Expressed conserved protein

Overview
NameExpressed conserved protein
Smed IDSMED30015621
Length (bp)894
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Expressed conserved protein (SMED30015621) t-SNE clustered cells

Violin plots show distribution of expression levels for Expressed conserved protein (SMED30015621) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30015621

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 1

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
testis primordiumSMED30015621SMESG000034843.1 Contig2472_SE3GPL10652PMID:20844018
Wang et al., 2010
whole organism juvenile cDNA to DNA expression microarray evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Expressed conserved protein vs. TrEMBL
Match: A0A0X3P8M1 (Uncharacterized protein (Fragment) OS=Schistocephalus solidus OX=70667 GN=TR161739 PE=4 SV=1)

HSP 1 Score: 225.328 bits (573), Expect = 2.452e-69
Identity = 111/231 (48.05%), Postives = 148/231 (64.07%), Query Frame = 2
Query:  113 MAIANSGANASNVCGWMRSDPMVDTENCNLCRSTEQTLVLIVYNNALSTFQKFRNTILTNLGVIRAYGNGEFFGMAKLASIRCIEGQFPAQWGLGILSFDNRFNAQKCCEAHTEIREQFWLGGVEMYILPLCTPCKSSLNYCLFQMDLYDIKNCSNFVGYVKDLFPLVLKFHGLIIAGSSDITVFRGSRSPRYIFIVQWSTPVDFHNYNEEAKVLLLRAGAACSSRIIFEI 805
            M  A    NASN  GW+ S  M      ++ R+T Q  V+I+Y+   STF KFRNT++ N+ V  AYGNGEFFGM+K   +RCIEG FP    LGI+SFD+   A KC E+ TE+RE+ WLGGVEMY++PLC P +   +Y  FQMD+YD+KN  NF+ Y+  +  +V +  GLI+AG++    +RG R P +I + QW T      YN E   +L  AGAACSSR+IFE+
Sbjct:   29 MNEAELNQNASNATGWVASKDMYRPAAVDMPRNTRQCFVMIIYDTKESTFGKFRNTMVLNIPVFHAYGNGEFFGMSK--CLRCIEGCFPTGCALGIISFDDHDQAVKCIESRTELREKMWLGGVEMYVVPLCNPVRHIGDYPFFQMDMYDVKNGRNFIKYLNTVEEMVHRKGGLIVAGTTQAGRWRGIRRPYFILLHQWVTVEQLEAYNNEVSPILRDAGAACSSRVIFEM 257          
BLAST of Expressed conserved protein vs. TrEMBL
Match: A0A0R3SCY7 (Uncharacterized protein OS=Hymenolepis diminuta OX=6216 GN=HDID_LOCUS2494 PE=4 SV=1)

HSP 1 Score: 210.305 bits (534), Expect = 7.763e-64
Identity = 99/228 (43.42%), Postives = 147/228 (64.47%), Query Frame = 2
Query:  125 NSGANASNVCGWMRSDPMVDTENCNLCRSTEQTLVLIVYNNALSTFQKFRNTILTNLGVIRAYGNGEFFGMAKLASIRCIEGQFPAQWGLGILSFDNRFNAQKCCEAHTEIREQFWLGGVEMYILPLCTPCKSSLNYCLFQMDLYDIKNCSNFVGYVKDLFPLVLKFHGLIIAGSSDITVFRGSRSPRYIFIVQWSTPVDFHNYNEEAKVLLLRAGAACSSRIIFEID 808
            N G N SN   W+ S  +    N ++ R+T QT+VLI+++ A + +  FRN ++ N+ + +AYG+GEF G++K  S++C EG FP   G+ +LSFDN+  A +C ++ T+IRE  W+G  EMYI+PLC P K+  ++ + Q+D YD+KN  NF  Y+  L  +V    GLIIAG+SD+T FRG   P Y+ I QW++     N+N+E   LL  AGAACS+R + E+D
Sbjct:    4 NKGNNISNSTAWVGSKSVYCINNVDIPRNTSQTIVLIIFDQAENYYGAFRNEMIINVPIFKAYGHGEFLGISK--SVKCFEGSFPMNSGVAVLSFDNKKEALRCLQSKTQIRETDWMGAPEMYIVPLCNPIKNMNDWNILQIDFYDVKNGVNFTKYLNTLEDIVHNNGGLIIAGTSDMTRFRGVSRPAYVLIYQWTSISQAQNFNKEVDGLLTSAGAACSTRAVVEMD 229          
BLAST of Expressed conserved protein vs. TrEMBL
Match: A0A0R3UKS8 (Uncharacterized protein OS=Mesocestoides corti OX=53468 GN=MCOS_LOCUS8228 PE=4 SV=1)

