------NLITLFRANLHRIDKDVERCDRNLMFF----SNKDNLESLRRVMYTYVRRNLEEGYTQGMCDLLAPLLVTFED-EALTLECFSLLMLRQRGKFPQRPG--MSKCLLNLRSLIQVVDPQIYALISDIDYAQALSFAFRWFLLDFKRELSYECTYKVWEVIWAAQRLRITDDFAIFFGLATITNYHDVLITNNFDYTDMIKFFNEMAERHDCSRLLSSARTHVKCLQNLVQ 682          

HSP 2 Score: 110.923 bits (276), Expect = 1.518e-24
Identity = 62/161 (38.51%), Postives = 89/161 (55.28%), Query Frame = 3
Query: 1149 STARQYVESLHQTSSSSLLFGKNNVYCQPREDVNKMPGYLSLHMAVNEML-IKWTPNELMSGGLNDAVFKENSVKVE--WDCALMIWVNKVVYIHCHQQADKGET-LVLVNHDGSQNPPFDFPQGGHLMSFLTCLENGLLPKCRLDPPLWLKKNREKLFQK 1619
            S +R YV SLH +  S+LL+GKNNV C      +   GY+SL    +  L +KW PN+LM      +    N+ +    W   + I +  ++YIH HQ+ +   T L  VN +G Q+ PF  P G H ++FL+ LE GL P  RLDPPLW+   +EK+  +
Sbjct:   56 SVSRDYVFSLHHSCKSTLLYGKNNV-CVAMNGSDFAKGYMSLQKFYDGNLSLKWVPNQLMHASSQPSSGHSNNGEFTNIWKNTINIEMQDIIYIHLHQKDEISPTCLTFVNCEGVQSAPFQLPAGQHSIAFLSSLETGLAPLLRLDPPLWVGTTKEKILPR 215          
BLAST of Small G protein signaling modulator 1 vs. Ensembl Celegans
Match: tbc-8 (TBC (Tre-2/Bub2/Cdc16) domain family [Source:UniProtKB/TrEMBL;Acc:I2HAA0])

HSP 1 Score: 259.225 bits (661), Expect = 7.552e-72
Identity = 155/422 (36.73%), Postives = 227/422 (53.79%), Query Frame = 3
Query: 2121 IRMLCSSMKKEIMARSFYGWLAYSRHMKTIRNHLSQLVLPVDLGTKSCKEFIKGLTKEKWTSAFNLNNQIEDNMSVLCYIYRGGCD----PELRVQTWPYLLGLFEWNSTENERQATLRKWERRYHVAISDWMVIETVLNEEEDASTPTDDNEERCAVQIERKSETNEKSNFGNSTSNNKNKKEAETKIVITQKILNVLKQNWTRIEKDVARCDRHFGFFGQTKTGEENLNILQRIMCTWVWENLELGYIQGMCDLLAPILVVFNGHEELTFACFSKYMERMISNFPVKDSTKMDLCFSRMRSAVQILDSDLLNHMQSYGDFTHFYFSYRWFLLDFKREFTYKDVFCLWETIWAADNV-ASPYFSLFVGLALLLSYRDVIIDNAMEFTDIIRFFNEMAEQHNVQKVLELARELVEKLQLLLH 3371
            I   C SM+ +IMAR+FYGWL Y RH++TIR HL  LV   D  T  C +    + ++ W  A     + E+    L  +Y  G +     E+R   WPYLLGLFEWN +   R   L ++  +Y   I +W V+E  +   ++ +       +  +   E   +  E  N    T +    +E          ++ + + N  RI+KDV RCDR+  FF    + ++NL  L+R+M T+V  NLE GY QGMCDLLAP+LV F   E LT  CFS  M R    FP +    M  C   +RS +Q++D  +   +          F++RWFLLDFKRE +Y+  + +WE IWAA  +  +  F++F GLA + +Y DV+I N  ++TD+I+FFNEMAE+H+  ++L  AR  V+ LQ L+ 
Sbjct:  514 IGTACQSMRNQIMARAFYGWLTYVRHLRTIRTHLLHLV---DTKTLICDDDCDPVDEKFWKQARAEPTE-ENEKEFLKRVYWRGIEGINTKEVRRMAWPYLLGLFEWNESPESR---LEQFTSQYWQDIEEWRVLEAEVRRRDEEAFRAARARKAASPVREESCDVFEDPN--EPTCSQHYDRE---------NLITLFRANLHRIDKDVERCDRNLMFF----SNKDNLESLRRVMYTYVRRNLEEGYTQGMCDLLAPLLVTFED-EALTLECFSLLMLRQRGKFPQRPG--MSKCLLNLRSLIQVVDPQIYALISDIDYAQALSFAFRWFLLDFKRELSYECTYKVWEVIWAAQRLRITDDFAIFFGLATITNYHDVLITNNFDYTDMIKFFNEMAERHDCSRLLSSARTHVKCLQNLVQ 910          

HSP 2 Score: 139.813 bits (351), Expect = 2.767e-33
Identity = 97/305 (31.80%), Postives = 145/305 (47.54%), Query Frame = 3
Query:  723 WIRLALTEKVLDKIIDYLV--KNSNRFYNHGSVIGDPCYGYILVSLLSGPCSLEYSRVKNPELIPDDPDAGELIQRQKIQNQSGSTGIEAGKSPNLSHAMSTSSLFWSSGSNQFLNKPALVNRQRRLTGIDLDEIPNSGNKSPFSTARQYVESLHQTSSSSLLFGKNNVYCQPREDVNKMPGYLSLHMAVNEML-IKWTPNELMSGGLNDAVFKENSVKVE--WDCALMIWVNKVVYIHCHQQADKGET-LVLVNHDGSQNPPFDFPQGGHLMSFLTCLENGLLPKCRLDPPLWLKKNREKLFQK 1619
            WIR AL  K L  II++ +  K+  R+Y++ +++ DP  G ++ +L+  PC + Y R+ N   I  +  A EL++        GST     + P LS     SS+  S   N                                S +R YV SLH +  S+LL+GKNNV C      +   GY+SL    +  L +KW PN+LM      +    N+ +    W   + I +  ++YIH HQ+ +   T L  VN +G Q+ PF  P G H ++FL+ LE GL P  RLDPPLW+   +EK+  +
Sbjct:  178 WIREALYLKSLSTIINHFIDSKSVRRYYDNSALLLDPVKGRLVATLMMAPCMVTYRRMSN--RIEQEATAEELVEGAT----RGSTSTVPSRPP-LSITRQVSSIAASVERNG-------------------------------SVSRDYVFSLHHSCKSTLLYGKNNV-CVAMNGSDFAKGYMSLQKFYDGNLSLKWVPNQLMHASSQPSSGHSNNGEFTNIWKNTINIEMQDIIYIHLHQKDEISPTCLTFVNCEGVQSAPFQLPAGQHSIAFLSSLETGLAPLLRLDPPLWVGTTKEKILPR 443          

HSP 3 Score: 51.9878 bits (123), Expect = 3.221e-6
Identity = 36/95 (37.89%), Postives = 60/95 (63.16%), Query Frame = 3
Query:  201 NGNLTSEIQSEK---CSEKEILIKTIKRQVKLLMEEFVNKKYVHEYSSNVISLCASIEACXXXXXXXXXXXXFKESSSLALLEKIAKQNAAAKSI 476
            NG++ +  +SE       +E+L+  +K ++K +M E   KKY++  S  V SLC +++AC++ GL+RR L LF   SS++LL+ IAK N  A+ +
Sbjct:   63 NGSVCAVEESEPDVPTQHREVLLTKLKIEIKNIMAEHGAKKYLNLNSPYVTSLCIAVDACIMDGLRRRLLTLFNSPSSMSLLQIIAKSNGPAQQV 157          
BLAST of Small G protein signaling modulator 1 vs. Ensembl Celegans
Match: tbc-14 (TBC (Tre-2/Bub2/Cdc16) domain family [Source:UniProtKB/TrEMBL;Acc:A0A168H1X0])

HSP 1 Score: 145.206 bits (365), Expect = 1.077e-35
Identity = 105/363 (28.93%), Postives = 170/363 (46.83%), Query Frame = 3
Query: 2283 LTKEKWTSAFNLNNQIEDNMSV---LCYIYRGGCDPELRVQTWPYLLGLFEWNSTENERQATLRKWERRYHVAISDWMVIETVLNEEEDASTPTDDNEERCAVQIERKSETNEKSNFGNSTSNNKNKKEAETKIVITQKILNVLKQNWTRIEKDVARCDRHFGFFGQTKTGEENLNI--LQRIMCTWVWENLELGYIQGMCDLLAPILVVFNGHEELTFACFSKYMERMISNFPVKDSTKMDLCFSRMRSAVQILDSDLLNHMQSYGDFTHFYFSYRWFLLDFKREFTYKDVFCLWETIWAADNVASPYFSLFVGLALLLSYRDVIIDNAMEFTDIIRFFNEMAEQHNVQKVLELARELVEKL 3356
            ++K+ W S F L+N   D M +      ++RGG + ELR + W  LLG  +W+ ++ + Q    +  ++Y      WM +             T+D E+R    ++RKS                                         +EKDVAR DR   FF     G++N+N+  L  ++ T+V  N +LGY+QGM D  +P+L V     + TF CF   ME    NF   D   + L  +++R  V I++  L N+++S       YF +RW L+ FKREF++ D   LWE +W+      P F L + +A+L S  ++IIDN    T+I++  N+++    V ++L  A  +  +L
Sbjct:  290 VSKDLWNS-FKLSNGSYDPMKLHHLKMNVFRGGLNAELRKEAWKCLLGYRQWHESDTDFQTRRAELAKQYENMKKQWMSV-------------TEDQEKRFTKFVKRKS----------------------------------------LVEKDVARTDRTVPFF----QGDDNVNLVHLHNVLMTYVMYNFDLGYVQGMSDFASPLLFVMKDEVD-TFWCFVGLMELTQKNFET-DQAFIKLQMNQLRDLVMIINPKLANYLESEKS-DDMYFCFRWVLVWFKREFSFLDTCKLWEVLWSGQ--PCPRFLLLICVAILDSQTNIIIDNQFGLTEILKHINDLSMHLKVDEILTAAEAIFHQL 589          
BLAST of Small G protein signaling modulator 1 vs. Ensembl Celegans
Match: tbc-14 (TBC (Tre-2/Bub2/Cdc16) domain family [Source:UniProtKB/TrEMBL;Acc:A0A168H1X0])

HSP 1 Score: 145.206 bits (365), Expect = 1.256e-35
Identity = 105/363 (28.93%), Postives = 170/363 (46.83%), Query Frame = 3
Query: 2283 LTKEKWTSAFNLNNQIEDNMSV---LCYIYRGGCDPELRVQTWPYLLGLFEWNSTENERQATLRKWERRYHVAISDWMVIETVLNEEEDASTPTDDNEERCAVQIERKSETNEKSNFGNSTSNNKNKKEAETKIVITQKILNVLKQNWTRIEKDVARCDRHFGFFGQTKTGEENLNI--LQRIMCTWVWENLELGYIQGMCDLLAPILVVFNGHEELTFACFSKYMERMISNFPVKDSTKMDLCFSRMRSAVQILDSDLLNHMQSYGDFTHFYFSYRWFLLDFKREFTYKDVFCLWETIWAADNVASPYFSLFVGLALLLSYRDVIIDNAMEFTDIIRFFNEMAEQHNVQKVLELARELVEKL 3356
            ++K+ W S F L+N   D M +      ++RGG + ELR + W  LLG  +W+ ++ + Q    +  ++Y      WM +             T+D E+R    ++RKS                                         +EKDVAR DR   FF     G++N+N+  L  ++ T+V  N +LGY+QGM D  +P+L V     + TF CF   ME    NF   D   + L  +++R  V I++  L N+++S       YF +RW L+ FKREF++ D   LWE +W+      P F L + +A+L S  ++IIDN    T+I++  N+++    V ++L  A  +  +L
Sbjct:  292 VSKDLWNS-FKLSNGSYDPMKLHHLKMNVFRGGLNAELRKEAWKCLLGYRQWHESDTDFQTRRAELAKQYENMKKQWMSV-------------TEDQEKRFTKFVKRKS----------------------------------------LVEKDVARTDRTVPFF----QGDDNVNLVHLHNVLMTYVMYNFDLGYVQGMSDFASPLLFVMKDEVD-TFWCFVGLMELTQKNFET-DQAFIKLQMNQLRDLVMIINPKLANYLESEKS-DDMYFCFRWVLVWFKREFSFLDTCKLWEVLWSGQ--PCPRFLLLICVAILDSQTNIIIDNQFGLTEILKHINDLSMHLKVDEILTAAEAIFHQL 591          
BLAST of Small G protein signaling modulator 1 vs. Ensembl Celegans
Match: tbc-16 (TBC (Tre-2/Bub2/Cdc16) domain family [Source:UniProtKB/TrEMBL;Acc:Q20600])

HSP 1 Score: 100.908 bits (250), Expect = 1.919e-21
Identity = 68/219 (31.05%), Postives = 109/219 (49.77%), Query Frame = 3
Query: 2715 WTRIE----KDVARCDRHFGFFGQTKTGEENLN--ILQRIMCTWVWENLELGYIQGMCDLLAPILVVFNGHEELTFACFSKYMERMI-SNFPVKDSTKMDLCFSRMRSAVQILDSDLLNHMQSY-GDFTHFYFSYRWFLLDFKREFTYKDVFCLWETIWAADNVASPYFSLFVGLALLLSYRDVIIDNAMEFTDIIRFFNEMAEQHNVQKVLELARELV 3347
            W  IE    KDV R DR   FF     G+ N N  I++ I+  +     ++ YIQGM DLLAP+L      E  ++ CF  +M++ + S+ P  +   M+   + +R+ +++   D   H++    D     F +RW LL FKREF       +WE  WA  +  + YF LFV +A++  Y   ++   +   +I+ FF  +A   +   VL+ AR L+
Sbjct:  466 WISIENSIVKDVVRTDRKNPFFA----GDNNPNSEIMKNILLNYAVMYPDINYIQGMSDLLAPLLSTLKD-EVDSYFCFKNFMQQTVFSSTPQGNENLMETNLTYLRNMLRMFVPDFYEHLEKQRPDAMQLMFVHRWILLCFKREFPENYALHIWECCWA--HYRTNYFHLFVCVAIVSIYGKDVLTQDLPHDEILLFFASLANHMDATLVLQKARGLL 677          
BLAST of Small G protein signaling modulator 1 vs. Ensembl Fly
Match: CG32506 (gene:FBgn0052506 transcript:FBtr0307539)

HSP 1 Score: 262.692 bits (670), Expect = 6.798e-72
Identity = 128/231 (55.41%), Postives = 174/231 (75.32%), Query Frame = 3
Query: 2676 VITQKILNVLKQNWTRIEKDVARCDRHFGFFGQTKTGEENLNILQRIMCTWVWENLELGYIQGMCDLLAPILVVFNGHEELTFACFSKYMERMISNFPVKDSTKMDLCFSRMRSAVQILDSDLLNHMQSYGDFTHFYFSYRWFLLDFKREFTYKDVFCLWETIWAADNVASPYFSLFVGLALLLSYRDVIIDNAMEFTDIIRFFNEMAEQHNVQKVLELARELVEKLQLLL 3368
            V + ++L     N  RIEKDV RCDR++ +F       ENL+ L+ ++ T+VWE+L++GY+QGMCDL+AP+LV+F+  E L+++CF K MERMI NFP      MD+ F+ MRS +QILDS++ + M S GD+THFYF YRWFLLDFKRE  Y DVF  WE IWAA ++AS +F LF+ LALL +YRD+I+ N+M+FTD+I+FFNEMAE+HN Q VL+LAR LV +LQ+++
Sbjct:  930 VYSSELLEQFGLNLHRIEKDVQRCDRNYWYFAN-----ENLDKLRNVISTYVWEHLDVGYMQGMCDLVAPLLVIFDD-ESLSYSCFCKLMERMIENFP--SGGAMDMHFANMRSLIQILDSEMYDLMDSNGDYTHFYFCYRWFLLDFKRELVYDDVFATWEVIWAAKHIASGHFVLFLALALLETYRDIILSNSMDFTDVIKFFNEMAERHNAQSVLQLARSLVLQLQMII 1152          

HSP 2 Score: 236.884 bits (603), Expect = 1.679e-63
Identity = 130/305 (42.62%), Postives = 177/305 (58.03%), Query Frame = 3
Query:  711 IKHYWIRLALTEKVLDKIIDYLVKNSNRFYNHGSVIGDPCYGYILVSLLSGPCSLEYSRVKNPELIPDDPDAGELIQRQKIQNQSGSTGIEAGKSPNLSHAMSTSSLFWSSGSNQFLNKPALVNRQRRLTGIDLDEIPNSGNKS--PFSTARQYVESLHQTSSSSLLFGKNNVYCQPREDVNKMPGYLSLHMAVNEMLIKWTPNELMSGGLNDAVFKENSVKVEWDCALMIWVNKVVYIHCHQQ--ADKGETLVLVNHDGSQNPPFDFPQGGHLMSFLTCLENGLLPKCRLDPPLWLKKNREKLF 1613
            +K+ WIRLAL EK L KII+YLV N++ FY+  S++ D  YG IL SLL GPC+LE++R K  +    DP A EL+QR +I +   S+                             ++PA++N +R L     DE      KS    S A+ YVESLHQ + ++LL+GKNNV   P++    MPGYLSLH  +  + IKWTPN+LM+G       ++      W  AL I V+++VY+HCHQ    D G T++LV  DG Q PP  FP+GGH+  FL+CLE GLLP  +LDPPLW ++   K+F
Sbjct:  156 MKYLWIRLALYEKRLTKIIEYLVSNASSFYDRDSLVADSDYGSILSSLLVGPCALEFTRAKTADHYWTDPHADELVQRHRISSCRRSS--------------------------STCSRPAIINFKRSLN-TSSDEAGTGSFKSIASASVAKDYVESLHQNAKATLLYGKNNVQVLPKDVAEPMPGYLSLHQHIQTLTIKWTPNQLMNGYTEAEEAEDIDKDAFWAYALNINVDEIVYVHCHQSRGEDSGGTVILVGQDGVQRPPIHFPEGGHMQQFLSCLETGLLPHGQLDPPLWSQRGIGKMF 433          

HSP 3 Score: 118.627 bits (296), Expect = 1.519e-26
Identity = 56/145 (38.62%), Postives = 87/145 (60.00%), Query Frame = 3
Query: 2115 SSIRMLCSSMKKEIMARSFYGWLAYSRHMKTIRNHLSQLVLPVDLGTKSCKEFIKGLTKEKWTSAFNLNNQIEDNMSVLCYIYRGGCDPELRVQTWPYLLGLFEWNSTENERQATLRKWERRYHVAISDWMVIETVLNEEEDAST 2549
            +SI M+CS+M+++I++R+FYGWLAY RH+ T+R HLS LV      T   K   +GLTKE+W    N+N  +E+       +Y GG  PELR + WPYLLG + + ST  +R+      +  Y   +S+W+ ++ ++ + E   T
Sbjct:  535 TSIEMVCSTMRRQIISRAFYGWLAYCRHLSTVRTHLSGLVH--GRITPEMKADEEGLTKERW-QLLNVNGVLENATEFYRLVYFGGVQPELRQEVWPYLLGHYAFGSTTEDRKKQDETCKHYYETTMSEWLAVDAIVQQREKEKT 676          

HSP 4 Score: 76.2554 bits (186), Expect = 1.723e-13
Identity = 50/83 (60.24%), Postives = 62/83 (74.70%), Query Frame = 3
Query:  246 KEILIKTIKRQVKLLMEEFVNKKYVHEYSSNVISLCASIEACXXXXXXXXXXXXFKESSSLALLEKIAKQNAAAKSICTLMSD 494
            KE LI ++K++VK LMEE V KKYVHE SS+V SLC ++EACL  GL+RRALGLFK SS+ ALL KIAK    A+ I  L+ +
Sbjct:   12 KERLIASVKKEVKQLMEEAVTKKYVHEESSSVTSLCGAVEACLSQGLRRRALGLFKTSSTTALLHKIAKSCPEAEHISKLVQE 94          
BLAST of Small G protein signaling modulator 1 vs. Ensembl Fly
Match: CG32506 (gene:FBgn0052506 transcript:FBtr0340401)

HSP 1 Score: 262.692 bits (670), Expect = 6.798e-72
Identity = 128/231 (55.41%), Postives = 174/231 (75.32%), Query Frame = 3
Query: 2676 VITQKILNVLKQNWTRIEKDVARCDRHFGFFGQTKTGEENLNILQRIMCTWVWENLELGYIQGMCDLLAPILVVFNGHEELTFACFSKYMERMISNFPVKDSTKMDLCFSRMRSAVQILDSDLLNHMQSYGDFTHFYFSYRWFLLDFKREFTYKDVFCLWETIWAADNVASPYFSLFVGLALLLSYRDVIIDNAMEFTDIIRFFNEMAEQHNVQKVLELARELVEKLQLLL 3368
            V + ++L     N  RIEKDV RCDR++ +F       ENL+ L+ ++ T+VWE+L++GY+QGMCDL+AP+LV+F+  E L+++CF K MERMI NFP      MD+ F+ MRS +QILDS++ + M S GD+THFYF YRWFLLDFKRE  Y DVF  WE IWAA ++AS +F LF+ LALL +YRD+I+ N+M+FTD+I+FFNEMAE+HN Q VL+LAR LV +LQ+++
Sbjct:  930 VYSSELLEQFGLNLHRIEKDVQRCDRNYWYFAN-----ENLDKLRNVISTYVWEHLDVGYMQGMCDLVAPLLVIFDD-ESLSYSCFCKLMERMIENFP--SGGAMDMHFANMRSLIQILDSEMYDLMDSNGDYTHFYFCYRWFLLDFKRELVYDDVFATWEVIWAAKHIASGHFVLFLALALLETYRDIILSNSMDFTDVIKFFNEMAERHNAQSVLQLARSLVLQLQMII 1152          

HSP 2 Score: 236.884 bits (603), Expect = 1.679e-63
Identity = 130/305 (42.62%), Postives = 177/305 (58.03%), Query Frame = 3
Query:  711 IKHYWIRLALTEKVLDKIIDYLVKNSNRFYNHGSVIGDPCYGYILVSLLSGPCSLEYSRVKNPELIPDDPDAGELIQRQKIQNQSGSTGIEAGKSPNLSHAMSTSSLFWSSGSNQFLNKPALVNRQRRLTGIDLDEIPNSGNKS--PFSTARQYVESLHQTSSSSLLFGKNNVYCQPREDVNKMPGYLSLHMAVNEMLIKWTPNELMSGGLNDAVFKENSVKVEWDCALMIWVNKVVYIHCHQQ--ADKGETLVLVNHDGSQNPPFDFPQGGHLMSFLTCLENGLLPKCRLDPPLWLKKNREKLF 1613
            +K+ WIRLAL EK L KII+YLV N++ FY+  S++ D  YG IL SLL GPC+LE++R K  +    DP A EL+QR +I +   S+                             ++PA++N +R L     DE      KS    S A+ YVESLHQ + ++LL+GKNNV   P++    MPGYLSLH  +  + IKWTPN+LM+G       ++      W  AL I V+++VY+HCHQ    D G T++LV  DG Q PP  FP+GGH+  FL+CLE GLLP  +LDPPLW ++   K+F
Sbjct:  156 MKYLWIRLALYEKRLTKIIEYLVSNASSFYDRDSLVADSDYGSILSSLLVGPCALEFTRAKTADHYWTDPHADELVQRHRISSCRRSS--------------------------STCSRPAIINFKRSLN-TSSDEAGTGSFKSIASASVAKDYVESLHQNAKATLLYGKNNVQVLPKDVAEPMPGYLSLHQHIQTLTIKWTPNQLMNGYTEAEEAEDIDKDAFWAYALNINVDEIVYVHCHQSRGEDSGGTVILVGQDGVQRPPIHFPEGGHMQQFLSCLETGLLPHGQLDPPLWSQRGIGKMF 433          

HSP 3 Score: 118.627 bits (296), Expect = 1.519e-26
Identity = 56/145 (38.62%), Postives = 87/145 (60.00%), Query Frame = 3
Query: 2115 SSIRMLCSSMKKEIMARSFYGWLAYSRHMKTIRNHLSQLVLPVDLGTKSCKEFIKGLTKEKWTSAFNLNNQIEDNMSVLCYIYRGGCDPELRVQTWPYLLGLFEWNSTENERQATLRKWERRYHVAISDWMVIETVLNEEEDAST 2549
            +SI M+CS+M+++I++R+FYGWLAY RH+ T+R HLS LV      T   K   +GLTKE+W    N+N  +E+       +Y GG  PELR + WPYLLG + + ST  +R+      +  Y   +S+W+ ++ ++ + E   T
Sbjct:  535 TSIEMVCSTMRRQIISRAFYGWLAYCRHLSTVRTHLSGLVH--GRITPEMKADEEGLTKERW-QLLNVNGVLENATEFYRLVYFGGVQPELRQEVWPYLLGHYAFGSTTEDRKKQDETCKHYYETTMSEWLAVDAIVQQREKEKT 676          

HSP 4 Score: 76.2554 bits (186), Expect = 1.723e-13
Identity = 50/83 (60.24%), Postives = 62/83 (74.70%), Query Frame = 3
Query:  246 KEILIKTIKRQVKLLMEEFVNKKYVHEYSSNVISLCASIEACXXXXXXXXXXXXFKESSSLALLEKIAKQNAAAKSICTLMSD 494
            KE LI ++K++VK LMEE V KKYVHE SS+V SLC ++EACL  GL+RRALGLFK SS+ ALL KIAK    A+ I  L+ +
Sbjct:   12 KERLIASVKKEVKQLMEEAVTKKYVHEESSSVTSLCGAVEACLSQGLRRRALGLFKTSSTTALLHKIAKSCPEAEHISKLVQE 94          
BLAST of Small G protein signaling modulator 1 vs. Ensembl Fly
Match: CG1695 (gene:FBgn0031116 transcript:FBtr0332936)

HSP 1 Score: 258.455 bits (659), Expect = 2.166e-70
Identity = 126/231 (54.55%), Postives = 173/231 (74.89%), Query Frame = 3
Query: 2676 VITQKILNVLKQNWTRIEKDVARCDRHFGFFGQTKTGEENLNILQRIMCTWVWENLELGYIQGMCDLLAPILVVFNGHEELTFACFSKYMERMISNFPVKDSTKMDLCFSRMRSAVQILDSDLLNHMQSYGDFTHFYFSYRWFLLDFKREFTYKDVFCLWETIWAADNVASPYFSLFVGLALLLSYRDVIIDNAMEFTDIIRFFNEMAEQHNVQKVLELARELVEKLQLLL 3368
            V + ++L     N  RIEKDV RCDR++ +F       ENL+ L+ ++ T+VWE+L++GY+QGMCDL+AP+LV+F+  E L+++CF K MERMI NFP      MD+ F+ MRS +QILDS++ + M S GD+THFYF YRWFLLDFKRE  Y DVF  WE IWAA ++AS +F LF+ LALL +YRD+I+ N+M+FTD+I+FFNEMAE+HN Q +L+L+R LV +LQ ++
Sbjct:  967 VYSVELLEQFGLNLHRIEKDVQRCDRNYWYFAN-----ENLDKLRNVISTYVWEHLDVGYMQGMCDLVAPLLVIFDD-ESLSYSCFCKLMERMIENFP--SGGAMDMHFANMRSLIQILDSEMYDLMDSNGDYTHFYFCYRWFLLDFKRELVYDDVFATWEVIWAAKHIASGHFVLFLALALLETYRDIILSNSMDFTDVIKFFNEMAERHNAQSILQLSRSLVLQLQTII 1189          

HSP 2 Score: 253.062 bits (645), Expect = 1.218e-68
Identity = 135/302 (44.70%), Postives = 180/302 (59.60%), Query Frame = 3
Query:  714 KHYWIRLALTEKVLDKIIDYLVKNSNRFYNHGSVIGDPCYGYILVSLLSGPCSLEYSRVKNPELIPDDPDAGELIQRQKIQNQSGSTGIEAGKSPNLSHAMSTSSLFWSSGSNQFLNKPALVNRQRRLTGIDLDEIPNSGNKSPFSTARQYVESLHQTSSSSLLFGKNNVYCQPREDVNKMPGYLSLHMAVNEMLIKWTPNELMSGGLNDAVFKENSVKVEWDCALMIWVNKVVYIHCHQQ--ADKGETLVLVNHDGSQNPPFDFPQGGHLMSFLTCLENGLLPKCRLDPPLWLKKNREKLF 1613
            K+ WIRLAL EK L KII++LV N+N +Y+  +++ DP YG IL SLL GPC+LE++R K  +    DP A EL+QR +I + + +         N   ++ TSS   SSGS +                            SP S A+ YVESLHQ S ++LL+GKNNV   P++    MPGYLSLH ++  + IKWTPN+LM+ G ND    + S    W  AL I V+++VY+HCHQ    D G T++LV  DG Q PP  FP+GGHL +FL+CLE GLLP  +LDPPLW ++   KLF
Sbjct:  176 KYLWIRLALHEKRLAKIIEHLVSNANSYYDREALVADPDYGSILSSLLVGPCALEFTRAKTADHYWSDPCADELVQRHRISSGNRTPPTTHRPIINFKRSLHTSSEDTSSGSFKAC--------------------------SPASVAKDYVESLHQNSRTTLLYGKNNVLVLPKDVSEPMPGYLSLHQSIQSLTIKWTPNQLMN-GYNDGDGGDKSFY--WSYALNINVDEIVYVHCHQNRGGDTGGTIILVGQDGVQRPPIHFPEGGHLQAFLSCLETGLLPHGQLDPPLWSQRGIGKLF 448          

HSP 3 Score: 118.242 bits (295), Expect = 1.960e-26
Identity = 59/183 (32.24%), Postives = 107/183 (58.47%), Query Frame = 3
Query: 2115 SSIRMLCSSMKKEIMARSFYGWLAYSRHMKTIRNHLSQLVLPVDLGTKSCKEFIKGLTKEKWTSAFNLNNQIEDNMSVLCYIYRGGCDPELRVQTWPYLLGLFEWNSTENERQATLRKWERRYHVAISDWMVIETVLNEEEDASTPTDDNEERCAVQIERKSETNEKSNFGNSTSNNKNKKEA 2663
            +SI ++CS+M+++I++R+FYGWLAY RH+ T+R HLS LV    +   +  E  +GLT+ KW  A + +  +  ++ +   +Y GG +PELR + WPYLLG +++ ST  ER+      +  Y   +S+W+ +E ++ + E         +E+ A+ + + S    +     ++S+N ++K A
Sbjct:  543 TSIELVCSTMRRQIISRAFYGWLAYCRHLSTVRTHLSGLVNGRIMPDLAADE--EGLTRGKWL-AMHEDGVVTGDLELYRLVYFGGVEPELRKEVWPYLLGHYDFGSTPEERKKQDETCKHYYETTMSEWLAVEAIVRQRE---------KEKTALAVAKLSAEQARLAANATSSSNPHQKLA 713          

HSP 4 Score: 72.7886 bits (177), Expect = 1.764e-12
Identity = 46/69 (66.67%), Postives = 57/69 (82.61%), Query Frame = 3
Query:  246 KEILIKTIKRQVKLLMEEFVNKKYVHEYSSNVISLCASIEACXXXXXXXXXXXXFKESSSLALLEKIAK 452
            KE LI ++K++VK LMEE V KKYVHE SS+V SLC ++EACL  GL+RRALGLFK SS+ AL++KIAK
Sbjct:   30 KERLIASVKKEVKQLMEEAVTKKYVHEESSSVTSLCGAVEACLSHGLRRRALGLFKTSSTTALIQKIAK 98          
BLAST of Small G protein signaling modulator 1 vs. Ensembl Fly
Match: Tbc1d15-17 (gene:FBgn0031233 transcript:FBtr0078125)

HSP 1 Score: 158.688 bits (400), Expect = 1.229e-39
Identity = 109/361 (30.19%), Postives = 175/361 (48.48%), Query Frame = 3
Query: 2283 LTKEKWTSAFNLNNQIEDNMSVLCYIYRGGCDPELRVQTWPYLLGLFEWNSTENERQATLRKWERRYHVAISDWMVIETVLNEEEDASTPTDDNEERCAVQIERKSETNEKSNFGNSTSNNKNKKEAETKIVITQKILNVLKQNWTRIEKDVARCDRHFGFFGQTKTGEENLNI--LQRIMCTWVWENLELGYIQGMCDLLAPILVVFNGHEELTFACFSKYMERMISNFPVKDSTKMDLCFSRMRSAVQILDSDLLNHMQSYGDFTHFYFSYRWFLLDFKREFTYKDVFCLWETIWAADNVASPYFSLFVGLALLLSYRDVIIDNAMEFTDIIRFFNEMAEQHNVQKVLELARELVEKLQ 3359
            LT+ +W      + +I D+  +   I+RGG    LR + W +LL  + W+ T  ER    ++    Y+   + W+ +                              T +++NF                           ++   +IEKDV R DR   FF     GE+N N+  LQ I+ T+V  N +LGY+QGM DLLAPIL +   +E  TF CF  +ME + +NF + D   M   F+++R  ++  ++ L N+M+S+ D  + YF +RW L+ +KRE   +DV  LWE +W    +  P F L   +A+L     VIID+  EFT+I++  NE++   +VQK L++A  +  +L+
Sbjct:  343 LTETQWLEFQTPDGRISDSARIKELIFRGGVVQSLRPEVWKFLLNYYLWSDTHVERIERRKQKSIEYYNMKAQWLAMT-----------------------------TTQEANFCG------------------------YRERKCQIEKDVKRTDRSLQFFA----GEDNPNLTLLQGILMTYVMYNFDLGYVQGMSDLLAPILEI-QVNEVDTFWCFVGFMELVFTNFDI-DQAGMKTQFAQIRRLIEFANAPLFNYMRSH-DSDNMYFCFRWLLVWYKRELNSEDVLKLWECLWT--RLPCPNFHLLFSVAILDQETRVIIDSQYEFTEILKHVNELSGNIDVQKTLQVAEGIYLQLK 641          
BLAST of Small G protein signaling modulator 1 vs. Ensembl Fly
Match: Tbc1d15-17 (gene:FBgn0031233 transcript:FBtr0332339)

HSP 1 Score: 158.688 bits (400), Expect = 1.229e-39
Identity = 109/361 (30.19%), Postives = 175/361 (48.48%), Query Frame = 3
Query: 2283 LTKEKWTSAFNLNNQIEDNMSVLCYIYRGGCDPELRVQTWPYLLGLFEWNSTENERQATLRKWERRYHVAISDWMVIETVLNEEEDASTPTDDNEERCAVQIERKSETNEKSNFGNSTSNNKNKKEAETKIVITQKILNVLKQNWTRIEKDVARCDRHFGFFGQTKTGEENLNI--LQRIMCTWVWENLELGYIQGMCDLLAPILVVFNGHEELTFACFSKYMERMISNFPVKDSTKMDLCFSRMRSAVQILDSDLLNHMQSYGDFTHFYFSYRWFLLDFKREFTYKDVFCLWETIWAADNVASPYFSLFVGLALLLSYRDVIIDNAMEFTDIIRFFNEMAEQHNVQKVLELARELVEKLQ 3359
            LT+ +W      + +I D+  +   I+RGG    LR + W +LL  + W+ T  ER    ++    Y+   + W+ +                              T +++NF                           ++   +IEKDV R DR   FF     GE+N N+  LQ I+ T+V  N +LGY+QGM DLLAPIL +   +E  TF CF  +ME + +NF + D   M   F+++R  ++  ++ L N+M+S+ D  + YF +RW L+ +KRE   +DV  LWE +W    +  P F L   +A+L     VIID+  EFT+I++  NE++   +VQK L++A  +  +L+
Sbjct:  343 LTETQWLEFQTPDGRISDSARIKELIFRGGVVQSLRPEVWKFLLNYYLWSDTHVERIERRKQKSIEYYNMKAQWLAMT-----------------------------TTQEANFCG------------------------YRERKCQIEKDVKRTDRSLQFFA----GEDNPNLTLLQGILMTYVMYNFDLGYVQGMSDLLAPILEI-QVNEVDTFWCFVGFMELVFTNFDI-DQAGMKTQFAQIRRLIEFANAPLFNYMRSH-DSDNMYFCFRWLLVWYKRELNSEDVLKLWECLWT--RLPCPNFHLLFSVAILDQETRVIIDSQYEFTEILKHVNELSGNIDVQKTLQVAEGIYLQLK 641          
BLAST of Small G protein signaling modulator 1 vs. Ensembl Zebrafish
Match: sgsm1a (small G protein signaling modulator 1a [Source:ZFIN;Acc:ZDB-GENE-060526-379])

