ATPase H transporting accessory protein 1a

Overview
NameATPase H transporting accessory protein 1a
Smed IDSMED30015615
Length (bp)439
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of ATPase H transporting accessory protein 1a (SMED30015615) t-SNE clustered cells

Violin plots show distribution of expression levels for ATPase H transporting accessory protein 1a (SMED30015615) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of ATPase H transporting accessory protein 1a (SMED30015615) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for ATPase H transporting accessory protein 1a (SMED30015615) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30015615

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 3

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
intestinal phagocyteSMED30015615SMESG000077471.1 PL030008A20F11ncbi_smed_estsPMID:23079596
Forsthoefel et al., 2012
FACS sorted cell population asexual adult cDNA to DNA expression microarray evidence
gutSMED30015615SMESG000077471.1 dd_Smed_v4_1840_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
parenchymal cellSMED30015615SMESG000077471.1 dd_Smed_v4_1840_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of ATPase H transporting accessory protein 1a vs. Ensembl Human
Match: ATP6AP1 (ATPase H+ transporting accessory protein 1 [Source:HGNC Symbol;Acc:HGNC:868])

HSP 1 Score: 76.6406 bits (187), Expect = 4.804e-17
Identity = 39/111 (35.14%), Postives = 60/111 (54.05%), Query Frame = 3
Query:   27 LTASWLTAPLDYSYHCSSPLNISSKDT-----------QLSFDKLQVQAFNVKDNKFGWANDCIGFFSIGVWSVLMSTIVLLAILSIGLQMTLQIASPDKSDDPKGKHVQL 326
              AS +T P  YS+HC    ++S K +           Q+     Q+QAFNV   +F +A+DC  FFS G+W  L++++ +L I + GL M L + + D+ DD KG  + L
Sbjct:  167 FNASQVTGPSIYSFHCEYVSSLSKKGSLLVARTQPSPWQMMLQDFQIQAFNVMGEQFSYASDCASFFSPGIWMGLLTSLFMLFIFTYGLHMILSLKTMDRFDDHKGPTISL 277          
BLAST of ATPase H transporting accessory protein 1a vs. Ensembl Human
Match: ATP6AP1 (ATPase H+ transporting accessory protein 1 [Source:HGNC Symbol;Acc:HGNC:868])

HSP 1 Score: 76.2554 bits (186), Expect = 2.123e-16
Identity = 39/109 (35.78%), Postives = 60/109 (55.05%), Query Frame = 3
Query:   33 ASWLTAPLDYSYHCSSPLNISSKDT-----------QLSFDKLQVQAFNVKDNKFGWANDCIGFFSIGVWSVLMSTIVLLAILSIGLQMTLQIASPDKSDDPKGKHVQL 326
            AS +T P  YS+HC    ++S K +           Q+     Q+QAFNV   +F +A+DC  FFS G+W  L++++ +L I + GL M L + + D+ DD KG  + L
Sbjct:  358 ASQVTGPSIYSFHCEYVSSLSKKGSLLVARTQPSPWQMMLQDFQIQAFNVMGEQFSYASDCASFFSPGIWMGLLTSLFMLFIFTYGLHMILSLKTMDRFDDHKGPTISL 466          
BLAST of ATPase H transporting accessory protein 1a vs. Ensembl Celegans
Match: vha-19 (Vacuolar H ATPase [Source:UniProtKB/TrEMBL;Acc:Q9TYW1])

HSP 1 Score: 44.669 bits (104), Expect = 7.144e-6
Identity = 28/89 (31.46%), Postives = 41/89 (46.07%), Query Frame = 3
Query:   81 PLNISSKDTQLSFDKLQVQAFNVKDNKFGW---------ANDCIGFFSIGVWSVLMSTIVLLAILSIGLQMTLQIASPDKSDDPKGKHV 320
            P N  S    ++    Q+Q FN + N   W           DC G FS G W  ++S +VL+A L  G  M   + + D+ DDPK + +
Sbjct:  358 PTNEQSVRIGVALMNTQIQLFNYQ-NPEKWVESAHFTLQTEDCTGTFSSGSWMGIVSALVLIAGLMFGYVMLQSVQTMDRFDDPKQRQI 445          
BLAST of ATPase H transporting accessory protein 1a vs. Ensembl Fly
Match: VhaAC45 (gene:FBgn0262515 transcript:FBtr0088588)

HSP 1 Score: 58.9214 bits (141), Expect = 9.667e-11
Identity = 38/114 (33.33%), Postives = 61/114 (53.51%), Query Frame = 3
Query:   24 NLTASWLTAPLDYSYHCSS----PLNISSKDTQLSFDKLQVQA-FN---VKDNKFGWANDCIGFFSIGVWSVLMSTIVLLAILSIGLQMTLQIASPDKSDDPKGKHVQLGPLAE 341
            N  +S + AP  +SY C +       +++    LSF  LQ+QA F+    +D  FG + DC+GF + G+   L    +LL I+ +G+   + I + D+ DDPKGK + +   AE
Sbjct:  266 NFRSSGVNAPTTFSYSCGNLTLESAAVNNMYNTLSFKSLQLQAPFDGTYKEDFPFGDSWDCVGFVTPGILMGLFVVALLLVIMFVGVCWMMDINTMDRFDDPKGKTITINAAAE 379          
BLAST of ATPase H transporting accessory protein 1a vs. Ensembl Fly
Match: VhaAC45 (gene:FBgn0262515 transcript:FBtr0088587)

HSP 1 Score: 58.9214 bits (141), Expect = 9.667e-11
Identity = 38/114 (33.33%), Postives = 61/114 (53.51%), Query Frame = 3
Query:   24 NLTASWLTAPLDYSYHCSS----PLNISSKDTQLSFDKLQVQA-FN---VKDNKFGWANDCIGFFSIGVWSVLMSTIVLLAILSIGLQMTLQIASPDKSDDPKGKHVQLGPLAE 341
            N  +S + AP  +SY C +       +++    LSF  LQ+QA F+    +D  FG + DC+GF + G+   L    +LL I+ +G+   + I + D+ DDPKGK + +   AE
Sbjct:  266 NFRSSGVNAPTTFSYSCGNLTLESAAVNNMYNTLSFKSLQLQAPFDGTYKEDFPFGDSWDCVGFVTPGILMGLFVVALLLVIMFVGVCWMMDINTMDRFDDPKGKTITINAAAE 379          
BLAST of ATPase H transporting accessory protein 1a vs. Ensembl Zebrafish
Match: atp6ap1b (ATPase H+ transporting accessory protein 1b [Source:ZFIN;Acc:ZDB-GENE-020423-2])