HSP 1 Score: 200.675 bits (509), Expect = 6.233e-60
Identity = 101/225 (44.89%), Postives = 140/225 (62.22%), Query Frame = 2
Query:  134 ANASNVCGWMRSDPMVDTENCNLCRSTEQTLVLIVYNNALSTFQKFRNTILTNLGVIRAYGNGEFFGMAKLASIRCIEGQFPAQWGLGILSFDNRFNAQKCCEAHTEIREQFWLGGVEMYILPLCTPCKSSLNYCLFQMDLYDIKNCSNFVGYVKDLFPLVLKFHGLIIAGSSDITVFRGSRSPRYIFIVQWSTPVDFHNYNEEAKVLLLRAGAACSSRIIFEID 808
             N SN  GW  S  M      ++ ++T QTLVLI++N A +    FRN ++ N  + RAYG+GEF G++K   +RCI+G FP+  G+ +LSFDN   A KC E+ TEIRE  W+G  EMY +PLC P +   ++   QMD+YDIKN  NFV Y+  +  LV K  GL+IAG+++   FRG R P Y+ + QW T      +N E   +L  AGAACS+R++FE+D
Sbjct:   12 TNVSNSSGWEPSKNMYCQTRLDIPKNTCQTLVLILFNQAENYHGAFRNEMIINTPIFRAYGHGEFLGISKC--LRCIDGCFPSNTGVSVLSFDNYEEAVKCLESKTEIRELNWMGNPEMYFVPLCNPIRHLSDFQFLQMDIYDIKNGVNFVKYINTVENLVQKNGGLVIAGTTETGKFRGMRRPMYMVLQQWQTIQQVEQFNSEISPILRDAGAACSTRVVFEMD 234          
BLAST of Expressed conserved protein vs. TrEMBL
Match: A0A068Y0H6 (Expressed conserved protein OS=Echinococcus multilocularis OX=6211 GN=EmuJ_000374000 PE=4 SV=1)

HSP 1 Score: 200.675 bits (509), Expect = 7.000e-60
Identity = 99/233 (42.49%), Postives = 144/233 (61.80%), Query Frame = 2
Query:  110 QMAIANSGANASNVCGWMRSDPMVDTENCNLCRSTEQTLVLIVYNNALSTFQKFRNTILTNLGVIRAYGNGEFFGMAKLASIRCIEGQFPAQWGLGILSFDNRFNAQKCCEAHTEIREQFWLGGVEMYILPLCTPCKSSLNYCLFQMDLYDIKNCSNFVGYVKDLFPLVLKFHGLIIAGSSDITVFRGSRSPRYIFIVQWSTPVDFHNYNEEAKVLLLRAGAACSSRIIFEID 808
            +  I    +NASN   W  S  M  + N N+ ++T QT+VLI++N A + +  FRN ++ NL V +AYGNGE+ G++K   +RC+EG FP   G+  L FD+   A +C ++ T+IRE  W+G  EMYI+PLC P +  ++Y   Q+D YD+KN  NF  Y+  +  +V    GLIIAG++DI  FRG   P Y+ I QW+T      +N E +  L  AGAACS+R++FE+D
Sbjct:   12 EETIITCDSNASNSTAWAGSRSMYCSTNFNIPKNTSQTMVLIIFNLAENYYGAFRNEMIINLPVFKAYGNGEYLGLSK--CVRCVEGSFPMNSGVAALCFDDHKEALRCMQSKTQIREANWMGCPEMYIIPLCNPIRHMIDYPFLQVDFYDVKNGVNFTKYMNTVENMVHDKGGLIIAGTTDIMRFRGVCRPMYVVIYQWTTIDLVECFNREVEPTLREAGAACSTRVVFEMD 242          
BLAST of Expressed conserved protein vs. TrEMBL
Match: A0A068WX81 (Expressed conserved protein OS=Echinococcus granulosus OX=6210 GN=EgrG_000374000 PE=4 SV=1)