HSP 1 Score: 302.753 bits (774), Expect = 3.233e-91
Identity = 181/443 (40.86%), Postives = 248/443 (55.98%), Query Frame = 3
Query:  291 MEEFVNKKYVHEYSSNVISLCASIEACXXXXXXXXXXXXFKESSSLALLEKIAKQNAAAKSICTLMSDEKLHYCDXXXXXXXXXXXXXXXXXXXXXXXXXXTFGYSWSASSFLGFSNNKFFSSINQSSDNEFINLHWKNLIKHYWIRLALTEKVLDKIIDYLVKNSNRFYNHGSVIGDPCYGYILVSLLSGPCSLEYSRVKNPELIPDDPDAGELIQRQKIQNQSGSTGIEAGKSPNLSHAMSTSSLFWSSGSNQFLNKPALVNRQRRLTGIDLDEIPNSGNKSPFSTARQYVESLHQTSSSSLLFGKNNVYCQPREDVNKMPGYLSLHMAVNEMLIKWTPNELMSGGLNDAVFKENSVKVEWDCALMIWVNKVVYIHCHQQADKGETLVLVNHDGSQNPPFDFPQGGHLMSFLTCLENGLLPKCRLDPPLWLKKNREKLFQK 1619
            MEE V +K+VHE SS+++S CA++EAC+L GLKRRA G  + +   AL  K+AK    A+ +C    + +L                               F    S S     S  K    +N S             ++H WI  AL EKVLDKI+ YLV+NS++FY   +++ DP  G IL SLL GPC+LEY+++K  +    DP A EL+QR +I      +G     SP                      +PAL   Q+R +   +DE P     SP  +AR YVESLHQ S ++LLFGKNNV  QPR+D+  +PGYLSLH   + M +KWTPN+LM+G + D  ++++   V WD A+ I + ++VY+HCHQQ D G T+VLV+ DG Q PP  FP+GGHL+ FL+CLENGLLP  +LDPPLW ++ + K+F K
Sbjct:    1 MEEAVTRKFVHEDSSHIVSFCAAVEACVLHGLKRRAAGFLRSNKIAALFTKVAKNFPPAEELCRKAQELEL------------------------------VFENRRSQSLSYSESTRKMPKVLNFSP----------QAVRHVWIHAALIEKVLDKIVLYLVENSSKFYEKEAILMDPVDGPILASLLVGPCALEYTKMKTADHFWTDPSADELVQRHRIH-----SGHCRQDSPT--------------------KRPALCI-QKRHSSSSMDERP-----SPSPSARDYVESLHQNSRATLLFGKNNVLVQPRDDMEAVPGYLSLHQTADYMTLKWTPNQLMNGSVGDLDYEKS---VYWDYAMTIRLEEIVYLHCHQQVDCGGTVVLVSQDGIQRPPLRFPRGGHLLQFLSCLENGLLPHGQLDPPLWSQRGKGKVFPK 369          
BLAST of Small G protein signaling modulator 1 vs. Ensembl Zebrafish
Match: sgsm1a (small G protein signaling modulator 1a [Source:ZFIN;Acc:ZDB-GENE-060526-379])

HSP 1 Score: 309.686 bits (792), Expect = 1.558e-88
Identity = 184/448 (41.07%), Postives = 252/448 (56.25%), Query Frame = 3
Query:  276 QVKLLMEEFVNKKYVHEYSSNVISLCASIEACXXXXXXXXXXXXFKESSSLALLEKIAKQNAAAKSICTLMSDEKLHYCDXXXXXXXXXXXXXXXXXXXXXXXXXXTFGYSWSASSFLGFSNNKFFSSINQSSDNEFINLHWKNLIKHYWIRLALTEKVLDKIIDYLVKNSNRFYNHGSVIGDPCYGYILVSLLSGPCSLEYSRVKNPELIPDDPDAGELIQRQKIQNQSGSTGIEAGKSPNLSHAMSTSSLFWSSGSNQFLNKPALVNRQRRLTGIDLDEIPNSGNKSPFSTARQYVESLHQTSSSSLLFGKNNVYCQPREDVNKMPGYLSLHMAVNEMLIKWTPNELMSGGLNDAVFKENSVKVEWDCALMIWVNKVVYIHCHQQADKGETLVLVNHDGSQNPPFDFPQGGHLMSFLTCLENGLLPKCRLDPPLWLKKNREKLFQK 1619
            QVK +MEE V +K+VHE SS+++S CA++EAC+L GLKRRA G  + +   AL  K+AK    A+ +C    + +L                               F    S S     S  K    +N S             ++H WI  AL EKVLDKI+ YLV+NS++FY   +++ DP  G IL SLL GPC+LEY+++K  +    DP A EL+QR +I      +G     SP                      +PAL   Q+R +   +DE P     SP  +AR YVESLHQ S ++LLFGKNNV  QPR+D+  +PGYLSLH   + M +KWTPN+LM+G + D  ++++   V WD A+ I + ++VY+HCHQQ D G T+VLV+ DG Q PP  FP+GGHL+ FL+CLENGLLP  +LDPPLW ++ + K+F K
Sbjct:   28 QVKQIMEEAVTRKFVHEDSSHIVSFCAAVEACVLHGLKRRAAGFLRSNKIAALFTKVAKNFPPAEELCRKAQELEL------------------------------VFENRRSQSLSYSESTRKMPKVLNFSP----------QAVRHVWIHAALIEKVLDKIVLYLVENSSKFYEKEAILMDPVDGPILASLLVGPCALEYTKMKTADHFWTDPSADELVQRHRIH-----SGHCRQDSPT--------------------KRPALCI-QKRHSSSSMDERP-----SPSPSARDYVESLHQNSRATLLFGKNNVLVQPRDDMEAVPGYLSLHQTADYMTLKWTPNQLMNGSVGDLDYEKS---VYWDYAMTIRLEEIVYLHCHQQVDCGGTVVLVSQDGIQRPPLRFPRGGHLLQFLSCLENGLLPHGQLDPPLWSQRGKGKVFPK 401          

HSP 2 Score: 269.24 bits (687), Expect = 1.525e-74
Identity = 127/252 (50.40%), Postives = 179/252 (71.03%), Query Frame = 3
Query: 2628 NSTSNNKNKKEAETKI-----VITQKILNVLKQNWTRIEKDVARCDRHFGFFGQTKTGEENLNILQRIMCTWVWENLELGYIQGMCDLLAPILVVFNGHEELTFACFSKYMERMISNFPVKDSTKMDLCFSRMRSAVQILDSDLLNHMQSYGDFTHFYFSYRWFLLDFKREFTYKDVFCLWETIWAADNVASPYFSLFVGLALLLSYRDVIIDNAMEFTDIIRFFNEMAEQHNVQKVLELARELVEKLQLLL 3368
            +S + N  K EA + +       +Q++L++   N  RI+KDV RCDR++ +F        NL  L+ IMC++VW++LE+GY+QGMCDLLAP+LV+ +  E + F+CF++ M+RM  NFP      MD  F+ MRS +QILD++L   M   GD+THFYF YRWFLLDFKRE  Y DVF +WETIWAA  V+S +F LF+ L+L+  YRD+I++N M+FTDII+FFNEMAE HN++++L L+R+LV K+Q L+
Sbjct:  761 DSLAVNTEKIEASSPVSSIGTTYSQELLDMYTLNLHRIDKDVQRCDRNYWYFTPA-----NLEKLRNIMCSYVWQHLEIGYVQGMCDLLAPLLVILDD-EAMAFSCFTELMKRMNQNFP--HGGAMDTHFANMRSLIQILDAELFELMHQNGDYTHFYFCYRWFLLDFKRELVYDDVFAVWETIWAAKCVSSSHFVLFIALSLVEIYRDIILENNMDFTDIIKFFNEMAEHHNIKQILTLSRDLVCKVQTLI 1004          

HSP 3 Score: 97.0561 bits (240), Expect = 8.992e-20
Identity = 58/193 (30.05%), Postives = 100/193 (51.81%), Query Frame = 3
Query: 2091 EKSKTYGKSSIRMLCSSMKKEIMARSFYGWLAYSRHMKTIRNHLSQLVLPVDLGTKSCKEFIKGLTKEKWTSAFNLNNQIEDNMSVLCYIYRGGCDPELRVQTWPYLLGLFEWNSTENERQ------ATLRKWERRYHV-AISDWMVIETVLNEEEDASTPTDD-NEERCAVQIERKSETNEKSNFGNSTSNN 2645
            +K   + ++ +++LC +MK +I++R+FYGWLAY RH+ T+R HLS LV    +      +   GLT E W       +  E+   +L  +Y GG +P LR + WP+LLG +++  +E ER+      ++ R+ + R    + S   V E+V   E+  S P +D  ++ C +            + G+ +S N
Sbjct:  445 KKKHLFCRTPLKLLCDNMKNQIISRAFYGWLAYCRHLSTVRTHLSGLVNHTIVEPDVPSDAYSGLTTEVWQKFLQDCSTYEEK-ELLRLVYFGGVEPSLRKEVWPFLLGHYQFGMSETERKESSQSCSSDRQRDSRLQSDSSSGTQVFESVEEVEQIESEPKNDVGKQVCKISNGTPQNGTSSPDSGHPSSRN 636          
BLAST of Small G protein signaling modulator 1 vs. Ensembl Zebrafish
Match: sgsm1a (small G protein signaling modulator 1a [Source:ZFIN;Acc:ZDB-GENE-060526-379])

HSP 1 Score: 309.686 bits (792), Expect = 2.853e-88
Identity = 184/448 (41.07%), Postives = 252/448 (56.25%), Query Frame = 3
Query:  276 QVKLLMEEFVNKKYVHEYSSNVISLCASIEACXXXXXXXXXXXXFKESSSLALLEKIAKQNAAAKSICTLMSDEKLHYCDXXXXXXXXXXXXXXXXXXXXXXXXXXTFGYSWSASSFLGFSNNKFFSSINQSSDNEFINLHWKNLIKHYWIRLALTEKVLDKIIDYLVKNSNRFYNHGSVIGDPCYGYILVSLLSGPCSLEYSRVKNPELIPDDPDAGELIQRQKIQNQSGSTGIEAGKSPNLSHAMSTSSLFWSSGSNQFLNKPALVNRQRRLTGIDLDEIPNSGNKSPFSTARQYVESLHQTSSSSLLFGKNNVYCQPREDVNKMPGYLSLHMAVNEMLIKWTPNELMSGGLNDAVFKENSVKVEWDCALMIWVNKVVYIHCHQQADKGETLVLVNHDGSQNPPFDFPQGGHLMSFLTCLENGLLPKCRLDPPLWLKKNREKLFQK 1619
            QVK +MEE V +K+VHE SS+++S CA++EAC+L GLKRRA G  + +   AL  K+AK    A+ +C    + +L                               F    S S     S  K    +N S             ++H WI  AL EKVLDKI+ YLV+NS++FY   +++ DP  G IL SLL GPC+LEY+++K  +    DP A EL+QR +I      +G     SP                      +PAL   Q+R +   +DE P     SP  +AR YVESLHQ S ++LLFGKNNV  QPR+D+  +PGYLSLH   + M +KWTPN+LM+G + D  ++++   V WD A+ I + ++VY+HCHQQ D G T+VLV+ DG Q PP  FP+GGHL+ FL+CLENGLLP  +LDPPLW ++ + K+F K
Sbjct:   28 QVKQIMEEAVTRKFVHEDSSHIVSFCAAVEACVLHGLKRRAAGFLRSNKIAALFTKVAKNFPPAEELCRKAQELEL------------------------------VFENRRSQSLSYSESTRKMPKVLNFSP----------QAVRHVWIHAALIEKVLDKIVLYLVENSSKFYEKEAILMDPVDGPILASLLVGPCALEYTKMKTADHFWTDPSADELVQRHRIH-----SGHCRQDSPT--------------------KRPALCI-QKRHSSSSMDERP-----SPSPSARDYVESLHQNSRATLLFGKNNVLVQPRDDMEAVPGYLSLHQTADYMTLKWTPNQLMNGSVGDLDYEKS---VYWDYAMTIRLEEIVYLHCHQQVDCGGTVVLVSQDGIQRPPLRFPRGGHLLQFLSCLENGLLPHGQLDPPLWSQRGKGKVFPK 401          

HSP 2 Score: 268.855 bits (686), Expect = 3.392e-74
Identity = 127/252 (50.40%), Postives = 179/252 (71.03%), Query Frame = 3
Query: 2628 NSTSNNKNKKEAETKI-----VITQKILNVLKQNWTRIEKDVARCDRHFGFFGQTKTGEENLNILQRIMCTWVWENLELGYIQGMCDLLAPILVVFNGHEELTFACFSKYMERMISNFPVKDSTKMDLCFSRMRSAVQILDSDLLNHMQSYGDFTHFYFSYRWFLLDFKREFTYKDVFCLWETIWAADNVASPYFSLFVGLALLLSYRDVIIDNAMEFTDIIRFFNEMAEQHNVQKVLELARELVEKLQLLL 3368
            +S + N  K EA + +       +Q++L++   N  RI+KDV RCDR++ +F        NL  L+ IMC++VW++LE+GY+QGMCDLLAP+LV+ +  E + F+CF++ M+RM  NFP      MD  F+ MRS +QILD++L   M   GD+THFYF YRWFLLDFKRE  Y DVF +WETIWAA  V+S +F LF+ L+L+  YRD+I++N M+FTDII+FFNEMAE HN++++L L+R+LV K+Q L+
Sbjct:  809 DSLAVNTEKIEASSPVSSIGTTYSQELLDMYTLNLHRIDKDVQRCDRNYWYFTPA-----NLEKLRNIMCSYVWQHLEIGYVQGMCDLLAPLLVILDD-EAMAFSCFTELMKRMNQNFP--HGGAMDTHFANMRSLIQILDAELFELMHQNGDYTHFYFCYRWFLLDFKRELVYDDVFAVWETIWAAKCVSSSHFVLFIALSLVEIYRDIILENNMDFTDIIKFFNEMAEHHNIKQILTLSRDLVCKVQTLI 1052          

HSP 3 Score: 104.76 bits (260), Expect = 4.020e-22
Identity = 49/149 (32.89%), Postives = 85/149 (57.05%), Query Frame = 3
Query: 2091 EKSKTYGKSSIRMLCSSMKKEIMARSFYGWLAYSRHMKTIRNHLSQLVLPVDLGTKSCKEFIKGLTKEKWTSAFNLNNQIEDNMSVLCYIYRGGCDPELRVQTWPYLLGLFEWNSTENERQATLRKWERRYHVAISDWMVIETVLNEEE 2537
            +K   + ++ +++LC +MK +I++R+FYGWLAY RH+ T+R HLS LV    +      +   GLT E W       +  E+   +L  +Y GG +P LR + WP+LLG +++  +E ER+    +    Y   +S+W+  E ++ ++E
Sbjct:  444 KKKHLFCRTPLKLLCDNMKNQIISRAFYGWLAYCRHLSTVRTHLSGLVNHTIVEPDVPSDAYSGLTTEVWQKFLQDCSTYEEK-ELLRLVYFGGVEPSLRKEVWPFLLGHYQFGMSETERKEVDEQMRACYEQTMSEWLGCEAIVKQKE 591          
BLAST of Small G protein signaling modulator 1 vs. Ensembl Zebrafish
Match: sgsm1a (small G protein signaling modulator 1a [Source:ZFIN;Acc:ZDB-GENE-060526-379])

HSP 1 Score: 310.071 bits (793), Expect = 3.210e-88
Identity = 184/448 (41.07%), Postives = 252/448 (56.25%), Query Frame = 3
Query:  276 QVKLLMEEFVNKKYVHEYSSNVISLCASIEACXXXXXXXXXXXXFKESSSLALLEKIAKQNAAAKSICTLMSDEKLHYCDXXXXXXXXXXXXXXXXXXXXXXXXXXTFGYSWSASSFLGFSNNKFFSSINQSSDNEFINLHWKNLIKHYWIRLALTEKVLDKIIDYLVKNSNRFYNHGSVIGDPCYGYILVSLLSGPCSLEYSRVKNPELIPDDPDAGELIQRQKIQNQSGSTGIEAGKSPNLSHAMSTSSLFWSSGSNQFLNKPALVNRQRRLTGIDLDEIPNSGNKSPFSTARQYVESLHQTSSSSLLFGKNNVYCQPREDVNKMPGYLSLHMAVNEMLIKWTPNELMSGGLNDAVFKENSVKVEWDCALMIWVNKVVYIHCHQQADKGETLVLVNHDGSQNPPFDFPQGGHLMSFLTCLENGLLPKCRLDPPLWLKKNREKLFQK 1619
            QVK +MEE V +K+VHE SS+++S CA++EAC+L GLKRRA G  + +   AL  K+AK    A+ +C    + +L                               F    S S     S  K    +N S             ++H WI  AL EKVLDKI+ YLV+NS++FY   +++ DP  G IL SLL GPC+LEY+++K  +    DP A EL+QR +I      +G     SP                      +PAL   Q+R +   +DE P     SP  +AR YVESLHQ S ++LLFGKNNV  QPR+D+  +PGYLSLH   + M +KWTPN+LM+G + D  ++++   V WD A+ I + ++VY+HCHQQ D G T+VLV+ DG Q PP  FP+GGHL+ FL+CLENGLLP  +LDPPLW ++ + K+F K
Sbjct:   28 QVKQIMEEAVTRKFVHEDSSHIVSFCAAVEACVLHGLKRRAAGFLRSNKIAALFTKVAKNFPPAEELCRKAQELEL------------------------------VFENRRSQSLSYSESTRKMPKVLNFSP----------QAVRHVWIHAALIEKVLDKIVLYLVENSSKFYEKEAILMDPVDGPILASLLVGPCALEYTKMKTADHFWTDPSADELVQRHRIH-----SGHCRQDSPT--------------------KRPALCI-QKRHSSSSMDERP-----SPSPSARDYVESLHQNSRATLLFGKNNVLVQPRDDMEAVPGYLSLHQTADYMTLKWTPNQLMNGSVGDLDYEKS---VYWDYAMTIRLEEIVYLHCHQQVDCGGTVVLVSQDGIQRPPLRFPRGGHLLQFLSCLENGLLPHGQLDPPLWSQRGKGKVFPK 401          

HSP 2 Score: 269.24 bits (687), Expect = 3.213e-74
Identity = 127/252 (50.40%), Postives = 179/252 (71.03%), Query Frame = 3
Query: 2628 NSTSNNKNKKEAETKI-----VITQKILNVLKQNWTRIEKDVARCDRHFGFFGQTKTGEENLNILQRIMCTWVWENLELGYIQGMCDLLAPILVVFNGHEELTFACFSKYMERMISNFPVKDSTKMDLCFSRMRSAVQILDSDLLNHMQSYGDFTHFYFSYRWFLLDFKREFTYKDVFCLWETIWAADNVASPYFSLFVGLALLLSYRDVIIDNAMEFTDIIRFFNEMAEQHNVQKVLELARELVEKLQLLL 3368
            +S + N  K EA + +       +Q++L++   N  RI+KDV RCDR++ +F        NL  L+ IMC++VW++LE+GY+QGMCDLLAP+LV+ +  E + F+CF++ M+RM  NFP      MD  F+ MRS +QILD++L   M   GD+THFYF YRWFLLDFKRE  Y DVF +WETIWAA  V+S +F LF+ L+L+  YRD+I++N M+FTDII+FFNEMAE HN++++L L+R+LV K+Q L+
Sbjct:  831 DSLAVNTEKIEASSPVSSIGTTYSQELLDMYTLNLHRIDKDVQRCDRNYWYFTPA-----NLEKLRNIMCSYVWQHLEIGYVQGMCDLLAPLLVILDD-EAMAFSCFTELMKRMNQNFP--HGGAMDTHFANMRSLIQILDAELFELMHQNGDYTHFYFCYRWFLLDFKRELVYDDVFAVWETIWAAKCVSSSHFVLFIALSLVEIYRDIILENNMDFTDIIKFFNEMAEHHNIKQILTLSRDLVCKVQTLI 1074          

HSP 3 Score: 104.375 bits (259), Expect = 4.521e-22
Identity = 49/149 (32.89%), Postives = 85/149 (57.05%), Query Frame = 3
Query: 2091 EKSKTYGKSSIRMLCSSMKKEIMARSFYGWLAYSRHMKTIRNHLSQLVLPVDLGTKSCKEFIKGLTKEKWTSAFNLNNQIEDNMSVLCYIYRGGCDPELRVQTWPYLLGLFEWNSTENERQATLRKWERRYHVAISDWMVIETVLNEEE 2537
            +K   + ++ +++LC +MK +I++R+FYGWLAY RH+ T+R HLS LV    +      +   GLT E W       +  E+   +L  +Y GG +P LR + WP+LLG +++  +E ER+    +    Y   +S+W+  E ++ ++E
Sbjct:  445 KKKHLFCRTPLKLLCDNMKNQIISRAFYGWLAYCRHLSTVRTHLSGLVNHTIVEPDVPSDAYSGLTTEVWQKFLQDCSTYEEK-ELLRLVYFGGVEPSLRKEVWPFLLGHYQFGMSETERKEVDEQMRACYEQTMSEWLGCEAIVKQKE 592          
BLAST of Small G protein signaling modulator 1 vs. Ensembl Zebrafish
Match: sgsm1b (small G protein signaling modulator 1b [Source:ZFIN;Acc:ZDB-GENE-091117-39])

HSP 1 Score: 260.766 bits (665), Expect = 1.609e-78
Identity = 123/229 (53.71%), Postives = 171/229 (74.67%), Query Frame = 3
Query: 2682 TQKILNVLKQNWTRIEKDVARCDRHFGFFGQTKTGEENLNILQRIMCTWVWENLELGYIQGMCDLLAPILVVFNGHEELTFACFSKYMERMISNFPVKDSTKMDLCFSRMRSAVQILDSDLLNHMQSYGDFTHFYFSYRWFLLDFKREFTYKDVFCLWETIWAADNVASPYFSLFVGLALLLSYRDVIIDNAMEFTDIIRFFNEMAEQHNVQKVLELARELVEKLQLLL 3368
            +Q+++++   N  RI+KDV RCDR++ +F        NL  L+ IMC++VW++L++GY+QGMCDLLAP+LV+ +  E + F+CF++ M+RM  NFP      MD  F+ MRS +QILDS+L   MQ  GD+THFYF YRWFLLDFKRE  Y DVF +WETIWAA   +S +F LF+ LAL+  YRD+I++N M+FTDII+FFNEMAE+H+V K+L +AR+LV K+Q+L+
Sbjct:   64 SQELVDLYTLNLHRIDKDVQRCDRNYWYFTPA-----NLEKLRNIMCSYVWQHLDIGYVQGMCDLLAPLLVILDD-EAMAFSCFTELMKRMNQNFP--HGGAMDTHFANMRSLIQILDSELFELMQQNGDYTHFYFCYRWFLLDFKREMVYDDVFSVWETIWAARYASSEHFVLFIALALVELYRDIILENNMDFTDIIKFFNEMAERHDVPKLLVMARDLVHKVQILI 284          
BLAST of Small G protein signaling modulator 1 vs. Ensembl Xenopus
Match: agbl1 (ATP/GTP binding protein-like 1 [Source:Xenbase;Acc:XB-GENE-950762])

HSP 1 Score: 334.724 bits (857), Expect = 3.173e-98
Identity = 187/493 (37.93%), Postives = 271/493 (54.97%), Query Frame = 3
Query: 2112 KSSIRMLCSSMKKEIMARSFYGWLAYSRHMKTIRNHLSQLV--------LPVDLGTKSCKEFIKGLTKEKWTSAFNLNNQIEDNMSVLCYIYRGGCDPELRVQTWPYLLGLFEWNSTENERQATLRKWERRYHVAISDWMVIETVLNEEEDASTPT-----------DDNEERC-----------------AVQIERKSETNEKSNFGNST-------------------------------------SNNKNKKEAETKI-VITQKILNVLKQNWTRIEKDVARCDRHFGFFGQTKTGEENLNILQRIMCTWVWENLELGYIQGMCDLLAPILVVFNGHEELTFACFSKYMERMISNFPVKDSTKMDLCFSRMRSAVQILDSDLLNHMQSYGDFTHFYFSYRWFLLDFKREFTYKDVFCLWETIWAADNVASPYFSLFVGLALLLSYRDVIIDNAMEFTDIIRFFNEMAEQHNVQKVLELARELVEKLQLLL 3368
            ++ ++MLC +MK +I++R+FYGWLAY RH+ T+R HLS LV        +PVD           GLT   W      +   E+   +L  IY GG   E+R + WP+LLG +++  TE +R+    +    Y   +++W+  E ++ + E  S              D   +R                  A QIE +SE ++ +   N T                                       NKN      K     Q++L++   N  RIEKDV RCDR++ +F        NL  L+ +MC++VW+++E+GY+QGMCDLLAP+LV+ +  E   F+CF++ M+RM  NFP      MD  F+ MRS +QILDS+L   M   GD+THFYF YRWFLLDFKRE  Y DVF +WETIWAA +++S +F LF+ LAL+  YRD+I++N M+FTDII+FFNEMAE+HN++ +L+LA++LV K+Q L+
Sbjct:  416 EAPLKMLCDNMKYQIVSRAFYGWLAYCRHLSTVRTHLSALVNHKIVYPDVPVDASF--------GLTVAIWQKYLEDSKSYEEQ-ELLRLIYYGGIQHEIRREVWPFLLGHYQFGMTEEDRREVDEQIRACYEQTMAEWLGCEAIVRQREKESHAAALLKCSSGASLDIQIQRMMHRDSTVSNEVFESVEEAEQIEARSEDSKPTKISNGTVANGTCSPDSGHPSSRNFSITSGYSEQSFSTDDNASLETNKNSLYLHMKQGTAEQELLDMYTINLHRIEKDVQRCDRNYWYFTPA-----NLEKLRNVMCSYVWQHIEIGYVQGMCDLLAPLLVILDD-EAKAFSCFTELMKRMNQNFP--HGGAMDTHFANMRSLIQILDSELFELMHQNGDYTHFYFCYRWFLLDFKRELVYDDVFSVWETIWAAKHISSAHFVLFIALALVEVYRDIILENNMDFTDIIKFFNEMAERHNIKHILKLAQDLVYKVQTLI 891          

HSP 2 Score: 278.1 bits (710), Expect = 3.881e-78
Identity = 141/303 (46.53%), Postives = 192/303 (63.37%), Query Frame = 3
Query:  711 IKHYWIRLALTEKVLDKIIDYLVKNSNRFYNHGSVIGDPCYGYILVSLLSGPCSLEYSRVKNPELIPDDPDAGELIQRQKIQNQSGSTGIEAGKSPNLSHAMSTSSLFWSSGSNQFLNKPALVNRQRRLTGIDLDEIPNSGNKSPFSTARQYVESLHQTSSSSLLFGKNNVYCQPREDVNKMPGYLSLHMAVNEMLIKWTPNELMSGGLNDAVFKENSVKVEWDCALMIWVNKVVYIHCHQQADKGETLVLVNHDGSQNPPFDFPQGGHLMSFLTCLENGLLPKCRLDPPLWLKKNREKLFQK 1619
            IKH WIR AL EKVLDKI+ YLV+N N++Y   +++ DP  G IL SLL GPC+LEY+++K  +    DP A EL+QR +I +               SH    S             +PAL  ++R  +G        S +  P  +AR YVESLHQ S ++LLFGKNNV  QPR+D+  +PGYLSLH + + M +KWTPN+LM+G + D  ++++   V WD A+ I + ++VY+HCHQQ D G T+VLV+ DG Q PP  FP+GGHL+ FL+CLENGLLP  +LDPPLW ++ + K+F K
Sbjct:  115 IKHLWIRTALIEKVLDKIVLYLVENCNKYYEKEALLMDPVDGPILASLLVGPCALEYTKMKTADHFWTDPSADELVQRHRIHS---------------SHCRQDSPT----------KRPALCIQKRHSSG--------SMDDRPSMSARDYVESLHQNSRATLLFGKNNVMVQPRDDMEAIPGYLSLHQSADTMTLKWTPNQLMNGSVGDLDYEKS---VYWDYAMTIRLEEIVYLHCHQQ-DSGGTVVLVSQDGIQRPPLRFPRGGHLLQFLSCLENGLLPHGQLDPPLWSQRGKGKVFPK 380          

HSP 3 Score: 54.299 bits (129), Expect = 1.271e-6
Identity = 35/72 (48.61%), Postives = 49/72 (68.06%), Query Frame = 3
Query:  279 VKLLMEEFVNKKYVHEYSSNVISLCASIEACXXXXXXXXXXXXFKESSSLALLEKIAKQNAAAKSICTLMSD 494
            VK +MEE V +K+VHE SS++IS CA++EAC+L GLKRRA G  + +   AL  K+AK    A+ +C  + D
Sbjct:   11 VKQIMEEAVTRKFVHEDSSHIISFCAAVEACVLYGLKRRAAGFLRSNKIAALFMKVAKSFPLAEELCRKVQD 82          
BLAST of Small G protein signaling modulator 1 vs. Ensembl Xenopus
Match: agbl1 (ATP/GTP binding protein-like 1 [Source:Xenbase;Acc:XB-GENE-950762])

HSP 1 Score: 281.567 bits (719), Expect = 4.847e-83
Identity = 141/303 (46.53%), Postives = 192/303 (63.37%), Query Frame = 3
Query:  711 IKHYWIRLALTEKVLDKIIDYLVKNSNRFYNHGSVIGDPCYGYILVSLLSGPCSLEYSRVKNPELIPDDPDAGELIQRQKIQNQSGSTGIEAGKSPNLSHAMSTSSLFWSSGSNQFLNKPALVNRQRRLTGIDLDEIPNSGNKSPFSTARQYVESLHQTSSSSLLFGKNNVYCQPREDVNKMPGYLSLHMAVNEMLIKWTPNELMSGGLNDAVFKENSVKVEWDCALMIWVNKVVYIHCHQQADKGETLVLVNHDGSQNPPFDFPQGGHLMSFLTCLENGLLPKCRLDPPLWLKKNREKLFQK 1619
            IKH WIR AL EKVLDKI+ YLV+N N++Y   +++ DP  G IL SLL GPC+LEY+++K  +    DP A EL+QR +I +               SH    S             +PAL  ++R  +G        S +  P  +AR YVESLHQ S ++LLFGKNNV  QPR+D+  +PGYLSLH + + M +KWTPN+LM+G + D  ++++   V WD A+ I + ++VY+HCHQQ D G T+VLV+ DG Q PP  FP+GGHL+ FL+CLENGLLP  +LDPPLW ++ + K+F K
Sbjct:  126 IKHLWIRTALIEKVLDKIVLYLVENCNKYYEKEALLMDPVDGPILASLLVGPCALEYTKMKTADHFWTDPSADELVQRHRIHS---------------SHCRQDSPT----------KRPALCIQKRHSSG--------SMDDRPSMSARDYVESLHQNSRATLLFGKNNVMVQPRDDMEAIPGYLSLHQSADTMTLKWTPNQLMNGSVGDLDYEKS---VYWDYAMTIRLEEIVYLHCHQQVDSGGTVVLVSQDGIQRPPLRFPRGGHLLQFLSCLENGLLPHGQLDPPLWSQRGKGKVFPK 392          

HSP 2 Score: 65.855 bits (159), Expect = 2.964e-10
Identity = 39/83 (46.99%), Postives = 59/83 (71.08%), Query Frame = 3
Query:  246 KEILIKTIKRQVKLLMEEFVNKKYVHEYSSNVISLCASIEACXXXXXXXXXXXXFKESSSLALLEKIAKQNAAAKSICTLMSD 494
            ++ L+KT+K++VK +MEE V +K+VHE SS++IS CA++EAC+L GLKRRA G  + +   AL  K+AK    A+ +C  + D
Sbjct:   11 RQKLLKTVKKEVKQIMEEAVTRKFVHEDSSHIISFCAAVEACVLYGLKRRAAGFLRSNKIAALFMKVAKSFPLAEELCRKVQD 93          
BLAST of Small G protein signaling modulator 1 vs. Ensembl Xenopus
Match: agbl1 (ATP/GTP binding protein-like 1 [Source:Xenbase;Acc:XB-GENE-950762])

HSP 1 Score: 280.796 bits (717), Expect = 9.700e-83
Identity = 141/303 (46.53%), Postives = 192/303 (63.37%), Query Frame = 3
Query:  711 IKHYWIRLALTEKVLDKIIDYLVKNSNRFYNHGSVIGDPCYGYILVSLLSGPCSLEYSRVKNPELIPDDPDAGELIQRQKIQNQSGSTGIEAGKSPNLSHAMSTSSLFWSSGSNQFLNKPALVNRQRRLTGIDLDEIPNSGNKSPFSTARQYVESLHQTSSSSLLFGKNNVYCQPREDVNKMPGYLSLHMAVNEMLIKWTPNELMSGGLNDAVFKENSVKVEWDCALMIWVNKVVYIHCHQQADKGETLVLVNHDGSQNPPFDFPQGGHLMSFLTCLENGLLPKCRLDPPLWLKKNREKLFQK 1619
            IKH WIR AL EKVLDKI+ YLV+N N++Y   +++ DP  G IL SLL GPC+LEY+++K  +    DP A EL+QR +I +               SH    S             +PAL  ++R  +G        S +  P  +AR YVESLHQ S ++LLFGKNNV  QPR+D+  +PGYLSLH + + M +KWTPN+LM+G + D  ++++   V WD A+ I + ++VY+HCHQQ D G T+VLV+ DG Q PP  FP+GGHL+ FL+CLENGLLP  +LDPPLW ++ + K+F K
Sbjct:  124 IKHLWIRTALIEKVLDKIVLYLVENCNKYYEKEALLMDPVDGPILASLLVGPCALEYTKMKTADHFWTDPSADELVQRHRIHS---------------SHCRQDSPT----------KRPALCIQKRHSSG--------SMDDRPSMSARDYVESLHQNSRATLLFGKNNVMVQPRDDMEAIPGYLSLHQSADTMTLKWTPNQLMNGSVGDLDYEKS---VYWDYAMTIRLEEIVYLHCHQQVDSGGTVVLVSQDGIQRPPLRFPRGGHLLQFLSCLENGLLPHGQLDPPLWSQRGKGKVFPK 390          

HSP 2 Score: 56.6102 bits (135), Expect = 1.870e-7
Identity = 36/79 (45.57%), Postives = 51/79 (64.56%), Query Frame = 3
Query:  258 IKTIKRQVKLLMEEFVNKKYVHEYSSNVISLCASIEACXXXXXXXXXXXXFKESSSLALLEKIAKQNAAAKSICTLMSD 494
             +   R VK +MEE V +K+VHE SS++IS CA++EAC+L GLKRRA G  + +   AL  K+AK    A+ +C  + D
Sbjct:   13 FRAFIRLVKQIMEEAVTRKFVHEDSSHIISFCAAVEACVLYGLKRRAAGFLRSNKIAALFMKVAKSFPLAEELCRKVQD 91          
BLAST of Small G protein signaling modulator 1 vs. Ensembl Xenopus
Match: zbtb6 (zinc finger and BTB domain containing 6 [Source:Xenbase;Acc:XB-GENE-5823898])

HSP 1 Score: 263.077 bits (671), Expect = 2.907e-76
Identity = 133/304 (43.75%), Postives = 192/304 (63.16%), Query Frame = 3
Query:  711 IKHYWIRLALTEKVLDKIIDYLVKNSNRFYNHGSVIGDPCYGYILVSLLSGPCSLEYSRVKNPELIPDDPDAGELIQRQKIQNQSGSTGIEAGKSPNLSHAMSTSSLFWSSGSNQFLNKPALVNRQRRLTGIDLDEIPNSGNKSPFS-TARQYVESLHQTSSSSLLFGKNNVYCQPREDVNKMPGYLSLHMAVNEMLIKWTPNELMSGGLNDAVFKENSVKVEWDCALMIWVNKVVYIHCHQQADKGETLVLVNHDGSQNPPFDFPQGGHLMSFLTCLENGLLPKCRLDPPLWLKKNREKLFQK 1619
            +KH W+R AL EKVLDKI+ Y+V N +++Y   S++ DP  G IL +LL GPC+LEY+++K  +    DP A EL+QR +I                 +H+   S             +PAL  ++R  +G        S ++  F+ +AR+YVESLHQ S + LL+GKNNV  QP+ED   +PGYLSLH +   + +KWTPN+L++G L D+  +++   V WD AL++ ++++V IHCHQQ D   TLVLV+ DG Q PP  FP GGHL++FL+CLENGLLP+ +L+PPLW ++ + K+F K
Sbjct:  139 LKHIWVRTALIEKVLDKIVQYIVDNCSKYYEKESLMSDPVCGPILAALLVGPCALEYTKLKTADHYWTDPSADELVQRHRIHG---------------AHSRQDSPC----------KRPALSIKKRHSSG--------SMSEDKFAASAREYVESLHQNSRTHLLYGKNNVLVQPKEDKEAIPGYLSLHQSGENLTLKWTPNQLLNGTLGDSELEKS---VFWDYALIVPISQIVCIHCHQQPDSRGTLVLVSQDGIQRPPLHFPPGGHLLAFLSCLENGLLPRGQLEPPLWSQRGKGKVFPK 406          
BLAST of Small G protein signaling modulator 1 vs. Ensembl Xenopus
Match: zbtb6 (zinc finger and BTB domain containing 6 [Source:Xenbase;Acc:XB-GENE-5823898])