HSP 1 Score: 80.1073 bits (196), Expect = 5.500e-18
Identity = 43/120 (35.83%), Postives = 70/120 (58.33%), Query Frame = 3
Query:   18 MMNLTASWLTAPLDYSYHCSS----------PLNISSKDTQ--LSFDKLQVQAFNVKDNKFGWANDCIGFFSIGVWSVLMSTIVLLAILSIGLQMTLQIASPDKSDDPKGKHVQLGPLAE 341
            M N +A  +  P +YS+ C +          P N +   T+  L F   Q+Q+F+V  + F +A+DC GFFS G+W  L+ ++++L IL+ GL M +Q+ + D+ DDPKG  + + PL+E
Sbjct:  342 MFNASAG-INTPAEYSFRCQNVSSAQSPLLVPRNATDNATKWTLIFTDFQIQSFSVTGDSFAFASDCAGFFSAGIWMGLVISLLMLLILTYGLHMIMQLRTMDRFDDPKGPAISV-PLSE 459          
BLAST of ATPase H transporting accessory protein 1a vs. Ensembl Zebrafish
Match: atp6ap1a (ATPase H+ transporting accessory protein 1a [Source:ZFIN;Acc:ZDB-GENE-090312-136])

HSP 1 Score: 79.337 bits (194), Expect = 1.049e-17
Identity = 36/105 (34.29%), Postives = 62/105 (59.05%), Query Frame = 3
Query:   48 APLDYSYHCSSPLNI------------SSKDTQLSFDKLQVQAFNVKDNKFGWANDCIGFFSIGVWSVLMSTIVLLAILSIGLQMTLQIASPDKSDDPKGKHVQL 326
            AP +YSY C S  +             ++ D Q+SF+  Q+Q FNV    F +A+DC  FF+ G+W  L+++++++ +L+ GL M +Q+ + D+ DDPKG  + +
Sbjct:  358 APSEYSYRCESVSSSYYAQLSPHSDKDNANDWQISFENFQIQGFNVAGKDFSYASDCASFFTPGIWMGLVTSLLMVLVLTYGLHMIMQLRTMDRFDDPKGPAISV 462          
BLAST of ATPase H transporting accessory protein 1a vs. Ensembl Zebrafish
Match: atp6ap1lb (ATPase H+ transporting accessory protein 1 like b [Source:ZFIN;Acc:ZDB-GENE-050208-117])

HSP 1 Score: 67.3958 bits (163), Expect = 9.676e-14
Identity = 33/106 (31.13%), Postives = 56/106 (52.83%), Query Frame = 3
Query:   33 ASWLTAPLDYSYHCSSPLNISSKDT--------------QLSFDKLQVQAFNVKDNKFGWANDCIGFFSIGVWSVLMSTIVLLAILSIGLQMTLQIASPDKSDDPK 308
            A+ + AP  YSYHC    ++   DT               ++F   Q+QAFNV+ NKF  A+DC  FF+  +   L+++++LL +L+  L M + +   D+ ++ K
Sbjct:  197 ATEVYAPATYSYHCQHVSSLQKYDTLLVPSSYTDSSANWHITFTDFQIQAFNVQSNKFASASDCATFFTPAILMGLITSLILLLVLAYALHMVVHLKHIDRYEEHK 302          
BLAST of ATPase H transporting accessory protein 1a vs. Ensembl Zebrafish
Match: atp6ap1la (ATPase H+ transporting accessory protein 1 like a [Source:ZFIN;Acc:ZDB-GENE-110318-1])

HSP 1 Score: 58.9214 bits (141), Expect = 1.318e-10
Identity = 30/101 (29.70%), Postives = 52/101 (51.49%), Query Frame = 3
Query:   48 APLDYSYHCSSPLNISSKDT--------------QLSFDKLQVQAFNVKDNKFGWANDCIGFFSIGVWSVLMSTIVLLAILSIGLQMTLQIASPDKSDDPK 308
            AP   SYHC    ++   DT               ++F   Q+QAFNV+ +KF  A+DC  FF+  +   L+++++LL +L+  L M + +   D+ ++ K
Sbjct:  213 APSTNSYHCQHVSSLQKYDTLLVPSANTDHAANWHITFTDFQIQAFNVQSSKFAPASDCATFFTPAILMGLITSLILLLVLAYALHMVVHLKHIDRYEEHK 313          
BLAST of ATPase H transporting accessory protein 1a vs. Ensembl Zebrafish
Match: atp6ap1lb (ATPase H+ transporting accessory protein 1 like b [Source:ZFIN;Acc:ZDB-GENE-050208-117])

HSP 1 Score: 49.6766 bits (117), Expect = 1.937e-7
Identity = 25/74 (33.78%), Postives = 36/74 (48.65%), Query Frame = 3
Query:   27 LTASWLTAPLDYSYHCSSPLNISSKDT--------------QLSFDKLQVQAFNVKDNKFGWANDCIGFFSIGV 206
              A+ + AP  YSYHC    ++   DT               ++F   Q+QAFNV+ NKF  A+DC  FF+  +
Sbjct:  207 FNATEVYAPATYSYHCQHVSSLQKYDTLLVPSSYTDSSANWHITFTDFQIQAFNVQSNKFASASDCATFFTPAI 280          
BLAST of ATPase H transporting accessory protein 1a vs. Ensembl Xenopus
Match: ENSXETT00000053628.1 (V-type proton ATPase subunit S1-like [Source:NCBI gene;Acc:100487454])

HSP 1 Score: 79.7221 bits (195), Expect = 8.291e-18
Identity = 40/106 (37.74%), Postives = 61/106 (57.55%), Query Frame = 3
Query:   45 TAPLDYSYHCSSPLNISSKDTQLS------------FDKLQVQAFNVKDNKFGWANDCIGFFSIGVWSVLMSTIVLLAILSIGLQMTLQIASPDKSDDPKGKHVQL 326
            +AP +YSYHC      S+   QL               + Q+Q FN+++N F +A+DC  FF+  +W  L+S+IVLL ILS G+ M +Q+ +  K DDPKG+ + +
Sbjct:  319 SAPAEYSYHCQQIGTSSAYGEQLVRSNSQAGSWNIFISEFQIQGFNIQNNLFSYASDCTSFFTPAIWMGLVSSIVLLWILSYGIFMIMQLTTNGKFDDPKGQQLSV 424          
BLAST of ATPase H transporting accessory protein 1a vs. Ensembl Xenopus
Match: ENSXETT00000053622.1 (V-type proton ATPase subunit S1-like [Source:NCBI gene;Acc:100487454])