HSP 1 Score: 197.978 bits (502), Expect = 8.909e-59
Identity = 98/233 (42.06%), Postives = 141/233 (60.52%), Query Frame = 2
Query:  110 QMAIANSGANASNVCGWMRSDPMVDTENCNLCRSTEQTLVLIVYNNALSTFQKFRNTILTNLGVIRAYGNGEFFGMAKLASIRCIEGQFPAQWGLGILSFDNRFNAQKCCEAHTEIREQFWLGGVEMYILPLCTPCKSSLNYCLFQMDLYDIKNCSNFVGYVKDLFPLVLKFHGLIIAGSSDITVFRGSRSPRYIFIVQWSTPVDFHNYNEEAKVLLLRAGAACSSRIIFEID 808
            +  I    +NASN   W  S  M    N N+ ++T QT+VLI++N A + +  FRN ++ NL + +AYGNGE+ G++K   +RC+EG FP   G+  L FD+   A +C ++ T+IRE  W+G  EMYI+PLC P +   +Y   Q+D YD+KN  NF  Y+  +  +V    GLIIAG++DI  FRG   P Y+ I QW T      +N E +  L  AGAACS+R++FE+D
Sbjct:   12 EETIITGDSNASNSTAWAGSRSMYCGTNFNIPKNTSQTMVLIIFNLAENYYGAFRNEMIINLPIFKAYGNGEYLGLSKC--VRCVEGSFPMNSGVAALCFDDHEEALRCMQSKTQIREANWMGCPEMYIIPLCNPIRHMTDYPFLQVDFYDVKNGVNFTKYMNTVENMVHDKGGLIIAGTTDIMRFRGVCRPMYVVIYQWPTIDLVECFNREVEPTLREAGAACSTRVVFEMD 242          
BLAST of Expressed conserved protein vs. Planmine SMEST
Match: SMESG000034843.1 (SMESG000034843.1)

HSP 1 Score: 496.508 bits (1277), Expect = 3.437e-180
Identity = 238/238 (100.00%), Postives = 238/238 (100.00%), Query Frame = 2
Query:  113 MAIANSGANASNVCGWMRSDPMVDTENCNLCRSTEQTLVLIVYNNALSTFQKFRNTILTNLGVIRAYGNGEFFGMAKLASIRCIEGQFPAQWGLGILSFDNRFNAQKCCEAHTEIREQFWLGGVEMYILPLCTPCKSSLNYCLFQMDLYDIKNCSNFVGYVKDLFPLVLKFHGLIIAGSSDITVFRGSRSPRYIFIVQWSTPVDFHNYNEEAKVLLLRAGAACSSRIIFEIDPPANCW 826
            MAIANSGANASNVCGWMRSDPMVDTENCNLCRSTEQTLVLIVYNNALSTFQKFRNTILTNLGVIRAYGNGEFFGMAKLASIRCIEGQFPAQWGLGILSFDNRFNAQKCCEAHTEIREQFWLGGVEMYILPLCTPCKSSLNYCLFQMDLYDIKNCSNFVGYVKDLFPLVLKFHGLIIAGSSDITVFRGSRSPRYIFIVQWSTPVDFHNYNEEAKVLLLRAGAACSSRIIFEIDPPANCW
Sbjct:    1 MAIANSGANASNVCGWMRSDPMVDTENCNLCRSTEQTLVLIVYNNALSTFQKFRNTILTNLGVIRAYGNGEFFGMAKLASIRCIEGQFPAQWGLGILSFDNRFNAQKCCEAHTEIREQFWLGGVEMYILPLCTPCKSSLNYCLFQMDLYDIKNCSNFVGYVKDLFPLVLKFHGLIIAGSSDITVFRGSRSPRYIFIVQWSTPVDFHNYNEEAKVLLLRAGAACSSRIIFEIDPPANCW 238          
BLAST of Expressed conserved protein vs. Planmine SMEST
Match: SMESG000043907.1 (SMESG000043907.1)

HSP 1 Score: 120.168 bits (300), Expect = 1.947e-32
Identity = 65/207 (31.40%), Postives = 107/207 (51.69%), Query Frame = 2
Query:  191 NCNLCRSTEQTLVLIVYN-NALSTFQKFRNTILTNLGVIRAYGNGEFFGMAKLASIRCIEGQFPAQWGLGILSFDNRFNAQKCCEAHTEIREQFWLGGVEMYILPLCTPCKSSLNYCLFQMDLYDIKNCSNFVGYVKDLFPLVLKFHGLIIAGSSDITVFRGSRSPRYIFIVQWSTPVDFHNYNEEAKVLLLRAGAACSSRIIFEID 808
            N +  R+T    VLI Y     ++  + R   +  L +++AYG+GE FG++K   +    G + +  G+ +LSFDN   A K   + T  RE  + G  E+   PL  P +    Y L Q+DLYD+K    F  Y+++L PL+    G +I  S ++  + G+R P ++ I+QW     +H +N  A  L      AC++RI+F ++
Sbjct:   20 NLSCPRTTCAAFVLITYELKKDASNTELRVAAIKVLSILKAYGHGEIFGVSKEGLVTVTNGLWGSNHGIILLSFDNEEEAVKFVHSPTGFREPLYPGSYEIITFPLVYPPRMVSEYKLLQLDLYDMKVLDKFFDYLQELIPLITCHGGYLICASQNVNHWFGTRKPNFVIIIQWIKIEKYHAFNRIATPLHREKSYACATRILFTME 226          
BLAST of Expressed conserved protein vs. Planmine SMEST
Match: SMESG000047126.1 (SMESG000047126.1)