HSP 1 Score: 264.233 bits (674), Expect = 3.633e-75
Identity = 133/304 (43.75%), Postives = 192/304 (63.16%), Query Frame = 3
Query:  711 IKHYWIRLALTEKVLDKIIDYLVKNSNRFYNHGSVIGDPCYGYILVSLLSGPCSLEYSRVKNPELIPDDPDAGELIQRQKIQNQSGSTGIEAGKSPNLSHAMSTSSLFWSSGSNQFLNKPALVNRQRRLTGIDLDEIPNSGNKSPFS-TARQYVESLHQTSSSSLLFGKNNVYCQPREDVNKMPGYLSLHMAVNEMLIKWTPNELMSGGLNDAVFKENSVKVEWDCALMIWVNKVVYIHCHQQADKGETLVLVNHDGSQNPPFDFPQGGHLMSFLTCLENGLLPKCRLDPPLWLKKNREKLFQK 1619
            +KH W+R AL EKVLDKI+ Y+V N +++Y   S++ DP  G IL +LL GPC+LEY+++K  +    DP A EL+QR +I                 +H+   S             +PAL  ++R  +G        S ++  F+ +AR+YVESLHQ S + LL+GKNNV  QP+ED   +PGYLSLH +   + +KWTPN+L++G L D+  +++   V WD AL++ ++++V IHCHQQ D   TLVLV+ DG Q PP  FP GGHL++FL+CLENGLLP+ +L+PPLW ++ + K+F K
Sbjct:  120 LKHIWVRTALIEKVLDKIVQYIVDNCSKYYEKESLMSDPVCGPILAALLVGPCALEYTKLKTADHYWTDPSADELVQRHRIHG---------------AHSRQDSPC----------KRPALSIKKRHSSG--------SMSEDKFAASAREYVESLHQNSRTHLLYGKNNVLVQPKEDKEAIPGYLSLHQSGENLTLKWTPNQLLNGTLGDSELEKS---VFWDYALIVPISQIVCIHCHQQPDSRGTLVLVSQDGIQRPPLHFPPGGHLLAFLSCLENGLLPRGQLEPPLWSQRGKGKVFPK 387          

HSP 2 Score: 104.375 bits (259), Expect = 3.308e-22
Identity = 53/154 (34.42%), Postives = 88/154 (57.14%), Query Frame = 3
Query: 2097 SKTYGKSSIRMLCSSMKKEIMARSFYGWLAYSRHMKTIRNHLSQLV----LPVDLGTKSCKEFIKGLTKEKWTSAFNLNNQIEDNMSVLCYIYRGGCDPELRVQTWPYLLGLFEWNSTENERQATLRKWERRYHVAISDWMVIETVLNEEEDAS 2546
            S  + ++ +++LC +MKK+I++R+FYGWLAY RH+ T+R HLS LV    +P D  T +      GLTKE W S +  + +    + +L  +Y GG + E+R + WP+LLG +++  T+ E          RY   +++W   E ++ + E  S
Sbjct:  466 SCVHDRAPLKLLCENMKKQIVSRAFYGWLAYCRHLSTVRTHLSALVNHSIIPPDKPTDAS----GGLTKEVW-SKYEKDMKNYKELELLRLVYYGGVEHEIRKEVWPFLLGHYKFGMTKKEMDRVDEAIAARYQKVMAEWKACEVIVKQREKES 614          

HSP 3 Score: 57.3806 bits (137), Expect = 1.515e-7
Identity = 36/79 (45.57%), Postives = 49/79 (62.03%), Query Frame = 3
Query:  258 IKTIKRQVKLLMEEFVNKKYVHEYSSNVISLCASIEACXXXXXXXXXXXXFKESSSLALLEKIAKQNAAAKSICTLMSD 494
            +  + + VK +MEE V +K+VHE SS++I+LC  +EACLL  LKRRA G  +     AL  K+AK  A A  IC  + D
Sbjct:   18 VTCLTKDVKQIMEEAVTRKFVHEDSSHIIALCGVVEACLLHLLKRRAAGFLRSDKVAALFMKVAKTCATAADICKKVQD 96          
BLAST of Small G protein signaling modulator 1 vs. Ensembl Mouse
Match: Sgsm1 (small G protein signaling modulator 1 [Source:MGI Symbol;Acc:MGI:107320])

HSP 1 Score: 352.058 bits (902), Expect = 1.744e-106
Identity = 218/632 (34.49%), Postives = 331/632 (52.37%), Query Frame = 3
Query:  711 IKHYWIRLALTEKVLDKIIDYLVKNSNRFYNHGSVIGDPCYGYILVSLLSGPCSLEYSRVKNPELIPDDPDAGELIQRQKIQNQSGSTGIEAGKSPNLSHAMSTSSLFWSSGSNQFLNKPALVNRQRRLTGIDLDEIPNSGNKSPFSTARQYVESLHQTSSSSLLFGKNNVYCQPREDVNKMPGYLSLHMAVNEMLIKWTPNELMSGGLNDAVFKENSVKVEWDCALMIWVNKVVYIHCHQQADKGETLVLVNHDGSQNPPFDFPQGGHLMSFLTCLENGLLPKCRLDPPLWLKKNREKLFQKSCENPINNSKE---LDQDGPKSAEFIKPTNKNKTIFLWSSSDRNSLKFSWFHQPFNKKLTIGNRKVLSQPLEHIVFDYRQAGRHNSQSDELLTDLVFRIVRPKNYNQTMSETHSGXXXXXXXXXITENPKSPNDL-----HSTVPQWHSDYTVLAMKRRCRLSSTEKSKTYG----KSSIRMLCSSMKKEIMARSFYGWLAYSRHMKTIRNHLSQLV--------LPVDLGTKSCKEFIKGLTKEKWTSAFNLNNQIEDNMSVLCYIYRGGCDPELRVQTWPYLLGLFEWNSTENERQATLRKWERRYHVAISDWMVIETVLNEEEDAS 2546
            IKH WIR AL E+VLDKI+ YLV+NS+++Y   +++ DP  G IL SLL GPC+LEY+++K  +    DP A EL+QR +I +               SH    S             +PAL  ++R  +G        S +  P  +AR YVESLHQ S ++LL+GKNNV  QPR+D+  +PGYLSLH   + M +KWTPN+LM+G + D  ++++   V WD A+ I + ++VY+HCHQQ D G T+VLV+ DG Q PPF FP+GGHL+ FL+CLENGLLP  +LDPPLW ++ + K+F K  +     S E    D++  ++ +++      + I+  + S+  +L      +P    ++IG   ++    + ++   +  G   +Q+   LT +  R V+                         E P  P DL     ++  P W       +     +  S +   T G    ++ +++LC +MK +I++R+FYGWLAY RH+ T+R HLS LV        LP D G        +GLT   W      ++       +L  IY GG  PE+R   WP+LLG +++  TE ER+    +    Y   +S+W+  E ++ + E  S
Sbjct:  126 IKHLWIRTALFERVLDKIVHYLVENSSKYYEKEALLMDPVDGPILASLLVGPCALEYTKMKTADHFWTDPSADELVQRHRIHS---------------SHLRQDSPT----------KRPALCIQKRHSSG--------SMDDRPSISARDYVESLHQNSRATLLYGKNNVLVQPRDDMEAVPGYLSLHQTADVMTLKWTPNQLMNGSVGDLDYEKS---VYWDYAVTIRLEEIVYLHCHQQVDSGGTVVLVSQDGIQRPPFRFPKGGHLLQFLSCLENGLLPHGQLDPPLWSQRGKGKVFPKLRKRSPQGSSESTSSDKEDDEATDYV-----FRIIYPGTQSEFVALDLMGSPRP----VSIGPAWMMLAAGQSMLVVAK--GLQWAQTRGCLT-IPTRSVK-------------------------EQPPMPQDLMDVSMNNLPPLWQPSPRKSSCSSCSQSGSADGGSTNGCNHERAPLKLLCDNMKYQILSRAFYGWLAYCRHLSTVRTHLSALVNHMIVSPDLPCDAG--------QGLTASIWEKYIQ-DSTTYPEQELLRLIYYGGVQPEIRRAVWPFLLGHYQFGMTEMERKEVDEQIHACYAQTMSEWLGCEAIVRQRERES 675          

HSP 2 Score: 58.9214 bits (141), Expect = 3.959e-8
Identity = 34/77 (44.16%), Postives = 55/77 (71.43%), Query Frame = 3
Query:  246 KEILIKTIKRQVKLLMEEFVNKKYVHEYSSNVISLCASIEACXXXXXXXXXXXXFKESSSLALLEKIAKQNAAAKSI 476
            ++ L++T+K++VK +MEE V +K+VHE SS++IS CA++EAC+L GL+RRA G  + +   AL  K+ K    A+ +
Sbjct:   11 RQRLLRTVKKEVKQIMEEAVTRKFVHEDSSHIISFCAAVEACVLHGLRRRAAGFLRSNKIAALFMKVGKGFPPAEEL 87          
BLAST of Small G protein signaling modulator 1 vs. Ensembl Mouse
Match: Sgsm2 (small G protein signaling modulator 2 [Source:MGI Symbol;Acc:MGI:2144695])

HSP 1 Score: 299.671 bits (766), Expect = 5.216e-85
Identity = 174/458 (37.99%), Postives = 255/458 (55.68%), Query Frame = 3
Query:  246 KEILIKTIKRQVKLLMEEFVNKKYVHEYSSNVISLCASIEACXXXXXXXXXXXXFKESSSLALLEKIAKQNAAAKSICTLMSDEKLHYCDXXXXXXXXXXXXXXXXXXXXXXXXXXTFGYSWSASSFLGFSNNKFFSSINQSSDNEFINLHWKNLIKHYWIRLALTEKVLDKIIDYLVKNSNRFYNHGSVIGDPCYGYILVSLLSGPCSLEYSRVKNPELIPDDPDAGELIQRQKIQNQSGSTGIEAGKSPNLSHAMSTSSLFWSSGSNQFLNKPALVNRQRRLTGIDLDEIPNSGNKSPFSTARQYVESLHQTSSSSLLFGKNNVYCQPREDVNKMPGYLSLHMAVNEMLIKWTPNELMSGGLNDAVFKENSVKVEWDCALMIWVNKVVYIHCHQQADKGETLVLVNHDGSQNPPFDFPQGGHLMSFLTCLENGLLPKCRLDPPLWLKKNREKLFQK 1619
            KE L+  +K++VK +MEE V +K+VHE SS++I+LC ++EACLL  L+RRA G  +     AL  K+ K    A+ IC  + +                         +         G S  A    G +  K  +   Q+             +KH W+R AL EKVLD+++ YL +N +++Y   +++ DP +G IL  LL GPC+LEY+++K  +    DP A EL+QR +I+             PN   + +               +PAL  R+R  +G       ++      + AR+YVESLHQ S + LL+GKNNV  QP+ED+  +PGYLSLH +   + +KWTPN+LM+G L D+  +++   V WD AL++  +++V IHCHQQ   G TLVLV+ DG Q PP  FPQGGHL+SFL+CLENGLLP+ +L+PPLW ++ + K+F K
Sbjct:    9 KEKLLWNVKKEVKQIMEEAVTRKFVHEDSSHIIALCGAVEACLLHQLRRRAAGFLRSDKMAALFTKVGKTCPVAEDICHKVQE------------------------LQQQAEGRKPSGGSQEALRKQGSTGGKAPALSPQA-------------LKHIWVRTALMEKVLDRVVQYLAENCSKYYEKEALLADPVFGPILACLLVGPCALEYTKLKTADHYWTDPSADELVQRHRIRG-----------PPNRQDSPA--------------KRPALGIRKRHSSG-------SASEDRLAACAREYVESLHQNSRTRLLYGKNNVLVQPKEDMEAVPGYLSLHQSAENLTLKWTPNQLMNGTLGDSELEKS---VYWDYALVVPFSQIVCIHCHQQKSGG-TLVLVSQDGIQRPPLHFPQGGHLLSFLSCLENGLLPRGQLEPPLWTQQGKGKVFPK 393          

HSP 2 Score: 265.774 bits (678), Expect = 2.401e-73
Identity = 121/229 (52.84%), Postives = 171/229 (74.67%), Query Frame = 3
Query: 2682 TQKILNVLKQNWTRIEKDVARCDRHFGFFGQTKTGEENLNILQRIMCTWVWENLELGYIQGMCDLLAPILVVFNGHEELTFACFSKYMERMISNFPVKDSTKMDLCFSRMRSAVQILDSDLLNHMQSYGDFTHFYFSYRWFLLDFKREFTYKDVFCLWETIWAADNVASPYFSLFVGLALLLSYRDVIIDNAMEFTDIIRFFNEMAEQHNVQKVLELARELVEKLQLLL 3368
            T ++L+ +  N  RI+KDV RCDR++ +F  +     NL  L+ IMC++VWE+L++GY+QGMCDLLAP+LV+ + +++L ++CFS  M+RM  NFP      MD  F+ MRS +QILDS+L   M   GD+THFYF YRWFLLDFKRE  Y+DVF +WE IWAA  ++S +F LF+ LAL+ +YR++I DN M+FTDII+FFNE AE+H+ Q++L +AR+LV K+Q+L+
Sbjct:  782 TIELLDTVALNLHRIDKDVQRCDRNYWYFTTS-----NLERLRDIMCSYVWEHLDMGYVQGMCDLLAPLLVILD-NDQLAYSCFSHLMKRMGQNFP--SGGAMDSHFANMRSLIQILDSELFELMHQNGDYTHFYFCYRWFLLDFKRELLYEDVFAVWEVIWAARRISSEHFVLFIALALVEAYREIIRDNNMDFTDIIKFFNERAERHDAQEILRIARDLVHKVQMLI 1002          

HSP 3 Score: 102.834 bits (255), Expect = 1.332e-21
Identity = 51/149 (34.23%), Postives = 84/149 (56.38%), Query Frame = 3
Query: 2121 IRMLCSSMKKEIMARSFYGWLAYSRHMKTIRNHLSQLV----LPVDLGTKSCKEFIKGLTKEKWTSAFNLNNQIEDNMSVLCYIYRGGCDPELRVQTWPYLLGLFEWNSTENERQATLRKWERRYHVAISDWMVIETVLNEEEDASTPT 2555
            +R+LC SMK++I++R+FYGWLAY RH+ T+R HLS LV    +P D    +      GLTK+ W S +  + +    + +L  +Y GG + E+R   WP+LLG +++  ++ E +        RY   +++W   E V+ + E  + P 
Sbjct:  484 LRLLCESMKRQIVSRAFYGWLAYCRHLSTVRTHLSALVHHNIIPPDRPPGAS----GGLTKDVW-SKYQKDEKNYKELELLRQVYYGGVEHEIRKDVWPFLLGHYKFGMSKKEMEQVDTAVAARYQQVLAEWKACEVVVRQREREAHPA 627          
BLAST of Small G protein signaling modulator 1 vs. Ensembl Mouse
Match: Sgsm2 (small G protein signaling modulator 2 [Source:MGI Symbol;Acc:MGI:2144695])

HSP 1 Score: 299.671 bits (766), Expect = 9.625e-85
Identity = 174/458 (37.99%), Postives = 255/458 (55.68%), Query Frame = 3
Query:  246 KEILIKTIKRQVKLLMEEFVNKKYVHEYSSNVISLCASIEACXXXXXXXXXXXXFKESSSLALLEKIAKQNAAAKSICTLMSDEKLHYCDXXXXXXXXXXXXXXXXXXXXXXXXXXTFGYSWSASSFLGFSNNKFFSSINQSSDNEFINLHWKNLIKHYWIRLALTEKVLDKIIDYLVKNSNRFYNHGSVIGDPCYGYILVSLLSGPCSLEYSRVKNPELIPDDPDAGELIQRQKIQNQSGSTGIEAGKSPNLSHAMSTSSLFWSSGSNQFLNKPALVNRQRRLTGIDLDEIPNSGNKSPFSTARQYVESLHQTSSSSLLFGKNNVYCQPREDVNKMPGYLSLHMAVNEMLIKWTPNELMSGGLNDAVFKENSVKVEWDCALMIWVNKVVYIHCHQQADKGETLVLVNHDGSQNPPFDFPQGGHLMSFLTCLENGLLPKCRLDPPLWLKKNREKLFQK 1619
            KE L+  +K++VK +MEE V +K+VHE SS++I+LC ++EACLL  L+RRA G  +     AL  K+ K    A+ IC  + +                         +         G S  A    G +  K  +   Q+             +KH W+R AL EKVLD+++ YL +N +++Y   +++ DP +G IL  LL GPC+LEY+++K  +    DP A EL+QR +I+             PN   + +               +PAL  R+R  +G       ++      + AR+YVESLHQ S + LL+GKNNV  QP+ED+  +PGYLSLH +   + +KWTPN+LM+G L D+  +++   V WD AL++  +++V IHCHQQ   G TLVLV+ DG Q PP  FPQGGHL+SFL+CLENGLLP+ +L+PPLW ++ + K+F K
Sbjct:    9 KEKLLWNVKKEVKQIMEEAVTRKFVHEDSSHIIALCGAVEACLLHQLRRRAAGFLRSDKMAALFTKVGKTCPVAEDICHKVQE------------------------LQQQAEGRKPSGGSQEALRKQGSTGGKAPALSPQA-------------LKHIWVRTALMEKVLDRVVQYLAENCSKYYEKEALLADPVFGPILACLLVGPCALEYTKLKTADHYWTDPSADELVQRHRIRG-----------PPNRQDSPA--------------KRPALGIRKRHSSG-------SASEDRLAACAREYVESLHQNSRTRLLYGKNNVLVQPKEDMEAVPGYLSLHQSAENLTLKWTPNQLMNGTLGDSELEKS---VYWDYALVVPFSQIVCIHCHQQKSGG-TLVLVSQDGIQRPPLHFPQGGHLLSFLSCLENGLLPRGQLEPPLWTQQGKGKVFPK 393          

HSP 2 Score: 266.159 bits (679), Expect = 2.515e-73
Identity = 121/229 (52.84%), Postives = 171/229 (74.67%), Query Frame = 3
Query: 2682 TQKILNVLKQNWTRIEKDVARCDRHFGFFGQTKTGEENLNILQRIMCTWVWENLELGYIQGMCDLLAPILVVFNGHEELTFACFSKYMERMISNFPVKDSTKMDLCFSRMRSAVQILDSDLLNHMQSYGDFTHFYFSYRWFLLDFKREFTYKDVFCLWETIWAADNVASPYFSLFVGLALLLSYRDVIIDNAMEFTDIIRFFNEMAEQHNVQKVLELARELVEKLQLLL 3368
            T ++L+ +  N  RI+KDV RCDR++ +F  +     NL  L+ IMC++VWE+L++GY+QGMCDLLAP+LV+ + +++L ++CFS  M+RM  NFP      MD  F+ MRS +QILDS+L   M   GD+THFYF YRWFLLDFKRE  Y+DVF +WE IWAA  ++S +F LF+ LAL+ +YR++I DN M+FTDII+FFNE AE+H+ Q++L +AR+LV K+Q+L+
Sbjct:  827 TIELLDTVALNLHRIDKDVQRCDRNYWYFTTS-----NLERLRDIMCSYVWEHLDMGYVQGMCDLLAPLLVILD-NDQLAYSCFSHLMKRMGQNFP--SGGAMDSHFANMRSLIQILDSELFELMHQNGDYTHFYFCYRWFLLDFKRELLYEDVFAVWEVIWAARRISSEHFVLFIALALVEAYREIIRDNNMDFTDIIKFFNERAERHDAQEILRIARDLVHKVQMLI 1047          

HSP 3 Score: 103.219 bits (256), Expect = 1.254e-21
Identity = 51/149 (34.23%), Postives = 84/149 (56.38%), Query Frame = 3
Query: 2121 IRMLCSSMKKEIMARSFYGWLAYSRHMKTIRNHLSQLV----LPVDLGTKSCKEFIKGLTKEKWTSAFNLNNQIEDNMSVLCYIYRGGCDPELRVQTWPYLLGLFEWNSTENERQATLRKWERRYHVAISDWMVIETVLNEEEDASTPT 2555
            +R+LC SMK++I++R+FYGWLAY RH+ T+R HLS LV    +P D    +      GLTK+ W S +  + +    + +L  +Y GG + E+R   WP+LLG +++  ++ E +        RY   +++W   E V+ + E  + P 
Sbjct:  529 LRLLCESMKRQIVSRAFYGWLAYCRHLSTVRTHLSALVHHNIIPPDRPPGAS----GGLTKDVW-SKYQKDEKNYKELELLRQVYYGGVEHEIRKDVWPFLLGHYKFGMSKKEMEQVDTAVAARYQQVLAEWKACEVVVRQREREAHPA 672          
BLAST of Small G protein signaling modulator 1 vs. Ensembl Mouse
Match: Sgsm1 (small G protein signaling modulator 1 [Source:MGI Symbol;Acc:MGI:107320])

HSP 1 Score: 280.026 bits (715), Expect = 1.134e-80
Identity = 140/303 (46.20%), Postives = 193/303 (63.70%), Query Frame = 3
Query:  711 IKHYWIRLALTEKVLDKIIDYLVKNSNRFYNHGSVIGDPCYGYILVSLLSGPCSLEYSRVKNPELIPDDPDAGELIQRQKIQNQSGSTGIEAGKSPNLSHAMSTSSLFWSSGSNQFLNKPALVNRQRRLTGIDLDEIPNSGNKSPFSTARQYVESLHQTSSSSLLFGKNNVYCQPREDVNKMPGYLSLHMAVNEMLIKWTPNELMSGGLNDAVFKENSVKVEWDCALMIWVNKVVYIHCHQQADKGETLVLVNHDGSQNPPFDFPQGGHLMSFLTCLENGLLPKCRLDPPLWLKKNREKLFQK 1619
            IKH WIR AL E+VLDKI+ YLV+NS+++Y   +++ DP  G IL SLL GPC+LEY+++K  +    DP A EL+QR +I +               SH    S             +PAL  ++R  +G        S +  P  +AR YVESLHQ S ++LL+GKNNV  QPR+D+  +PGYLSLH   + M +KWTPN+LM+G + D  ++++   V WD A+ I + ++VY+HCHQQ D G T+VLV+ DG Q PPF FP+GGHL+ FL+CLENGLLP  +LDPPLW ++ + K+F K
Sbjct:  126 IKHLWIRTALFERVLDKIVHYLVENSSKYYEKEALLMDPVDGPILASLLVGPCALEYTKMKTADHFWTDPSADELVQRHRIHS---------------SHLRQDSPT----------KRPALCIQKRHSSG--------SMDDRPSISARDYVESLHQNSRATLLYGKNNVLVQPRDDMEAVPGYLSLHQTADVMTLKWTPNQLMNGSVGDLDYEKS---VYWDYAVTIRLEEIVYLHCHQQVDSGGTVVLVSQDGIQRPPFRFPKGGHLLQFLSCLENGLLPHGQLDPPLWSQRGKGKVFPK 392          

HSP 2 Score: 102.834 bits (255), Expect = 1.003e-21
Identity = 53/153 (34.64%), Postives = 82/153 (53.59%), Query Frame = 3
Query: 2112 KSSIRMLCSSMKKEIMARSFYGWLAYSRHMKTIRNHLSQLV--------LPVDLGTKSCKEFIKGLTKEKWTSAFNLNNQIEDNMSVLCYIYRGGCDPELRVQTWPYLLGLFEWNSTENERQATLRKWERRYHVAISDWMVIETVLNEEEDAS 2546
            ++ +++LC +MK +I++R+FYGWLAY RH+ T+R HLS LV        LP D G        +GLT   W      ++       +L  IY GG  PE+R   WP+LLG +++  TE ER+    +    Y   +S+W+  E ++ + E  S
Sbjct:  477 RAPLKLLCDNMKYQILSRAFYGWLAYCRHLSTVRTHLSALVNHMIVSPDLPCDAG--------QGLTASIWEKYIQ-DSTTYPEQELLRLIYYGGVQPEIRRAVWPFLLGHYQFGMTEMERKEVDEQIHACYAQTMSEWLGCEAIVRQRERES 620          

HSP 3 Score: 58.9214 bits (141), Expect = 3.649e-8
Identity = 34/77 (44.16%), Postives = 55/77 (71.43%), Query Frame = 3
Query:  246 KEILIKTIKRQVKLLMEEFVNKKYVHEYSSNVISLCASIEACXXXXXXXXXXXXFKESSSLALLEKIAKQNAAAKSI 476
            ++ L++T+K++VK +MEE V +K+VHE SS++IS CA++EAC+L GL+RRA G  + +   AL  K+ K    A+ +
Sbjct:   11 RQRLLRTVKKEVKQIMEEAVTRKFVHEDSSHIISFCAAVEACVLHGLRRRAAGFLRSNKIAALFMKVGKGFPPAEEL 87          
BLAST of Small G protein signaling modulator 1 vs. Ensembl Mouse
Match: Sgsm1 (small G protein signaling modulator 1 [Source:MGI Symbol;Acc:MGI:107320])

HSP 1 Score: 277.33 bits (708), Expect = 1.100e-78
Identity = 126/247 (51.01%), Postives = 180/247 (72.87%), Query Frame = 3
Query: 2628 NSTSNNKNKKEAETKIVITQKILNVLKQNWTRIEKDVARCDRHFGFFGQTKTGEENLNILQRIMCTWVWENLELGYIQGMCDLLAPILVVFNGHEELTFACFSKYMERMISNFPVKDSTKMDLCFSRMRSAVQILDSDLLNHMQSYGDFTHFYFSYRWFLLDFKREFTYKDVFCLWETIWAADNVASPYFSLFVGLALLLSYRDVIIDNAMEFTDIIRFFNEMAEQHNVQKVLELARELVEKLQLLL 3368
             S++NN+    + + +  + ++L++   N  RIEKDV RCDR + +F        NL  L+ IMC+++W+++E+GY+QGMCDLLAP+LV+ +  E L F+CF++ M+RM  NFP      MD  F+ MRS +QILDS+L   M   GD+THFYF YRWFLLDFKRE  Y DVF +WETIWAA +V+S ++ LF+ LAL+  YRD+I++N M+FTDII+FFNEMAE+HN +++L+LAR+LV K+Q+L+
Sbjct:  565 TSSANNEASPVSSSGVTYSPELLDLYTVNLHRIEKDVQRCDRSYWYFTAA-----NLEKLRNIMCSYIWQHIEIGYVQGMCDLLAPLLVILDD-EALAFSCFTELMKRMNQNFP--HGGAMDTHFANMRSLIQILDSELFELMHQNGDYTHFYFCYRWFLLDFKRELVYDDVFSVWETIWAAKHVSSAHYVLFIALALVEVYRDIILENNMDFTDIIKFFNEMAERHNAKQILQLARDLVHKVQILI 803          

HSP 2 Score: 119.013 bits (297), Expect = 1.139e-26
Identity = 49/83 (59.04%), Postives = 64/83 (77.11%), Query Frame = 3
Query: 1371 VEWDCALMIWVNKVVYIHCHQQADKGETLVLVNHDGSQNPPFDFPQGGHLMSFLTCLENGLLPKCRLDPPLWLKKNREKLFQK 1619
            V WD A+ I + ++VY+HCHQQ D G T+VLV+ DG Q PPF FP+GGHL+ FL+CLENGLLP  +LDPPLW ++ + K+F K
Sbjct:   23 VYWDYAVTIRLEEIVYLHCHQQVDSGGTVVLVSQDGIQRPPFRFPKGGHLLQFLSCLENGLLPHGQLDPPLWSQRGKGKVFPK 105          

HSP 3 Score: 102.064 bits (253), Expect = 2.129e-21
Identity = 70/245 (28.57%), Postives = 110/245 (44.90%), Query Frame = 3
Query: 1863 NSQSDELLTDLVFRIVRPKNYNQTMSETHSGXXXXXXXXXITENPKSPNDL-----HSTVPQWHSDYTVLAMKRRCRLSSTEKSKTYG----KSSIRMLCSSMKKEIMARSFYGWLAYSRHMKTIRNHLSQLV--------LPVDLGTKSCKEFIKGLTKEKWTSAFNLNNQIEDNMSVLCYIYRGGCDPELRVQTWPYLLGLFEWNSTENERQATLRKWERRYHVAISDWMVIETVLNEEEDAS 2546
            + + D+  TD VFRI+ P                       T++   P DL     ++  P W       +     +  S +   T G    ++ +++LC +MK +I++R+FYGWLAY RH+ T+R HLS LV        LP D G        +GLT   W      ++       +L  IY GG  PE+R   WP+LLG +++  TE ER+    +    Y   +S+W+  E ++ + E  S
Sbjct:  120 SDKEDDEATDYVFRIIYPG----------------------TQSEFVPQDLMDVSMNNLPPLWQPSPRKSSCSSCSQSGSADGGSTNGCNHERAPLKLLCDNMKYQILSRAFYGWLAYCRHLSTVRTHLSALVNHMIVSPDLPCDAG--------QGLTASIWEKYIQ-DSTTYPEQELLRLIYYGGVQPEIRRAVWPFLLGHYQFGMTEMERKEVDEQIHACYAQTMSEWLGCEAIVRQRERES 333          
BLAST of Small G protein signaling modulator 1 vs. UniProt/SwissProt
Match: sp|Q2NKQ1|SGSM1_HUMAN (Small G protein signaling modulator 1 OS=Homo sapiens OX=9606 GN=SGSM1 PE=1 SV=2)

HSP 1 Score: 364.385 bits (934), Expect = 3.638e-106
Identity = 225/639 (35.21%), Postives = 329/639 (51.49%), Query Frame = 3
Query:  711 IKHYWIRLALTEKVLDKIIDYLVKNSNRFYNHGSVIGDPCYGYILVSLLSGPCSLEYSRVKNPELIPDDPDAGELIQRQKIQNQSGSTGIEAGKSPNLSHAMSTSSLFWSSGSNQFLNKPALVNRQRRLTGIDLDEIPNSGNKSPFSTARQYVESLHQTSSSSLLFGKNNVYCQPREDVNKMPGYLSLHMAVNEMLIKWTPNELMSGGLNDAVFKENSVKVEWDCALMIWVNKVVYIHCHQQADKGETLVLVNHDGSQNPPFDFPQGGHLMSFLTCLENGLLPKCRLDPPLWLKKNREKLFQKSCENPINNSKE---LDQDGPKSAEF----IKPTNKNKTI---FLWSSSDRNSLKFSWFHQPFNKKLTIGNRKVLSQPLEHIVFDYRQAGRHNSQSDELLTDLVFRIVRPKNYNQTMSETHSGXXXXXXXXXITENPKSPNDLH----STVPQ-WHSDYTVLAMKRRCRLSSTEKSKTYG----KSSIRMLCSSMKKEIMARSFYGWLAYSRHMKTIRNHLSQLV--------LPVDLGTKSCKEFIKGLTKEKWTSAFNLNNQIEDNMSVLCYIYRGGCDPELRVQTWPYLLGLFEWNSTENERQATLRKWERRYHVAISDWMVIETVLNEEEDAS 2546
            IKH WIR AL EKVLDKI+ YLV+NS+++Y   +++ DP  G IL SLL GPC+LEY+++K  +    DP A EL+QR +I +               SH    S             +PAL  ++R  +G        S +  P  +AR YVESLHQ S ++LL+GKNNV  QPR+D+  +PGYLSLH   + M +KWTPN+LM+G + D  ++++   V WD A+ I + ++VY+HCHQQ D G T+VLV+ DG Q PPF FP+GGHL+ FL+CLENGLLP  +LDPPLW ++ + K+F K  +     S E    D+D  ++ ++    I P  +++ +   FL S+S   S+  +W   P  + + +  R                     SQ +    D       PK                       E P  P DL     S +P  W       +     +  S + S T G    ++ +++LC +MK +I++R+FYGWLAY RH+ T+R HLS LV        LP D G        +GLT   W    + +   E+   +L  IY GG  PE+R   WP+LLG +++  TE ER+    +    Y   +++W+  E ++ + E  S
Sbjct:  126 IKHLWIRTALFEKVLDKIVHYLVENSSKYYEKEALLMDPVDGPILASLLVGPCALEYTKMKTADHFWTDPSADELVQRHRIHS---------------SHVRQDSPT----------KRPALCIQKRHSSG--------SMDDRPSLSARDYVESLHQNSRATLLYGKNNVLVQPRDDMEAVPGYLSLHQTADVMTLKWTPNQLMNGSVGDLDYEKS---VYWDYAMTIRLEEIVYLHCHQQVDSGGTVVLVSQDGIQRPPFRFPKGGHLLQFLSCLENGLLPHGQLDPPLWSQRGKGKVFPKLRKRSPQGSAESTSSDKDDDEATDYVFRIIYPGMQSEFVAPDFLGSTSSV-SVGPAWMMVPAGRSMLVVAR--------------------GSQWEPARWDTTLPTPSPK-----------------------EQPPMPQDLMDVSVSNLPSLWQPSPRKSSCSSCSQSGSADGSSTNGCNHERAPLKLLCDNMKYQILSRAFYGWLAYCRHLSTVRTHLSALVNHMIVSPDLPCDAG--------QGLTARIWEQYLHDSTSYEEQ-ELLRLIYYGGIQPEIRKAVWPFLLGHYQFGMTETERKEVDEQIHACYAQTMAEWLGCEAIVRQRERES 675          

HSP 2 Score: 277.715 bits (709), Expect = 5.706e-76
Identity = 131/270 (48.52%), Postives = 190/270 (70.37%), Query Frame = 3
Query: 2559 DNEERCAVQIERKSETNEKSNFGNSTSNNKNKKEAETKIVITQKILNVLKQNWTRIEKDVARCDRHFGFFGQTKTGEENLNILQRIMCTWVWENLELGYIQGMCDLLAPILVVFNGHEELTFACFSKYMERMISNFPVKDSTKMDLCFSRMRSAVQILDSDLLNHMQSYGDFTHFYFSYRWFLLDFKREFTYKDVFCLWETIWAADNVASPYFSLFVGLALLLSYRDVIIDNAMEFTDIIRFFNEMAEQHNVQKVLELARELVEKLQLLL 3368
            D+E+  + + E +S     ++   +TS N+    + + +  + ++L++   N  RIEKDV RCDR++ +F        NL  L+ IMC+++W+++E+GY+QGMCDLLAP+LV+ +  E L F+CF++ M+RM  NFP      MD  F+ MRS +QILDS+L   M   GD+THFYF YRWFLLDFKRE  Y DVF +WETIWAA +V+S ++ LF+ LAL+  YRD+I++N M+FTDII+FFNEMAE+HN ++VL+LAR+LV K+Q L+
Sbjct:  884 DSEDNLSEEPEMESLFPALASLAVTTSANEVSPVSSSGVTYSPELLDLYTVNLHRIEKDVQRCDRNYWYFTPA-----NLEKLRNIMCSYIWQHIEIGYVQGMCDLLAPLLVILDD-EALAFSCFTELMKRMNQNFP--HGGAMDTHFANMRSLIQILDSELFELMHQNGDYTHFYFCYRWFLLDFKRELVYDDVFLVWETIWAAKHVSSAHYVLFIALALVEVYRDIILENNMDFTDIIKFFNEMAERHNTKQVLKLARDLVYKVQTLI 1145          

HSP 3 Score: 60.077 bits (144), Expect = 1.554e-7
Identity = 35/83 (42.17%), Postives = 57/83 (68.67%), Query Frame = 3
Query:  246 KEILIKTIKRQVKLLMEEFVNKKYVHEYSSNVISLCASIEACXXXXXXXXXXXXFKESSSLALLEKIAKQNAAAKSICTLMSD 494
            ++ L++T+K++VK +MEE V +K+VHE SS++IS CA++EAC+L GL+RRA G  + +   AL  K+ K    A+ +   + D
Sbjct:   11 RQRLLRTVKKEVKQIMEEAVTRKFVHEDSSHIISFCAAVEACVLHGLRRRAAGFLRSNKIAALFMKVGKNFPPAEDLSRKVQD 93          
BLAST of Small G protein signaling modulator 1 vs. UniProt/SwissProt
Match: sp|Q80U12|SGSM2_MOUSE (Small G protein signaling modulator 2 OS=Mus musculus OX=10090 GN=Sgsm2 PE=1 SV=2)

HSP 1 Score: 299.671 bits (766), Expect = 3.648e-84
Identity = 174/458 (37.99%), Postives = 255/458 (55.68%), Query Frame = 3
Query:  246 KEILIKTIKRQVKLLMEEFVNKKYVHEYSSNVISLCASIEACXXXXXXXXXXXXFKESSSLALLEKIAKQNAAAKSICTLMSDEKLHYCDXXXXXXXXXXXXXXXXXXXXXXXXXXTFGYSWSASSFLGFSNNKFFSSINQSSDNEFINLHWKNLIKHYWIRLALTEKVLDKIIDYLVKNSNRFYNHGSVIGDPCYGYILVSLLSGPCSLEYSRVKNPELIPDDPDAGELIQRQKIQNQSGSTGIEAGKSPNLSHAMSTSSLFWSSGSNQFLNKPALVNRQRRLTGIDLDEIPNSGNKSPFSTARQYVESLHQTSSSSLLFGKNNVYCQPREDVNKMPGYLSLHMAVNEMLIKWTPNELMSGGLNDAVFKENSVKVEWDCALMIWVNKVVYIHCHQQADKGETLVLVNHDGSQNPPFDFPQGGHLMSFLTCLENGLLPKCRLDPPLWLKKNREKLFQK 1619
            KE L+  +K++VK +MEE V +K+VHE SS++I+LC ++EACLL  L+RRA G  +     AL  K+ K    A+ IC  + +                         +         G S  A    G +  K  +   Q+             +KH W+R AL EKVLD+++ YL +N +++Y   +++ DP +G IL  LL GPC+LEY+++K  +    DP A EL+QR +I+             PN   + +               +PAL  R+R  +G       ++      + AR+YVESLHQ S + LL+GKNNV  QP+ED+  +PGYLSLH +   + +KWTPN+LM+G L D+  +++   V WD AL++  +++V IHCHQQ   G TLVLV+ DG Q PP  FPQGGHL+SFL+CLENGLLP+ +L+PPLW ++ + K+F K
Sbjct:    9 KEKLLWNVKKEVKQIMEEAVTRKFVHEDSSHIIALCGAVEACLLHQLRRRAAGFLRSDKMAALFTKVGKTCPVAEDICHKVQE------------------------LQQQAEGRKPSGGSQEALRKQGSTGGKAPALSPQA-------------LKHIWVRTALMEKVLDRVVQYLAENCSKYYEKEALLADPVFGPILACLLVGPCALEYTKLKTADHYWTDPSADELVQRHRIRG-----------PPNRQDSPA--------------KRPALGIRKRHSSG-------SASEDRLAACAREYVESLHQNSRTRLLYGKNNVLVQPKEDMEAVPGYLSLHQSAENLTLKWTPNQLMNGTLGDSELEKS---VYWDYALVVPFSQIVCIHCHQQKSGG-TLVLVSQDGIQRPPLHFPQGGHLLSFLSCLENGLLPRGQLEPPLWTQQGKGKVFPK 393          