HSP 1 Score: 79.7221 bits (195), Expect = 8.809e-18
Identity = 40/106 (37.74%), Postives = 61/106 (57.55%), Query Frame = 3
Query:   45 TAPLDYSYHCSSPLNISSKDTQLS------------FDKLQVQAFNVKDNKFGWANDCIGFFSIGVWSVLMSTIVLLAILSIGLQMTLQIASPDKSDDPKGKHVQL 326
            +AP +YSYHC      S+   QL               + Q+Q FN+++N F +A+DC  FF+  +W  L+S+IVLL ILS G+ M +Q+ +  K DDPKG+ + +
Sbjct:  327 SAPAEYSYHCQQIGTSSAYGEQLVRSNSQAGSWNIFISEFQIQGFNIQNNLFSYASDCTSFFTPAIWMGLVSSIVLLWILSYGIFMIMQLTTNGKFDDPKGQQLSV 432          
BLAST of ATPase H transporting accessory protein 1a vs. Ensembl Xenopus
Match: ENSXETT00000053627.1 (V-type proton ATPase subunit S1-like [Source:NCBI gene;Acc:100487454])

HSP 1 Score: 79.7221 bits (195), Expect = 9.044e-18
Identity = 40/106 (37.74%), Postives = 61/106 (57.55%), Query Frame = 3
Query:   45 TAPLDYSYHCSSPLNISSKDTQLS------------FDKLQVQAFNVKDNKFGWANDCIGFFSIGVWSVLMSTIVLLAILSIGLQMTLQIASPDKSDDPKGKHVQL 326
            +AP +YSYHC      S+   QL               + Q+Q FN+++N F +A+DC  FF+  +W  L+S+IVLL ILS G+ M +Q+ +  K DDPKG+ + +
Sbjct:  322 SAPAEYSYHCQQIGTSSAYGEQLVRSNSQAGSWNIFISEFQIQGFNIQNNLFSYASDCTSFFTPAIWMGLVSSIVLLWILSYGIFMIMQLTTNGKFDDPKGQQLSV 427          
BLAST of ATPase H transporting accessory protein 1a vs. Ensembl Xenopus
Match: ENSXETT00000053626.1 (V-type proton ATPase subunit S1-like [Source:NCBI gene;Acc:100487454])

HSP 1 Score: 79.7221 bits (195), Expect = 9.348e-18
Identity = 40/106 (37.74%), Postives = 61/106 (57.55%), Query Frame = 3
Query:   45 TAPLDYSYHCSSPLNISSKDTQLS------------FDKLQVQAFNVKDNKFGWANDCIGFFSIGVWSVLMSTIVLLAILSIGLQMTLQIASPDKSDDPKGKHVQL 326
            +AP +YSYHC      S+   QL               + Q+Q FN+++N F +A+DC  FF+  +W  L+S+IVLL ILS G+ M +Q+ +  K DDPKG+ + +
Sbjct:  345 SAPAEYSYHCQQIGTSSAYGEQLVRSNSQAGSWNIFISEFQIQGFNIQNNLFSYASDCTSFFTPAIWMGLVSSIVLLWILSYGIFMIMQLTTNGKFDDPKGQQLSV 450          
BLAST of ATPase H transporting accessory protein 1a vs. Ensembl Xenopus
Match: atp6ap1.2 (ATPase, H+ transporting, lysosomal accessory protein 1, gene 2 [Source:NCBI gene;Acc:100170603])

HSP 1 Score: 77.0258 bits (188), Expect = 8.132e-17
Identity = 40/113 (35.40%), Postives = 65/113 (57.52%), Query Frame = 3
Query:   33 ASWLTAPLDYSYHC----------SSPLNISSKDT-----QLSFDKLQVQAFNVKDNKFGWANDCIGFFSIGVWSVLMSTIVLLAILSIGLQMTLQIASPDKSDDPKGKHVQL 326
            A  + AP +YS+HC          S  ++ +SK++     QL   + Q+Q FNV    F +A+DC GFFS G+W  L++T++ + IL+ GL M + + + D+ DDPKG  + +
Sbjct:  330 APQVNAPSNYSFHCQYISSWPTFGSVLVSNTSKNSPASKWQLHIAEFQIQGFNVTGMAFSYASDCAGFFSPGIWMGLITTLLFVFILTYGLHMVMSLKTMDRFDDPKGPSIAV 442          
BLAST of ATPase H transporting accessory protein 1a vs. Ensembl Mouse
Match: Atp6ap1 (ATPase, H+ transporting, lysosomal accessory protein 1 [Source:MGI Symbol;Acc:MGI:109629])

HSP 1 Score: 81.2629 bits (199), Expect = 2.123e-18
Identity = 40/111 (36.04%), Postives = 61/111 (54.95%), Query Frame = 3
Query:   24 NLTASWLTAPLDYSYHCSSPLNISSKDT----------QLSFDKLQVQAFNVKDNKFGWANDCIGFFSIGVWSVLMSTIVLLAILSIGLQMTLQIASPDKSDDPKGKHVQL 326
            +   S +T P  YS+HC    ++S K            Q++    Q+QAFNV   +F +A+DC GFFS G+W  L++T+ +L I + GL M L + + D+ DD KG  + L
Sbjct:  349 HFNVSQVTGPSIYSFHCEYVSSVSKKGNLLVTNVPSVWQMTLHNFQIQAFNVTGEQFSYASDCAGFFSPGIWMGLLTTLFMLFIFTYGLHMILSLKTMDRFDDHKGPTITL 459          
BLAST of ATPase H transporting accessory protein 1a vs. UniProt/SwissProt
Match: sp|P40682|VAS1_BOVIN (V-type proton ATPase subunit S1 OS=Bos taurus OX=9913 GN=ATP6AP1 PE=1 SV=1)