HSP 1 Score: 73.1738 bits (178), Expect = 4.622e-15
Identity = 52/180 (28.89%), Postives = 90/180 (50.00%), Query Frame = 2
Query:  209 STEQTLVLIVYNNALSTFQKFRNTILTNLGVIRAYGNGEFFGMAKLASIRCIEGQFPAQWGLGILSFDNRFNAQKCCEAHTEIREQFWLGGVEMYILPLCT--PCKSSLNYCLFQMDLYDIKNCSNFVGYVKDLFPLVLKFHGL--IIAGSSDITVFRGSRSPRYIFIVQWSTPVDFHNY 736
             T + LVLI+++  L+  + F NT++    +IR YGNG+  G ++   I+ IEG +P ++ +G+L FD   +A+K   +    ++Q WL  VE+Y++PL    P K      LF  DL    N   F       +   +  +G    IA +  +  +RG  +  ++ I  W +  D+ N+
Sbjct:   18 ETGEVLVLILFDATLT--KSFCNTMVKEKNIIRNYGNGQMIGFSE--EIKVIEGDWPQKYTIGLLRFDTMKDAKKWNFSDPLTKQQDWLDQVEIYVMPLLKAFPKKEYQVMELFNCDLI---NEEQFYHKFLPSYKSAIDGNGCENFIACTDKVERWRGRHNFCHVMISLWPSLDDYMNW 190          
BLAST of Expressed conserved protein vs. Planmine SMEST
Match: SMESG000047126.1 (SMESG000047126.1)

HSP 1 Score: 72.4034 bits (176), Expect = 5.503e-15
Identity = 52/180 (28.89%), Postives = 90/180 (50.00%), Query Frame = 2
Query:  209 STEQTLVLIVYNNALSTFQKFRNTILTNLGVIRAYGNGEFFGMAKLASIRCIEGQFPAQWGLGILSFDNRFNAQKCCEAHTEIREQFWLGGVEMYILPLCT--PCKSSLNYCLFQMDLYDIKNCSNFVGYVKDLFPLVLKFHGL--IIAGSSDITVFRGSRSPRYIFIVQWSTPVDFHNY 736
             T + LVLI+++  L+  + F NT++    +IR YGNG+  G ++   I+ IEG +P ++ +G+L FD   +A+K   +    ++Q WL  VE+Y++PL    P K      LF  DL    N   F       +   +  +G    IA +  +  +RG  +  ++ I  W +  D+ N+
Sbjct:   18 ETGEVLVLILFDATLT--KSFCNTMVKEKNIIRNYGNGQMIGFSE--EIKVIEGDWPQKYTIGLLRFDTMKDAKKWNFSDPLTKQQDWLDQVEIYVMPLLKAFPKKEYQVMELFNCDLI---NEEQFYHKFLPSYKSAIDGNGCENFIACTDKVERWRGRHNFCHVMISLWPSLDDYMNW 190          
BLAST of Expressed conserved protein vs. Planmine SMEST
Match: SMESG000004187.1 (SMESG000004187.1)