HSP 2 Score: 265.774 bits (678), Expect = 1.679e-72
Identity = 121/229 (52.84%), Postives = 171/229 (74.67%), Query Frame = 3
Query: 2682 TQKILNVLKQNWTRIEKDVARCDRHFGFFGQTKTGEENLNILQRIMCTWVWENLELGYIQGMCDLLAPILVVFNGHEELTFACFSKYMERMISNFPVKDSTKMDLCFSRMRSAVQILDSDLLNHMQSYGDFTHFYFSYRWFLLDFKREFTYKDVFCLWETIWAADNVASPYFSLFVGLALLLSYRDVIIDNAMEFTDIIRFFNEMAEQHNVQKVLELARELVEKLQLLL 3368
            T ++L+ +  N  RI+KDV RCDR++ +F  +     NL  L+ IMC++VWE+L++GY+QGMCDLLAP+LV+ + +++L ++CFS  M+RM  NFP      MD  F+ MRS +QILDS+L   M   GD+THFYF YRWFLLDFKRE  Y+DVF +WE IWAA  ++S +F LF+ LAL+ +YR++I DN M+FTDII+FFNE AE+H+ Q++L +AR+LV K+Q+L+
Sbjct:  782 TIELLDTVALNLHRIDKDVQRCDRNYWYFTTS-----NLERLRDIMCSYVWEHLDMGYVQGMCDLLAPLLVILD-NDQLAYSCFSHLMKRMGQNFP--SGGAMDSHFANMRSLIQILDSELFELMHQNGDYTHFYFCYRWFLLDFKRELLYEDVFAVWEVIWAARRISSEHFVLFIALALVEAYREIIRDNNMDFTDIIKFFNERAERHDAQEILRIARDLVHKVQMLI 1002          

HSP 3 Score: 102.834 bits (255), Expect = 9.317e-21
Identity = 51/149 (34.23%), Postives = 84/149 (56.38%), Query Frame = 3
Query: 2121 IRMLCSSMKKEIMARSFYGWLAYSRHMKTIRNHLSQLV----LPVDLGTKSCKEFIKGLTKEKWTSAFNLNNQIEDNMSVLCYIYRGGCDPELRVQTWPYLLGLFEWNSTENERQATLRKWERRYHVAISDWMVIETVLNEEEDASTPT 2555
            +R+LC SMK++I++R+FYGWLAY RH+ T+R HLS LV    +P D    +      GLTK+ W S +  + +    + +L  +Y GG + E+R   WP+LLG +++  ++ E +        RY   +++W   E V+ + E  + P 
Sbjct:  484 LRLLCESMKRQIVSRAFYGWLAYCRHLSTVRTHLSALVHHNIIPPDRPPGAS----GGLTKDVW-SKYQKDEKNYKELELLRQVYYGGVEHEIRKDVWPFLLGHYKFGMSKKEMEQVDTAVAARYQQVLAEWKACEVVVRQREREAHPA 627          
BLAST of Small G protein signaling modulator 1 vs. UniProt/SwissProt
Match: sp|O43147|SGSM2_HUMAN (Small G protein signaling modulator 2 OS=Homo sapiens OX=9606 GN=SGSM2 PE=1 SV=4)

HSP 1 Score: 296.975 bits (759), Expect = 3.373e-83
Identity = 174/458 (37.99%), Postives = 252/458 (55.02%), Query Frame = 3
Query:  246 KEILIKTIKRQVKLLMEEFVNKKYVHEYSSNVISLCASIEACXXXXXXXXXXXXFKESSSLALLEKIAKQNAAAKSICTLMSDEKLHYCDXXXXXXXXXXXXXXXXXXXXXXXXXXTFGYSWSASSFLGFSNNKFFSSINQSSDNEFINLHWKNLIKHYWIRLALTEKVLDKIIDYLVKNSNRFYNHGSVIGDPCYGYILVSLLSGPCSLEYSRVKNPELIPDDPDAGELIQRQKIQNQSGSTGIEAGKSPNLSHAMSTSSLFWSSGSNQFLNKPALVNRQRRLTGIDLDEIPNSGNKSPFSTARQYVESLHQTSSSSLLFGKNNVYCQPREDVNKMPGYLSLHMAVNEMLIKWTPNELMSGGLNDAVFKENSVKVEWDCALMIWVNKVVYIHCHQQADKGETLVLVNHDGSQNPPFDFPQGGHLMSFLTCLENGLLPKCRLDPPLWLKKNREKLFQK 1619
            KE L+  +K++VK +MEE V +K+VHE SS++I+LC ++EACLL  L+RRA G  +     AL  K+ K    A  IC  + +                         +         G S  A    G ++ K  +   Q+             +KH W+R AL EKVLDK++ YL +N +++Y   +++ DP +G IL SLL GPC+LEY+++K  +    DP A EL+QR +I+         A                          +PAL  R+R  +G       ++      + AR+ VESLHQ S + LL+GKN+V  QP+ED+  +PGYLSLH +   + +KWTPN+LM+G L D+  +++   V WD AL++  ++VV IHCHQQ   G TLVLV+ DG Q PP  FPQGGHL+SFL+CLENGLLP+ +L+PPLW ++ + K+F K
Sbjct:    9 KEKLLWNVKKEVKQIMEEAVTRKFVHEDSSHIIALCGAVEACLLHQLRRRAAGFLRSDKMAALFTKVGKTCPVAGEICHKVQE------------------------LQQQAEGRKPSGVSQEALRRQGSASGKAPALSPQA-------------LKHVWVRTALIEKVLDKVVQYLAENCSKYYEKEALLADPVFGPILASLLVGPCALEYTKLKTADHYWTDPSADELVQRHRIRGPPTRQDSPA-------------------------KRPALGIRKRHSSG-------SASEDRLAACARECVESLHQNSRTRLLYGKNHVLVQPKEDMEAVPGYLSLHQSAESLTLKWTPNQLMNGTLGDSELEKS---VYWDYALVVPFSQVVCIHCHQQKSGG-TLVLVSQDGIQRPPLHFPQGGHLLSFLSCLENGLLPRGQLEPPLWTQQGKGKVFPK 393          

HSP 2 Score: 264.618 bits (675), Expect = 3.302e-72
Identity = 125/260 (48.08%), Postives = 179/260 (68.85%), Query Frame = 3
Query: 2589 ERKSETNEKSNFGNSTSNNKNKKEAETKIVITQKILNVLKQNWTRIEKDVARCDRHFGFFGQTKTGEENLNILQRIMCTWVWENLELGYIQGMCDLLAPILVVFNGHEELTFACFSKYMERMISNFPVKDSTKMDLCFSRMRSAVQILDSDLLNHMQSYGDFTHFYFSYRWFLLDFKREFTYKDVFCLWETIWAADNVASPYFSLFVGLALLLSYRDVIIDNAMEFTDIIRFFNEMAEQHNVQKVLELARELVEKLQLLL 3368
            E +  + EK   G   +  +    A      T ++L+ +  N  RI+KDV RCDR++ +F        NL  L+ +MC++VWE+L++GY+QGMCDLLAP+LV  + +++L ++CFS  M+RM  NFP  +   MD  F+ MRS +QILDS+L   M   GD+THFYF YRWFLLDFKRE  Y+DVF +WE IWAA +++S +F LF+ LAL+ +YR++I DN M+FTDII+FFNE AE H+ Q++L +AR+LV K+Q+L+
Sbjct:  754 EPQDPSQEKPQAGELEAGEE--LAAVCAAAYTIELLDTVALNLHRIDKDVQRCDRNYWYFTPP-----NLERLRDVMCSYVWEHLDVGYVQGMCDLLAPLLVTLD-NDQLAYSCFSHLMKRMSQNFP--NGGAMDTHFANMRSLIQILDSELFELMHQNGDYTHFYFCYRWFLLDFKRELLYEDVFAVWEVIWAARHISSEHFVLFIALALVEAYREIIRDNNMDFTDIIKFFNERAEHHDAQEILRIARDLVHKVQMLI 1003          

HSP 3 Score: 100.523 bits (249), Expect = 5.492e-20
Identity = 50/149 (33.56%), Postives = 84/149 (56.38%), Query Frame = 3
Query: 2121 IRMLCSSMKKEIMARSFYGWLAYSRHMKTIRNHLSQL----VLPVDLGTKSCKEFIKGLTKEKWTSAFNLNNQIEDNMSVLCYIYRGGCDPELRVQTWPYLLGLFEWNSTENERQATLRKWERRYHVAISDWMVIETVLNEEEDASTPT 2555
            +R+LC SMK++I++R+FYGWLA+ RH+ T+R HLS L    V+P D    +      GLTK+ W S +  + +    + +L  +Y GG + E+R   WP+LLG +++  ++ E +        RY   +++W   E V+ + E  + P 
Sbjct:  484 LRLLCESMKRQIVSRAFYGWLAHCRHLSTVRTHLSALVHHSVIPPDRPPGAS----AGLTKDVW-SKYQKDKKNYKELELLRQVYYGGIEHEIRKDVWPFLLGHYKFGMSKKEMEQVDAVVAARYQQVLAEWKACEVVVRQREREAHPA 627          
BLAST of Small G protein signaling modulator 1 vs. UniProt/SwissProt
Match: sp|Q8BPQ7|SGSM1_MOUSE (Small G protein signaling modulator 1 OS=Mus musculus OX=10090 GN=Sgsm1 PE=1 SV=2)

HSP 1 Score: 278.87 bits (712), Expect = 1.354e-76
Identity = 126/247 (51.01%), Postives = 180/247 (72.87%), Query Frame = 3
Query: 2628 NSTSNNKNKKEAETKIVITQKILNVLKQNWTRIEKDVARCDRHFGFFGQTKTGEENLNILQRIMCTWVWENLELGYIQGMCDLLAPILVVFNGHEELTFACFSKYMERMISNFPVKDSTKMDLCFSRMRSAVQILDSDLLNHMQSYGDFTHFYFSYRWFLLDFKREFTYKDVFCLWETIWAADNVASPYFSLFVGLALLLSYRDVIIDNAMEFTDIIRFFNEMAEQHNVQKVLELARELVEKLQLLL 3368
             S++NN+    + + +  + ++L++   N  RIEKDV RCDR + +F        NL  L+ IMC+++W+++E+GY+QGMCDLLAP+LV+ +  E L F+CF++ M+RM  NFP      MD  F+ MRS +QILDS+L   M   GD+THFYF YRWFLLDFKRE  Y DVF +WETIWAA +V+S ++ LF+ LAL+  YRD+I++N M+FTDII+FFNEMAE+HN +++L+LAR+LV K+Q+L+
Sbjct:  852 TSSANNEASPVSSSGVTYSPELLDLYTVNLHRIEKDVQRCDRSYWYFTAA-----NLEKLRNIMCSYIWQHIEIGYVQGMCDLLAPLLVILDD-EALAFSCFTELMKRMNQNFP--HGGAMDTHFANMRSLIQILDSELFELMHQNGDYTHFYFCYRWFLLDFKRELVYDDVFSVWETIWAAKHVSSAHYVLFIALALVEVYRDIILENNMDFTDIIKFFNEMAERHNAKQILQLARDLVHKVQILI 1090          

HSP 2 Score: 278.1 bits (710), Expect = 2.787e-76
Identity = 139/303 (45.87%), Postives = 192/303 (63.37%), Query Frame = 3
Query:  711 IKHYWIRLALTEKVLDKIIDYLVKNSNRFYNHGSVIGDPCYGYILVSLLSGPCSLEYSRVKNPELIPDDPDAGELIQRQKIQNQSGSTGIEAGKSPNLSHAMSTSSLFWSSGSNQFLNKPALVNRQRRLTGIDLDEIPNSGNKSPFSTARQYVESLHQTSSSSLLFGKNNVYCQPREDVNKMPGYLSLHMAVNEMLIKWTPNELMSGGLNDAVFKENSVKVEWDCALMIWVNKVVYIHCHQQADKGETLVLVNHDGSQNPPFDFPQGGHLMSFLTCLENGLLPKCRLDPPLWLKKNREKLFQK 1619
            IKH WIR AL  +VLDKI+ YLV+NS+++Y   +++ DP  G IL SLL GPC+LEY+++K  +    DP A EL+QR +I +               SH    S             +PAL  ++R  +G        S +  P  +AR YVESLHQ S ++LL+GKNNV  QPR+D+  +PGYLSLH   + M +KWTPN+LM+G + D  ++++   V WD A+ I + ++VY+HCHQQ D G T+VLV+ DG Q PPF FP+GGHL+ FL+CLENGLLP  +LDPPLW ++ + K+F K
Sbjct:  126 IKHLWIRTALFGRVLDKIVHYLVENSSKYYEKEALLMDPVDGPILASLLVGPCALEYTKMKTADHFWTDPSADELVQRHRIHS---------------SHLRQDSPT----------KRPALCIQKRHSSG--------SMDDRPSISARDYVESLHQDSRATLLYGKNNVLVQPRDDMEAVPGYLSLHQTADVMTLKWTPNQLMNGSVGDLDYEKS---VYWDYAVTIRLEEIVYLHCHQQVDSGGTVVLVSQDGIQRPPFRFPKGGHLLQFLSCLENGLLPHGQLDPPLWSQRGKGKVFPK 392          

HSP 3 Score: 102.834 bits (255), Expect = 1.216e-20
Identity = 53/153 (34.64%), Postives = 82/153 (53.59%), Query Frame = 3
Query: 2112 KSSIRMLCSSMKKEIMARSFYGWLAYSRHMKTIRNHLSQLV--------LPVDLGTKSCKEFIKGLTKEKWTSAFNLNNQIEDNMSVLCYIYRGGCDPELRVQTWPYLLGLFEWNSTENERQATLRKWERRYHVAISDWMVIETVLNEEEDAS 2546
            ++ +++LC +MK +I++R+FYGWLAY RH+ T+R HLS LV        LP D G        +GLT   W      ++       +L  IY GG  PE+R   WP+LLG +++  TE ER+    +    Y   +S+W+  E ++ + E  S
Sbjct:  477 RAPLKLLCDNMKYQILSRAFYGWLAYCRHLSTVRTHLSALVNHMIVSPDLPCDAG--------QGLTASIWEKYIQ-DSTTYPEQELLRLIYYGGVQPEIRRAVWPFLLGHYQFGMTEMERKEVDEQIHACYAQTMSEWLGCEAIVRQRERES 620          
BLAST of Small G protein signaling modulator 1 vs. UniProt/SwissProt
Match: sp|Q8TC07|TBC15_HUMAN (TBC1 domain family member 15 OS=Homo sapiens OX=9606 GN=TBC1D15 PE=1 SV=2)

HSP 1 Score: 142.124 bits (357), Expect = 2.456e-33
Identity = 105/370 (28.38%), Postives = 176/370 (47.57%), Query Frame = 3
Query: 2226 QLVLPVDLGTKSCKEFIKGLTKEKWTSAFNLNNQI--EDNMSVLCYIYRGGCDPELRVQTWPYLLGLFEWNSTENERQATLRKWERRYHVAISDWMVIETVLNEEEDASTPTDDNEERCAVQIERKSETNEKSNFGNSTSNNKNKKEAETKIVITQKILNVLKQNWTRIEKDVARCDRHFGFF-GQTKTGEENLNILQRIMCTWVWENLELGYIQGMCDLLAPILVVFNGHEELTFACFSKYMERMISNFPVKDSTKMDLCFSRMRSAVQILDSDLLNHMQSYGDFTHFYFSYRWFLLDFKREFTYKDVFCLWETIWAADNVASPYFSLFVGLALLLSYRDVIIDNAMEFTDIIRFFNEMAEQHNVQKVL 3326
            +++  +DLG +   +  + ++ E+WT   +   +I   DNM  +  I+RGG    LR Q W +LLG F W+ST+ ER    ++    Y                             R  +Q +  S+  EK N                         + L+   + IEKDV R DR   F+ GQ   G   L +L  I+ T+   + +LGY+QGM DLL+P+L V   +E   F CF+ YM++M  NF  +    M     ++ + +++LDS   ++++S  D  + YF +RW L+ FKREF++ D+  LWE +W    +    F L +  A+L S +  I++    F +I++  NE++ + +V+ +L
Sbjct:  298 EVITRIDLGERPVVQRREPVSLEEWTKNIDSEGRILNVDNMKQM--IFRGGLSHALRKQAWKFLLGYFPWDSTKEERTQLQKQKTDEYF----------------------------RMKLQWKSISQEQEKRN-------------------------SRLRDYRSLIEKDVNRTDRTNKFYEGQDNPG---LILLHDILMTYCMYDFDLGYVQGMSDLLSPLLYVME-NEVDAFWCFASYMDQMHQNFE-EQMQGMKTQLIQLSTLLRLLDSGFCSYLESQ-DSGYLYFCFRWLLIRFKREFSFLDILRLWEVMWT--ELPCTNFHLLLCCAILESEKQQIMEKHYGFNEILKHINELSMKIDVEDIL 604          
BLAST of Small G protein signaling modulator 1 vs. TrEMBL
Match: R7TEE5 (Uncharacterized protein OS=Capitella teleta OX=283909 GN=CAPTEDRAFT_101633 PE=4 SV=1)

HSP 1 Score: 553.903 bits (1426), Expect = 1.525e-177
Identity = 330/892 (37.00%), Postives = 487/892 (54.60%), Query Frame = 3
Query:  714 KHYWIRLALTEKVLDKIIDYLVKNSNRFYNHGSVIGDPCYGYILVSLLSGPCSLEYSRVKNPELIPDDPDAGELIQRQKIQNQSGSTGIEAGKSPNLSHAMSTSSLFWSSGSNQFLNKPAL-VNRQRRLTGIDLDEIPNSGNKSPFSTARQYVESLHQTSSSSLLFGKNNVYCQPREDVNKMPGYLSLHMAVNEMLIKWTPNELMSGGLNDAVFKENSVK-VEWDCALMIWVNKVVYIHCHQQADKGETLVLVNHDGSQNPPFDFPQGGHLMSFLTCLENGLLPKCRLDPPLWLKKNREKLFQKSC-ENPINNSKELDQDGPKSAEFIKPTNKNKTIFLWSSSDRNSLKFSWFHQPFNKKLTIGNRKVLSQPLEHIVFDYRQAGRHNSQSDELLTDLVFRIV---RPKNYNQTMSETHSGXXXXXXXXXITENPKSPNDLHSTVPQWHSDYTVLAMKRRCRLSSTEKSKTYG-KSSIRMLCSSMKKEIMARSFYGWLAYSRHMKTIRNHLSQLVLPVDLGTKSCKEFIKGLTKEKWTSAFNLNNQIEDNMSVLCYIYRGGCDPELRVQTWPYLLGLFEWNSTENERQATLRKWERRYHVAISDWMVIETVLNEEEDASTPTDDNEERCAVQIERKSETNEKSNFGNSTSNNKNKKEAETKIVITQKILNVLKQNWTRIEKDVARCDRHFGFFGQTKTGEENLNILQRIMCTWVWENLELGYIQGMCDLLAPILVVFNGHEELTFACFSKYMERMISNFPVKDSTKMDLCFSRMRSAVQILDSDLLNHMQSYGDFTHFYFSYRWFLLDFKREFTYKDVFCLWETIWAADNVASPYFSLFVGLALLLSYRDVIIDNAMEFTDIIRFFNEMAEQHNVQKVLELARELVEKLQLLL 3368
            K+ WIR+AL EK L KI++YLV NS+++Y   +++ DPC G    +LL GPC+L+Y+R+K P+    DP A EL+QR +I +           S + +H M + S            +P L V   RR T    +E      ++  ++A++YVESLHQ + S+LL+GKNNV  QPREDV  + GYLSLH     + +KWTPN+LM+G  +    +E++ + + WD A+ ++++++VY+HCHQ++D G T+VLV  DG Q                              PP+   K    L   SC EN +    +LD                    LWS   R  +        F +    G+R  LS            A   +  S++  TD VFRIV   RP+N       +  G             P  P  + +  P      +V ++     ++      T G +S+++MLC +M+++I++R+FYGWL++ RH+KT+R HLS LV  V +      +   GL+ E W +  +    ++D  ++   +Y GGC  E+R + WPYLLG + + STE ER       +++Y   +S+W+ IE ++ +         D E   A   +   E+ +        S+  N  E          +L+ +  N  RI+KDV RCDR++ +F  T     NL+ L+ +MCT+VWE+LE+GY+QGMCDL+AP+LV+F+  E   ++CF   M+RM SNFP      MD  F+ MRS +QILD +L  HM  YGD+THFYF YRWFLLDFKRE  Y DVFC+WETIWAA +++S +F LF+ LAL+  YRD+I+DN M+FTDII+FFNEMAE+HN ++VL+L+RELV KLQ L+
Sbjct:   99 KYLWIRIALFEKQLAKILEYLVTNSSKYYEKDALMTDPCDGPTFSTLLVGPCALDYTRMKTPDHFWTDPPADELVQRHRIHS-----------SAHGNHQMRSDSP----------KRPGLQVLPVRRHTSSSSEE----SARTVLTSAKEYVESLHQNNKSTLLYGKNNVLVQPREDVEPLAGYLSLHQESAGLSVKWTPNQLMNGCCDKEQDEESADRSLFWDFAVTVYIDEIVYLHCHQRSDTGGTIVLVGQDGVQR-----------------------------PPIHFPKGGHLLAFLSCLENGLLPHGQLDPP------------------LWSQRGRGKV--------FPRLKRKGSR--LSS----------AASAGSGHSEDEATDYVFRIVSTFRPENLPTLQWASSQG-----------SRPPVPEVIATPPPP-----SVSSLDEAMDINGDVDEATEGHRSAVKMLCDTMRRQILSRAFYGWLSHCRHLKTVRTHLSGLVNNVIVAVDDPSDASGGLSAELW-AEMSQGGVVKDKGNIYRLVYYGGCVHEVRKEVWPYLLGHYAFGSTEEERVEHDDHVKQQYERTMSEWLAIEAIVRQR--------DKETMAANLAKLSQESQDMIPLVRKDSSLSNDAE----------LLDSVALNLHRIDKDVQRCDRNYWYFTPT-----NLDKLRNVMCTYVWEHLEVGYVQGMCDLVAPLLVIFDD-EAKAYSCFCHLMKRMSSNFP--HGGAMDQHFANMRSLIQILDPELFEHMHQYGDYTHFYFCYRWFLLDFKRELVYDDVFCVWETIWAARHISSRHFVLFLALALVQYYRDIIMDNNMDFTDIIKFFNEMAERHNAKQVLQLSRELVYKLQDLI 855          
BLAST of Small G protein signaling modulator 1 vs. TrEMBL
Match: A0A267FAU7 (Uncharacterized protein OS=Macrostomum lignano OX=282301 GN=BOX15_Mlig019554g1 PE=4 SV=1)

HSP 1 Score: 540.421 bits (1391), Expect = 2.915e-170
Identity = 333/964 (34.54%), Postives = 474/964 (49.17%), Query Frame = 3
Query:  711 IKHYWIRLALTEKVLDKIIDYLVKNSNRFYNHGSVIGDPCYGYILVSLLSGPCSLEYSRVKNPEL-IPDDPDAGELIQRQKIQN--QSGSTGIEAGKSPNLSHAMSTSSLFWSSGSNQFLNKPALVNRQRRLTGIDLDEIPNSGNKSPFSTARQYVESLHQTSSSSLLFGKNNVYCQPREDVNKMPGYLSLHMAVNEMLIKWTPNELMSGGL---------------------------NDAVFKENSVKVE---WDCALMIWVNKVVYIHCHQQADKGETLVLVNHDGSQNPPFDFPQGGHLMSFLTCLENGLLPKCRLDPPLWLKKNREKLFQKSCENPINNSKELDQDGPKSAEFIKPTNKNKTIFLWSSSDRNSLKFSWFHQPFNKKLTIGNRKVLSQPLEHIVFDYRQAGRHNSQSDELLTDLVFRIV-RPKNYNQTMSETHSGXXXXXXXXXITENPKSPNDLHSTVPQWHSDYTVLAMKRRCRLSSTEKSKTYGKSSIRMLCSSMKKEIMARSFYGWLAYSRHMKTIRNHLSQLVLPVDLGTKSCKEFIKGLTKEKWTSAFNLNNQIEDNMSVLCYIYRGGCD-PELRVQTWPYLLGLFEWNSTENERQATLRKWERRYHVAISDWMVIETVLNEEE-----------------DASTPTDDNEERCAVQIERKSETNEKSNFGNSTSNNKNKKEAETKI--------------------VITQKILNVLKQNWTRIEKDVARCDRHFGFFGQTKTGEENLNILQRIMCTWVWENLELGYIQGMCDLLAPILVVFNGHEELTFACFSKYMERMISNFP------VKDSTKMDLCFSRMRSAVQILDSDLLNHMQSYGDFTHFYFSYRWFLLDFKREFTYKDVFCLWETIWAADNVASPYFSLFVGLALLLSYRDVIIDNAMEFTDIIRFFNEMAEQHNVQKVLELARELVEKLQLLL 3368
            +K  WIR+AL EK L +II++LV+N  +FY   S+IGDPC G +L SLL GPC+LE+ + + P + +  D  A EL+QR +I +  ++ +   +  + P+L    S S     +G        A  NR+R   G  + E               +V+ LHQ S ++LLFGKNNV  Q      KMPGYLSLH+  + + +KW PN LM  G                            N A   +    +E   W+ AL I V  +VYIHCH     G +LV V HDG+Q PP  FP GGHL+ FLTCLENGLLP   L+PPLW  + + KL  +                 K    +K +  +  I     +D+   +        N + + G      QP +    D  QA    S  D+ + D VFRIV R   Y    +E                    P +   +V  W   Y+  A++ R    +    +   + +IR  C SM+K+I++R+FYGWLA+ RHM  +R HL  LV     G    +++  GLT+  W +         D       +Y GGC  PELR + WP LLG   W S+E ERQ      + R+   +S+W  ++ ++ E +                  A+TPT       AV       +    +   +T + +        +                    V + ++++ +  NW RI+KDV RCDRH  FF    T   NL  L+ IMC +VW+NL +GYIQG CDLLAP+LV     E LT ACFS  M++M++NFP          + MD   + +R+ +Q+ D  L  HM   GD+THFYF YRWFLL+FKREF YKDV  +W+TIW+A ++ S +F++FV +ALL  YR VII+N M+FTDII+F+NEMAE H +  +LE A +L ++L  L+
Sbjct:  164 VKFQWIRVALMEKHLARIIEHLVENGRQFYETDSIIGDPCDGPLLASLLVGPCALEFDKSQGPGMEMCTDLSADELLQRHRIHSPLRNPAASPKPARKPSLKLKRSQSP----AGGE------AAANRRRSPAGGGMAE---------------FVQLLHQNSRATLLFGKNNVLSQTPALPRKMPGYLSLHLEPSGLTVKWMPNLLMMAGSTSDSEASLAAPNSSLAASASGSESGQSNPASPWQAGETIEAPPWESALTIRVEDMVYIHCHSNQPVGCSLVFVAHDGTQKPPLQFPPGGHLLQFLTCLENGLLPGGALEPPLWSHRCKGKLLPRM----------------KRRSILKDSFISGLIMSGDDADKGGSQA-------NAEQSDG------QPADEQPGDSEQA---PSDFDDNM-DFVFRIVMRESKYRSATAEA------------------DPVEEAGSVFSWQESYSAEALQSRLTQPAAPAER---QQTIRQACDSMRKQILSRAFYGWLAHVRHMSCVRRHLPDLVT-CRAGLGRREDYPDGLTEAIWEAG--------DKQEAWRALYWGGCSKPELRKKVWPVLLGFHSWESSEAERQRATEAAQARFENLLSEWGPLDAIVRENDRELAATARDLMIARARTSAATPTPAGRPLLAVPGRLAEASPATEDAAAATPSKEGAAGGSAAVPSSLSRESIASSASQASNGGVYSSELIDSVTANWHRIDKDVDRCDRHVTFF----TVPANLEKLRNIMCCYVWQNLSVGYIQGFCDLLAPLLVALE-EEGLTLACFSLLMKQMVANFPGAAENCASTESLMDQHLANLRATIQVTDPQLFEHMLKRGDYTHFYFCYRWFLLEFKREFCYKDVCLIWDTIWSASHLVSKHFNVFVAMALLKEYRGVIIENDMDFTDIIKFYNEMAEHHRLSSILESAHDLADQLVKLV 1034          

HSP 2 Score: 68.1662 bits (165), Expect = 1.231e-7
Identity = 44/94 (46.81%), Postives = 68/94 (72.34%), Query Frame = 3
Query:  219 EIQSEKCSEKEILIKTIKRQVKLLMEEFVNKKYVHEYSSNVISLCASIEACXXXXXXXXXXXXFKESSSLALLEKIAKQNAAAKSIC-TLMSDE 497
            +I S     +E+L++ +KR+VK LMEE V ++ VH+  S + SLCA ++ CLL GLKR +LG+F++SS+LALL+KI++   AAK++   L +DE
Sbjct:   48 KINSSGAEYREMLLRHVKREVKQLMEESVTRRGVHQECSIITSLCAGVDNCLLYGLKRHSLGMFRDSSTLALLQKISRSCPAAKAVTDRLQTDE 141          
BLAST of Small G protein signaling modulator 1 vs. TrEMBL
Match: A0A267G274 (Uncharacterized protein (Fragment) OS=Macrostomum lignano OX=282301 GN=BOX15_Mlig019554g2 PE=4 SV=1)

HSP 1 Score: 537.339 bits (1383), Expect = 1.011e-168
Identity = 332/964 (34.44%), Postives = 473/964 (49.07%), Query Frame = 3
Query:  711 IKHYWIRLALTEKVLDKIIDYLVKNSNRFYNHGSVIGDPCYGYILVSLLSGPCSLEYSRVKNPEL-IPDDPDAGELIQRQKIQN--QSGSTGIEAGKSPNLSHAMSTSSLFWSSGSNQFLNKPALVNRQRRLTGIDLDEIPNSGNKSPFSTARQYVESLHQTSSSSLLFGKNNVYCQPREDVNKMPGYLSLHMAVNEMLIKWTPNELMSGGL---------------------------NDAVFKENSVKVE---WDCALMIWVNKVVYIHCHQQADKGETLVLVNHDGSQNPPFDFPQGGHLMSFLTCLENGLLPKCRLDPPLWLKKNREKLFQKSCENPINNSKELDQDGPKSAEFIKPTNKNKTIFLWSSSDRNSLKFSWFHQPFNKKLTIGNRKVLSQPLEHIVFDYRQAGRHNSQSDELLTDLVFRIV-RPKNYNQTMSETHSGXXXXXXXXXITENPKSPNDLHSTVPQWHSDYTVLAMKRRCRLSSTEKSKTYGKSSIRMLCSSMKKEIMARSFYGWLAYSRHMKTIRNHLSQLVLPVDLGTKSCKEFIKGLTKEKWTSAFNLNNQIEDNMSVLCYIYRGGCD-PELRVQTWPYLLGLFEWNSTENERQATLRKWERRYHVAISDWMVIETVLNEEE-----------------DASTPTDDNEERCAVQIERKSETNEKSNFGNSTSNNKNKKEAETKI--------------------VITQKILNVLKQNWTRIEKDVARCDRHFGFFGQTKTGEENLNILQRIMCTWVWENLELGYIQGMCDLLAPILVVFNGHEELTFACFSKYMERMISNFP------VKDSTKMDLCFSRMRSAVQILDSDLLNHMQSYGDFTHFYFSYRWFLLDFKREFTYKDVFCLWETIWAADNVASPYFSLFVGLALLLSYRDVIIDNAMEFTDIIRFFNEMAEQHNVQKVLELARELVEKLQLLL 3368
            +K  WIR+AL EK L +II++LV+N  +FY   S+IGDPC G +L SLL GPC+LE+ + + P + +  D  A EL+QR +I +  ++ +   +  + P+L    S S     +G        A  NR R   G  + E               +V+ LHQ S ++LLFGKNNV  Q      KMPGYLSLH+  + + +KW PN LM  G                            N A   +    +E   W+ AL I V  +VYIHCH     G +LV V HDG+Q PP  FP GGHL+ FLTC+ENGLLP   L+PPLW  + + KL  +                 K    +K +  +  I     +D+   +        N + + G      QP +    D  QA    S  D+ + D VFRIV R   Y    +E                    P +   +V  W   Y+  A++ R    +    +   + +IR  C SM+K+I++R+FYGWLA+ RHM  +R HL  LV     G    +++  GLT+  W +         D       +Y GGC  PELR + WP LLG   W S+E ERQ      + R+   +S+W  ++ ++ E +                  A+TPT       AV       +    +   +T + +        +                    V + ++++ +  NW RI+KDV RCDRH  FF    T   NL  L+ IMC +VW+NL +GYIQG CDLLAP+LV     E LT ACFS  M++M++NFP          + MD   + +R+ +Q+ D  L  HM   GD+THFYF YRWFLL+FKREF YKDV  +W+TIW+A ++ S +F++FV +ALL  YR VII+N M+FTDII+F+NEMAE H +  +LE A +L ++L  L+
Sbjct:  192 VKFQWIRVALMEKHLARIIEHLVENGRQFYETDSIIGDPCDGPLLASLLVGPCALEFDKSQGPGMEMCTDLSADELLQRHRIHSPLRNPAASPKPARKPSLKLKRSQSP----AGGE------AAANRWRSPAGGGMAE---------------FVQLLHQNSRATLLFGKNNVLSQTPALPRKMPGYLSLHLEPSGLTVKWMPNLLMMAGSTSDSEASLAAPNSSPAASASGSESGQSNPASPWQAGETIEAPPWESALTIRVEDMVYIHCHSNQPVGCSLVFVAHDGTQKPPLQFPPGGHLLQFLTCMENGLLPGGALEPPLWSHRCKGKLLPRM----------------KRRSILKDSFISGLIMSGDDADKGGSQA-------NAEQSDG------QPADEQPGDSEQA---PSDFDDNM-DFVFRIVMRESKYRSATAEA------------------DPVEEAGSVFSWQESYSAEALQSRLTQPAAPAER---QQTIRQACDSMRKQILSRAFYGWLAHVRHMSCVRRHLPDLVT-CRAGLGRREDYPHGLTEAIWEAG--------DKQEAWRALYWGGCSKPELRKKVWPVLLGFHSWESSEAERQRATEAAQARFENLLSEWGPLDAIVRENDRELAATARDLMIARARTSAATPTPAGRPLLAVPGRPAEASPATEDAAAATPSKEGAAGGSAAVPSSLSRESIASSASQASNGGVYSGELIDSVTANWHRIDKDVDRCDRHVTFF----TVPANLEKLRNIMCCYVWQNLSVGYIQGFCDLLAPLLVALE-EEGLTLACFSLLMKQMVANFPGAAENCASTESLMDQHLANLRATIQVTDPQLFEHMLKRGDYTHFYFCYRWFLLEFKREFCYKDVCLIWDTIWSASHLVSKHFNVFVAMALLKEYRGVIIENDMDFTDIIKFYNEMAEHHRLSSILESAHDLADQLVKLV 1062          

HSP 2 Score: 70.0922 bits (170), Expect = 3.394e-8
Identity = 46/94 (48.94%), Postives = 68/94 (72.34%), Query Frame = 3
Query:  219 EIQSEKCSEKEILIKTIKRQVKLLMEEFVNKKYVHEYSSNVISLCASIEACXXXXXXXXXXXXFKESSSLALLEKIAKQNAAAKSIC-TLMSDE 497
            +I S     +E+L++ +KR+VK LMEE V ++ VH+  S + SLCA +E CLL GLKR +LG+F++SS+LALL+KI++   AAK+I   L +DE
Sbjct:   76 KINSSGAEYREMLLRHVKREVKQLMEESVTRRGVHQECSIITSLCAGVENCLLYGLKRHSLGMFRDSSTLALLQKISRSCPAAKAITDRLQTDE 169          
BLAST of Small G protein signaling modulator 1 vs. TrEMBL
Match: A0A226E6I6 (Small G protein signaling modulator 1 OS=Folsomia candida OX=158441 GN=Fcan01_12820 PE=4 SV=1)