HSP 1 Score: 83.9593 bits (206), Expect = 1.550e-18
Identity = 43/112 (38.39%), Postives = 65/112 (58.04%), Query Frame = 3
Query:   33 ASWLTAPLDYSYHCSSPLNISSKDT--------------QLSFDKLQVQAFNVKDNKFGWANDCIGFFSIGVWSVLMSTIVLLAILSIGLQMTLQIASPDKSDDPKGKHVQL 326
            AS +T P  YS+HC    ++SS++               Q++F   Q+QAFNV D KF +A+DC GFFS G+W  L++++ +L I + GL M L + + D+ DD KG  + L
Sbjct:  356 ASQVTGPSIYSFHCE---HVSSENEDGNLLVPDTQPSLWQMTFRDFQIQAFNVTDKKFSYASDCAGFFSPGIWMGLLTSLFMLFIFTYGLHMILSLKTMDRFDDHKGPTITL 464          
BLAST of ATPase H transporting accessory protein 1a vs. UniProt/SwissProt
Match: sp|O54715|VAS1_RAT (V-type proton ATPase subunit S1 OS=Rattus norvegicus OX=10116 GN=Atp6ap1 PE=2 SV=1)

HSP 1 Score: 81.6481 bits (200), Expect = 1.270e-17
Identity = 40/111 (36.04%), Postives = 62/111 (55.86%), Query Frame = 3
Query:   24 NLTASWLTAPLDYSYHCSSPLNISSKDT----------QLSFDKLQVQAFNVKDNKFGWANDCIGFFSIGVWSVLMSTIVLLAILSIGLQMTLQIASPDKSDDPKGKHVQL 326
            +   S +T P  YS+HC    ++S K +          Q++    Q+QAFNV   +F +A+DC GFFS G+W  L++T+ +L I + GL M L + + D+ DD KG  + L
Sbjct:  349 HFNVSQVTGPSIYSFHCEYVSSLSKKGSLLVTNVPSLWQMTLHNFQIQAFNVTGEQFSYASDCAGFFSPGIWMGLLTTLFMLFIFTYGLHMILSLKTMDRFDDRKGPTITL 459          
BLAST of ATPase H transporting accessory protein 1a vs. UniProt/SwissProt
Match: sp|Q9R1Q9|VAS1_MOUSE (V-type proton ATPase subunit S1 OS=Mus musculus OX=10090 GN=Atp6ap1 PE=1 SV=1)

HSP 1 Score: 81.2629 bits (199), Expect = 1.485e-17
Identity = 40/111 (36.04%), Postives = 61/111 (54.95%), Query Frame = 3
Query:   24 NLTASWLTAPLDYSYHCSSPLNISSKDT----------QLSFDKLQVQAFNVKDNKFGWANDCIGFFSIGVWSVLMSTIVLLAILSIGLQMTLQIASPDKSDDPKGKHVQL 326
            +   S +T P  YS+HC    ++S K            Q++    Q+QAFNV   +F +A+DC GFFS G+W  L++T+ +L I + GL M L + + D+ DD KG  + L
Sbjct:  349 HFNVSQVTGPSIYSFHCEYVSSVSKKGNLLVTNVPSVWQMTLHNFQIQAFNVTGEQFSYASDCAGFFSPGIWMGLLTTLFMLFIFTYGLHMILSLKTMDRFDDHKGPTITL 459          
BLAST of ATPase H transporting accessory protein 1a vs. UniProt/SwissProt
Match: sp|Q15904|VAS1_HUMAN (V-type proton ATPase subunit S1 OS=Homo sapiens OX=9606 GN=ATP6AP1 PE=1 SV=2)

HSP 1 Score: 76.2554 bits (186), Expect = 1.020e-15
Identity = 39/109 (35.78%), Postives = 60/109 (55.05%), Query Frame = 3
Query:   33 ASWLTAPLDYSYHCSSPLNISSKDT-----------QLSFDKLQVQAFNVKDNKFGWANDCIGFFSIGVWSVLMSTIVLLAILSIGLQMTLQIASPDKSDDPKGKHVQL 326
            AS +T P  YS+HC    ++S K +           Q+     Q+QAFNV   +F +A+DC  FFS G+W  L++++ +L I + GL M L + + D+ DD KG  + L
Sbjct:  358 ASQVTGPSIYSFHCEYVSSLSKKGSLLVARTQPSPWQMMLQDFQIQAFNVMGEQFSYASDCASFFSPGIWMGLLTSLFMLFIFTYGLHMILSLKTMDRFDDHKGPTISL 466          
BLAST of ATPase H transporting accessory protein 1a vs. UniProt/SwissProt
Match: sp|Q7JR49|VAS1_DROME (V-type proton ATPase subunit S1 OS=Drosophila melanogaster OX=7227 GN=VhaAC45 PE=1 SV=1)

HSP 1 Score: 58.9214 bits (141), Expect = 9.690e-10
Identity = 38/114 (33.33%), Postives = 61/114 (53.51%), Query Frame = 3
Query:   24 NLTASWLTAPLDYSYHCSS----PLNISSKDTQLSFDKLQVQA-FN---VKDNKFGWANDCIGFFSIGVWSVLMSTIVLLAILSIGLQMTLQIASPDKSDDPKGKHVQLGPLAE 341
            N  +S + AP  +SY C +       +++    LSF  LQ+QA F+    +D  FG + DC+GF + G+   L    +LL I+ +G+   + I + D+ DDPKGK + +   AE
Sbjct:  266 NFRSSGVNAPTTFSYSCGNLTLESAAVNNMYNTLSFKSLQLQAPFDGTYKEDFPFGDSWDCVGFVTPGILMGLFVVALLLVIMFVGVCWMMDINTMDRFDDPKGKTITINAAAE 379          
BLAST of ATPase H transporting accessory protein 1a vs. TrEMBL
Match: A0A183N2K1 (Uncharacterized protein OS=Schistosoma margrebowiei OX=48269 GN=SMRZ_LOCUS22526 PE=4 SV=1)