HSP 1 Score: 72.7886 bits (177), Expect = 6.103e-15
Identity = 52/180 (28.89%), Postives = 90/180 (50.00%), Query Frame = 2
Query:  209 STEQTLVLIVYNNALSTFQKFRNTILTNLGVIRAYGNGEFFGMAKLASIRCIEGQFPAQWGLGILSFDNRFNAQKCCEAHTEIREQFWLGGVEMYILPLCT--PCKSSLNYCLFQMDLYDIKNCSNFVGYVKDLFPLVLKFHGL--IIAGSSDITVFRGSRSPRYIFIVQWSTPVDFHNY 736
             T + LVLI+++  L+  + F NT++    +IR YGNG+  G ++   I+ IEG +P ++ +G+L FD   +A+K   +    ++Q WL  VE+Y++PL    P K      LF  DL    N   F       +   +  +G    IA +  +  +RG  +  ++ I  W +  D+ N+
Sbjct:   18 ETGEVLVLILFDATLT--KSFCNTMVKEKNIIRNYGNGQMVGFSE--EIKVIEGDWPQKYTIGLLRFDTMKDAKKWNFSDPLTKQQDWLDQVEIYVMPLLKAFPKKEYQVMELFNCDLI---NEEQFYHKFLPSYKSAIDGNGCENFIACTDKVERWRGRHNFCHVMISLWPSLDDYMNW 190          
The following BLAST results are available for this feature:
BLAST of Expressed conserved protein vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Expressed conserved protein vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Expressed conserved protein vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Expressed conserved protein vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Expressed conserved protein vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Expressed conserved protein vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Expressed conserved protein vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Expressed conserved protein vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A0X3P8M12.452e-6948.05Uncharacterized protein (Fragment) OS=Schistocepha... [more]
A0A0R3SCY77.763e-6443.42Uncharacterized protein OS=Hymenolepis diminuta OX... [more]
A0A0R3UKS86.233e-6044.89Uncharacterized protein OS=Mesocestoides corti OX=... [more]
A0A068Y0H67.000e-6042.49Expressed conserved protein OS=Echinococcus multil... [more]
A0A068WX818.909e-5942.06Expressed conserved protein OS=Echinococcus granul... [more]
back to top
BLAST of Expressed conserved protein vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Expressed conserved protein vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Expressed conserved protein vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Expressed conserved protein vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Expressed conserved protein vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Expressed conserved protein vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000034843.13.437e-180100.00SMESG000034843.1[more]
SMESG000043907.11.947e-3231.40SMESG000043907.1[more]
SMESG000047126.14.622e-1528.89SMESG000047126.1[more]
SMESG000047126.15.503e-1528.89SMESG000047126.1[more]
SMESG000004187.16.103e-1528.89SMESG000004187.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30015621 ID=SMED30015621|Name=Expressed conserved protein|organism=Schmidtea mediterranea sexual|type=transcript|length=894bp
AAAATTGGAACCTCTTTATGATTTAAACCGCTTTGAAGATCCAATTTCAA
TTTAATTGATTTTTAAATACAGAATTTTAAATTTTATTGATAATAAGAAT
CTATAATTCCAAATGGCTATCGCAAACAGTGGGGCAAACGCTTCAAATGT
GTGCGGGTGGATGCGGTCAGACCCCATGGTGGATACAGAAAACTGTAATT
TATGCCGTTCCACGGAGCAAACATTGGTTCTGATCGTGTATAATAATGCA
TTGAGTACTTTTCAAAAATTTAGAAATACTATATTGACAAACCTTGGAGT
TATTAGAGCTTATGGCAATGGCGAATTCTTTGGAATGGCCAAATTAGCGT
CGATACGTTGTATTGAAGGTCAATTTCCAGCACAGTGGGGTCTAGGAATA
TTAAGTTTTGATAATAGATTCAATGCTCAAAAATGCTGCGAAGCACATAC
AGAAATCCGAGAACAGTTTTGGCTAGGAGGAGTTGAAATGTATATTCTGC
CATTGTGTACACCTTGTAAAAGTTCATTAAATTATTGCCTCTTTCAAATG
GATTTGTATGACATTAAAAACTGTTCCAATTTTGTCGGATACGTAAAAGA
CTTGTTTCCATTAGTGCTGAAATTTCACGGTCTTATAATAGCGGGGTCAT
CGGATATTACAGTGTTCAGAGGTTCAAGATCCCCTCGATATATATTCATT
GTTCAATGGAGCACTCCTGTTGATTTTCATAATTATAATGAAGAAGCAAA
GGTTTTATTGCTTCGAGCTGGTGCTGCTTGTAGTTCAAGAATTATTTTCG
AAATTGATCCACCAGCTAATTGTTGGTAACCCTTATCAGGTTTATTTCCA
TGTGAACTCAAATTCATATTTTTATTTATTTTGAGCAATGTGTG
back to top

protein sequence of SMED30015621-orf-1

>SMED30015621-orf-1 ID=SMED30015621-orf-1|Name=SMED30015621-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=239bp
MAIANSGANASNVCGWMRSDPMVDTENCNLCRSTEQTLVLIVYNNALSTF
QKFRNTILTNLGVIRAYGNGEFFGMAKLASIRCIEGQFPAQWGLGILSFD
NRFNAQKCCEAHTEIREQFWLGGVEMYILPLCTPCKSSLNYCLFQMDLYD
IKNCSNFVGYVKDLFPLVLKFHGLIIAGSSDITVFRGSRSPRYIFIVQWS
TPVDFHNYNEEAKVLLLRAGAACSSRIIFEIDPPANCW*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0003304testis primordium