HSP 1 Score: 526.554 bits (1355), Expect = 2.023e-165
Identity = 341/966 (35.30%), Postives = 492/966 (50.93%), Query Frame = 3
Query:  711 IKHYWIRLALTEKVLDKIIDYLVKNSNRFYNHGSVIGDPCYGYILVSLLSGPCSLEYSRVKNPELIPDDPDAGELIQRQKIQNQSGSTGIE--AGKSPNLSHAMSTSSLFWSSGSNQFLNKPALVNRQRRLTGIDLDEIPNSGNKSPFSTARQYVESLHQTSSSSLLFGKNNVYCQPREDVNKMPGYLSLHMAVNEMLIKWTPNELMSGGLNDA--------VFKEN-----SVKVEWDCALMIWVNKVVYIHCHQQADKGETLVLVNHDGSQNPPFDFPQGGHLMSFLTCLENGLLPKCRLDPPLWLKKNREKLFQKSCENPINNSKELDQDGPKSAEFIKPTNKNKTIFLWSSSDRNSLKFSWFHQPFNKKLTIGNRKVL--SQPLEHIVFDYRQAGRHNSQSDELLTDLVFRIVRPKNYNQTMSETHSGXXXXXXXXXITENP---KSPNDLHSTVPQ-------WHSDYTVLAMKRRCRLSSTEKSKTYGKSSIRMLCSSMKKEIMARSFYGWLAYSRHMKTIRNHLSQLVLPVDLGTKSCKEFIKGLTKEKWTSAFNLNNQIEDNMSVLCYIYRGGCDPELRVQTWPYLLGLFEWNSTENERQATLRKWERRYHVAISDWMVIETV---------------LNEEEDASTPTDDNEERCAVQIERKSET-------------NEKSNFGNSTS--------NNKNKKEAETKI-----------------VITQKILNVLKQNWTRIEKDVARCDRHFGFFGQTKTGEENLNILQRIMCTWVWENLELGYIQGMCDLLAPILVVFNGHEELTFACFSKYMERMISNFPVKDSTKMDLCFSRMRSAVQILDSDLLNHMQSYGDFTHFYFSYRWFLLDFKREFTYKDVFCLWETIWAADNVASPYFSLFVGLALLLSYRDVIIDNAMEFTDIIRFFNEMAEQHNVQKVLELARELVEKLQLLL 3368
            +K+ WIRLAL EK L KI+DY+V NS+++Y   +++ DP YG IL SLL GPC+L++S+++  E    DP A EL+QR +I +    T     A K P L +  S    F +S  N                                  ++ YVESLHQ S S+LL+GKNNV    +E    + GYLSLH   + + +KWTPN+LM+G  +DA        V K+       + + W+ AL + V++ VY+HCHQ ++  + +VLV  DG Q PP  FP+GGHL++FL+CLENGLLP   LDPPLW ++ +E + +                                  +WS +   ++    F +   K  +  + +V+   QP    + +        +++D+  +D VFRIV P        +            D+ E P    SP+   S VP         HS  T  +      L      +  G+  I+ +C +MKK+I++R+FYGWLA+ RH++T+R HL  LV    + +   ++   GLT+EKW       N   D   +   +Y GG    LR + WP +L        E E    LR   R Y   +S+W+ +E +               L+ EE  S P   +   C ++    +E              N+ SN G+ST          N+N  +A  +                  V + ++L     N  RI+KDV RCDR++ +F      E NL  L+ +MCT+VWEN+E+GY+QGMCDL AP+LV+ +  E L + CF K MERM +NFP      MD  F+ MRS +QILD DL   ++  GD+THFYF YRWFLLDFKREF Y DVF +WET WAA  +AS  + LF+ LALL  YRD+I+ N+M+FTDII+FFNEMAE+H+ + +L++AR LV +LQ L+
Sbjct:  128 MKYLWIRLALIEKQLAKIVDYIVMNSSKYYEKDALVSDPDYGSILSSLLVGPCALDFSKLRTSEYCWRDPPADELVQRHRISSGQFPTPASPPAHKRPGLHYKGSIG--FSNSDDNM--------------------------------RSKDYVESLHQNSKSTLLYGKNNVLVFIKEGTQPLAGYLSLHQYGDALNLKWTPNQLMNG-CSDANNTHDKKYVRKQTFRISVGISIYWEHALNVAVHETVYVHCHQGSE-SDWIVLVGQDGVQRPPIHFPRGGHLLAFLSCLENGLLPHGMLDPPLWSQRGKETVSE----------------------------------IWSKTAMLAISGKVFPKLKRKGSSRFHDQVVMEEQPPTPTIIEEEAP---TTETDQTASDFVFRIVYPNFVRSAFPQD-----------DVLEYPVWQSSPSTPKSAVPPITPRSTPLHSISTTSSTSSSRSLDQQPSIQEQGEP-IQTVCLTMKKQIISRAFYGWLAHCRHLRTVRTHLLGLVHSEIVKSDVPEDASGGLTEEKWKQLQEAGNI--DMKEIYRLVYFGGMAHPLRKKLWPIMLS----GKIEGEDPDKLR---REYEDRMSEWLAVEAIVRQRDREQMAMNLAKLSSEETISEP---HPPTCILETHESNEVFEENEAPATPAKQNDVSNKGSSTKEKSKPPDITNENHNDAHHERDDSDVSSEASPVSSRGGVYSNELLETFGLNIHRIDKDVKRCDRNYWYF-----TESNLEKLRNVMCTYVWENIEMGYVQGMCDLAAPLLVILDD-EALAYGCFRKLMERMSANFP-SGGGAMDAHFANMRSLLQILDHDLFTLIRQNGDYTHFYFCYRWFLLDFKREFCYDDVFLVWETTWAARQLASSEYVLFLALALLTYYRDIILANSMDFTDIIKFFNEMAERHDGKLILQIARSLVLQLQTLI 989          

HSP 2 Score: 73.559 bits (179), Expect = 3.060e-9
Identity = 48/92 (52.17%), Postives = 67/92 (72.83%), Query Frame = 3
Query:  240 SEKEILIKTIKRQVKLLMEEFVNKKYVHEYSSNVISLCASIEACXXXXXXXXXXXXFKESSSLALLEKIAKQNAAAKSICTLMSDEKLHYCD 515
            ++KE LI+ +K++VK +MEE V KK+VHE S  + SLC+S+EAC+  GLKRRALGLFK SS+ ALL K+AK    A +I  L+++  +  CD
Sbjct:    9 TDKEKLIRNVKKEVKSIMEEAVTKKFVHEDSGCITSLCSSVEACVSHGLKRRALGLFKSSSTAALLHKVAKSCQPAATIVQLVAE--VENCD 98          
BLAST of Small G protein signaling modulator 1 vs. TrEMBL
Match: A0A1I8G8Y1 (Uncharacterized protein OS=Macrostomum lignano OX=282301 PE=4 SV=1)

HSP 1 Score: 472.241 bits (1214), Expect = 9.085e-145
Identity = 310/951 (32.60%), Postives = 445/951 (46.79%), Query Frame = 3
Query:  711 IKHYWIRLALTEKVLDKIIDYLVKNSNRFYNHGSVIGDPCYGYILVSLLSGPCSLEYSRVKNPEL-IPDDPDAGELIQRQKIQN--QSGSTGIEAGKSPNLSHAMSTSSLFWSSGSNQFLNKPALVNRQRRLTGIDLDEIPNSGNKSPFSTARQYVESLHQTSSSSLLFGKNNVYCQPREDVNKMPGYLSLHMAVNEMLIKWTPNELMSGGL---------------------------NDAVFKENSVKVE---WDCALMIWVNKVVYIHCHQQADKGETLVLVNHDGSQNPPFDFPQGGHLMSFLTCLENGLLPKCRLDPPLWLKKNREKLFQKSCENPINNSKELDQDGPKSAEFIKPTNKNKTIFLWSSSDRNSLKFSWFHQPFNKKLTIGNRKVLSQPLEHIVFDYRQAGRHNSQSDELLTDLVFRIV-RPKNYNQTMSETHSGXXXXXXXXXITENPKSPNDLHSTVPQWHSDYTVLAMKRRCRLSSTEKSKTYGKSSIRMLCSSMKKEIMARSFYGWLAYSRHMKTIRNHLSQLVLPVDLGTKSCKEFIKGLTKEKWTSAFNLNNQIEDNMSVLCYIYRGGCD-PELRVQTWPYLLGLFEWNSTENERQATLRKWERRYHVAISDWMVIETVLNEEE-----------------DASTPTDDNEERCAVQIERKSETNEKSNFGNSTSNNKNKKEAETKI--------------------VITQKILNVLKQNWTRIEKDVARCDRHFGFFGQTKTGEENLNILQRIMCTWVWENLELGYIQGMCDLLAPILVVFNGHEELTFACFSKYMERMISNFP------VKDSTKMDLCFSRMRSAVQILDSDLLNHMQSYGDFTHFYFSYRWFLLDFKREFTYKDVFCLWETIWAADNVASPYFSLFVGLALLLSYRDVIIDNAMEFTDIIRFFNEMAEQHNVQKVLE 3329
            +K  WIR+AL EK L +II++LV+N  +FY   S+IGDPC G +L SLL GPC+LE+ + + P + +  D  A EL+QR +I +  ++ +   +  + P+L    S S     +G        A  NR+R   G  + E               +V+ LHQ S ++LLFGKNNV  Q      KMPGYLSLH+  + + +KW PN LM  G                            N A   +    +E   W+ AL I V  +VYIHCH     G +LV V HDG+Q PP  FP GGHL+ FLTCLENGLLP   L+PPLW  + + KL  +                 K    +K +  +  I     +D+   +        N + + G      QP +    D  QA    S  D+ + D VFRIV R   Y    +E                    P +   +V  W   Y+  A++ R    +    +   + +IR  C SM+K+I++R+FYGWLA+ RHM  +R HL  LV     G    +++  GLT+  W +         D       +Y GGC  PELR +            S+E ERQ      + R+   +S+W  ++ ++ E +                  A+TPT       AV       +    +   +T + +        +                    V + ++++ +  NW RI+KDV RCDRH  FF    T   NL  L+ IMC +VW+NL                      E LT ACFS  M++M++NFP          + MD   + +R+ +Q+ D  L  HM   GD+THFYF YRWFLL+FKREF YKDV  +W+TIW+A ++ S +F++FV +ALL  YR VII+N M+FTDII+F+NEMAE H +  +LE
Sbjct:  167 VKFQWIRVALMEKHLARIIEHLVENGRQFYETDSIIGDPCDGPLLASLLVGPCALEFDKSQGPGMEMCTDLSADELLQRHRIHSPLRNPAASPKPARKPSLKLKRSQSP----AGGE------AAANRRRSPAGGGMAE---------------FVQLLHQNSRATLLFGKNNVLSQTPALPRKMPGYLSLHLEPSGLTVKWMPNLLMMAGSTSDSEASLAAPNSSLAASASGSESGQSNPASPWQAGETIEAPPWESALTIRVEDMVYIHCHSNQPVGCSLVFVAHDGTQKPPLQFPPGGHLLQFLTCLENGLLPGGALEPPLWSHRCKGKLLPRM----------------KRRSILKDSFISGLIMSGDDADKGGSQA-------NAEQSDG------QPADEQPGDSEQA---PSDFDDNM-DFVFRIVMRESKYRSATAEA------------------DPVEEAGSVFSWQESYSAEALQSRLTQPAAPAER---QQTIRQACDSMRKQILSRAFYGWLAHVRHMSCVRRHLPDLVT-CRAGLGRREDYPDGLTEAIWEAG--------DKQEAWRALYWGGCSKPELRKK------------SSEAERQRATEAAQARFENLLSEWGPLDAIVRENDRELAATARDLMIARARTSAATPTPAGRPLLAVPGRLAEASPATEDAAAATPSKEGAAGGSAAVPSSLSRESIASSASQASNGGVYSSELIDSVTANWHRIDKDVDRCDRHVTFF----TVPANLEKLRNIMCCYVWQNLS--------------------EEGLTLACFSLLMKQMVANFPGAAENCASTESLMDQHLANLRATIQVTDPQLFEHMLKRGDYTHFYFCYRWFLLEFKREFCYKDVCLIWDTIWSASHLVSKHFNVFVAMALLKEYRGVIIENDMDFTDIIKFYNEMAEHHRLSSILE 993          

HSP 2 Score: 68.5514 bits (166), Expect = 1.126e-7
Identity = 44/94 (46.81%), Postives = 68/94 (72.34%), Query Frame = 3
Query:  219 EIQSEKCSEKEILIKTIKRQVKLLMEEFVNKKYVHEYSSNVISLCASIEACXXXXXXXXXXXXFKESSSLALLEKIAKQNAAAKSIC-TLMSDE 497
            +I S     +E+L++ +KR+VK LMEE V ++ VH+  S + SLCA ++ CLL GLKR +LG+F++SS+LALL+KI++   AAK++   L +DE
Sbjct:   51 KINSSGAEYREMLLRHVKREVKQLMEESVTRRGVHQECSIITSLCAGVDNCLLYGLKRHSLGMFRDSSTLALLQKISRSCPAAKAVTDRLQTDE 144          
BLAST of Small G protein signaling modulator 1 vs. Ensembl Cavefish
Match: sgsm1b (small G protein signaling modulator 1 [Source:NCBI gene;Acc:103030982])

HSP 1 Score: 284.648 bits (727), Expect = 1.002e-79
Identity = 154/359 (42.90%), Postives = 211/359 (58.77%), Query Frame = 3
Query:  711 IKHYWIRLALTEKVLDKIIDYLVKNSNRFYNHGSVIGDPCYGYILVSLLSGPCSLEYSRVKNPELIPDDPDAGELIQRQKIQNQSGSTGIEAGKSPNLSHAMSTSSLFWSSGSNQFLNKPALVNRQRRLTGIDLDEIPNSGNKSPFSTARQYVESLHQTSSSSLLFGKNNVYCQPREDVNKMPGYLSLHMAVNEMLIKWTPNELMSGGLNDAVFKENSVKVEWDCALMIWVNKVVYIHCHQQADKGETLVLVNHDGSQNPPFDFPQGGHLMSFLTCLENGLLPKCRLDPPLWLKKNREKLFQK--------SCENPINNSKELDQD------GPKSAEFIKPTNKNKTIFLWSSSDRNS 1745
            IKH WIR ALTEKVLDKI+ YLV+NS++FY    ++ DP  G IL SLL GPC+LEY++ K       DP A EL+QR +I      +G     SP                      +PAL+  Q+R +   +D+ P+         AR YVESLHQ S ++LLFGKNNV  QP +D+  +PGYLSLH     M +KWTPN+LM+G + +  ++++   V WD A+ I + ++VY+HCHQQ D G T+VLV+ DG Q PPF FP+GGHL+ FLTCLE GLLP  +LDPPLW ++ + K+F K        SCE+  +   +   D       P S EF+ P   ++++ +W  + R S
Sbjct:   99 IKHLWIRTALTEKVLDKIVLYLVENSSKFYEREGLLRDPVDGPILASLLVGPCALEYTKAKTANHFWTDPSADELVQRHRIH-----SGHCRQDSPT--------------------KRPALI--QKRQSSGSMDDRPSLW-------ARDYVESLHQNSRATLLFGKNNVLVQPTDDMEAIPGYLSLHQTAELMTLKWTPNQLMNGNMGELDYEKS---VYWDYAMTIRLEEIVYLHCHQQVDSGGTVVLVSQDGIQRPPFRFPKGGHLLQFLTCLETGLLPHGQLDPPLWSQRGKGKVFPKLRKRSPHGSCESFSDKDDDEATDYVFRIIYPGSQEFVGPELMDQSMSMWQPTPRKS 420          

HSP 2 Score: 273.478 bits (698), Expect = 6.257e-76
Identity = 127/248 (51.21%), Postives = 177/248 (71.37%), Query Frame = 3
Query: 2625 GNSTSNNKNKKEAETKIVITQKILNVLKQNWTRIEKDVARCDRHFGFFGQTKTGEENLNILQRIMCTWVWENLELGYIQGMCDLLAPILVVFNGHEELTFACFSKYMERMISNFPVKDSTKMDLCFSRMRSAVQILDSDLLNHMQSYGDFTHFYFSYRWFLLDFKREFTYKDVFCLWETIWAADNVASPYFSLFVGLALLLSYRDVIIDNAMEFTDIIRFFNEMAEQHNVQKVLELARELVEKLQLLL 3368
            G    N+     +      +Q++L++   N  RI+KDV RCDR++ +F  T     NL  L+ IMC++VW++L++GY+QGMCDLLAP+LV+ +  E + F+CF++ M+RM  NFP      MD  F+ MRS +QILDS+L   MQ  GD+THFYF YRWFLLDFKRE  Y DVF +WETIWAA  ++S +F LF+ LAL+  YRD+I++N M+FTDII+FFNEMAE+H+V K+L +AR+LV K+Q+L+
Sbjct:  789 GGEHKNDVASPVSSIGTTYSQELLDLYTLNLHRIDKDVQRCDRNYWYFTTT-----NLEKLRNIMCSYVWQHLDIGYVQGMCDLLAPLLVILDD-EAMAFSCFTELMKRMNQNFP--HGGAMDTHFANMRSLIQILDSELFELMQQNGDYTHFYFCYRWFLLDFKREMVYDDVFSVWETIWAARTISSGHFVLFIALALVELYRDIILENNMDFTDIIKFFNEMAERHDVPKLLVMARDLVHKVQILI 1028          

HSP 3 Score: 108.227 bits (269), Expect = 2.340e-23
Identity = 50/144 (34.72%), Postives = 84/144 (58.33%), Query Frame = 3
Query: 2106 YGKSSIRMLCSSMKKEIMARSFYGWLAYSRHMKTIRNHLSQLVLPVDLGTKSCKEFIKGLTKEKWTSAFNLNNQIEDNMSVLCYIYRGGCDPELRVQTWPYLLGLFEWNSTENERQATLRKWERRYHVAISDWMVIETVLNEEE 2537
            + ++ +++LC +MK +I++R+FYGWLAY RH+ T+R HLS LV P  +      +   GL+ E W  AF  ++   +   +L  +Y GG DP LR + WP+LLG + +  T +ER+    +    Y   +S+W+  E ++ + E
Sbjct:  441 HDRAPLKLLCETMKYQIISRAFYGWLAYCRHLSTVRTHLSALVNPAIIEPDVPYDAKGGLSAEVW-KAFLQDSSAYEEAELLRLVYYGGVDPTLRKEVWPFLLGHYHFTMTLSERKEVDEQVRACYEQTMSEWLGCEAIVKQRE 583          
BLAST of Small G protein signaling modulator 1 vs. Ensembl Cavefish
Match: sgsm1a (small G protein signaling modulator 1a [Source:ZFIN;Acc:ZDB-GENE-060526-379])

HSP 1 Score: 286.96 bits (733), Expect = 1.335e-79
Identity = 143/303 (47.19%), Postives = 194/303 (64.03%), Query Frame = 3
Query:  711 IKHYWIRLALTEKVLDKIIDYLVKNSNRFYNHGSVIGDPCYGYILVSLLSGPCSLEYSRVKNPELIPDDPDAGELIQRQKIQNQSGSTGIEAGKSPNLSHAMSTSSLFWSSGSNQFLNKPALVNRQRRLTGIDLDEIPNSGNKSPFSTARQYVESLHQTSSSSLLFGKNNVYCQPREDVNKMPGYLSLHMAVNEMLIKWTPNELMSGGLNDAVFKENSVKVEWDCALMIWVNKVVYIHCHQQADKGETLVLVNHDGSQNPPFDFPQGGHLMSFLTCLENGLLPKCRLDPPLWLKKNREKLFQK 1619
            ++H WIR AL EKVLDKI+ YLV+NS++FY   +V+ DP  G IL SLL GPC+LEY+++K  +    DP A EL+QR +I +               +H    S             +PAL   Q+R +   +DE P     SP  +AR YVESLHQ S ++LLFGKNNV  QPR+D+  +PGYLSLH     M +KWTPN+LM+G + D  ++++   V WD A+ I + ++VY+HCHQQ D G T+VLV+ DG Q PP  FP+GGHL+ FL+CLENGLLP+ +LDPPLW ++ + K+F K
Sbjct:  149 VRHLWIRTALIEKVLDKIVLYLVENSSKFYEKEAVLMDPVDGPILASLLVGPCALEYTKMKTADHFWTDPSADELVQRHRIHS---------------THYRQDSPT----------KRPALCI-QKRHSSSSMDERP-----SPSPSARDYVESLHQNSRATLLFGKNNVLVQPRDDMEAIPGYLSLHQTAEAMTLKWTPNQLMNGSVGDLDYEKS---VYWDYAMTIRLEEIVYLHCHQQVDSGGTVVLVSQDGIQRPPLRFPRGGHLLQFLSCLENGLLPRGQLDPPLWSQRGKGKVFPK 417          

HSP 2 Score: 242.276 bits (617), Expect = 5.153e-65
Identity = 112/203 (55.17%), Postives = 147/203 (72.41%), Query Frame = 3
Query: 2682 TQKILNVLKQNWTRIEKDVARCDRHFGFFGQTKTGEENLNILQRIMCTWVWENLELGYIQGMCDLLAPILVVFNGHEELTFACFSKYMERMISNFPVKDSTKMDLCFSRMRSAVQILDSDLLNHMQSYGDFTHFYFSYRWFLLDFKREFTYKDVFCLWETIWAADNVASPYFSLFVGLALLLSYRDVIIDNAMEFTDIIRFFN 3290
            +Q++L++   N  RIEKDV RCDR++ +F        NL  L+ IMC++VW++LE+GY+QGMCDLLAP+LV+ +  E L F+CFS+ M+RM  NFP      MD  F+ MRS +QILDS+L   M   GD+THFYF YRWFLLDFKRE  Y DVF +WETIWAA   +S +F LF+ LAL+  YRD+I++N M+FTDII+FFN
Sbjct: 1041 SQEMLDMYTLNLHRIEKDVQRCDRNYWYFTPA-----NLEKLRNIMCSYVWQHLEIGYVQGMCDLLAPLLVILD-DEALAFSCFSELMKRMNQNFP--HGGAMDTHFANMRSLIQILDSELFELMHQNGDYTHFYFCYRWFLLDFKRELVYDDVFSVWETIWAARYASSGHFVLFIALALVEIYRDIILENNMDFTDIIKFFN 1235          

HSP 3 Score: 103.219 bits (256), Expect = 9.357e-22
Identity = 48/142 (33.80%), Postives = 84/142 (59.15%), Query Frame = 3
Query: 2112 KSSIRMLCSSMKKEIMARSFYGWLAYSRHMKTIRNHLSQLVLPVDLGTKSCKEFIKGLTKEKWTSAFNLNNQIEDNMSVLCYIYRGGCDPELRVQTWPYLLGLFEWNSTENERQATLRKWERRYHVAISDWMVIETVLNEEE 2537
            ++ +++LC +MK +I++R+FYGWLAY RH+ T+R HLS LV    +   +  +   GLT E W+      +  E+   +L  +Y GG +P LR + WP+LLG +++  TE++R+    +    Y   +S+W+  E ++ + E
Sbjct:  495 RTPLKLLCDNMKNQIISRAFYGWLAYCRHLSTVRIHLSALVNHTIVEPDAPCDAYGGLTAEVWSKFLQDCSAFEEK-EILRLVYFGGVEPTLRKEVWPFLLGHYQFGMTESDRKEVDDQVRACYEQTMSEWLGCEAIVRQRE 635          

HSP 4 Score: 62.7734 bits (151), Expect = 2.355e-9
Identity = 37/95 (38.95%), Postives = 60/95 (63.16%), Query Frame = 3
Query:  210 LTSEIQSEKCSEKEILIKTIKRQVKLLMEEFVNKKYVHEYSSNVISLCASIEACXXXXXXXXXXXXFKESSSLALLEKIAKQNAAAKSICTLMSD 494
            +T    S +   ++ L++ +K++VK +MEE V +K+VHE SS+++S CA++EAC+L GLKRRA G  + +   AL  K+ K    A+ +C    D
Sbjct:   23 ITPPSLSTEAETRQKLVRNVKKEVKQIMEEAVTRKFVHEDSSHIVSFCAAVEACVLHGLKRRAAGFLRSNKVAALFTKVGKSFPPAEELCRKAQD 117          
BLAST of Small G protein signaling modulator 1 vs. Ensembl Cavefish
Match: sgsm1a (small G protein signaling modulator 1a [Source:ZFIN;Acc:ZDB-GENE-060526-379])

HSP 1 Score: 283.878 bits (725), Expect = 1.487e-79
Identity = 143/303 (47.19%), Postives = 194/303 (64.03%), Query Frame = 3
Query:  711 IKHYWIRLALTEKVLDKIIDYLVKNSNRFYNHGSVIGDPCYGYILVSLLSGPCSLEYSRVKNPELIPDDPDAGELIQRQKIQNQSGSTGIEAGKSPNLSHAMSTSSLFWSSGSNQFLNKPALVNRQRRLTGIDLDEIPNSGNKSPFSTARQYVESLHQTSSSSLLFGKNNVYCQPREDVNKMPGYLSLHMAVNEMLIKWTPNELMSGGLNDAVFKENSVKVEWDCALMIWVNKVVYIHCHQQADKGETLVLVNHDGSQNPPFDFPQGGHLMSFLTCLENGLLPKCRLDPPLWLKKNREKLFQK 1619
            ++H WIR AL EKVLDKI+ YLV+NS++FY   +V+ DP  G IL SLL GPC+LEY+++K  +    DP A EL+QR +I +               +H    S             +PAL   Q+R +   +DE P     SP  +AR YVESLHQ S ++LLFGKNNV  QPR+D+  +PGYLSLH     M +KWTPN+LM+G + D  ++++   V WD A+ I + ++VY+HCHQQ D G T+VLV+ DG Q PP  FP+GGHL+ FL+CLENGLLP+ +LDPPLW ++ + K+F K
Sbjct:  120 VRHLWIRTALIEKVLDKIVLYLVENSSKFYEKEAVLMDPVDGPILASLLVGPCALEYTKMKTADHFWTDPSADELVQRHRIHS---------------THYRQDSPT----------KRPALCI-QKRHSSSSMDERP-----SPSPSARDYVESLHQNSRATLLFGKNNVLVQPRDDMEAIPGYLSLHQTAEAMTLKWTPNQLMNGSVGDLDYEKS---VYWDYAMTIRLEEIVYLHCHQQVDSGGTVVLVSQDGIQRPPLRFPRGGHLLQFLSCLENGLLPRGQLDPPLWSQRGKGKVFPK 388          

HSP 2 Score: 272.707 bits (696), Expect = 9.501e-76
Identity = 128/229 (55.90%), Postives = 170/229 (74.24%), Query Frame = 3
Query: 2682 TQKILNVLKQNWTRIEKDVARCDRHFGFFGQTKTGEENLNILQRIMCTWVWENLELGYIQGMCDLLAPILVVFNGHEELTFACFSKYMERMISNFPVKDSTKMDLCFSRMRSAVQILDSDLLNHMQSYGDFTHFYFSYRWFLLDFKREFTYKDVFCLWETIWAADNVASPYFSLFVGLALLLSYRDVIIDNAMEFTDIIRFFNEMAEQHNVQKVLELARELVEKLQLLL 3368
            +Q++L++   N  RIEKDV RCDR++ +F        NL  L+ IMC++VW++LE+GY+QGMCDLLAP+LV+ +  E L F+CFS+ M+RM  NFP      MD  F+ MRS +QILDS+L   M   GD+THFYF YRWFLLDFKRE  Y DVF +WETIWAA   +S +F LF+ LAL+  YRD+I++N M+FTDII+FFNEMAE HNV++VL +AR+LV K+Q+L+
Sbjct:  800 SQEMLDMYTLNLHRIEKDVQRCDRNYWYFTPA-----NLEKLRNIMCSYVWQHLEIGYVQGMCDLLAPLLVILDD-EALAFSCFSELMKRMNQNFP--HGGAMDTHFANMRSLIQILDSELFELMHQNGDYTHFYFCYRWFLLDFKRELVYDDVFSVWETIWAARYASSGHFVLFIALALVEIYRDIILENNMDFTDIIKFFNEMAEHHNVKQVLAMARDLVCKVQILI 1020          

HSP 3 Score: 98.2117 bits (243), Expect = 3.097e-20
Identity = 59/198 (29.80%), Postives = 103/198 (52.02%), Query Frame = 3
Query: 2112 KSSIRMLCSSMKKEIMARSFYGWLAYSRHMKTIRNHLSQLVLPVDLGTKSCKEFIKGLTKEKWTSAFNLNNQIEDNMSVLCYIYRGGCDPELRVQTWPYLLGLFEWNSTENERQ------ATLRKWERRYHV-AISDWMVIETVLNEEEDASTPTDDNEERCAVQIERKSETNEKSNFGNSTSNNKNKKEAETKIVIT 2684
            ++ +++LC +MK +I++R+FYGWLAY RH+ T+R HLS LV    +   +  +   GLT E W+      +  E+   +L  +Y GG +P LR + WP+LLG +++  TE++R+      ++ R+ + R    + S   V E+V   E+  + P  D  +R          +NE S  GN  ++  +   +     +T
Sbjct:  487 RTPLKLLCDNMKNQIISRAFYGWLAYCRHLSTVRIHLSALVNHTIVEPDAPCDAYGGLTAEVWSKFLQDCSAFEEK-EILRLVYFGGVEPTLRKEVWPFLLGHYQFGMTESDRKESSQSCSSDRQRDARLQSDSSSSTQVFESVEEVEQIETEPKGDEAKRVP------KVSNETSQNGNGNASPDSGHPSSRNFSVT 677          

HSP 4 Score: 53.5286 bits (127), Expect = 1.329e-6
Identity = 33/72 (45.83%), Postives = 47/72 (65.28%), Query Frame = 3
Query:  279 VKLLMEEFVNKKYVHEYSSNVISLCASIEACXXXXXXXXXXXXFKESSSLALLEKIAKQNAAAKSICTLMSD 494
            VK +MEE V +K+VHE SS+++S CA++EAC+L GLKRRA G  + +   AL  K+ K    A+ +C    D
Sbjct:   17 VKQIMEEAVTRKFVHEDSSHIVSFCAAVEACVLHGLKRRAAGFLRSNKVAALFTKVGKSFPPAEELCRKAQD 88          
BLAST of Small G protein signaling modulator 1 vs. Ensembl Cavefish
Match: sgsm1a (small G protein signaling modulator 1a [Source:ZFIN;Acc:ZDB-GENE-060526-379])

HSP 1 Score: 286.574 bits (732), Expect = 2.896e-79
Identity = 143/303 (47.19%), Postives = 194/303 (64.03%), Query Frame = 3
Query:  711 IKHYWIRLALTEKVLDKIIDYLVKNSNRFYNHGSVIGDPCYGYILVSLLSGPCSLEYSRVKNPELIPDDPDAGELIQRQKIQNQSGSTGIEAGKSPNLSHAMSTSSLFWSSGSNQFLNKPALVNRQRRLTGIDLDEIPNSGNKSPFSTARQYVESLHQTSSSSLLFGKNNVYCQPREDVNKMPGYLSLHMAVNEMLIKWTPNELMSGGLNDAVFKENSVKVEWDCALMIWVNKVVYIHCHQQADKGETLVLVNHDGSQNPPFDFPQGGHLMSFLTCLENGLLPKCRLDPPLWLKKNREKLFQK 1619
            ++H WIR AL EKVLDKI+ YLV+NS++FY   +V+ DP  G IL SLL GPC+LEY+++K  +    DP A EL+QR +I +               +H    S             +PAL   Q+R +   +DE P     SP  +AR YVESLHQ S ++LLFGKNNV  QPR+D+  +PGYLSLH     M +KWTPN+LM+G + D  ++++   V WD A+ I + ++VY+HCHQQ D G T+VLV+ DG Q PP  FP+GGHL+ FL+CLENGLLP+ +LDPPLW ++ + K+F K
Sbjct:  149 VRHLWIRTALIEKVLDKIVLYLVENSSKFYEKEAVLMDPVDGPILASLLVGPCALEYTKMKTADHFWTDPSADELVQRHRIHS---------------THYRQDSPT----------KRPALCI-QKRHSSSSMDERP-----SPSPSARDYVESLHQNSRATLLFGKNNVLVQPRDDMEAIPGYLSLHQTAEAMTLKWTPNQLMNGSVGDLDYEKS---VYWDYAMTIRLEEIVYLHCHQQVDSGGTVVLVSQDGIQRPPLRFPRGGHLLQFLSCLENGLLPRGQLDPPLWSQRGKGKVFPK 417          

HSP 2 Score: 242.276 bits (617), Expect = 6.414e-65
Identity = 112/203 (55.17%), Postives = 147/203 (72.41%), Query Frame = 3
Query: 2682 TQKILNVLKQNWTRIEKDVARCDRHFGFFGQTKTGEENLNILQRIMCTWVWENLELGYIQGMCDLLAPILVVFNGHEELTFACFSKYMERMISNFPVKDSTKMDLCFSRMRSAVQILDSDLLNHMQSYGDFTHFYFSYRWFLLDFKREFTYKDVFCLWETIWAADNVASPYFSLFVGLALLLSYRDVIIDNAMEFTDIIRFFN 3290
            +Q++L++   N  RIEKDV RCDR++ +F        NL  L+ IMC++VW++LE+GY+QGMCDLLAP+LV+ +  E L F+CFS+ M+RM  NFP      MD  F+ MRS +QILDS+L   M   GD+THFYF YRWFLLDFKRE  Y DVF +WETIWAA   +S +F LF+ LAL+  YRD+I++N M+FTDII+FFN
Sbjct: 1124 SQEMLDMYTLNLHRIEKDVQRCDRNYWYFTPA-----NLEKLRNIMCSYVWQHLEIGYVQGMCDLLAPLLVILD-DEALAFSCFSELMKRMNQNFP--HGGAMDTHFANMRSLIQILDSELFELMHQNGDYTHFYFCYRWFLLDFKRELVYDDVFSVWETIWAARYASSGHFVLFIALALVEIYRDIILENNMDFTDIIKFFN 1318          

HSP 3 Score: 103.605 bits (257), Expect = 8.239e-22
Identity = 48/142 (33.80%), Postives = 84/142 (59.15%), Query Frame = 3
Query: 2112 KSSIRMLCSSMKKEIMARSFYGWLAYSRHMKTIRNHLSQLVLPVDLGTKSCKEFIKGLTKEKWTSAFNLNNQIEDNMSVLCYIYRGGCDPELRVQTWPYLLGLFEWNSTENERQATLRKWERRYHVAISDWMVIETVLNEEE 2537
            ++ +++LC +MK +I++R+FYGWLAY RH+ T+R HLS LV    +   +  +   GLT E W+      +  E+   +L  +Y GG +P LR + WP+LLG +++  TE++R+    +    Y   +S+W+  E ++ + E
Sbjct:  557 RTPLKLLCDNMKNQIISRAFYGWLAYCRHLSTVRIHLSALVNHTIVEPDAPCDAYGGLTAEVWSKFLQDCSAFEEK-EILRLVYFGGVEPTLRKEVWPFLLGHYQFGMTESDRKEVDDQVRACYEQTMSEWLGCEAIVRQRE 697          

HSP 4 Score: 63.1586 bits (152), Expect = 1.810e-9
Identity = 37/95 (38.95%), Postives = 60/95 (63.16%), Query Frame = 3
Query:  210 LTSEIQSEKCSEKEILIKTIKRQVKLLMEEFVNKKYVHEYSSNVISLCASIEACXXXXXXXXXXXXFKESSSLALLEKIAKQNAAAKSICTLMSD 494
            +T    S +   ++ L++ +K++VK +MEE V +K+VHE SS+++S CA++EAC+L GLKRRA G  + +   AL  K+ K    A+ +C    D
Sbjct:   23 ITPPSLSTEAETRQKLVRNVKKEVKQIMEEAVTRKFVHEDSSHIVSFCAAVEACVLHGLKRRAAGFLRSNKVAALFTKVGKSFPPAEELCRKAQD 117          
BLAST of Small G protein signaling modulator 1 vs. Ensembl Cavefish
Match: sgsm1a (small G protein signaling modulator 1a [Source:ZFIN;Acc:ZDB-GENE-060526-379])

HSP 1 Score: 286.189 bits (731), Expect = 2.929e-79
Identity = 143/303 (47.19%), Postives = 194/303 (64.03%), Query Frame = 3
Query:  711 IKHYWIRLALTEKVLDKIIDYLVKNSNRFYNHGSVIGDPCYGYILVSLLSGPCSLEYSRVKNPELIPDDPDAGELIQRQKIQNQSGSTGIEAGKSPNLSHAMSTSSLFWSSGSNQFLNKPALVNRQRRLTGIDLDEIPNSGNKSPFSTARQYVESLHQTSSSSLLFGKNNVYCQPREDVNKMPGYLSLHMAVNEMLIKWTPNELMSGGLNDAVFKENSVKVEWDCALMIWVNKVVYIHCHQQADKGETLVLVNHDGSQNPPFDFPQGGHLMSFLTCLENGLLPKCRLDPPLWLKKNREKLFQK 1619
            ++H WIR AL EKVLDKI+ YLV+NS++FY   +V+ DP  G IL SLL GPC+LEY+++K  +    DP A EL+QR +I +               +H    S             +PAL   Q+R +   +DE P     SP  +AR YVESLHQ S ++LLFGKNNV  QPR+D+  +PGYLSLH     M +KWTPN+LM+G + D  ++++   V WD A+ I + ++VY+HCHQQ D G T+VLV+ DG Q PP  FP+GGHL+ FL+CLENGLLP+ +LDPPLW ++ + K+F K
Sbjct:  123 VRHLWIRTALIEKVLDKIVLYLVENSSKFYEKEAVLMDPVDGPILASLLVGPCALEYTKMKTADHFWTDPSADELVQRHRIHS---------------THYRQDSPT----------KRPALCI-QKRHSSSSMDERP-----SPSPSARDYVESLHQNSRATLLFGKNNVLVQPRDDMEAIPGYLSLHQTAEAMTLKWTPNQLMNGSVGDLDYEKS---VYWDYAMTIRLEEIVYLHCHQQVDSGGTVVLVSQDGIQRPPLRFPRGGHLLQFLSCLENGLLPRGQLDPPLWSQRGKGKVFPK 391          