HSP 1 Score: 87.4261 bits (215), Expect = 6.627e-19
Identity = 44/108 (40.74%), Postives = 60/108 (55.56%), Query Frame = 3
Query:   27 LTASWLTAPLDYSYHCSSPLNI-------SSKDTQLSFDKLQVQAFNVKDNKFGWANDCIGFFSIGVWSVLMSTIVLLAILSIGLQMTLQIASPDKSDDPKGKHVQLG 329
            L   W  AP++  Y C+ P          S     L F  +QVQ F VKD  FG   DC+G+FSIGVWS L+ +I+L++IL+ GL M   +   +  +DPK K +QLG
Sbjct:   58 LVMKWAGAPINLGYKCTKPSAAPVILPSDSGNSVSLQFSSIQVQPFGVKDGVFGDVTDCVGYFSIGVWSSLIVSILLISILTYGLVMLASVQPSEIYEDPKKKMIQLG 165          
BLAST of ATPase H transporting accessory protein 1a vs. TrEMBL
Match: A0A3P8UGA9 (ATPase H+ transporting accessory protein 1a OS=Cynoglossus semilaevis OX=244447 PE=4 SV=1)

HSP 1 Score: 91.6633 bits (226), Expect = 1.106e-18
Identity = 44/105 (41.90%), Postives = 64/105 (60.95%), Query Frame = 3
Query:   48 APLDYSYHCSSPLNI--------SSKDT----QLSFDKLQVQAFNVKDNKFGWANDCIGFFSIGVWSVLMSTIVLLAILSIGLQMTLQIASPDKSDDPKGKHVQL 326
            AP +YSY C S  N         SSKD     ++SFD  Q+Q FNV    F +A+DC GFFS G+W  LM+T++++ +L+ GL M +Q+ + D+ DDPKG  + +
Sbjct:  415 APAEYSYRCQSVTNFRWPLLVPRSSKDPANQWRVSFDDFQIQGFNVSKGDFSYASDCAGFFSPGIWMGLMTTLLMVLVLTYGLHMIMQLHTMDRFDDPKGPAISV 519          
BLAST of ATPase H transporting accessory protein 1a vs. TrEMBL
Match: A0A3P8UJS3 (ATPase H+ transporting accessory protein 1a OS=Cynoglossus semilaevis OX=244447 PE=4 SV=1)

HSP 1 Score: 91.6633 bits (226), Expect = 1.210e-18
Identity = 44/105 (41.90%), Postives = 64/105 (60.95%), Query Frame = 3
Query:   48 APLDYSYHCSSPLNI--------SSKDT----QLSFDKLQVQAFNVKDNKFGWANDCIGFFSIGVWSVLMSTIVLLAILSIGLQMTLQIASPDKSDDPKGKHVQL 326
            AP +YSY C S  N         SSKD     ++SFD  Q+Q FNV    F +A+DC GFFS G+W  LM+T++++ +L+ GL M +Q+ + D+ DDPKG  + +
Sbjct:  415 APAEYSYRCQSVTNFRWPLLVPRSSKDPANQWRVSFDDFQIQGFNVSKGDFSYASDCAGFFSPGIWMGLMTTLLMVLVLTYGLHMIMQLHTMDRFDDPKGPAISV 519          
BLAST of ATPase H transporting accessory protein 1a vs. TrEMBL
Match: A0A093CZQ7 (V-type proton ATPase subunit S1 (Fragment) OS=Tauraco erythrolophus OX=121530 GN=N340_01485 PE=4 SV=1)

HSP 1 Score: 88.1965 bits (217), Expect = 1.876e-18
Identity = 41/110 (37.27%), Postives = 65/110 (59.09%), Query Frame = 3
Query:   18 MMNLTASWLTAPLDYSYHCS------------SPLNISSKDTQLSFDKLQVQAFNVKDNKFGWANDCIGFFSIGVWSVLMSTIVLLAILSIGLQMTLQIASPDKSDDPKG 311
            +     S ++AP +YS+HC              P N  + +  +   + Q+Q FN++DN+F +A+DC GFFS GVW  L+++IVLL IL+ G+ M +Q+ +  + DDPKG
Sbjct:  128 LATFNVSVMSAPAEYSFHCQLVGTSNLYPAKLIPSNEEANNWDVFISRFQIQGFNIEDNEFSYASDCTGFFSPGVWMGLVTSIVLLWILAYGIHMIMQLTTNSRFDDPKG 237          
BLAST of ATPase H transporting accessory protein 1a vs. TrEMBL
Match: A0A093PZ05 (V-type proton ATPase subunit S1 (Fragment) OS=Phalacrocorax carbo OX=9209 GN=N336_12391 PE=4 SV=1)

HSP 1 Score: 88.9669 bits (219), Expect = 2.152e-18
Identity = 40/104 (38.46%), Postives = 67/104 (64.42%), Query Frame = 3
Query:   36 SWLTAPLDYSYHCS------------SPLNISSKDTQLSFDKLQVQAFNVKDNKFGWANDCIGFFSIGVWSVLMSTIVLLAILSIGLQMTLQIASPDKSDDPKG 311
            S ++AP +YS+HC              P N  +K+  +   +LQ+Q FN+++N+F +A+DC GFF+ G+W  L+++IVLL IL+ G+ M +Q+ + ++ DDPKG
Sbjct:  179 SVISAPAEYSFHCQLVGTSNLYPARLIPSNNEAKNWDVFISRLQIQGFNIENNQFSYASDCTGFFTPGIWMGLVTSIVLLWILTYGIHMIMQLTTNNRFDDPKG 282          
BLAST of ATPase H transporting accessory protein 1a vs. Ensembl Cavefish
Match: atp6ap1a (ATPase H+ transporting accessory protein 1a [Source:ZFIN;Acc:ZDB-GENE-090312-136])

HSP 1 Score: 83.1889 bits (204), Expect = 3.754e-19
Identity = 39/105 (37.14%), Postives = 63/105 (60.00%), Query Frame = 3
Query:   48 APLDYSYHCSSPLNI--------SSKDT----QLSFDKLQVQAFNVKDNKFGWANDCIGFFSIGVWSVLMSTIVLLAILSIGLQMTLQIASPDKSDDPKGKHVQL 326
            AP +YSY C S  +         SSKD     ++SFD  Q+Q FNV    F +A+DC  FF+ G+W  L+++++++ +L+ GL M +Q+ + D+ DDPKG  + +
Sbjct:  358 APAEYSYRCDSVTSFRYAQLTPRSSKDNANDWRISFDDFQIQGFNVSGKDFSYASDCASFFTPGIWMGLLTSLLMVLVLTYGLHMIMQLHTMDRFDDPKGPAISV 462          
BLAST of ATPase H transporting accessory protein 1a vs. Ensembl Cavefish
Match: atp6ap1lb (V-type proton ATPase subunit S1-like [Source:NCBI gene;Acc:103031199])

HSP 1 Score: 67.0106 bits (162), Expect = 1.545e-13
Identity = 33/108 (30.56%), Postives = 56/108 (51.85%), Query Frame = 3
Query:   27 LTASWLTAPLDYSYHCSSPLNISSKDT--------------QLSFDKLQVQAFNVKDNKFGWANDCIGFFSIGVWSVLMSTIVLLAILSIGLQMTLQIASPDKSDDPK 308
              A+ + AP  YSYHC    ++   DT               ++F   Q+QAFNV+ NKF  A+DC  FF+  +   L+++++LL +L+  L M + +   D+ ++ K
Sbjct:  228 FNATEVYAPATYSYHCQHVSSLQKYDTLLVPSSHTDSSANWHITFTDFQIQAFNVQSNKFASASDCATFFTPAILMGLITSLILLLVLAYALHMVVHLKHIDRYEEHK 335          
BLAST of ATPase H transporting accessory protein 1a vs. Ensembl Cavefish
Match: atp6ap1b (ATPase H+ transporting accessory protein 1b [Source:ZFIN;Acc:ZDB-GENE-020423-2])

HSP 1 Score: 62.7734 bits (151), Expect = 5.178e-12
Identity = 38/104 (36.54%), Postives = 62/104 (59.62%), Query Frame = 3
Query:   51 PLDYSYHC------SSPLNI------SSKDTQLSFDKLQVQAFNVKDNKFGWANDCIGFFSIGVWSVLMSTIVLLAILSIGLQMTLQIASPDKSDDPKGKHVQL 326
            P +YS+HC       SPL +      ++    + F   Q+Q+FNV  N F +A+DC  FF+ G+W  L++T+++L IL+ GL M +Q+ + D+ DDPKG  + +
Sbjct:  339 PAEYSFHCQRVSSVESPLLVPNSTLDNATKWTIMFTNFQIQSFNVTQN-FAYASDCASFFTPGIWMGLLTTLLMLLILTYGLHMIMQVRTMDRFDDPKGPAISV 441          
BLAST of ATPase H transporting accessory protein 1a vs. Ensembl Cavefish
Match: atp6ap1la (ATPase H+ transporting accessory protein 1 like [Source:NCBI gene;Acc:103037615])

HSP 1 Score: 59.3066 bits (142), Expect = 8.139e-11
Identity = 30/101 (29.70%), Postives = 52/101 (51.49%), Query Frame = 3
Query:   48 APLDYSYHCSSPLNISSKDT--------------QLSFDKLQVQAFNVKDNKFGWANDCIGFFSIGVWSVLMSTIVLLAILSIGLQMTLQIASPDKSDDPK 308
            AP   SYHC    ++   DT               ++F   Q+QAFNV+ +KF  A+DC  FF+  +   L+++++LL +L+  L M + +   D+ ++ K
Sbjct:  215 APSTNSYHCQHVSSLQKYDTLLVPSAITDNSANWHITFTDFQIQAFNVQSSKFASASDCATFFTPAILMGLITSLILLLVLAYALHMVVHLKHIDRYEEHK 315          
BLAST of ATPase H transporting accessory protein 1a vs. Ensembl Sea Lamprey
Match: atp6ap1b (ATPase H+ transporting accessory protein 1b [Source:ZFIN;Acc:ZDB-GENE-020423-2])

HSP 1 Score: 79.337 bits (194), Expect = 1.238e-18
Identity = 40/109 (36.70%), Postives = 59/109 (54.13%), Query Frame = 3
Query:   36 SWLTAPLDYSYHCSS------------PLNISSKDTQLSFDKLQVQAFNVKDNKFGWANDCIGFFSIGVWSVLMSTIVLLAILSIGLQMTLQIASPDKSDDPKGKHVQL 326
            S + AP  YSY C              P++  S    +S    Q+QAFNV+D KF +A+DC  FF+  VW  L+   +LL +L+ G+ M LQ+ + D+ DDPKG  + +
Sbjct:  291 SSVYAPAIYSYRCQVVSTSPDSGARLVPVSPISAHVHVSLKDFQIQAFNVRDGKFAYASDCASFFTPAVWMGLVVGFILLLVLTYGVHMVLQLKTMDRFDDPKGPTISV 399          
BLAST of ATPase H transporting accessory protein 1a vs. Ensembl Nematostella
Match: EDO39520 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S9P7])

HSP 1 Score: 61.6178 bits (148), Expect = 4.089e-12
Identity = 28/71 (39.44%), Postives = 45/71 (63.38%), Query Frame = 3
Query:  117 FDKLQVQAFNVKDNKFGWANDCIGFFSIGVWSVLMSTIVLLAILSIGLQMTLQIASPDKSDDPKGKHVQLG 329
            +D L VQA+ +++ +F +A DC+GFFSI +   L++  VLL IL  G+     I + D+ DDP+G  + +G
Sbjct:  406 YDHL-VQAYGIENGRFSYAYDCVGFFSIPILMGLLTVGVLLMILFFGVMAVFSITTMDRFDDPRGPGINIG 475          
BLAST of ATPase H transporting accessory protein 1a vs. Ensembl Medaka
Match: atp6ap1a (ATPase H+ transporting accessory protein 1 [Source:NCBI gene;Acc:101168188])

HSP 1 Score: 85.1149 bits (209), Expect = 8.621e-20
Identity = 40/105 (38.10%), Postives = 68/105 (64.76%), Query Frame = 3
Query:   48 APLDYSYHCSS------PLNI--SSKDT----QLSFDKLQVQAFNVKDNKFGWANDCIGFFSIGVWSVLMSTIVLLAILSIGLQMTLQIASPDKSDDPKGKHVQL 326
            AP +YS+ C S      PL +  S+KD     ++SF+  Q+Q FN+  ++F +A+DC GFFS G+W  LM++++++ +L+ GL M +Q+ + D+ DDPKG  + +
Sbjct:  374 APAEYSFRCQSVTSDRWPLLVPRSAKDPANQWKVSFEDFQIQGFNLSGSEFSYASDCAGFFSAGIWMGLMTSLLMVLVLTYGLHMIMQLNTMDRFDDPKGPAISV 478          
BLAST of ATPase H transporting accessory protein 1a vs. Ensembl Medaka
Match: atp6ap1lb (V-type proton ATPase subunit S1 [Source:NCBI gene;Acc:101159585])