HSP 2 Score: 275.404 bits (703), Expect = 1.154e-75
Identity = 128/229 (55.90%), Postives = 170/229 (74.24%), Query Frame = 3
Query: 2682 TQKILNVLKQNWTRIEKDVARCDRHFGFFGQTKTGEENLNILQRIMCTWVWENLELGYIQGMCDLLAPILVVFNGHEELTFACFSKYMERMISNFPVKDSTKMDLCFSRMRSAVQILDSDLLNHMQSYGDFTHFYFSYRWFLLDFKREFTYKDVFCLWETIWAADNVASPYFSLFVGLALLLSYRDVIIDNAMEFTDIIRFFNEMAEQHNVQKVLELARELVEKLQLLL 3368
            +Q++L++   N  RIEKDV RCDR++ +F        NL  L+ IMC++VW++LE+GY+QGMCDLLAP+LV+ +  E L F+CFS+ M+RM  NFP      MD  F+ MRS +QILDS+L   M   GD+THFYF YRWFLLDFKRE  Y DVF +WETIWAA   +S +F LF+ LAL+  YRD+I++N M+FTDII+FFNEMAE HNV++VL +AR+LV K+Q+L+
Sbjct: 1098 SQEMLDMYTLNLHRIEKDVQRCDRNYWYFTPA-----NLEKLRNIMCSYVWQHLEIGYVQGMCDLLAPLLVILD-DEALAFSCFSELMKRMNQNFP--HGGAMDTHFANMRSLIQILDSELFELMHQNGDYTHFYFCYRWFLLDFKRELVYDDVFSVWETIWAARYASSGHFVLFIALALVEIYRDIILENNMDFTDIIKFFNEMAEHHNVKQVLAMARDLVCKVQILI 1318          

HSP 3 Score: 103.219 bits (256), Expect = 9.726e-22
Identity = 48/142 (33.80%), Postives = 84/142 (59.15%), Query Frame = 3
Query: 2112 KSSIRMLCSSMKKEIMARSFYGWLAYSRHMKTIRNHLSQLVLPVDLGTKSCKEFIKGLTKEKWTSAFNLNNQIEDNMSVLCYIYRGGCDPELRVQTWPYLLGLFEWNSTENERQATLRKWERRYHVAISDWMVIETVLNEEE 2537
            ++ +++LC +MK +I++R+FYGWLAY RH+ T+R HLS LV    +   +  +   GLT E W+      +  E+   +L  +Y GG +P LR + WP+LLG +++  TE++R+    +    Y   +S+W+  E ++ + E
Sbjct:  531 RTPLKLLCDNMKNQIISRAFYGWLAYCRHLSTVRIHLSALVNHTIVEPDAPCDAYGGLTAEVWSKFLQDCSAFEEK-EILRLVYFGGVEPTLRKEVWPFLLGHYQFGMTESDRKEVDDQVRACYEQTMSEWLGCEAIVRQRE 671          

HSP 4 Score: 62.3882 bits (150), Expect = 3.379e-9
Identity = 35/83 (42.17%), Postives = 56/83 (67.47%), Query Frame = 3
Query:  246 KEILIKTIKRQVKLLMEEFVNKKYVHEYSSNVISLCASIEACXXXXXXXXXXXXFKESSSLALLEKIAKQNAAAKSICTLMSD 494
            ++ L++ +K++VK +MEE V +K+VHE SS+++S CA++EAC+L GLKRRA G  + +   AL  K+ K    A+ +C    D
Sbjct:    9 RQKLVRNVKKEVKQIMEEAVTRKFVHEDSSHIVSFCAAVEACVLHGLKRRAAGFLRSNKVAALFTKVGKSFPPAEELCRKAQD 91          
BLAST of Small G protein signaling modulator 1 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000006060.1 (pep scaffold:Pmarinus_7.0:GL483653:11070:13246:1 gene:ENSPMAG00000005481.1 transcript:ENSPMAT00000006060.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 223.402 bits (568), Expect = 2.191e-67
Identity = 109/189 (57.67%), Postives = 141/189 (74.60%), Query Frame = 3
Query: 2724 IEKDVARCDRHFGFFGQTKTGEENLNILQRIMCTWVWENLELGYIQGMCDLLAPILVVFNGHEELTFACFSKYMERMISNFPVKDSTKMDLCFSRMRSAVQILDSDLLNHMQSYGDFTHFYFSYRWFLLDFKREFTYKDVFCLWETIWAADNVASPYFSLFVGLALLLSYRDVIIDNAMEFTDIIRFFN 3290
            I+KDV RCDR+F FF        NL  L+RIMC++VWE+L++GY+QGMCDLLAP+LV+ +  E L ++CFS+ M+RMI NFP      MD  F+ MRS +QILDS++   M   GD+THF+F YRWFLLDFKRE  Y+DVF +WE IWAA  V+S +F LF+ LAL+  YRD+I++N M+FTDIIRFFN
Sbjct:    1 IDKDVHRCDRNFWFFTAG-----NLERLRRIMCSYVWEHLDVGYVQGMCDLLAPLLVILDD-EVLAYSCFSQLMKRMIQNFP--QGGAMDNHFANMRSLIQILDSEIFELMHRNGDYTHFFFCYRWFLLDFKRELVYEDVFAVWEAIWAARRVSSEHFVLFLALALVARYRDIILENNMDFTDIIRFFN 181          
BLAST of Small G protein signaling modulator 1 vs. Ensembl Sea Lamprey
Match: tbc1d15 (TBC1 domain family, member 15 [Source:ZFIN;Acc:ZDB-GENE-041111-251])

HSP 1 Score: 134.035 bits (336), Expect = 1.461e-32
Identity = 102/379 (26.91%), Postives = 178/379 (46.97%), Query Frame = 3
Query: 2226 QLVLPVDLGTKSCKEFIKGLTKEKWTSAFNLNNQIEDNMSVLCYIYRGGCDPELRVQTWPYLLGLFEWNSTENERQATLRKWERRYHVAISDWMVIETVLNEEEDASTPTDDNEERCAVQIERKSETNEKSNFGNSTSNNKNKKEAETKIVITQKILNVLKQNWTRIEKDVARCDRHFGFF-GQTKTGEENLNILQRIMCTWVWENLELGYIQGMCDLLAPILVVFNGHEELTFACFSKYMERMISNFPVKDSTK-MDLCFSRMRSAVQILDSDLLNHMQSYGDFTHFYFSYRWFLLDFKREFTYKDVFCLWETIWAADNVASPYFSLFVGLALLLSYRDVIIDNAMEFTDIIRFFNEMAEQHNVQKVLELARELVEKL 3356
            +L+   +LG +   +  + ++ E+W    +   ++ D   +   I +GG    LR + W ++LG + W ST  ER+A ++K    Y                             R  +Q +  SE  EK N     SN ++ K                      IEKDV R DR   F+ G    G   L +L  I+ T+   + +LGY+QGM DLL+PIL V   +E   F CF  YM+++  NF  K+S + M     ++   + +LD    ++++++ D  + YF +RW L+ FKREF+++D+  LWE +W    +    F L +  A+L   R  ++D    F +I++  NE++ + +V+++L+  + +  +L
Sbjct:  268 ELITCTELGPRPNVQRREPVSTEEWERYMDPEGRVRDVDKLKAAICQGGLAHSLRKEVWKFVLGYYPWTSTTEERKAVVKKKADEYF----------------------------RMKLQWKSVSEEQEKRN-----SNLRDYKNL--------------------IEKDVNRTDRTNKFYEGSNNPG---LTLLNDILMTYCMYDFDLGYVQGMSDLLSPILYV-QENEVDAFWCFVGYMDQVHHNF--KESQQGMKTQLVQLCQLLHLLDPSFCDYLETH-DSGNLYFCFRWLLIRFKREFSFQDILRLWEVMWTG--LPCQNFHLLLCCAILDIERQHMMDAKCGFNEILKHVNELSMKLDVEEILKRGQAIYLQL 584          
BLAST of Small G protein signaling modulator 1 vs. Ensembl Sea Lamprey
Match: tbck (TBC1 domain containing kinase [Source:ZFIN;Acc:ZDB-GENE-070112-1062])

HSP 1 Score: 66.2402 bits (160), Expect = 1.794e-11
Identity = 55/198 (27.78%), Postives = 93/198 (46.97%), Query Frame = 3
Query: 2724 IEKDVARCDRHFGFFGQTKTGEENLNILQRIMCTWVWENLELGYIQGMCDLLAPILVV-FNGHEELTFACFSKYMERMISNFPVKDSTKMDL----CFSRMRSAVQILDSDLLNHMQSYGDFTHFYFSYRWFLLDFKREFTYKDVFCLWETIWAADNVASPYFSLFVGLALLLSYRDVIIDNAMEFTDIIRFFNEMAE 3302
            +E    RC +    + +  +  E     +RI+  WV  +  L Y QG+  L AP L + FN    L ++C S ++ + + NF +KD++ +       FS+M   +   D +L NH+ S G     Y +  WFL  F   F    +F LW+T+     + S  F L V +A+L   R  ++ +   F + I  F+++ E
Sbjct:    3 VEVTNPRCHQ----YNELLSSPEGHAKFKRILKAWVLSHPHLVYWQGLDSLCAPFLYLNFNNEAALAYSCMSAFIPKYLHNFFMKDNSNVIQEYLKVFSQM---IAFHDPELNNHLNSIGFIPDLY-AIPWFLTMFTHVFPLHKMFHLWDTLL----LGSSAFPLCVAVAVLQQLRARLLLSG--FNECILLFSDLPE 186          
BLAST of Small G protein signaling modulator 1 vs. Ensembl Sea Lamprey
Match: TBC1D13 (TBC1 domain family member 13 [Source:HGNC Symbol;Acc:HGNC:25571])

HSP 1 Score: 52.7582 bits (125), Expect = 2.976e-7
Identity = 53/204 (25.98%), Postives = 92/204 (45.10%), Query Frame = 3
Query: 2787 EENLNILQRIMCTWVWENLELGYIQGMCDLLAPILVVF--------NGHEEL-TFACFSKYMERMISNF--PVKDST-----KMDLCFSRMRSAVQILDSDLLNHMQSYGDFTHFYFSYRWFLLDFKREFTYKDVFCLWETIWAADNVASPYFSLFVGLALLLSYRDVIIDNAMEFTDIIRFFNEMAEQHNVQKVLELARELVE 3350
            E +  +++RI+  +   N  + Y+QGM +++ PI   F          H E  TF CF+  M  +  NF   + DS       M L +S ++      D +L   +Q       F F++RW  L   +EF   DV  +W+++++        F + V  A+L+  RD ++    +F   +R   +     +VQ +L+ A EL E
Sbjct:  204 EAHWEVVERILFIFAKLNPGIAYVQGMNEIVGPIYYSFATDSSPEWREHAEADTFFCFTNLMSEIRDNFIKSLDDSQCGIGHNMQLVYSTLKER----DLELYMRLQEQNIKPQF-FAFRWLTLLLSQEFLLPDVLRIWDSLFSDTRRFD--FLILVCSAMLMLIRDRMLQG--DFAVNMRLLQDYP-IPDVQPILKKATELRE 397          
BLAST of Small G protein signaling modulator 1 vs. Ensembl Yeast
Match: GYP7 (GTPase-activating protein for yeast Rab family members; members include Ypt7p (most effective), Ypt1p, Ypt31p, and Ypt32p (in vitro); involved in vesicle mediated protein trafficking; contains a PH-like domain [Source:SGD;Acc:S000002393])

HSP 1 Score: 100.138 bits (248), Expect = 7.169e-22
Identity = 75/251 (29.88%), Postives = 116/251 (46.22%), Query Frame = 3
Query: 2721 RIEKDVARCDRHFGFFG------------------QTKTGEENLNI----------------LQRIMCTWVWENLELGYIQGMCDLLAPILVVFNGHEELTFACFSKYMERMISNFPVKDSTKMDLCFSRMRSAVQILDSDLLNHMQSYGDFTHFYFSYRWFLLDFKREFTYKDVFCLWETIWAADNVASPYFSLFVGLALLLSYRDVIIDNAMEFTDIIRFFNEMAEQHNVQKVLELARELVEKLQLLLH 3371
            RI KDV RCDR+   F                      T  E+ N                 LQ I+ T+   N  LGY+QGM DLL+PI V+    E  TF CF+ +M+ M  NF ++D + +      +   VQ++  +L  H+    D  + +F +R  L+ FKREF  +D+  +WE  W      S  F LF  LA+L      I+ +  +F  I++FFNE+  + +   ++  A  L +K + ++H
Sbjct:  451 RISKDVRRCDRNLEIFQYNTIDGLPPPPQQLPANENNSTSPESANDESDDADDGVRNPHLIHLQNILITYNVYNTNLGYVQGMTDLLSPIYVIMK-EEWKTFWCFTHFMDIMERNF-LRDQSGIHEQMLTLVELVQLMLPELSEHLNK-CDSGNLFFCFRMLLVWFKREFEMEDIMHIWENFWTF--YYSSQFQLFFMLAILQKNSQAILQHLNQFDQILKFFNELNGKLDWNDLMVRAELLFKKFEKMMH 696          
BLAST of Small G protein signaling modulator 1 vs. Ensembl Yeast
Match: GYP1 (Cis-golgi GTPase-activating protein (GAP) for yeast Rabs; the Rab family members are Ypt1p (in vivo) and for Ypt1p, Sec4p, Ypt7p, and Ypt51p (in vitro); involved in vesicle docking and fusion [Source:SGD;Acc:S000005596])

HSP 1 Score: 60.4622 bits (145), Expect = 1.028e-9
Identity = 47/177 (26.55%), Postives = 74/177 (41.81%), Query Frame = 3
Query: 2715 WTRIEKDVARCDRHFGFFGQTKTGEENLNILQRIMCTWVWENLELGYIQGMCDLLAPILVVF---------------------------NGHEELTFACFSKYMERMISNFPVKDSTKMDLCFSRMRSAVQILDSDLLNHMQS-YGDFTHFYFSYRWFLLDFKREFTYKDVFCLWET 3161
            W +IE D+ R + H   + Q K+ +   N LQRI+  W   +   GY+QG+ DL+ P    F                              E  TF C +K +E++  N+ +     +      +   V+ +D+DL NH Q+ + +F  F F  RW      REF    V  +W+T
Sbjct:  334 WHQIEIDIPRTNPHIPLY-QFKSVQ---NSLQRILYLWAIRHPASGYVQGINDLVTPFFETFLTEYLPPSQIDDVEIKDPSTYMVDEQITDLEADTFWCLTKLLEQITDNY-IHGQPGILRQVKNLSQLVKRIDADLYNHFQNEHVEFIQFAF--RWMNCLLMREFQMGTVIRMWDT 503          
BLAST of Small G protein signaling modulator 1 vs. Ensembl Nematostella
Match: EDO44527 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RV83])

HSP 1 Score: 263.077 bits (671), Expect = 3.067e-73
Identity = 121/229 (52.84%), Postives = 167/229 (72.93%), Query Frame = 3
Query: 2682 TQKILNVLKQNWTRIEKDVARCDRHFGFFGQTKTGEENLNILQRIMCTWVWENLELGYIQGMCDLLAPILVVFNGHEELTFACFSKYMERMISNFPVKDSTKMDLCFSRMRSAVQILDSDLLNHMQSYGDFTHFYFSYRWFLLDFKREFTYKDVFCLWETIWAADNVASPYFSLFVGLALLLSYRDVIIDNAMEFTDIIRFFNEMAEQHNVQKVLELARELVEKLQLLL 3368
            + ++L+ L  N  RI+KDV RCDR++ +F Q     ENL  L+ ++ ++VW  L +GY+QGMCDL+AP+LV+F+  E +T++CF + M+RM +NFP      MDL FS MRS +Q+LD ++  H+Q  GD THFYF YRWFLLDFKRE  Y DVF +WETIWAA +  + +F LF+ LALL  YRD+I+DN M+FTDII+FFNEMAE+H+ +  LE+AR L+ K+Q L+
Sbjct:  745 SAELLDNLSMNLHRIDKDVQRCDRNYWYFTQ-----ENLLKLRNVISSYVWTTLNVGYVQGMCDLVAPLLVIFD-DESITYSCFVQLMDRMNNNFP--HGGAMDLHFSNMRSLIQVLDPEMFEHLQQNGDLTHFYFCYRWFLLDFKRELLYDDVFKVWETIWAARHCTTDHFVLFIALALLQFYRDIILDNKMDFTDIIKFFNEMAERHDAKAALEMARTLITKVQELI 965          

HSP 2 Score: 231.876 bits (590), Expect = 8.901e-63
Identity = 165/463 (35.64%), Postives = 236/463 (50.97%), Query Frame = 3
Query:  291 MEEFVNKKYVHEYSSNVISLCASIEACXXXXXXXXXXXXFKESSSLALLEKIAKQNAAAKSICTLMSDEKLHYCDXXXXXXXXXXXXXXXXXXXXXXXXXXTFGYSWSASSFLGFSNNKFFSSINQSSDNEFINLH--WKNLIKHYWIRLALTEKVLDKIIDYLVKNSNRFYNHGSVIGDPCYGYILVSLLSGPCSLEYSRVKNPELIPDDPDAGELIQRQKIQNQSGSTGIEAGKSPNLSHAMSTSSLFWSSGSNQFLNKPALVNRQRRLTGIDLDEIPNSGNKSPFSTARQYVESLHQTSSSSLLFGKNNVYCQPREDVNKMPGYLSLHMAVNEMLIKWTPNELMSGGLNDAVFKENSVKVEWDCALMIWVNKVVYIHCHQQADKGETLVLVNHDGSQNPPFDFPQGGHLMSFLTCLENGLLPKCRLDPPLWLKKNREKL---FQKSCEN--PINNSKELD 1658
            MEE V KK++H  SS + SLCA+++A L  GLK+RA GL     +  +LEK+AK + AA  +   +S                                    G   S     G S     S IN S+    IN +    +  K+ WIR+AL EK+L +I+  L   ++ FY   ++I DP  G I + LL GPC+L++S++K P+    DP A EL+QR KI                       SSL+           P+  N  R   G    +   +   +P   AR+++ESLHQ S ++LL+GKNNV  QP E  + +PGYLSLH +   +++KWTPN LMSG        E    + WD AL + +N VVY+HCHQQ+  G  ++L+  DG Q PP  FP  G L+SFL CLENGL P  +LDPPL+  ++R  +    +K+ E+  P++ +KEL+
Sbjct:    1 MEEAVMKKFIHADSSTITSLCAAVQAGLTHGLKKRAGGLLPAYDTQTILEKLAKMSEAAAELVKELS------------------------------------GNESSQKLNNGTSGKVALSCINPSTKK--INGYSVTGHCGKYLWIRIALLEKLLTRIVVDLKSYASMFYEPEALIADPVDGQIFIELLDGPCALDFSKMKTPDNYWTDPSADELVQRHKIH----------------------SSLY---------PVPSSPNPPRPQLGATARKQEENTAVAPV-MAREHIESLHQNSYTTLLYGKNNVNVQPHEKASPIPGYLSLHKSNELLVLKWTPNTLMSGS------DEKEKSLFWDYALTVNLNDVVYLHCHQQSGSG-VVILIGQDGVQRPPIHFPTAGSLLSFLNCLENGLHPFGQLDPPLFAPRSRGLVLPSLKKTGESSAPVSPNKELN 386          

HSP 3 Score: 91.6633 bits (226), Expect = 1.003e-18
Identity = 54/152 (35.53%), Postives = 86/152 (56.58%), Query Frame = 3
Query: 2094 KSKTYGKSSIRMLCSSMKKEIMARSFYGWLAYSRHMKTIRNHLSQLVLPVDL-GTKSCKEFIKGLTKEKWTSAFNLNNQIEDNMSVLCYIYRGGCDPELRVQTWPYLLGLFEWNST-ENERQATLRKWERRYHVAISDWMVIET-VLNEEED 2540
            + K+    S+   C +M+++I  R+F GW +Y RH++T+R HLS LV    + G ++ ++F  GLT+E W   F   +  E++  +  Y+Y GG    LR + WPYLL  + + ST E+ RQ  L K E  Y   + DW  +ET ++  E+D
Sbjct:  445 QKKSVQSESLHSACETMRRQITLRAFNGWSSYVRHLQTVRTHLSFLVSHDTVTGRENGEDFTCGLTEEAWKRLFKDGSVTEED-RLKKYVYFGGISHSLRKEVWPYLLKHYTFGSTPESRRQTDLVKRE-EYQQILEDWRSVETYIIQNEKD 594          
BLAST of Small G protein signaling modulator 1 vs. Ensembl Nematostella
Match: EDO50033 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RF48])

HSP 1 Score: 145.206 bits (365), Expect = 1.022e-36
Identity = 97/361 (26.87%), Postives = 166/361 (45.98%), Query Frame = 3
Query: 2244 DLGTKSCKEFIKGLTKEKWTSAFNLNNQIEDNMSVLCYIYRGGCDPELRVQTWPYLLGLFEWNSTENERQATLRKWERRYHVAISDWMVIETVLNEEEDASTPTDDNEERCAVQIERKSETNEKSNFGNSTSNNKNKKEAETKIVITQKILNVLKQNWTRIEKDVARCDRHFGFFGQTKTGEENLNILQRIMCTWVWENLELGYIQGMCDLLAPILVVFNGHEELTFACFSKYMERMISNFPVKDSTKMDLCFSRMRSAVQILDSDLLNHMQSYGDFTHFYFSYRWFLLDFKREFTYKDVFCLWETIWAADNVASPYFSLFVGLALLLSYRDVIIDNAMEFTDIIRFFNEMAEQHNVQKVL 3326
            DLG        + L++++W +  + + ++ +   +   I+RGG  P LR   W +LLG +++  T   R+   R  E  Y      W  I                     A Q +R +E  E+                                    ++KDV R DR   ++ + +T  +N+  L  ++ T+   N +LGY+QGM DLL+P+L +   +E   F CF   ME+M  NF  ++   M +   ++   ++ +D     +++ + D  + YF +RW L+ FKREF++ D+  LWE  W  +   SP F L V LA+L  +R VI++    F +I+++ NE+A Q +VQ+ L
Sbjct:  154 DLGEAPQVSREEPLSEDEWRTMLDKSGRVINIKKLHERIFRGGISPSLRGDVWRFLLGYYKYGCTFESRKTLCRAKEDEYQTMKMQWQTIS--------------------AKQEKRFAEFRERKQL---------------------------------VDKDVTRTDRTHPYYVEKETENDNVRKLYDVLMTYCMYNFDLGYVQGMSDLLSPVLFLVE-NEVDAFWCFVGLMEKMAHNFD-ENQEGMKMQLHQLGVLLKFVDPGFYTYLEKH-DSGNLYFCFRWLLICFKREFSFDDIMTLWEAFWTQN--LSPNFHLIVCLAILDRHRQVIMECQFGFNEILKYVNELAYQIDVQETL 456          
BLAST of Small G protein signaling modulator 1 vs. Ensembl Nematostella
Match: EDO35100 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SMF5])

HSP 1 Score: 125.176 bits (313), Expect = 3.225e-31
Identity = 87/307 (28.34%), Postives = 162/307 (52.77%), Query Frame = 3
Query: 2283 LTKEKWTSAFNLNNQIEDNMSVLCYIYRGGCDPELRVQTWPYLLGLFEWNSTENERQATLRKWERRYHVAISDWM----VIETVLNEEED-ASTPTD----DNEERCAVQIERKSETNEKSN-FGNSTSNNKNKKEAETKIVITQKILNVLKQNWT--RIEKDVARCDRHFGFF-GQTKTGEENLNILQRIMCTWVWENLELGYIQGMCDLLAPILVVFNGHEELTFACFSKYMERMISNFPVKDSTKMDLCFSRMRSAVQILDSDLLNHMQSYGDFTHFYFSYRWFLLDFKREFTYKDVFCLWETI 3164
            L K++WT   + + +I +   +   +++GG   +LR + W +L GL+ ++ST+ ERQ  L +   +Y+   + W       + ++ E    A  P      + EE C ++ + + + +++++ FG+   N +   +   K+  +++++++ K N +   I+KDV R DR   FF GQ   G  NL +L+ I+ T+   + ++GY QGM D+L+  LVV    +E  ++CF+ YME +  +F   DST M+     +   ++ +D  L  H  S  D     F +RW +L FKREF +++   L+E +
Sbjct:    5 LEKQEWTKMMDQDGRIINESGLRKAVFKGGVSSQLRKEVWRFLYGLYPFSSTQRERQVILAENYTKYNAQKNRWKQEIDAYQNIMGEPGGMAVNPKPLYIRECEELCKLKHDPEEKESQRADAFGSIHDNQRVFLDLTAKVNASRQVIDIEKLNKSIRSIDKDVPRTDRAHPFFKGQ---GNPNLIVLRDILITYAAYHQDVGYAQGMNDILSRFLVVLVAEDE-AYSCFANYMEHVKGDFL--DSTMMN-KIELVGKLLKQMDRQLEQHFTS-NDMGDLLFVHRWLVLGFKREFCFEEALKLFEIL 303          
BLAST of Small G protein signaling modulator 1 vs. Ensembl Nematostella
Match: EDO48014 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RKM9])

HSP 1 Score: 125.176 bits (313), Expect = 1.803e-30
Identity = 91/361 (25.21%), Postives = 158/361 (43.77%), Query Frame = 3
Query: 2283 LTKEKWTSAFNLNNQIEDNMSVLCYIYRGGCDPELRVQTWPYLLGLFEWNSTENERQATLRKWERRYHVAISDWMVIETVLNEEEDASTPTDDNEERCAVQIERKSETNEKSNFGNSTSNNKNKKEAETKIVITQKILNVLKQNWTRIEKDVARCDRHFGFFGQTKTGEENLNILQRIMCTWVWENLELGYIQGMCDLLAPILVVFNGHEELTFACFSKYMERMISNFPVKDSTKMDLCFSRMRSAVQILDSDLLNHMQSYGDFTHFYFSYRWFLLDFKREFTYKDVFCLWETIWAADNVASPYFSLFVGLALLLSYRDVIIDNAMEFTDIIRFFNEMAEQHNVQKVLELARELVEKLQLL 3365
            ++ E W +  N + QIED  +    ++ GG  PE+R   W +LLG F                                         T +  ++ER  ++ E+++   +  N   S ++              ++ +   K     ++KDV R DR   +F     G  N+ +++ I+  +   N E+GY QGM DLL+P+L       +  F CF+  ME  +     KD   MD   + +R  V+++      H+    D     F +RW LL FKREF  + V  +WE  W+     + YF LF+ +A++  Y   ++D  M+  +++ FF +++ + +  KVL  AR+L+ K + L
Sbjct:   94 MSAETWKTFLNSSGQIEDVANFRRAVFFGGLSPEVRKDAWKFLLGYF-----------------------------------------TYSSTSQERADMRKEKEAIYLKAQNIRLSMTD--------------EEYVQFWKVVQCTVDKDVPRTDRSHPYFA--GEGNPNIEVMRSILLNYAIHNPEIGYSQGMSDLLSPVLAALQDEVD-AFWCFAALMEASVFVTSPKDDA-MDKQLAYLRELVRMMQPKFYAHLLIEDDGLDMLFCHRWLLLCFKREFYDEQVLLMWEACWS--RYQTDYFHLFLCVAIMQEYGSEVLDWDMQMDEMLHFFTDLSMKMDGNKVLRTARQLLLKFRKL 393          
BLAST of Small G protein signaling modulator 1 vs. Ensembl Nematostella
Match: EDO42591 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S184])

HSP 1 Score: 95.9005 bits (237), Expect = 6.093e-21
Identity = 56/149 (37.58%), Postives = 79/149 (53.02%), Query Frame = 3
Query: 2724 IEKDVARCDRHFGFFGQTKTGEENLNILQRIMCTWVWENLELGYIQGMCDLLAPILVVFNGHEELTFACFSKYMERMISNFPVKDSTKMDLCFSRMRSAVQILDSDLLNHMQSYGDFTHFYFSYRWFLLDFKREFTYKDVFCLWETIWA 3170
            ++KDV R DR   +F  T     ++  L  I+ T+   N ++ Y+QGM DL +PILVV N  E L + CF   M RM S+F + DS  +   F  +   +Q  D     ++   G     +F YRW LLD KREF ++DV  L E IW+
Sbjct:  230 VQKDVVRTDRVHPYFDVTD-DHPHIRSLFNILVTYALANPDVSYVQGMSDLASPILVVMND-EALAYTCFCALMARMKSHF-LLDSRTVTQKFDHLSMLLQKTDPQYYKYLVDIGA-DDMFFCYRWLLLDLKREFPFEDVLNLMEVIWS 374          
BLAST of Small G protein signaling modulator 1 vs. Ensembl Medaka
Match: sgsm2 (small G protein signaling modulator 2 [Source:NCBI gene;Acc:101175420])

HSP 1 Score: 323.168 bits (827), Expect = 6.252e-94
Identity = 195/517 (37.72%), Postives = 291/517 (56.29%), Query Frame = 3
Query: 2091 EKSKTYGKSSIRMLCSSMKKEIMARSFYGWLAYSRHMKTIRNHLSQLVLPVDLGTKSCKEFIKGLTKEKWTSAFNLNNQIEDNMSVLCYIYRGGCDPELRVQTWPYLLGLFEW----------NSTENER-QATLRKW----------ERRYHVAI---------SDWMVIE------TVLNE------EEDAS---TPT-DDN---------------EERCAVQIER----------------KSETNEKSNFGNSTSNNKNKKE-----AETKI------VITQ---KILNVLKQNWTRIEKDVARCDRHFGFFGQTKTGEENLNILQRIMCTWVWENLELGYIQGMCDLLAPILVVFNGHEELTFACFSKYMERMISNFPVKDSTKMDLCFSRMRSAVQILDSDLLNHMQSYGDFTHFYFSYRWFLLDFKREFTYKDVFCLWETIWAADNVASPYFSLFVGLALLLSYRDVIIDNAMEFTDIIRFFNEMAEQHNVQKVLELARELVEKLQLLL 3368
            E+   + +  ++MLC +MKK+I++R+FYGWLAY RH+ T+R HLS LV    +      E   GL+KE W S +  + +    + +L  +Y GG +  +R + WP+LLG +++          N+  +ER Q  +++W          E+    AI          D  V+       T+ NE      E DA    TP+ DDN               EER  V+ +                  S+ +   + G ST      +E     +E+++      ++T    ++L+ +  N  RI+KDV RCDR++ +F        NL  L+ IMC++VWE+L++GY+QGMCDLLAP++V+ +  E L ++CF++ M+RM  NFP  +   MD  F+ MRS +QILDS+L   M   GD+THFYF YRWFLLDFKRE  Y+DVF +WE IW +  ++S +F LF+ LAL+  YR++IIDN M+FTDII+FFNEMAE+H+VQ +L++ARELV K+Q L+
Sbjct:  427 ERILCFHRIPLKMLCHNMKKQIVSRAFYGWLAYCRHLSTVRTHLSALVNHNIVPPDRPGEASGGLSKEVW-SKYQKDCKNYKELELLRLVYYGGVEHGIRKEVWPFLLGHYKFGMGKNDMSQINAKISERYQQVMKEWKACELIVKQREKEMQSAIFSKLSSGSSIDSHVLRLAHRDSTISNEVFMSVDEPDAGSQETPSADDNTPTMTTLAPPVALPPEERPLVEFDSPDSGLPSSRNYSVTSAHSQISSSMDEGQSTEEEAPGREFQDSLSESRVCHQLDKLVTSGAIELLDTVALNLHRIDKDVQRCDRNYYYFTTA-----NLEKLRNIMCSYVWEHLDMGYVQGMCDLLAPLMVILDD-ECLAYSCFTQLMKRMSQNFP--NGGAMDAHFANMRSLIQILDSELFELMHQNGDYTHFYFCYRWFLLDFKRELLYEDVFAVWEVIWVSPRISSQHFVLFLALALVTVYREIIIDNNMDFTDIIKFFNEMAERHDVQHILKVARELVHKVQSLM 934          

HSP 2 Score: 259.61 bits (662), Expect = 8.459e-72
Identity = 131/319 (41.07%), Postives = 198/319 (62.07%), Query Frame = 3
Query:  711 IKHYWIRLALTEKVLDKIIDYLVKNSNRFYNHGSVIGDPCYGYILVSLLSGPCSLEYSRVKNPELIPDDPDAGELIQRQKIQNQSGSTGIEAGKSPNLSHAMSTSSLFWSSGSNQFLNKPALVNRQRRLTGIDLDEIPNSGNKSPFS-TARQYVESLHQTSSSSLLFGKNNVYCQPREDVNKMPGYLSLHMAVNEMLIKWTPNELMSGGLNDAVFKENSVKVEWDCALMIWVNKVVYIHCHQQADKGETLVLVNHDGSQNPPFDFPQGGHLMSFLTCLENGLLPKCRLDPPLWLKKNREKLFQKSCENPINNSKELDQD 1664
            IKH W+R AL EKVLDKI+  +V NS+++Y   +++ DP +G IL +LL GPC+LEY+++K  +    DP A EL+QR +I     +  + A +                        +PAL  ++R+ +G        S ++  F+ +AR+YVESLHQ S + LL+GKNNV  QP++D+  + GYLSLH A + + +KWTPN+L++G + D   +++   + WD AL + + ++V IHCHQ  D G TLVLV+ DG Q PP  FP GGHL++FL+CLE GLLP+ +L+PPLW ++ + K+F K      + ++ +DQD
Sbjct:  116 IKHIWVRTALFEKVLDKIVQVIVDNSSKYYEKEALMHDPVFGPILAALLVGPCALEYTKLKTSDHFWTDPSANELVQRHRIHGAHRTLDVPASR------------------------RPALGIQKRQSSG--------SMSEDRFAASAREYVESLHQNSRTHLLYGKNNVLVQPKKDMEVLRGYLSLHQAGDNLTLKWTPNQLINGTMGDCDLEKS---IYWDYALTVPMRQIVCIHCHQLPDSGGTLVLVSQDGIQRPPLHFPAGGHLLAFLSCLETGLLPRGQLEPPLWSQRGKGKVFPK-LRKRSSAARLIDQD 398          
BLAST of Small G protein signaling modulator 1 vs. Ensembl Medaka
Match: sgsm1a (small G protein signaling modulator 1 [Source:NCBI gene;Acc:101156582])

HSP 1 Score: 274.248 bits (700), Expect = 1.539e-75
Identity = 126/228 (55.26%), Postives = 170/228 (74.56%), Query Frame = 3
Query: 2685 QKILNVLKQNWTRIEKDVARCDRHFGFFGQTKTGEENLNILQRIMCTWVWENLELGYIQGMCDLLAPILVVFNGHEELTFACFSKYMERMISNFPVKDSTKMDLCFSRMRSAVQILDSDLLNHMQSYGDFTHFYFSYRWFLLDFKREFTYKDVFCLWETIWAADNVASPYFSLFVGLALLLSYRDVIIDNAMEFTDIIRFFNEMAEQHNVQKVLELARELVEKLQLLL 3368
            Q++L++   N  RIEKDV RCDR++ +F        NL  L+ IMC+++W++L++GY+QGMCDLLAP+LV+ +  E L F+CF++ M+RM  NFP      MD  F+ MRS +QILDS+L   M   GD+THFYF YRWFLLDFKRE  Y DVF +WETIWAA  V+S +F LF+ LAL+  YRD+I++N M+FTDII+FFNEMAE HN++K+L LAR+LV K+Q+L+
Sbjct:  999 QELLDLYTLNLHRIEKDVQRCDRNYWYFTPA-----NLEKLRNIMCSYIWKHLDIGYVQGMCDLLAPLLVILDD-EALAFSCFTELMKRMNQNFP--HGGAMDTHFANMRSLIQILDSELFELMHQNGDYTHFYFCYRWFLLDFKRELVYDDVFAVWETIWAAKYVSSNHFVLFIALALVEMYRDIILENNMDFTDIIKFFNEMAEHHNIKKILTLARDLVCKVQMLI 1218          

HSP 2 Score: 273.863 bits (699), Expect = 2.123e-75
Identity = 138/303 (45.54%), Postives = 193/303 (63.70%), Query Frame = 3
Query:  711 IKHYWIRLALTEKVLDKIIDYLVKNSNRFYNHGSVIGDPCYGYILVSLLSGPCSLEYSRVKNPELIPDDPDAGELIQRQKIQNQSGSTGIEAGKSPNLSHAMSTSSLFWSSGSNQFLNKPALVNRQRRLTGIDLDEIPNSGNKSPFSTARQYVESLHQTSSSSLLFGKNNVYCQPREDVNKMPGYLSLHMAVNEMLIKWTPNELMSGGLNDAVFKENSVKVEWDCALMIWVNKVVYIHCHQQADKGETLVLVNHDGSQNPPFDFPQGGHLMSFLTCLENGLLPKCRLDPPLWLKKNREKLFQK 1619
            +K+ WI+ AL +KVLDKI+ +LV+NS+++Y   +++ DP  G IL SLL GPC+LEY+++K  +    DP A EL+QR +I      +G     SP                      +PAL   Q+R +   +DE P     SP  +AR YVESLHQ + ++LLFGKNNV  QPR+D+  +PGYLSLH   N M +KWTPN+LM+G + D  ++ +   V WD A+ I + ++VY+HCHQQ D G T+VLV+ DG Q PP  FP+GGHL+ FL+CLENGLLP  +L+PPLW ++ + K+F K
Sbjct:  126 VKNLWIKAALFDKVLDKIVLFLVENSSKYYEKEALLMDPVDGPILASLLVGPCALEYTKMKTADHFWTDPSADELVQRHRIH-----SGHCRQDSPT--------------------KRPALCI-QKRHSSSSMDERP-----SPSPSARDYVESLHQNNRATLLFGKNNVLVQPRDDMEAIPGYLSLHQTANIMTLKWTPNQLMNGSMADLEYERS---VYWDYAMTICLEEIVYLHCHQQVDSGGTVVLVSQDGIQRPPLRFPRGGHLLQFLSCLENGLLPHGQLEPPLWSQRGKGKVFPK 394          