HSP 1 Score: 57.7658 bits (138), Expect = 2.326e-10
Identity = 30/107 (28.04%), Postives = 53/107 (49.53%), Query Frame = 3
Query:   33 ASWLTAPLDYSYHCSSPLNISSKDT--------------QLSFDKLQVQAFNVKDNKFGWANDCIGFFSIGVWSVLMSTIVLLAILSIGLQMTLQIASPDKSDDPKG 311
            AS + AP   SYHC    ++   DT               ++F   Q+QAFNV+ +KF   +DC  F +  +   L+++++LL +L+  L M + +   D+ ++ K 
Sbjct:  217 ASKVYAPATSSYHCQHVSSLHKYDTLLVPSSHTDTSANWHITFTDFQIQAFNVQSDKFASPSDCATFLTPAILMGLVTSLILLLVLAYALHMVVHLKHIDRYEEHKA 323          
BLAST of ATPase H transporting accessory protein 1a vs. Ensembl Medaka
Match: atp6ap1b (V-type proton ATPase subunit S1 [Source:NCBI gene;Acc:101165235])

HSP 1 Score: 53.5286 bits (127), Expect = 8.762e-9
Identity = 33/106 (31.13%), Postives = 58/106 (54.72%), Query Frame = 3
Query:   48 APLDYSYHCSSPLNI-------SSKDTQLS-----FDKLQVQAFNVKD-NKFGWANDCIGFFSIGVWSVLMSTIVLLAILSIGLQMTLQIASPDKSDDPKGKHVQL 326
            AP +YS+ C S  N        ++ ++ LS     F   Q+Q F + +   F +A+DC  FF+  +W  L++++++L I   GL M +Q+ + D+ DDPKG  + +
Sbjct:  337 APAEYSFRCQSVNNFQDALLVRNNTNSSLSVWSLNFIDFQIQGFGLNNGTNFSYASDCASFFTPAIWMGLLTSLLMLLIFLYGLHMIMQLNTMDRFDDPKGPFISV 442          
BLAST of ATPase H transporting accessory protein 1a vs. Planmine SMEST
Match: SMESG000077471.1 (SMESG000077471.1)

HSP 1 Score: 219.55 bits (558), Expect = 1.588e-73
Identity = 106/106 (100.00%), Postives = 106/106 (100.00%), Query Frame = 3
Query:   24 NLTASWLTAPLDYSYHCSSPLNISSKDTQLSFDKLQVQAFNVKDNKFGWANDCIGFFSIGVWSVLMSTIVLLAILSIGLQMTLQIASPDKSDDPKGKHVQLGPLAE 341
            NLTASWLTAPLDYSYHCSSPLNISSKDTQLSFDKLQVQAFNVKDNKFGWANDCIGFFSIGVWSVLMSTIVLLAILSIGLQMTLQIASPDKSDDPKGKHVQLGPLAE
Sbjct:  126 NLTASWLTAPLDYSYHCSSPLNISSKDTQLSFDKLQVQAFNVKDNKFGWANDCIGFFSIGVWSVLMSTIVLLAILSIGLQMTLQIASPDKSDDPKGKHVQLGPLAE 231          
BLAST of ATPase H transporting accessory protein 1a vs. Planmine SMEST
Match: SMESG000036138.1 (SMESG000036138.1)

HSP 1 Score: 85.5001 bits (210), Expect = 4.765e-21
Identity = 44/100 (44.00%), Postives = 61/100 (61.00%), Query Frame = 3
Query:   42 LTAPLDYSYHCSS----PLNISSKDTQLSFDKLQVQAFNVKDNKFGWANDCIGFFSIGVWSVLMSTIVLLAILSIGLQMTLQIASPDKSDDPKGKHVQLG 329
            +TAPL+ SYHC      P N S    Q++FDK QVQ F     KF +ANDC G+FS    +VL  +++L+ ILS G+ M + I + DK D+PKGK + + 
Sbjct:  130 VTAPLNTSYHCMKQTFKPKNNSF--VQVTFDKFQVQPFIGNATKFSFANDCSGYFSEASLTVLFVSLILIGILSFGIHMIISIQTSDKFDNPKGKQINIA 227          
The following BLAST results are available for this feature:
BLAST of ATPase H transporting accessory protein 1a vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 2
Match NameE-valueIdentityDescription
ATP6AP14.804e-1735.14ATPase H+ transporting accessory protein 1 [Source... [more]
ATP6AP12.123e-1635.78ATPase H+ transporting accessory protein 1 [Source... [more]
back to top
BLAST of ATPase H transporting accessory protein 1a vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 1
Match NameE-valueIdentityDescription
vha-197.144e-631.46Vacuolar H ATPase [Source:UniProtKB/TrEMBL;Acc:Q9... [more]
back to top
BLAST of ATPase H transporting accessory protein 1a vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 2
Match NameE-valueIdentityDescription
VhaAC459.667e-1133.33gene:FBgn0262515 transcript:FBtr0088588[more]
VhaAC459.667e-1133.33gene:FBgn0262515 transcript:FBtr0088587[more]
back to top
BLAST of ATPase H transporting accessory protein 1a vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
atp6ap1b5.500e-1835.83ATPase H+ transporting accessory protein 1b [Sourc... [more]
atp6ap1a1.049e-1734.29ATPase H+ transporting accessory protein 1a [Sourc... [more]
atp6ap1lb9.676e-1431.13ATPase H+ transporting accessory protein 1 like b ... [more]
atp6ap1la1.318e-1029.70ATPase H+ transporting accessory protein 1 like a ... [more]
atp6ap1lb1.937e-733.78ATPase H+ transporting accessory protein 1 like b ... [more]
back to top
BLAST of ATPase H transporting accessory protein 1a vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ENSXETT00000053628.18.291e-1837.74V-type proton ATPase subunit S1-like [Source:NCBI ... [more]
ENSXETT00000053622.18.809e-1837.74V-type proton ATPase subunit S1-like [Source:NCBI ... [more]
ENSXETT00000053627.19.044e-1837.74V-type proton ATPase subunit S1-like [Source:NCBI ... [more]
ENSXETT00000053626.19.348e-1837.74V-type proton ATPase subunit S1-like [Source:NCBI ... [more]
atp6ap1.28.132e-1735.40ATPase, H+ transporting, lysosomal accessory prote... [more]
back to top
BLAST of ATPase H transporting accessory protein 1a vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 1
Match NameE-valueIdentityDescription
Atp6ap12.123e-1836.04ATPase, H+ transporting, lysosomal accessory prote... [more]
back to top
BLAST of ATPase H transporting accessory protein 1a vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|P40682|VAS1_BOVIN1.550e-1838.39V-type proton ATPase subunit S1 OS=Bos taurus OX=9... [more]
sp|O54715|VAS1_RAT1.270e-1736.04V-type proton ATPase subunit S1 OS=Rattus norvegic... [more]
sp|Q9R1Q9|VAS1_MOUSE1.485e-1736.04V-type proton ATPase subunit S1 OS=Mus musculus OX... [more]
sp|Q15904|VAS1_HUMAN1.020e-1535.78V-type proton ATPase subunit S1 OS=Homo sapiens OX... [more]
sp|Q7JR49|VAS1_DROME9.690e-1033.33V-type proton ATPase subunit S1 OS=Drosophila mela... [more]
back to top
BLAST of ATPase H transporting accessory protein 1a vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A183N2K16.627e-1940.74Uncharacterized protein OS=Schistosoma margrebowie... [more]
A0A3P8UGA91.106e-1841.90ATPase H+ transporting accessory protein 1a OS=Cyn... [more]
A0A3P8UJS31.210e-1841.90ATPase H+ transporting accessory protein 1a OS=Cyn... [more]
A0A093CZQ71.876e-1837.27V-type proton ATPase subunit S1 (Fragment) OS=Taur... [more]
A0A093PZ052.152e-1838.46V-type proton ATPase subunit S1 (Fragment) OS=Phal... [more]
back to top
BLAST of ATPase H transporting accessory protein 1a vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 4
Match NameE-valueIdentityDescription
atp6ap1a3.754e-1937.14ATPase H+ transporting accessory protein 1a [Sourc... [more]
atp6ap1lb1.545e-1330.56V-type proton ATPase subunit S1-like [Source:NCBI ... [more]
atp6ap1b5.178e-1236.54ATPase H+ transporting accessory protein 1b [Sourc... [more]
atp6ap1la8.139e-1129.70ATPase H+ transporting accessory protein 1 like [S... [more]
back to top
BLAST of ATPase H transporting accessory protein 1a vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 1
Match NameE-valueIdentityDescription
atp6ap1b1.238e-1836.70ATPase H+ transporting accessory protein 1b [Sourc... [more]
back to top
BLAST of ATPase H transporting accessory protein 1a vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of ATPase H transporting accessory protein 1a vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 1
Match NameE-valueIdentityDescription
EDO395204.089e-1239.44Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of ATPase H transporting accessory protein 1a vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 3
Match NameE-valueIdentityDescription
atp6ap1a8.621e-2038.10ATPase H+ transporting accessory protein 1 [Source... [more]
atp6ap1lb2.326e-1028.04V-type proton ATPase subunit S1 [Source:NCBI gene;... [more]
atp6ap1b8.762e-931.13V-type proton ATPase subunit S1 [Source:NCBI gene;... [more]
back to top
BLAST of ATPase H transporting accessory protein 1a vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 2
Match NameE-valueIdentityDescription
SMESG000077471.11.588e-73100.00SMESG000077471.1[more]
SMESG000036138.14.765e-2144.00SMESG000036138.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30015615 ID=SMED30015615|Name=ATPase H  transporting accessory protein 1a|organism=Schmidtea mediterranea sexual|type=transcript|length=439bp
CGGAGACTGGTTAGTAAATGATGAATCTTACTGCTTCCTGGTTAACTGCT
CCACTTGATTATTCTTATCATTGTTCTTCGCCGTTAAATATATCTTCTAA
AGATACACAGTTATCTTTTGATAAATTGCAGGTGCAAGCTTTTAATGTCA
AAGACAACAAATTTGGTTGGGCAAATGATTGCATTGGATTTTTTTCAATT
GGTGTTTGGAGTGTTTTGATGTCCACAATAGTTCTGTTAGCCATTTTGTC
GATTGGACTTCAAATGACTTTGCAAATTGCAAGTCCTGATAAATCAGATG
ATCCGAAAGGGAAACACGTGCAATTAGGTCCTTTGGCTGAATAAAAAAAT
TACAGATTCCTTAATAAAGCATAATATTCGATTGCCATTTTTAAAATTGA
TTTTTGTGAAATAAATATTTTTGATTTTTTAAAAAAAAA
back to top

protein sequence of SMED30015615-orf-1

>SMED30015615-orf-1 ID=SMED30015615-orf-1|Name=SMED30015615-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=109bp
MMNLTASWLTAPLDYSYHCSSPLNISSKDTQLSFDKLQVQAFNVKDNKFG
WANDCIGFFSIGVWSVLMSTIVLLAILSIGLQMTLQIASPDKSDDPKGKH
VQLGPLAE*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: biological process
TermDefinition
GO:1902600hydrogen ion transmembrane transport
GO:0015991ATP hydrolysis coupled proton transport
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000026gut
PLANA:0000070intestinal phagocyte
PLANA:0003116parenchymal cell
Vocabulary: INTERPRO
TermDefinition
IPR008388ATPase_V1-cplx_s1su
IPR002000Lysosome-assoc_membr_glycop
IPR024722ATPase_V1_suS1_fam
Vocabulary: cellular component
TermDefinition
GO:0016020membrane
GO:0016021integral component of membrane
GO:0033180proton-transporting V-type ATPase, V1 domain
Vocabulary: molecular function
TermDefinition
GO:0046933proton-transporting ATP synthase activity, rotational mechanism
GO:0046961proton-transporting ATPase activity, rotational mechanism
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR008388ATPase, V1 complex, subunit S1PFAMPF05827ATP-synt_S1coord: 9..102
e-value: 9.9E-31
score: 106.5
IPR008388ATPase, V1 complex, subunit S1PANTHERPTHR12471VACUOLAR ATP SYNTHASE SUBUNIT S1coord: 5..102
NoneNo IPR availableGENE3DG3DSA:2.40.160.110coord: 1..57
e-value: 1.1E-10
score: 43.8
NoneNo IPR availableTMHMMTMhelixcoord: 55..77