HSP 3 Score: 101.679 bits (252), Expect = 3.096e-21
Identity = 47/148 (31.76%), Postives = 84/148 (56.76%), Query Frame = 3
Query: 2094 KSKTYGKSSIRMLCSSMKKEIMARSFYGWLAYSRHMKTIRNHLSQLVLPVDLGTKSCKEFIKGLTKEKWTSAFNLNNQIEDNMSVLCYIYRGGCDPELRVQTWPYLLGLFEWNSTENERQATLRKWERRYHVAISDWMVIETVLNEEE 2537
            K   Y ++ +++LC +MK +I++R+FYGWLAY RH+ T+R HLS LV    +      +  +GLT + W + F  ++       +L  +Y GG +P LR   WP+LLG +++  ++ +R+    +    Y   +S+W+  E ++ + E
Sbjct:  471 KGCNYERTPLKLLCDNMKYQIISRAFYGWLAYCRHLSTVRTHLSALVNHTIVAPDVPGDAYEGLTTDVWQT-FLQDSTAYKEHELLRLVYFGGVEPSLRKDVWPFLLGHYKFGMSKAQRKEVDEQVRESYQQTMSEWLGCEGIVRQRE 617          

HSP 4 Score: 62.003 bits (149), Expect = 4.139e-9
Identity = 35/78 (44.87%), Postives = 56/78 (71.79%), Query Frame = 3
Query:  246 KEILIKTIKRQVKLLMEEFVNKKYVHEYSSNVISLCASIEACXXXXXXXXXXXXFKESSSLALLEKIAKQNAAAKSIC 479
            ++ L++T+K++VK +MEE V +K+VHE SS+++S CA++EAC+L GLKRRA G  + +   AL  K+ K    A+ +C
Sbjct:   11 RQKLLRTVKKEVKQIMEEAVTRKFVHEDSSHIVSFCAAVEACVLHGLKRRAAGFLRSNKIAALFMKVGKSFPPAEELC 88          
BLAST of Small G protein signaling modulator 1 vs. Ensembl Medaka
Match: sgsm1a (small G protein signaling modulator 1 [Source:NCBI gene;Acc:101156582])

HSP 1 Score: 274.633 bits (701), Expect = 1.567e-75
Identity = 126/228 (55.26%), Postives = 170/228 (74.56%), Query Frame = 3
Query: 2685 QKILNVLKQNWTRIEKDVARCDRHFGFFGQTKTGEENLNILQRIMCTWVWENLELGYIQGMCDLLAPILVVFNGHEELTFACFSKYMERMISNFPVKDSTKMDLCFSRMRSAVQILDSDLLNHMQSYGDFTHFYFSYRWFLLDFKREFTYKDVFCLWETIWAADNVASPYFSLFVGLALLLSYRDVIIDNAMEFTDIIRFFNEMAEQHNVQKVLELARELVEKLQLLL 3368
            Q++L++   N  RIEKDV RCDR++ +F        NL  L+ IMC+++W++L++GY+QGMCDLLAP+LV+ +  E L F+CF++ M+RM  NFP      MD  F+ MRS +QILDS+L   M   GD+THFYF YRWFLLDFKRE  Y DVF +WETIWAA  V+S +F LF+ LAL+  YRD+I++N M+FTDII+FFNEMAE HN++K+L LAR+LV K+Q+L+
Sbjct: 1021 QELLDLYTLNLHRIEKDVQRCDRNYWYFTPA-----NLEKLRNIMCSYIWKHLDIGYVQGMCDLLAPLLVILDD-EALAFSCFTELMKRMNQNFP--HGGAMDTHFANMRSLIQILDSELFELMHQNGDYTHFYFCYRWFLLDFKRELVYDDVFAVWETIWAAKYVSSNHFVLFIALALVEMYRDIILENNMDFTDIIKFFNEMAEHHNIKKILTLARDLVCKVQMLI 1240          

HSP 2 Score: 274.248 bits (700), Expect = 2.063e-75
Identity = 138/303 (45.54%), Postives = 193/303 (63.70%), Query Frame = 3
Query:  711 IKHYWIRLALTEKVLDKIIDYLVKNSNRFYNHGSVIGDPCYGYILVSLLSGPCSLEYSRVKNPELIPDDPDAGELIQRQKIQNQSGSTGIEAGKSPNLSHAMSTSSLFWSSGSNQFLNKPALVNRQRRLTGIDLDEIPNSGNKSPFSTARQYVESLHQTSSSSLLFGKNNVYCQPREDVNKMPGYLSLHMAVNEMLIKWTPNELMSGGLNDAVFKENSVKVEWDCALMIWVNKVVYIHCHQQADKGETLVLVNHDGSQNPPFDFPQGGHLMSFLTCLENGLLPKCRLDPPLWLKKNREKLFQK 1619
            +K+ WI+ AL +KVLDKI+ +LV+NS+++Y   +++ DP  G IL SLL GPC+LEY+++K  +    DP A EL+QR +I      +G     SP                      +PAL   Q+R +   +DE P     SP  +AR YVESLHQ + ++LLFGKNNV  QPR+D+  +PGYLSLH   N M +KWTPN+LM+G + D  ++ +   V WD A+ I + ++VY+HCHQQ D G T+VLV+ DG Q PP  FP+GGHL+ FL+CLENGLLP  +L+PPLW ++ + K+F K
Sbjct:  126 VKNLWIKAALFDKVLDKIVLFLVENSSKYYEKEALLMDPVDGPILASLLVGPCALEYTKMKTADHFWTDPSADELVQRHRIH-----SGHCRQDSPT--------------------KRPALCI-QKRHSSSSMDERP-----SPSPSARDYVESLHQNNRATLLFGKNNVLVQPRDDMEAIPGYLSLHQTANIMTLKWTPNQLMNGSMADLEYERS---VYWDYAMTICLEEIVYLHCHQQVDSGGTVVLVSQDGIQRPPLRFPRGGHLLQFLSCLENGLLPHGQLEPPLWSQRGKGKVFPK 394          

HSP 3 Score: 101.679 bits (252), Expect = 3.290e-21
Identity = 47/148 (31.76%), Postives = 84/148 (56.76%), Query Frame = 3
Query: 2094 KSKTYGKSSIRMLCSSMKKEIMARSFYGWLAYSRHMKTIRNHLSQLVLPVDLGTKSCKEFIKGLTKEKWTSAFNLNNQIEDNMSVLCYIYRGGCDPELRVQTWPYLLGLFEWNSTENERQATLRKWERRYHVAISDWMVIETVLNEEE 2537
            K   Y ++ +++LC +MK +I++R+FYGWLAY RH+ T+R HLS LV    +      +  +GLT + W + F  ++       +L  +Y GG +P LR   WP+LLG +++  ++ +R+    +    Y   +S+W+  E ++ + E
Sbjct:  471 KGCNYERTPLKLLCDNMKYQIISRAFYGWLAYCRHLSTVRTHLSALVNHTIVAPDVPGDAYEGLTTDVWQT-FLQDSTAYKEHELLRLVYFGGVEPSLRKDVWPFLLGHYKFGMSKAQRKEVDEQVRESYQQTMSEWLGCEGIVRQRE 617          

HSP 4 Score: 62.003 bits (149), Expect = 4.338e-9
Identity = 35/78 (44.87%), Postives = 56/78 (71.79%), Query Frame = 3
Query:  246 KEILIKTIKRQVKLLMEEFVNKKYVHEYSSNVISLCASIEACXXXXXXXXXXXXFKESSSLALLEKIAKQNAAAKSIC 479
            ++ L++T+K++VK +MEE V +K+VHE SS+++S CA++EAC+L GLKRRA G  + +   AL  K+ K    A+ +C
Sbjct:   11 RQKLLRTVKKEVKQIMEEAVTRKFVHEDSSHIVSFCAAVEACVLHGLKRRAAGFLRSNKIAALFMKVGKSFPPAEELC 88          
BLAST of Small G protein signaling modulator 1 vs. Ensembl Medaka
Match: sgsm2 (small G protein signaling modulator 2 [Source:NCBI gene;Acc:101175420])

HSP 1 Score: 267.7 bits (683), Expect = 7.263e-74
Identity = 122/229 (53.28%), Postives = 170/229 (74.24%), Query Frame = 3
Query: 2682 TQKILNVLKQNWTRIEKDVARCDRHFGFFGQTKTGEENLNILQRIMCTWVWENLELGYIQGMCDLLAPILVVFNGHEELTFACFSKYMERMISNFPVKDSTKMDLCFSRMRSAVQILDSDLLNHMQSYGDFTHFYFSYRWFLLDFKREFTYKDVFCLWETIWAADNVASPYFSLFVGLALLLSYRDVIIDNAMEFTDIIRFFNEMAEQHNVQKVLELARELVEKLQLLL 3368
            T ++L+ +  N  RI+KDV RCDR++ +F        NL  L+ IMC++VWE+L++GY+QGMCDLLAP++V+ +  E L ++CF++ M+RM  NFP  +   MD  F+ MRS +QILDS+L   M   GD+THFYF YRWFLLDFKRE  Y+DVF +WE IW +  ++S +F LF+ LAL+  YR++IIDN M+FTDII+FFNEMAE+H+VQ +L++ARELV K+Q L+
Sbjct:  832 TIELLDTVALNLHRIDKDVQRCDRNYYYFTTA-----NLEKLRNIMCSYVWEHLDMGYVQGMCDLLAPLMVILDD-ECLAYSCFTQLMKRMSQNFP--NGGAMDAHFANMRSLIQILDSELFELMHQNGDYTHFYFCYRWFLLDFKRELLYEDVFAVWEVIWVSPRISSQHFVLFLALALVTVYREIIIDNNMDFTDIIKFFNEMAERHDVQHILKVARELVHKVQSLM 1052          

HSP 2 Score: 259.996 bits (663), Expect = 2.263e-71
Identity = 131/319 (41.07%), Postives = 198/319 (62.07%), Query Frame = 3
Query:  711 IKHYWIRLALTEKVLDKIIDYLVKNSNRFYNHGSVIGDPCYGYILVSLLSGPCSLEYSRVKNPELIPDDPDAGELIQRQKIQNQSGSTGIEAGKSPNLSHAMSTSSLFWSSGSNQFLNKPALVNRQRRLTGIDLDEIPNSGNKSPFS-TARQYVESLHQTSSSSLLFGKNNVYCQPREDVNKMPGYLSLHMAVNEMLIKWTPNELMSGGLNDAVFKENSVKVEWDCALMIWVNKVVYIHCHQQADKGETLVLVNHDGSQNPPFDFPQGGHLMSFLTCLENGLLPKCRLDPPLWLKKNREKLFQKSCENPINNSKELDQD 1664
            IKH W+R AL EKVLDKI+  +V NS+++Y   +++ DP +G IL +LL GPC+LEY+++K  +    DP A EL+QR +I     +  + A +                        +PAL  ++R+ +G        S ++  F+ +AR+YVESLHQ S + LL+GKNNV  QP++D+  + GYLSLH A + + +KWTPN+L++G + D   +++   + WD AL + + ++V IHCHQ  D G TLVLV+ DG Q PP  FP GGHL++FL+CLE GLLP+ +L+PPLW ++ + K+F K      + ++ +DQD
Sbjct:  129 IKHIWVRTALFEKVLDKIVQVIVDNSSKYYEKEALMHDPVFGPILAALLVGPCALEYTKLKTSDHFWTDPSANELVQRHRIHGAHRTLDVPASR------------------------RPALGIQKRQSSG--------SMSEDRFAASAREYVESLHQNSRTHLLYGKNNVLVQPKKDMEVLRGYLSLHQAGDNLTLKWTPNQLINGTMGDCDLEKS---IYWDYALTVPMRQIVCIHCHQLPDSGGTLVLVSQDGIQRPPLHFPAGGHLLAFLSCLETGLLPRGQLEPPLWSQRGKGKVFPK-LRKRSSAARLIDQD 411          

HSP 3 Score: 97.4413 bits (241), Expect = 4.978e-20
Identity = 48/139 (34.53%), Postives = 79/139 (56.83%), Query Frame = 3
Query: 2121 IRMLCSSMKKEIMARSFYGWLAYSRHMKTIRNHLSQLVLPVDLGTKSCKEFIKGLTKEKWTSAFNLNNQIEDNMSVLCYIYRGGCDPELRVQTWPYLLGLFEWNSTENERQATLRKWERRYHVAISDWMVIETVLNEEE 2537
            ++MLC +MKK+I++R+FYGWLAY RH+ T+R HLS LV    +      E   GL+KE W S +  + +    + +L  +Y GG +  +R + WP+LLG +++   +N+      K   RY   + +W   E ++ + E
Sbjct:  542 LKMLCHNMKKQIVSRAFYGWLAYCRHLSTVRTHLSALVNHNIVPPDRPGEASGGLSKEVW-SKYQKDCKNYKELELLRLVYYGGVEHGIRKEVWPFLLGHYKFGMGKNDMSQINAKISERYQQVMKEWKACELIVKQRE 679          

HSP 4 Score: 66.2402 bits (160), Expect = 1.782e-10
Identity = 41/78 (52.56%), Postives = 52/78 (66.67%), Query Frame = 3
Query:  246 KEILIKTIKRQVKLLMEEFVNKKYVHEYSSNVISLCASIEACXXXXXXXXXXXXFKESSSLALLEKIAKQNAAAKSIC 479
            KE L+ ++KR+VK LMEE V KK+VHE SS+VI+LCA+IEACL   LKRRA G  +     AL  K+ K N     +C
Sbjct:    7 KEKLLWSVKREVKQLMEEAVTKKFVHEDSSHVIALCATIEACLGHLLKRRAAGFLRSDKIAALFTKVGKVNDTVADVC 84          
BLAST of Small G protein signaling modulator 1 vs. Ensembl Medaka
Match: sgsm2 (small G protein signaling modulator 2 [Source:NCBI gene;Acc:101175420])

HSP 1 Score: 267.314 bits (682), Expect = 8.071e-74
Identity = 122/229 (53.28%), Postives = 170/229 (74.24%), Query Frame = 3
Query: 2682 TQKILNVLKQNWTRIEKDVARCDRHFGFFGQTKTGEENLNILQRIMCTWVWENLELGYIQGMCDLLAPILVVFNGHEELTFACFSKYMERMISNFPVKDSTKMDLCFSRMRSAVQILDSDLLNHMQSYGDFTHFYFSYRWFLLDFKREFTYKDVFCLWETIWAADNVASPYFSLFVGLALLLSYRDVIIDNAMEFTDIIRFFNEMAEQHNVQKVLELARELVEKLQLLL 3368
            T ++L+ +  N  RI+KDV RCDR++ +F        NL  L+ IMC++VWE+L++GY+QGMCDLLAP++V+ +  E L ++CF++ M+RM  NFP  +   MD  F+ MRS +QILDS+L   M   GD+THFYF YRWFLLDFKRE  Y+DVF +WE IW +  ++S +F LF+ LAL+  YR++IIDN M+FTDII+FFNEMAE+H+VQ +L++ARELV K+Q L+
Sbjct:  837 TIELLDTVALNLHRIDKDVQRCDRNYYYFTTA-----NLEKLRNIMCSYVWEHLDMGYVQGMCDLLAPLMVILDD-ECLAYSCFTQLMKRMSQNFP--NGGAMDAHFANMRSLIQILDSELFELMHQNGDYTHFYFCYRWFLLDFKRELLYEDVFAVWEVIWVSPRISSQHFVLFLALALVTVYREIIIDNNMDFTDIIKFFNEMAERHDVQHILKVARELVHKVQSLM 1057          

HSP 2 Score: 259.996 bits (663), Expect = 2.436e-71
Identity = 131/319 (41.07%), Postives = 198/319 (62.07%), Query Frame = 3
Query:  711 IKHYWIRLALTEKVLDKIIDYLVKNSNRFYNHGSVIGDPCYGYILVSLLSGPCSLEYSRVKNPELIPDDPDAGELIQRQKIQNQSGSTGIEAGKSPNLSHAMSTSSLFWSSGSNQFLNKPALVNRQRRLTGIDLDEIPNSGNKSPFS-TARQYVESLHQTSSSSLLFGKNNVYCQPREDVNKMPGYLSLHMAVNEMLIKWTPNELMSGGLNDAVFKENSVKVEWDCALMIWVNKVVYIHCHQQADKGETLVLVNHDGSQNPPFDFPQGGHLMSFLTCLENGLLPKCRLDPPLWLKKNREKLFQKSCENPINNSKELDQD 1664
            IKH W+R AL EKVLDKI+  +V NS+++Y   +++ DP +G IL +LL GPC+LEY+++K  +    DP A EL+QR +I     +  + A +                        +PAL  ++R+ +G        S ++  F+ +AR+YVESLHQ S + LL+GKNNV  QP++D+  + GYLSLH A + + +KWTPN+L++G + D   +++   + WD AL + + ++V IHCHQ  D G TLVLV+ DG Q PP  FP GGHL++FL+CLE GLLP+ +L+PPLW ++ + K+F K      + ++ +DQD
Sbjct:  134 IKHIWVRTALFEKVLDKIVQVIVDNSSKYYEKEALMHDPVFGPILAALLVGPCALEYTKLKTSDHFWTDPSANELVQRHRIHGAHRTLDVPASR------------------------RPALGIQKRQSSG--------SMSEDRFAASAREYVESLHQNSRTHLLYGKNNVLVQPKKDMEVLRGYLSLHQAGDNLTLKWTPNQLINGTMGDCDLEKS---IYWDYALTVPMRQIVCIHCHQLPDSGGTLVLVSQDGIQRPPLHFPAGGHLLAFLSCLETGLLPRGQLEPPLWSQRGKGKVFPK-LRKRSSAARLIDQD 416          

HSP 3 Score: 97.8265 bits (242), Expect = 4.432e-20
Identity = 48/139 (34.53%), Postives = 79/139 (56.83%), Query Frame = 3
Query: 2121 IRMLCSSMKKEIMARSFYGWLAYSRHMKTIRNHLSQLVLPVDLGTKSCKEFIKGLTKEKWTSAFNLNNQIEDNMSVLCYIYRGGCDPELRVQTWPYLLGLFEWNSTENERQATLRKWERRYHVAISDWMVIETVLNEEE 2537
            ++MLC +MKK+I++R+FYGWLAY RH+ T+R HLS LV    +      E   GL+KE W S +  + +    + +L  +Y GG +  +R + WP+LLG +++   +N+      K   RY   + +W   E ++ + E
Sbjct:  547 LKMLCHNMKKQIVSRAFYGWLAYCRHLSTVRTHLSALVNHNIVPPDRPGEASGGLSKEVW-SKYQKDCKNYKELELLRLVYYGGVEHGIRKEVWPFLLGHYKFGMGKNDMSQINAKISERYQQVMKEWKACELIVKQRE 684          

HSP 4 Score: 58.9214 bits (141), Expect = 3.201e-8
Identity = 37/68 (54.41%), Postives = 44/68 (64.71%), Query Frame = 3
Query:  276 QVKLLMEEFVNKKYVHEYSSNVISLCASIEACXXXXXXXXXXXXFKESSSLALLEKIAKQNAAAKSIC 479
            QVK LMEE V KK+VHE SS+VI+LCA+IEACL   LKRRA G  +     AL  K+ K N     +C
Sbjct:   22 QVKQLMEEAVTKKFVHEDSSHVIALCATIEACLGHLLKRRAAGFLRSDKIAALFTKVGKVNDTVADVC 89          
BLAST of Small G protein signaling modulator 1 vs. Planmine SMEST
Match: SMESG000001889.1 (SMESG000001889.1)

HSP 1 Score: 1747.25 bits (4524), Expect = 0.000e+0
Identity = 839/844 (99.41%), Postives = 841/844 (99.64%), Query Frame = 3
Query:  843 LVSLLSGPCSLEYSRVKNPELIPDDPDAGELIQRQKIQNQSGSTGIEAGKSPNLSHAMSTSSLFWSSGSNQFLNKPALVNRQRRLTGIDLDEIPNSGNKSPFSTARQYVESLHQTSSSSLLFGKNNVYCQPREDVNKMPGYLSLHMAVNEMLIKWTPNELMSGGLNDAVFKENSVKVEWDCALMIWVNKVVYIHCHQQADKGETLVLVNHDGSQNPPFDFPQGGHLMSFLTCLENGLLPKCRLDPPLWLKKNREKLFQKSCENPINNSKELDQDGPKSAEFIKPTNKNKTIFLWSSSDRNSLKFSWFHQPFNKKLTIGNRKVLSQPLEHIVFDYRQAGRHNSQSDELLTDLVFRIVRPKNYNQTMSETHSGXXXXXXXXXITENPKSPNDLHSTVPQWHSDYTVLAMKRRCRLSSTEKSKTYGKSSIRMLCSSMKKEIMARSFYGWLAYSRHMKTIRNHLSQLVLPVDLGTKSCKEFIKGLTKEKWTSAFNLNNQIEDNMSVLCYIYRGGCDPELRVQTWPYLLGLFEWNSTENERQATLRKWERRYHVAISDWMVIETVLNEEEDASTPTDDNEERCAVQIERKSETNEKSNFGNSTSNNKNKKEAETKIVITQKILNVLKQNWTRIEKDVARCDRHFGFFGQTKTGEENLNILQRIMCTWVWENLELGYIQGMCDLLAPILVVFNGHEELTFACFSKYMERMISNFPVKDSTKMDLCFSRMRSAVQILDSDLLNHMQSYGDFTHFYFSYRWFLLDFKREFTYKDVFCLWETIWAADNVASPYFSLFVGLALLLSYRDVIIDNAMEFTDIIRFFNEMAEQHNVQKVLELARELVEKLQLLLHS 3374
            L+ LL+GPCSLEYSRVKNPELIPDDPDAGELIQRQKIQNQSGSTGIEAGKSPNLSHAMSTSSLFWSSGSNQFLNKPALVNRQRRLTGIDLDEIPNSGNKSPFSTARQYVESLHQTSSSSLLFGKNNVYCQPREDVNKMPGYLSLHMAVNEMLIKWTPNELMSGGLNDAVFKEN VKVEWDCALMIWVNKVVYIHCHQQADKGETLVLVNHDGSQNPPFDFPQGGHLMSFLTCLENGLLPKCRLDPPLWLKKNREKLFQKSCENPINNSKELDQDGPKSAEFIKPTNKNKTIFLWSSSDRNSLKFSWFHQPFNKKLTIGNRKVLSQPLEHIVFDYRQAGRHNSQSDELLTDLVFRIVRPKNYNQTMSETHSGDEDFDDFDDITENPKSPNDLHSTVPQWHSDYTVLAMKRRCRLSSTEKSKTYGKSSIRMLCSSMKKEIMARSFYGWLAYSRHMKTIRNHLSQLVLPVDLGTKSCKEFIKGLTKEKWTSAFNLNNQIEDNMSVLCYIYRGGCDPELRVQTWPYLLGLFEWNSTENERQATLRKWERRYHVAISDWMVIETVLNEEEDASTPTDDNEERCAVQIERKSETNEKSNFGNSTSNNKNKK AETKIVITQKILNVLKQNWTRIEKDVARCDRHFGFFGQTKTGEENLNILQRIMCTWVWENLELGYIQGMCDLLAPILVVFNGHEELTFACFSKYMERMISNFPVKDSTKMDLCFSRMRSAVQILDSDLLNHMQSYGDFTHFYFSYRWFLLDFKREFTYKDVFCLWETIWAADNVASPYFSLFVGLALLLSYRDVIIDNAMEFTDIIRFFNEMAEQHNVQKVLELARELVEKLQLLLHS
Sbjct:  510 LMLLLAGPCSLEYSRVKNPELIPDDPDAGELIQRQKIQNQSGSTGIEAGKSPNLSHAMSTSSLFWSSGSNQFLNKPALVNRQRRLTGIDLDEIPNSGNKSPFSTARQYVESLHQTSSSSLLFGKNNVYCQPREDVNKMPGYLSLHMAVNEMLIKWTPNELMSGGLNDAVFKENPVKVEWDCALMIWVNKVVYIHCHQQADKGETLVLVNHDGSQNPPFDFPQGGHLMSFLTCLENGLLPKCRLDPPLWLKKNREKLFQKSCENPINNSKELDQDGPKSAEFIKPTNKNKTIFLWSSSDRNSLKFSWFHQPFNKKLTIGNRKVLSQPLEHIVFDYRQAGRHNSQSDELLTDLVFRIVRPKNYNQTMSETHSGDEDFDDFDDITENPKSPNDLHSTVPQWHSDYTVLAMKRRCRLSSTEKSKTYGKSSIRMLCSSMKKEIMARSFYGWLAYSRHMKTIRNHLSQLVLPVDLGTKSCKEFIKGLTKEKWTSAFNLNNQIEDNMSVLCYIYRGGCDPELRVQTWPYLLGLFEWNSTENERQATLRKWERRYHVAISDWMVIETVLNEEEDASTPTDDNEERCAVQIERKSETNEKSNFGNSTSNNKNKKGAETKIVITQKILNVLKQNWTRIEKDVARCDRHFGFFGQTKTGEENLNILQRIMCTWVWENLELGYIQGMCDLLAPILVVFNGHEELTFACFSKYMERMISNFPVKDSTKMDLCFSRMRSAVQILDSDLLNHMQSYGDFTHFYFSYRWFLLDFKREFTYKDVFCLWETIWAADNVASPYFSLFVGLALLLSYRDVIIDNAMEFTDIIRFFNEMAEQHNVQKVLELARELVEKLQLLLHS 1353          
BLAST of Small G protein signaling modulator 1 vs. Planmine SMEST
Match: SMESG000001889.1 (SMESG000001889.1)

HSP 1 Score: 1744.55 bits (4517), Expect = 0.000e+0
Identity = 838/844 (99.29%), Postives = 840/844 (99.53%), Query Frame = 3
Query:  843 LVSLLSGPCSLEYSRVKNPELIPDDPDAGELIQRQKIQNQSGSTGIEAGKSPNLSHAMSTSSLFWSSGSNQFLNKPALVNRQRRLTGIDLDEIPNSGNKSPFSTARQYVESLHQTSSSSLLFGKNNVYCQPREDVNKMPGYLSLHMAVNEMLIKWTPNELMSGGLNDAVFKENSVKVEWDCALMIWVNKVVYIHCHQQADKGETLVLVNHDGSQNPPFDFPQGGHLMSFLTCLENGLLPKCRLDPPLWLKKNREKLFQKSCENPINNSKELDQDGPKSAEFIKPTNKNKTIFLWSSSDRNSLKFSWFHQPFNKKLTIGNRKVLSQPLEHIVFDYRQAGRHNSQSDELLTDLVFRIVRPKNYNQTMSETHSGXXXXXXXXXITENPKSPNDLHSTVPQWHSDYTVLAMKRRCRLSSTEKSKTYGKSSIRMLCSSMKKEIMARSFYGWLAYSRHMKTIRNHLSQLVLPVDLGTKSCKEFIKGLTKEKWTSAFNLNNQIEDNMSVLCYIYRGGCDPELRVQTWPYLLGLFEWNSTENERQATLRKWERRYHVAISDWMVIETVLNEEEDASTPTDDNEERCAVQIERKSETNEKSNFGNSTSNNKNKKEAETKIVITQKILNVLKQNWTRIEKDVARCDRHFGFFGQTKTGEENLNILQRIMCTWVWENLELGYIQGMCDLLAPILVVFNGHEELTFACFSKYMERMISNFPVKDSTKMDLCFSRMRSAVQILDSDLLNHMQSYGDFTHFYFSYRWFLLDFKREFTYKDVFCLWETIWAADNVASPYFSLFVGLALLLSYRDVIIDNAMEFTDIIRFFNEMAEQHNVQKVLELARELVEKLQLLLHS 3374
            L+ LL+GPCSLEYSRVKNPELIPDDPDAGELIQRQKIQNQSGSTGIEAGKSPNLSHAMSTSSLFWSSGSNQFLNKPAL NRQRRLTGIDLDEIPNSGNKSPFSTARQYVESLHQTSSSSLLFGKNNVYCQPREDVNKMPGYLSLHMAVNEMLIKWTPNELMSGGLNDAVFKEN VKVEWDCALMIWVNKVVYIHCHQQADKGETLVLVNHDGSQNPPFDFPQGGHLMSFLTCLENGLLPKCRLDPPLWLKKNREKLFQKSCENPINNSKELDQDGPKSAEFIKPTNKNKTIFLWSSSDRNSLKFSWFHQPFNKKLTIGNRKVLSQPLEHIVFDYRQAGRHNSQSDELLTDLVFRIVRPKNYNQTMSETHSGDEDFDDFDDITENPKSPNDLHSTVPQWHSDYTVLAMKRRCRLSSTEKSKTYGKSSIRMLCSSMKKEIMARSFYGWLAYSRHMKTIRNHLSQLVLPVDLGTKSCKEFIKGLTKEKWTSAFNLNNQIEDNMSVLCYIYRGGCDPELRVQTWPYLLGLFEWNSTENERQATLRKWERRYHVAISDWMVIETVLNEEEDASTPTDDNEERCAVQIERKSETNEKSNFGNSTSNNKNKK AETKIVITQKILNVLKQNWTRIEKDVARCDRHFGFFGQTKTGEENLNILQRIMCTWVWENLELGYIQGMCDLLAPILVVFNGHEELTFACFSKYMERMISNFPVKDSTKMDLCFSRMRSAVQILDSDLLNHMQSYGDFTHFYFSYRWFLLDFKREFTYKDVFCLWETIWAADNVASPYFSLFVGLALLLSYRDVIIDNAMEFTDIIRFFNEMAEQHNVQKVLELARELVEKLQLLLHS
Sbjct:  735 LMLLLAGPCSLEYSRVKNPELIPDDPDAGELIQRQKIQNQSGSTGIEAGKSPNLSHAMSTSSLFWSSGSNQFLNKPAL-NRQRRLTGIDLDEIPNSGNKSPFSTARQYVESLHQTSSSSLLFGKNNVYCQPREDVNKMPGYLSLHMAVNEMLIKWTPNELMSGGLNDAVFKENPVKVEWDCALMIWVNKVVYIHCHQQADKGETLVLVNHDGSQNPPFDFPQGGHLMSFLTCLENGLLPKCRLDPPLWLKKNREKLFQKSCENPINNSKELDQDGPKSAEFIKPTNKNKTIFLWSSSDRNSLKFSWFHQPFNKKLTIGNRKVLSQPLEHIVFDYRQAGRHNSQSDELLTDLVFRIVRPKNYNQTMSETHSGDEDFDDFDDITENPKSPNDLHSTVPQWHSDYTVLAMKRRCRLSSTEKSKTYGKSSIRMLCSSMKKEIMARSFYGWLAYSRHMKTIRNHLSQLVLPVDLGTKSCKEFIKGLTKEKWTSAFNLNNQIEDNMSVLCYIYRGGCDPELRVQTWPYLLGLFEWNSTENERQATLRKWERRYHVAISDWMVIETVLNEEEDASTPTDDNEERCAVQIERKSETNEKSNFGNSTSNNKNKKGAETKIVITQKILNVLKQNWTRIEKDVARCDRHFGFFGQTKTGEENLNILQRIMCTWVWENLELGYIQGMCDLLAPILVVFNGHEELTFACFSKYMERMISNFPVKDSTKMDLCFSRMRSAVQILDSDLLNHMQSYGDFTHFYFSYRWFLLDFKREFTYKDVFCLWETIWAADNVASPYFSLFVGLALLLSYRDVIIDNAMEFTDIIRFFNEMAEQHNVQKVLELARELVEKLQLLLHS 1577          

HSP 2 Score: 368.237 bits (944), Expect = 2.070e-106
Identity = 230/245 (93.88%), Postives = 230/245 (93.88%), Query Frame = 3
Query:  123 MSIPSLHNIFSRRSTNGNLDVRSPISNGNLTSEIQSEKCSEKEILIKTIKRQVKLLMEEFVNKKYVHEYSSNVISLCASIEACXXXXXXXXXXXXFKESSSLALLEKIAKQNAAAKSICTLMSDEKLHYCDXXXXXXXXXXXXXXXXXXXXXXXXXXTFGYSWSASSFLGFSNNKFFSSINQSSDNEFINLHWKNLIKHYWIRLALTEKVLDKIIDYLVKNSNRFYNHGSVIGDPCYGYILVSLL 857
            MSIPSLHNIFSRRSTNGNLDVRSPISNGNLTSEIQSE               VKLLMEEFVNKKYVHEYSSNVISLCASIEACLLLGLKRRALGLFKESSSLALLEKIAKQNAAAKSICTLMSDEKLHYCDSLSDASHHSSNTSSSISSRSDYSNSSTFGYSWSASSFLGFSNNKFFSSINQSSDNEFINLHWKNLIKHYWIRLALTEKVLDKIIDYLVKNSNRFYNHGSVIGDPCYGYILVSLL
Sbjct:    1 MSIPSLHNIFSRRSTNGNLDVRSPISNGNLTSEIQSENA-------------VKLLMEEFVNKKYVHEYSSNVISLCASIEACLLLGLKRRALGLFKESSSLALLEKIAKQNAAAKSICTLMSDEKLHYCDSLSDASHHSSNTSSSISSRSDYSNSSTFGYSWSASSFLGFSNNKFFSSINQSSDNEFINLHWKNLIKHYWIRLALTEKVLDKIIDYLVKNSNRFYNHGSVIGDPCYGYILVSLL 232          
BLAST of Small G protein signaling modulator 1 vs. Planmine SMEST
Match: SMESG000001889.1 (SMESG000001889.1)

HSP 1 Score: 1743.4 bits (4514), Expect = 0.000e+0
Identity = 843/863 (97.68%), Postives = 846/863 (98.03%), Query Frame = 3
Query:  795 FYNHGSVIGDPCYGYILVSL---LSGPCSLEYSRVKNPELIPDDPDAGELIQRQKIQNQSGSTGIEAGKSPNLSHAMSTSSLFWSSGSNQFLNKPALVNRQRRLTGIDLDEIPNSGNKSPFSTARQYVESLHQTSSSSLLFGKNNVYCQPREDVNKMPGYLSLHMAVNEMLIKWTPNELMSGGLNDAVFKENSVKVEWDCALMIWVNKVVYIHCHQQADKGETLVLVNHDGSQNPPFDFPQGGHLMSFLTCLENGLLPKCRLDPPLWLKKNREKLFQKSCENPINNSKELDQDGPKSAEFIKPTNKNKTIFLWSSSDRNSLKFSWFHQPFNKKLTIGNRKVLSQPLEHIVFDYRQAGRHNSQSDELLTDLVFRIVRPKNYNQTMSETHSGXXXXXXXXXITENPKSPNDLHSTVPQWHSDYTVLAMKRRCRLSSTEKSKTYGKSSIRMLCSSMKKEIMARSFYGWLAYSRHMKTIRNHLSQLVLPVDLGTKSCKEFIKGLTKEKWTSAFNLNNQIEDNMSVLCYIYRGGCDPELRVQTWPYLLGLFEWNSTENERQATLRKWERRYHVAISDWMVIETVLNEEEDASTPTDDNEERCAVQIERKSETNEKSNFGNSTSNNKNKKEAETKIVITQKILNVLKQNWTRIEKDVARCDRHFGFFGQTKTGEENLNILQRIMCTWVWENLELGYIQGMCDLLAPILVVFNGHEELTFACFSKYMERMISNFPVKDSTKMDLCFSRMRSAVQILDSDLLNHMQSYGDFTHFYFSYRWFLLDFKREFTYKDVFCLWETIWAADNVASPYFSLFVGLALLLSYRDVIIDNAMEFTDIIRFFNEMAEQHNVQKVLELARELVEKLQLLLHS 3374
            F N G +I       +LV L   L+GPCSLEYSRVKNPELIPDDPDAGELIQRQKIQNQSGSTGIEAGKSPNLSHAMSTSSLFWSSGSNQFLNKPAL NRQRRLTGIDLDEIPNSGNKSPFSTARQYVESLHQTSSSSLLFGKNNVYCQPREDVNKMPGYLSLHMAVNEMLIKWTPNELMSGGLNDAVFKEN VKVEWDCALMIWVNKVVYIHCHQQADKGETLVLVNHDGSQNPPFDFPQGGHLMSFLTCLENGLLPKCRLDPPLWLKKNREKLFQKSCENPINNSKELDQDGPKSAEFIKPTNKNKTIFLWSSSDRNSLKFSWFHQPFNKKLTIGNRKVLSQPLEHIVFDYRQAGRHNSQSDELLTDLVFRIVRPKNYNQTMSETHSGDEDFDDFDDITENPKSPNDLHSTVPQWHSDYTVLAMKRRCRLSSTEKSKTYGKSSIRMLCSSMKKEIMARSFYGWLAYSRHMKTIRNHLSQLVLPVDLGTKSCKEFIKGLTKEKWTSAFNLNNQIEDNMSVLCYIYRGGCDPELRVQTWPYLLGLFEWNSTENERQATLRKWERRYHVAISDWMVIETVLNEEEDASTPTDDNEERCAVQIERKSETNEKSNFGNSTSNNKNKK AETKIVITQKILNVLKQNWTRIEKDVARCDRHFGFFGQTKTGEENLNILQRIMCTWVWENLELGYIQGMCDLLAPILVVFNGHEELTFACFSKYMERMISNFPVKDSTKMDLCFSRMRSAVQILDSDLLNHMQSYGDFTHFYFSYRWFLLDFKREFTYKDVFCLWETIWAADNVASPYFSLFVGLALLLSYRDVIIDNAMEFTDIIRFFNEMAEQHNVQKVLELARELVEKLQLLLHS
Sbjct:  723 FINSGVLILSSGLMLLLVFLFDPLAGPCSLEYSRVKNPELIPDDPDAGELIQRQKIQNQSGSTGIEAGKSPNLSHAMSTSSLFWSSGSNQFLNKPAL-NRQRRLTGIDLDEIPNSGNKSPFSTARQYVESLHQTSSSSLLFGKNNVYCQPREDVNKMPGYLSLHMAVNEMLIKWTPNELMSGGLNDAVFKENPVKVEWDCALMIWVNKVVYIHCHQQADKGETLVLVNHDGSQNPPFDFPQGGHLMSFLTCLENGLLPKCRLDPPLWLKKNREKLFQKSCENPINNSKELDQDGPKSAEFIKPTNKNKTIFLWSSSDRNSLKFSWFHQPFNKKLTIGNRKVLSQPLEHIVFDYRQAGRHNSQSDELLTDLVFRIVRPKNYNQTMSETHSGDEDFDDFDDITENPKSPNDLHSTVPQWHSDYTVLAMKRRCRLSSTEKSKTYGKSSIRMLCSSMKKEIMARSFYGWLAYSRHMKTIRNHLSQLVLPVDLGTKSCKEFIKGLTKEKWTSAFNLNNQIEDNMSVLCYIYRGGCDPELRVQTWPYLLGLFEWNSTENERQATLRKWERRYHVAISDWMVIETVLNEEEDASTPTDDNEERCAVQIERKSETNEKSNFGNSTSNNKNKKGAETKIVITQKILNVLKQNWTRIEKDVARCDRHFGFFGQTKTGEENLNILQRIMCTWVWENLELGYIQGMCDLLAPILVVFNGHEELTFACFSKYMERMISNFPVKDSTKMDLCFSRMRSAVQILDSDLLNHMQSYGDFTHFYFSYRWFLLDFKREFTYKDVFCLWETIWAADNVASPYFSLFVGLALLLSYRDVIIDNAMEFTDIIRFFNEMAEQHNVQKVLELARELVEKLQLLLHS 1584          

HSP 2 Score: 368.622 bits (945), Expect = 1.484e-106
Identity = 230/245 (93.88%), Postives = 230/245 (93.88%), Query Frame = 3
Query:  123 MSIPSLHNIFSRRSTNGNLDVRSPISNGNLTSEIQSEKCSEKEILIKTIKRQVKLLMEEFVNKKYVHEYSSNVISLCASIEACXXXXXXXXXXXXFKESSSLALLEKIAKQNAAAKSICTLMSDEKLHYCDXXXXXXXXXXXXXXXXXXXXXXXXXXTFGYSWSASSFLGFSNNKFFSSINQSSDNEFINLHWKNLIKHYWIRLALTEKVLDKIIDYLVKNSNRFYNHGSVIGDPCYGYILVSLL 857
            MSIPSLHNIFSRRSTNGNLDVRSPISNGNLTSEIQSE               VKLLMEEFVNKKYVHEYSSNVISLCASIEACLLLGLKRRALGLFKESSSLALLEKIAKQNAAAKSICTLMSDEKLHYCDSLSDASHHSSNTSSSISSRSDYSNSSTFGYSWSASSFLGFSNNKFFSSINQSSDNEFINLHWKNLIKHYWIRLALTEKVLDKIIDYLVKNSNRFYNHGSVIGDPCYGYILVSLL
Sbjct:    1 MSIPSLHNIFSRRSTNGNLDVRSPISNGNLTSEIQSENA-------------VKLLMEEFVNKKYVHEYSSNVISLCASIEACLLLGLKRRALGLFKESSSLALLEKIAKQNAAAKSICTLMSDEKLHYCDSLSDASHHSSNTSSSISSRSDYSNSSTFGYSWSASSFLGFSNNKFFSSINQSSDNEFINLHWKNLIKHYWIRLALTEKVLDKIIDYLVKNSNRFYNHGSVIGDPCYGYILVSLL 232          
BLAST of Small G protein signaling modulator 1 vs. Planmine SMEST
Match: SMESG000001889.1 (SMESG000001889.1)

HSP 1 Score: 1743.01 bits (4513), Expect = 0.000e+0
Identity = 836/839 (99.64%), Postives = 837/839 (99.76%), Query Frame = 3
Query:  858 SGPCSLEYSRVKNPELIPDDPDAGELIQRQKIQNQSGSTGIEAGKSPNLSHAMSTSSLFWSSGSNQFLNKPALVNRQRRLTGIDLDEIPNSGNKSPFSTARQYVESLHQTSSSSLLFGKNNVYCQPREDVNKMPGYLSLHMAVNEMLIKWTPNELMSGGLNDAVFKENSVKVEWDCALMIWVNKVVYIHCHQQADKGETLVLVNHDGSQNPPFDFPQGGHLMSFLTCLENGLLPKCRLDPPLWLKKNREKLFQKSCENPINNSKELDQDGPKSAEFIKPTNKNKTIFLWSSSDRNSLKFSWFHQPFNKKLTIGNRKVLSQPLEHIVFDYRQAGRHNSQSDELLTDLVFRIVRPKNYNQTMSETHSGXXXXXXXXXITENPKSPNDLHSTVPQWHSDYTVLAMKRRCRLSSTEKSKTYGKSSIRMLCSSMKKEIMARSFYGWLAYSRHMKTIRNHLSQLVLPVDLGTKSCKEFIKGLTKEKWTSAFNLNNQIEDNMSVLCYIYRGGCDPELRVQTWPYLLGLFEWNSTENERQATLRKWERRYHVAISDWMVIETVLNEEEDASTPTDDNEERCAVQIERKSETNEKSNFGNSTSNNKNKKEAETKIVITQKILNVLKQNWTRIEKDVARCDRHFGFFGQTKTGEENLNILQRIMCTWVWENLELGYIQGMCDLLAPILVVFNGHEELTFACFSKYMERMISNFPVKDSTKMDLCFSRMRSAVQILDSDLLNHMQSYGDFTHFYFSYRWFLLDFKREFTYKDVFCLWETIWAADNVASPYFSLFVGLALLLSYRDVIIDNAMEFTDIIRFFNEMAEQHNVQKVLELARELVEKLQLLLHS 3374
            +GPCSLEYSRVKNPELIPDDPDAGELIQRQKIQNQSGSTGIEAGKSPNLSHAMSTSSLFWSSGSNQFLNKPALVNRQRRLTGIDLDEIPNSGNKSPFSTARQYVESLHQTSSSSLLFGKNNVYCQPREDVNKMPGYLSLHMAVNEMLIKWTPNELMSGGLNDAVFKEN VKVEWDCALMIWVNKVVYIHCHQQADKGETLVLVNHDGSQNPPFDFPQGGHLMSFLTCLENGLLPKCRLDPPLWLKKNREKLFQKSCENPINNSKELDQDGPKSAEFIKPTNKNKTIFLWSSSDRNSLKFSWFHQPFNKKLTIGNRKVLSQPLEHIVFDYRQAGRHNSQSDELLTDLVFRIVRPKNYNQTMSETHSGDEDFDDFDDITENPKSPNDLHSTVPQWHSDYTVLAMKRRCRLSSTEKSKTYGKSSIRMLCSSMKKEIMARSFYGWLAYSRHMKTIRNHLSQLVLPVDLGTKSCKEFIKGLTKEKWTSAFNLNNQIEDNMSVLCYIYRGGCDPELRVQTWPYLLGLFEWNSTENERQATLRKWERRYHVAISDWMVIETVLNEEEDASTPTDDNEERCAVQIERKSETNEKSNFGNSTSNNKNKK AETKIVITQKILNVLKQNWTRIEKDVARCDRHFGFFGQTKTGEENLNILQRIMCTWVWENLELGYIQGMCDLLAPILVVFNGHEELTFACFSKYMERMISNFPVKDSTKMDLCFSRMRSAVQILDSDLLNHMQSYGDFTHFYFSYRWFLLDFKREFTYKDVFCLWETIWAADNVASPYFSLFVGLALLLSYRDVIIDNAMEFTDIIRFFNEMAEQHNVQKVLELARELVEKLQLLLHS
Sbjct:  524 TGPCSLEYSRVKNPELIPDDPDAGELIQRQKIQNQSGSTGIEAGKSPNLSHAMSTSSLFWSSGSNQFLNKPALVNRQRRLTGIDLDEIPNSGNKSPFSTARQYVESLHQTSSSSLLFGKNNVYCQPREDVNKMPGYLSLHMAVNEMLIKWTPNELMSGGLNDAVFKENPVKVEWDCALMIWVNKVVYIHCHQQADKGETLVLVNHDGSQNPPFDFPQGGHLMSFLTCLENGLLPKCRLDPPLWLKKNREKLFQKSCENPINNSKELDQDGPKSAEFIKPTNKNKTIFLWSSSDRNSLKFSWFHQPFNKKLTIGNRKVLSQPLEHIVFDYRQAGRHNSQSDELLTDLVFRIVRPKNYNQTMSETHSGDEDFDDFDDITENPKSPNDLHSTVPQWHSDYTVLAMKRRCRLSSTEKSKTYGKSSIRMLCSSMKKEIMARSFYGWLAYSRHMKTIRNHLSQLVLPVDLGTKSCKEFIKGLTKEKWTSAFNLNNQIEDNMSVLCYIYRGGCDPELRVQTWPYLLGLFEWNSTENERQATLRKWERRYHVAISDWMVIETVLNEEEDASTPTDDNEERCAVQIERKSETNEKSNFGNSTSNNKNKKGAETKIVITQKILNVLKQNWTRIEKDVARCDRHFGFFGQTKTGEENLNILQRIMCTWVWENLELGYIQGMCDLLAPILVVFNGHEELTFACFSKYMERMISNFPVKDSTKMDLCFSRMRSAVQILDSDLLNHMQSYGDFTHFYFSYRWFLLDFKREFTYKDVFCLWETIWAADNVASPYFSLFVGLALLLSYRDVIIDNAMEFTDIIRFFNEMAEQHNVQKVLELARELVEKLQLLLHS 1362          
BLAST of Small G protein signaling modulator 1 vs. Planmine SMEST
Match: SMESG000001889.1 (SMESG000001889.1)

HSP 1 Score: 1740.32 bits (4506), Expect = 0.000e+0
Identity = 838/844 (99.29%), Postives = 840/844 (99.53%), Query Frame = 3
Query:  843 LVSLLSGPCSLEYSRVKNPELIPDDPDAGELIQRQKIQNQSGSTGIEAGKSPNLSHAMSTSSLFWSSGSNQFLNKPALVNRQRRLTGIDLDEIPNSGNKSPFSTARQYVESLHQTSSSSLLFGKNNVYCQPREDVNKMPGYLSLHMAVNEMLIKWTPNELMSGGLNDAVFKENSVKVEWDCALMIWVNKVVYIHCHQQADKGETLVLVNHDGSQNPPFDFPQGGHLMSFLTCLENGLLPKCRLDPPLWLKKNREKLFQKSCENPINNSKELDQDGPKSAEFIKPTNKNKTIFLWSSSDRNSLKFSWFHQPFNKKLTIGNRKVLSQPLEHIVFDYRQAGRHNSQSDELLTDLVFRIVRPKNYNQTMSETHSGXXXXXXXXXITENPKSPNDLHSTVPQWHSDYTVLAMKRRCRLSSTEKSKTYGKSSIRMLCSSMKKEIMARSFYGWLAYSRHMKTIRNHLSQLVLPVDLGTKSCKEFIKGLTKEKWTSAFNLNNQIEDNMSVLCYIYRGGCDPELRVQTWPYLLGLFEWNSTENERQATLRKWERRYHVAISDWMVIETVLNEEEDASTPTDDNEERCAVQIERKSETNEKSNFGNSTSNNKNKKEAETKIVITQKILNVLKQNWTRIEKDVARCDRHFGFFGQTKTGEENLNILQRIMCTWVWENLELGYIQGMCDLLAPILVVFNGHEELTFACFSKYMERMISNFPVKDSTKMDLCFSRMRSAVQILDSDLLNHMQSYGDFTHFYFSYRWFLLDFKREFTYKDVFCLWETIWAADNVASPYFSLFVGLALLLSYRDVIIDNAMEFTDIIRFFNEMAEQHNVQKVLELARELVEKLQLLLHS 3374
            L+ LL+GPCSLEYSRVKNPELIPDDPDAGELIQRQKIQNQSGSTGIEAGKSPNLSHAMSTSSLFWSSGSNQFLNKPAL NRQRRLTGIDLDEIPNSGNKSPFSTARQYVESLHQTSSSSLLFGKNNVYCQPREDVNKMPGYLSLHMAVNEMLIKWTPNELMSGGLNDAVFKEN VKVEWDCALMIWVNKVVYIHCHQQADKGETLVLVNHDGSQNPPFDFPQGGHLMSFLTCLENGLLPKCRLDPPLWLKKNREKLFQKSCENPINNSKELDQDGPKSAEFIKPTNKNKTIFLWSSSDRNSLKFSWFHQPFNKKLTIGNRKVLSQPLEHIVFDYRQAGRHNSQSDELLTDLVFRIVRPKNYNQTMSETHSGDEDFDDFDDITENPKSPNDLHSTVPQWHSDYTVLAMKRRCRLSSTEKSKTYGKSSIRMLCSSMKKEIMARSFYGWLAYSRHMKTIRNHLSQLVLPVDLGTKSCKEFIKGLTKEKWTSAFNLNNQIEDNMSVLCYIYRGGCDPELRVQTWPYLLGLFEWNSTENERQATLRKWERRYHVAISDWMVIETVLNEEEDASTPTDDNEERCAVQIERKSETNEKSNFGNSTSNNKNKK AETKIVITQKILNVLKQNWTRIEKDVARCDRHFGFFGQTKTGEENLNILQRIMCTWVWENLELGYIQGMCDLLAPILVVFNGHEELTFACFSKYMERMISNFPVKDSTKMDLCFSRMRSAVQILDSDLLNHMQSYGDFTHFYFSYRWFLLDFKREFTYKDVFCLWETIWAADNVASPYFSLFVGLALLLSYRDVIIDNAMEFTDIIRFFNEMAEQHNVQKVLELARELVEKLQLLLHS
Sbjct:  510 LMLLLAGPCSLEYSRVKNPELIPDDPDAGELIQRQKIQNQSGSTGIEAGKSPNLSHAMSTSSLFWSSGSNQFLNKPAL-NRQRRLTGIDLDEIPNSGNKSPFSTARQYVESLHQTSSSSLLFGKNNVYCQPREDVNKMPGYLSLHMAVNEMLIKWTPNELMSGGLNDAVFKENPVKVEWDCALMIWVNKVVYIHCHQQADKGETLVLVNHDGSQNPPFDFPQGGHLMSFLTCLENGLLPKCRLDPPLWLKKNREKLFQKSCENPINNSKELDQDGPKSAEFIKPTNKNKTIFLWSSSDRNSLKFSWFHQPFNKKLTIGNRKVLSQPLEHIVFDYRQAGRHNSQSDELLTDLVFRIVRPKNYNQTMSETHSGDEDFDDFDDITENPKSPNDLHSTVPQWHSDYTVLAMKRRCRLSSTEKSKTYGKSSIRMLCSSMKKEIMARSFYGWLAYSRHMKTIRNHLSQLVLPVDLGTKSCKEFIKGLTKEKWTSAFNLNNQIEDNMSVLCYIYRGGCDPELRVQTWPYLLGLFEWNSTENERQATLRKWERRYHVAISDWMVIETVLNEEEDASTPTDDNEERCAVQIERKSETNEKSNFGNSTSNNKNKKGAETKIVITQKILNVLKQNWTRIEKDVARCDRHFGFFGQTKTGEENLNILQRIMCTWVWENLELGYIQGMCDLLAPILVVFNGHEELTFACFSKYMERMISNFPVKDSTKMDLCFSRMRSAVQILDSDLLNHMQSYGDFTHFYFSYRWFLLDFKREFTYKDVFCLWETIWAADNVASPYFSLFVGLALLLSYRDVIIDNAMEFTDIIRFFNEMAEQHNVQKVLELARELVEKLQLLLHS 1352          
The following BLAST results are available for this feature:
BLAST of Small G protein signaling modulator 1 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
SGSM17.575e-10735.21small G protein signaling modulator 1 [Source:HGNC... [more]
SGSM11.366e-10436.07small G protein signaling modulator 1 [Source:HGNC... [more]
SGSM24.075e-8437.99small G protein signaling modulator 2 [Source:HGNC... [more]
SGSM27.025e-8437.99small G protein signaling modulator 2 [Source:HGNC... [more]
SGSM28.892e-8436.22small G protein signaling modulator 2 [Source:HGNC... [more]
back to top
BLAST of Small G protein signaling modulator 1 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
tbc-84.186e-7336.73TBC (Tre-2/Bub2/Cdc16) domain family [Source:UniP... [more]
tbc-87.552e-7236.73TBC (Tre-2/Bub2/Cdc16) domain family [Source:UniP... [more]
tbc-141.077e-3528.93TBC (Tre-2/Bub2/Cdc16) domain family [Source:UniP... [more]
tbc-141.256e-3528.93TBC (Tre-2/Bub2/Cdc16) domain family [Source:UniP... [more]
tbc-161.919e-2131.05TBC (Tre-2/Bub2/Cdc16) domain family [Source:UniP... [more]
back to top
BLAST of Small G protein signaling modulator 1 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
CG325066.798e-7255.41gene:FBgn0052506 transcript:FBtr0307539[more]
CG325066.798e-7255.41gene:FBgn0052506 transcript:FBtr0340401[more]
CG16952.166e-7054.55gene:FBgn0031116 transcript:FBtr0332936[more]
Tbc1d15-171.229e-3930.19gene:FBgn0031233 transcript:FBtr0078125[more]
Tbc1d15-171.229e-3930.19gene:FBgn0031233 transcript:FBtr0332339[more]
back to top
BLAST of Small G protein signaling modulator 1 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
sgsm1a3.233e-9140.86small G protein signaling modulator 1a [Source:ZFI... [more]
sgsm1a1.558e-8841.07small G protein signaling modulator 1a [Source:ZFI... [more]
sgsm1a2.853e-8841.07small G protein signaling modulator 1a [Source:ZFI... [more]
sgsm1a3.210e-8841.07small G protein signaling modulator 1a [Source:ZFI... [more]
sgsm1b1.609e-7853.71small G protein signaling modulator 1b [Source:ZFI... [more]
back to top
BLAST of Small G protein signaling modulator 1 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
agbl13.173e-9837.93ATP/GTP binding protein-like 1 [Source:Xenbase;Acc... [more]
agbl14.847e-8346.53ATP/GTP binding protein-like 1 [Source:Xenbase;Acc... [more]
agbl19.700e-8346.53ATP/GTP binding protein-like 1 [Source:Xenbase;Acc... [more]
zbtb62.907e-7643.75zinc finger and BTB domain containing 6 [Source:Xe... [more]
zbtb63.633e-7543.75zinc finger and BTB domain containing 6 [Source:Xe... [more]
back to top
BLAST of Small G protein signaling modulator 1 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Sgsm11.744e-10634.49small G protein signaling modulator 1 [Source:MGI ... [more]
Sgsm25.216e-8537.99small G protein signaling modulator 2 [Source:MGI ... [more]
Sgsm29.625e-8537.99small G protein signaling modulator 2 [Source:MGI ... [more]
Sgsm11.134e-8046.20small G protein signaling modulator 1 [Source:MGI ... [more]
Sgsm11.100e-7851.01small G protein signaling modulator 1 [Source:MGI ... [more]
back to top
BLAST of Small G protein signaling modulator 1 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q2NKQ1|SGSM1_HUMAN3.638e-10635.21Small G protein signaling modulator 1 OS=Homo sapi... [more]
sp|Q80U12|SGSM2_MOUSE3.648e-8437.99Small G protein signaling modulator 2 OS=Mus muscu... [more]
sp|O43147|SGSM2_HUMAN3.373e-8337.99Small G protein signaling modulator 2 OS=Homo sapi... [more]
sp|Q8BPQ7|SGSM1_MOUSE1.354e-7651.01Small G protein signaling modulator 1 OS=Mus muscu... [more]
sp|Q8TC07|TBC15_HUMAN2.456e-3328.38TBC1 domain family member 15 OS=Homo sapiens OX=96... [more]
back to top
BLAST of Small G protein signaling modulator 1 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
R7TEE51.525e-17737.00Uncharacterized protein OS=Capitella teleta OX=283... [more]
A0A267FAU72.915e-17034.54Uncharacterized protein OS=Macrostomum lignano OX=... [more]
A0A267G2741.011e-16834.44Uncharacterized protein (Fragment) OS=Macrostomum ... [more]
A0A226E6I62.023e-16535.30Small G protein signaling modulator 1 OS=Folsomia ... [more]
A0A1I8G8Y19.085e-14532.60Uncharacterized protein OS=Macrostomum lignano OX=... [more]
back to top
BLAST of Small G protein signaling modulator 1 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
sgsm1b1.002e-7942.90small G protein signaling modulator 1 [Source:NCBI... [more]
sgsm1a1.335e-7947.19small G protein signaling modulator 1a [Source:ZFI... [more]
sgsm1a1.487e-7947.19small G protein signaling modulator 1a [Source:ZFI... [more]
sgsm1a2.896e-7947.19small G protein signaling modulator 1a [Source:ZFI... [more]
sgsm1a2.929e-7947.19small G protein signaling modulator 1a [Source:ZFI... [more]
back to top
BLAST of Small G protein signaling modulator 1 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 4
Match NameE-valueIdentityDescription
ENSPMAT00000006060.12.191e-6757.67pep scaffold:Pmarinus_7.0:GL483653:11070:13246:1 g... [more]
tbc1d151.461e-3226.91TBC1 domain family, member 15 [Source:ZFIN;Acc:ZDB... [more]
tbck1.794e-1127.78TBC1 domain containing kinase [Source:ZFIN;Acc:ZDB... [more]
TBC1D132.976e-725.98TBC1 domain family member 13 [Source:HGNC Symbol;A... [more]
back to top
BLAST of Small G protein signaling modulator 1 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 2
Match NameE-valueIdentityDescription
GYP77.169e-2229.88GTPase-activating protein for yeast Rab family mem... [more]
GYP11.028e-926.55Cis-golgi GTPase-activating protein (GAP) for yeas... [more]
back to top
BLAST of Small G protein signaling modulator 1 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
EDO445273.067e-7352.84Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO500331.022e-3626.87Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO351003.225e-3128.34Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO480141.803e-3025.21Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO425916.093e-2137.58Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Small G protein signaling modulator 1 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
sgsm26.252e-9437.72small G protein signaling modulator 2 [Source:NCBI... [more]
sgsm1a1.539e-7555.26small G protein signaling modulator 1 [Source:NCBI... [more]
sgsm1a1.567e-7555.26small G protein signaling modulator 1 [Source:NCBI... [more]
sgsm27.263e-7453.28small G protein signaling modulator 2 [Source:NCBI... [more]
sgsm28.071e-7453.28small G protein signaling modulator 2 [Source:NCBI... [more]
back to top
BLAST of Small G protein signaling modulator 1 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000001889.10.000e+099.41SMESG000001889.1[more]
SMESG000001889.12.070e-10699.29SMESG000001889.1[more]
SMESG000001889.11.484e-10697.68SMESG000001889.1[more]
SMESG000001889.10.000e+099.64SMESG000001889.1[more]
SMESG000001889.10.000e+099.29SMESG000001889.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30015622 ID=SMED30015622|Name=Small G protein signaling modulator 1|organism=Schmidtea mediterranea sexual|type=transcript|length=3530bp
ATTTATCATTGTATGAATGAAAAGTATTTTTGAATTTCGGGAATTGAAAT
TCGAAACTGCATTTTCCCATGAATTGATTGATAAAAATTTCTATATATTA
AGCTTCATTTGAAAATTTTACAATGTCAATTCCCAGCTTGCATAATATTT
TTTCACGCCGAAGCACAAATGGGAACTTAGATGTTCGAAGTCCAATTTCA
AATGGGAATTTAACCAGTGAAATTCAATCTGAAAAATGCAGTGAAAAAGA
AATTTTAATAAAAACTATTAAAAGACAGGTTAAACTATTAATGGAAGAAT
TTGTGAACAAAAAATACGTTCACGAATACAGCAGTAATGTAATTTCACTT
TGTGCGTCAATCGAAGCCTGCTTATTGCTTGGATTAAAGAGACGAGCACT
GGGACTGTTTAAAGAAAGCAGCAGTTTAGCACTGCTGGAAAAAATCGCAA
AGCAAAATGCTGCAGCAAAATCTATTTGTACGTTAATGTCCGATGAAAAA
CTTCATTACTGTGATTCTTTGAGTGATGCTAGTCATCATTCTAGCAATAC
AAGCAGTTCAATCTCATCCAGATCTGATTATTCAAATAGTTCAACATTCG
GCTACAGTTGGAGCGCCTCTTCTTTCCTTGGTTTTAGTAATAATAAATTT
TTCTCATCCATTAATCAATCCAGCGATAACGAATTCATAAATCTTCATTG
GAAAAATCTTATAAAGCATTACTGGATCAGATTGGCGCTAACAGAGAAAG
TCCTCGACAAAATTATTGATTATCTTGTAAAAAATTCCAATCGGTTTTAC
AATCATGGATCAGTAATCGGGGATCCATGTTATGGATATATTTTAGTTTC
ATTACTCTCCGGTCCATGCTCTCTCGAGTATTCCCGAGTTAAAAATCCCG
AATTAATCCCCGATGACCCGGACGCTGGCGAGCTAATTCAGAGACAAAAA
ATTCAAAATCAGTCCGGCAGTACTGGAATCGAAGCAGGAAAATCGCCAAA
TTTAAGTCATGCTATGTCGACCTCCTCTCTTTTTTGGTCATCTGGTTCAA
ACCAATTTTTAAACAAGCCGGCTTTGGTGAATCGACAACGAAGACTCACT
GGAATAGACTTAGACGAGATTCCCAATTCAGGAAATAAATCACCTTTTTC
TACAGCGAGACAATATGTAGAATCCTTACACCAGACATCCAGCAGCAGTT
TGTTATTTGGTAAAAATAATGTCTACTGCCAACCGAGGGAAGATGTCAAT
AAAATGCCCGGTTATTTGTCCTTACATATGGCTGTAAATGAGATGCTTAT
AAAATGGACCCCAAACGAGCTGATGAGTGGCGGATTAAACGATGCAGTTT
TCAAAGAAAATTCTGTAAAAGTTGAATGGGACTGTGCTCTGATGATTTGG
GTAAACAAAGTTGTCTATATTCATTGCCATCAACAAGCGGACAAAGGTGA
AACCTTGGTACTTGTAAATCACGATGGATCTCAAAATCCACCATTTGATT
TTCCTCAAGGTGGCCATTTAATGTCGTTTCTTACTTGTTTAGAAAACGGA
TTGTTGCCAAAATGTAGATTAGATCCCCCTTTGTGGTTAAAAAAGAATAG
AGAGAAACTGTTTCAAAAATCTTGTGAAAATCCAATAAATAATTCAAAAG
AACTAGACCAAGATGGACCTAAATCTGCTGAATTTATAAAACCTACAAAT
AAGAACAAAACTATATTTTTGTGGAGCTCATCAGACAGAAACTCTTTGAA
ATTTAGCTGGTTTCATCAGCCATTTAACAAAAAGTTGACCATAGGTAACA
GAAAGGTTTTATCACAGCCTTTAGAACACATTGTATTCGATTATCGGCAG
GCTGGCAGACATAATTCACAATCCGACGAGTTGCTCACGGATCTCGTATT
CAGAATTGTCAGACCAAAGAATTACAATCAGACCATGAGTGAAACACACA
GTGGTGATGAAGACTTTGATGATTTTGACGATATTACAGAAAATCCGAAA
TCTCCAAATGATTTACATTCAACTGTCCCCCAATGGCATTCAGATTACAC
AGTGTTGGCAATGAAACGACGTTGTCGATTGTCAAGCACAGAGAAAAGTA
AAACCTACGGAAAATCCTCGATCAGAATGCTGTGCTCTTCAATGAAAAAA
GAAATAATGGCTCGATCATTCTATGGATGGCTCGCTTATAGTAGACACAT
GAAAACAATTCGAAATCATCTCAGTCAACTGGTACTACCCGTGGACCTGG
GAACAAAAAGTTGTAAAGAATTCATTAAAGGATTGACAAAAGAAAAATGG
ACTTCTGCATTTAATTTAAACAATCAGATTGAAGATAATATGTCAGTTCT
CTGTTACATTTATCGAGGAGGCTGTGATCCGGAATTAAGAGTTCAGACTT
GGCCTTATCTTTTGGGATTGTTTGAATGGAACAGTACTGAAAATGAAAGG
CAAGCAACACTTCGAAAATGGGAGAGACGATACCATGTTGCTATTTCAGA
TTGGATGGTTATCGAAACCGTTTTAAATGAAGAAGAGGATGCCTCAACTC
CCACAGATGACAATGAAGAAAGATGCGCAGTCCAGATTGAAAGGAAATCA
GAAACCAACGAGAAGTCAAATTTTGGTAACTCAACTTCAAATAATAAAAA
TAAAAAAGAGGCCGAAACTAAAATAGTTATTACGCAAAAAATTCTCAATG
TTTTAAAACAAAACTGGACTAGAATTGAAAAAGATGTTGCCAGGTGTGAC
AGACACTTTGGATTTTTCGGACAGACAAAAACTGGAGAAGAAAATCTCAA
TATCCTCCAAAGAATAATGTGCACCTGGGTGTGGGAAAATCTCGAATTAG
GATATATTCAAGGAATGTGTGATTTATTAGCACCGATTTTAGTAGTTTTC
AATGGCCATGAAGAATTAACTTTCGCATGTTTCAGTAAATATATGGAAAG
AATGATTTCAAATTTCCCAGTCAAAGATAGTACAAAAATGGATCTATGTT
TTTCAAGAATGCGATCTGCCGTTCAGATTCTAGATTCAGATTTATTAAAT
CACATGCAAAGTTATGGAGATTTTACTCACTTCTATTTTTCGTATAGATG
GTTTTTATTAGATTTTAAAAGAGAATTTACATATAAAGATGTATTTTGTT
TATGGGAAACCATTTGGGCAGCAGATAATGTAGCAAGTCCCTATTTCAGT
TTATTCGTTGGGTTGGCCTTGCTACTGTCTTATCGAGATGTAATAATTGA
CAATGCAATGGAATTCACAGACATAATCAGATTTTTTAATGAAATGGCAG
AACAACATAATGTACAAAAAGTATTGGAATTAGCAAGGGAGCTCGTAGAA
AAACTCCAATTGCTTCTTCACAGCTGAATAGCGTATTTTTTTATTAAAAT
GATTTTCGGAGTTTAAACAATTATTTTTGCATTGAAATTTTCAGATTATT
TAATGCTGTTATCAATATTTGTATTTGTGTCCATTCTAGACTCATTTGTA
ATGTGAATTGAATTATTATTTACTTTCGGC
back to top

protein sequence of SMED30015622-orf-1

>SMED30015622-orf-1 ID=SMED30015622-orf-1|Name=SMED30015622-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=1085bp
MSIPSLHNIFSRRSTNGNLDVRSPISNGNLTSEIQSEKCSEKEILIKTIK
RQVKLLMEEFVNKKYVHEYSSNVISLCASIEACLLLGLKRRALGLFKESS
SLALLEKIAKQNAAAKSICTLMSDEKLHYCDSLSDASHHSSNTSSSISSR
SDYSNSSTFGYSWSASSFLGFSNNKFFSSINQSSDNEFINLHWKNLIKHY
WIRLALTEKVLDKIIDYLVKNSNRFYNHGSVIGDPCYGYILVSLLSGPCS
LEYSRVKNPELIPDDPDAGELIQRQKIQNQSGSTGIEAGKSPNLSHAMST
SSLFWSSGSNQFLNKPALVNRQRRLTGIDLDEIPNSGNKSPFSTARQYVE
SLHQTSSSSLLFGKNNVYCQPREDVNKMPGYLSLHMAVNEMLIKWTPNEL
MSGGLNDAVFKENSVKVEWDCALMIWVNKVVYIHCHQQADKGETLVLVNH
DGSQNPPFDFPQGGHLMSFLTCLENGLLPKCRLDPPLWLKKNREKLFQKS
CENPINNSKELDQDGPKSAEFIKPTNKNKTIFLWSSSDRNSLKFSWFHQP
FNKKLTIGNRKVLSQPLEHIVFDYRQAGRHNSQSDELLTDLVFRIVRPKN
YNQTMSETHSGDEDFDDFDDITENPKSPNDLHSTVPQWHSDYTVLAMKRR
CRLSSTEKSKTYGKSSIRMLCSSMKKEIMARSFYGWLAYSRHMKTIRNHL
SQLVLPVDLGTKSCKEFIKGLTKEKWTSAFNLNNQIEDNMSVLCYIYRGG
CDPELRVQTWPYLLGLFEWNSTENERQATLRKWERRYHVAISDWMVIETV
LNEEEDASTPTDDNEERCAVQIERKSETNEKSNFGNSTSNNKNKKEAETK
IVITQKILNVLKQNWTRIEKDVARCDRHFGFFGQTKTGEENLNILQRIMC
TWVWENLELGYIQGMCDLLAPILVVFNGHEELTFACFSKYMERMISNFPV
KDSTKMDLCFSRMRSAVQILDSDLLNHMQSYGDFTHFYFSYRWFLLDFKR
EFTYKDVFCLWETIWAADNVASPYFSLFVGLALLLSYRDVIIDNAMEFTD
IIRFFNEMAEQHNVQKVLELARELVEKLQLLLHS*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: biological process
TermDefinition
GO:0043547positive regulation of GTPase activity
GO:0006886intracellular protein transport
GO:0031338regulation of vesicle fusion
GO:0090630activation of GTPase activity
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000099neuron
PLANA:0000418head
PLANA:0003117parapharyngeal cell
Vocabulary: INTERPRO
TermDefinition
IPR021935SGSM1/2_RBD
IPR037213Run_dom_sf
IPR035969Rab-GTPase_TBC_sf
IPR004012Run_dom
IPR000195Rab-GTPase-TBC_dom
Vocabulary: molecular function
TermDefinition
GO:0005096GTPase activator activity
GO:0005515protein binding
GO:0017137Rab GTPase binding
Vocabulary: cellular component
TermDefinition
GO:0005737cytoplasm
GO:0005794Golgi apparatus
GO:0005829cytosol
GO:0012505endomembrane system
GO:0016020membrane
GO:0030659cytoplasmic vesicle membrane
GO:0031410cytoplasmic vesicle
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR004012RUN domainSMARTSM00593893paper3coord: 142..202
e-value: 2.7E-10
score: 50.2
IPR004012RUN domainPFAMPF02759RUNcoord: 19..201
e-value: 7.8E-22
score: 77.7
IPR004012RUN domainPROSITEPS50826RUNcoord: 11..204
score: 18.776
IPR000195Rab-GTPase-TBC domainSMARTSM00164tbc_4coord: 691..989
e-value: 1.8E-34
score: 130.5
IPR000195Rab-GTPase-TBC domainPFAMPF00566RabGAP-TBCcoord: 785..985
e-value: 4.6E-28
score: 98.3
IPR000195Rab-GTPase-TBC domainPROSITEPS50086TBC_RABGAPcoord: 694..962
score: 28.578
NoneNo IPR availableGENE3DG3DSA:1.10.472.80coord: 898..1024
e-value: 4.0E-24
score: 86.9
NoneNo IPR availableGENE3DG3DSA:1.10.8.270coord: 758..886
e-value: 3.0E-8
score: 35.7
NoneNo IPR availableGENE3DG3DSA:2.30.29.230coord: 294..472
e-value: 9.3E-59
score: 200.1
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 770..789
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 775..789
NoneNo IPR availablePANTHERPTHR22957:SF355coord: 331..760
NoneNo IPR availablePANTHERPTHR22957TBC1 DOMAIN FAMILY MEMBER GTPASE-ACTIVATING PROTEINcoord: 331..760
coord: 794..1026
NoneNo IPR availablePANTHERPTHR22957:SF355coord: 794..1026
IPR021935Small G protein signalling modulator 1/2, Rab-binding domainPFAMPF12068PH_RBDcoord: 304..441
e-value: 5.7E-25
score: 87.7
IPR037213RUN domain superfamilySUPERFAMILYSSF140741RUN domain-likecoord: 6..203
IPR035969Rab-GTPase-TBC domain superfamilySUPERFAMILYSSF47923Ypt/Rab-GAP domain of gyp1pcoord: 898..1021
IPR035969Rab-GTPase-TBC domain superfamilySUPERFAMILYSSF47923Ypt/Rab-GAP domain of gyp1pcoord: 667..921