acidic repeat-containing protein

Overview
Nameacidic repeat-containing protein
Smed IDSMED30015608
Length (bp)819
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of acidic repeat-containing protein (SMED30015608) t-SNE clustered cells

Violin plots show distribution of expression levels for acidic repeat-containing protein (SMED30015608) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of acidic repeat-containing protein (SMED30015608) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for acidic repeat-containing protein (SMED30015608) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30015608

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 6

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
X1 cellSMED30015608SMESG000016996.1 SmedASXL_009175SmedAsxl_ww_GCZZ01PMID:26114597
Zhu et al., 2015
FACS sorted cell population asexual adult RNA-sequencing evidence
posterior muscle cellSMED30015608SMESG000016996.1 dd_Smed_v4_14607_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
posterior sideSMED30015608SMESG000016996.1 dd_Smed_v4_14607_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
reproductive organSMED30015608SMESG000016996.1 SMESG000016995.1 SMESG000016994.1 Contig47817newmark_estsPMID:28434803
Rouhana et al., 2017
whole organism adult hermaphrodite RNA-sequencing evidence
reproductive organSMED30015608SMESG000016996.1 SMESG000016995.1 SMESG000016994.1 Contig47817uc_Smed_v2PMID:28434803
Rouhana et al., 2017
whole organism adult hermaphrodite RNA-sequencing evidence
zeta neoblastSMED30015608SMESG000016996.1 dd_Smed_v4_14607_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of acidic repeat-containing protein vs. Ensembl Human
Match: GCNA (germ cell nuclear acidic peptidase [Source:HGNC Symbol;Acc:HGNC:15805])

HSP 1 Score: 78.5666 bits (192), Expect = 9.154e-16
Identity = 37/109 (33.94%), Postives = 58/109 (53.21%), Query Frame = 1
Query:  166 RHVFIDLSPKICNDSHRLLTVMIHEMCHAAAFMISKINDCHGSIWRSWCLAAKMAFPLVPLTERCHSYRAKFKYQYRCETCPFVKAKHSKYKDNK--ICPKCKSKLILF 486
            R   I +  K+C+ + R+   +IHEMCHAA+++I  I+D HG  W+ +   +    P +P   RCH+Y+  +K  Y C  C      ++K  D    IC KCK  L++ 
Sbjct:  569 RFAKIQIGLKVCDSADRIRDTLIHEMCHAASWLIDGIHDSHGDAWKYYARKSNRIHPELPRVTRCHNYKINYKVHYECTGCKTRIGCYTKSLDTSRFICAKCKGSLVMV 677          
BLAST of acidic repeat-containing protein vs. Ensembl Human
Match: GCNA (germ cell nuclear acidic peptidase [Source:HGNC Symbol;Acc:HGNC:15805])

HSP 1 Score: 78.5666 bits (192), Expect = 9.154e-16
Identity = 37/109 (33.94%), Postives = 58/109 (53.21%), Query Frame = 1
Query:  166 RHVFIDLSPKICNDSHRLLTVMIHEMCHAAAFMISKINDCHGSIWRSWCLAAKMAFPLVPLTERCHSYRAKFKYQYRCETCPFVKAKHSKYKDNK--ICPKCKSKLILF 486
            R   I +  K+C+ + R+   +IHEMCHAA+++I  I+D HG  W+ +   +    P +P   RCH+Y+  +K  Y C  C      ++K  D    IC KCK  L++ 
Sbjct:  569 RFAKIQIGLKVCDSADRIRDTLIHEMCHAASWLIDGIHDSHGDAWKYYARKSNRIHPELPRVTRCHNYKINYKVHYECTGCKTRIGCYTKSLDTSRFICAKCKGSLVMV 677          
BLAST of acidic repeat-containing protein vs. Ensembl Celegans
Match: gcna-1 (Germ Cell Nuclear Antigen [Source:UniProtKB/TrEMBL;Acc:Q23462])

HSP 1 Score: 72.7886 bits (177), Expect = 2.407e-14
Identity = 36/108 (33.33%), Postives = 59/108 (54.63%), Query Frame = 1
Query:  178 IDLSPKICNDSHRLLTVMIHEMCHAAAFMISKIN-DCHGSIWRSWCLAAKMAFPLVPLTERCHSYRAKFKYQYRCE--TCPFVKAKHSKYKDN--KICPKCKSKLILF 486
            +++SP +C  + R+   +IHE+CHAA +++ +++ + HG  W+ W       F  +P  ERCHSY  + K+ Y CE   C     + SK  D   K C +C  + IL+
Sbjct:  344 VEMSPVVCTTAERVRDTLIHELCHAATWVVDRLHKEGHGPGWKRWGARCSSVFKSLPFIERCHSYEIEAKFFYVCEKDGCDVEIKRQSKSLDTSRKACGRCFGRFILY 451          
BLAST of acidic repeat-containing protein vs. Ensembl Fly
Match: CG14814 (gene:FBgn0023515 transcript:FBtr0339494)

HSP 1 Score: 98.2117 bits (243), Expect = 9.173e-23
Identity = 56/168 (33.33%), Postives = 87/168 (51.79%), Query Frame = 1
Query:  166 RHVFIDLSPKICNDSHRLLTVMIHEMCHAAAFMISKINDCHGSIWRSWCLAAKMAFPLVPLTERCHSYRAKFKYQYRCETCPFVKAKHSKYKDNKI----CPKCKSKLILFSDR----GYGVHFEVDTNKPLVGFAAFVKENYKSVRSKDVNHKQAMSILSERFYLQK 645
            R   ++LS K+   + RL   +IHE+CHAAA++ +     HG +W+ W   A   FP +P  + CH+Y  +FKY Y+C +C   KA H+  +  K+    C  C+  + LF ++    G  V       K   GFA FVK+N++  +  ++   Q M ILS  +  QK
Sbjct:  844 RSSVVELSVKVLTTADRLRCTLIHELCHAAAWVFNG-EGGHGRVWKMWAQRANDKFPDLPQIKVCHNYSIEFKYTYKCLSCD--KASHAHSRSRKVEDLRCRICRGPITLFLNKKDKQGNTVSTPAGEAK---GFAKFVKDNFQRHKRDNMTAAQVMRILSVEYAKQK 1005          
BLAST of acidic repeat-containing protein vs. Ensembl Fly
Match: CG14814 (gene:FBgn0023515 transcript:FBtr0070370)

HSP 1 Score: 98.2117 bits (243), Expect = 9.173e-23
Identity = 56/168 (33.33%), Postives = 87/168 (51.79%), Query Frame = 1
Query:  166 RHVFIDLSPKICNDSHRLLTVMIHEMCHAAAFMISKINDCHGSIWRSWCLAAKMAFPLVPLTERCHSYRAKFKYQYRCETCPFVKAKHSKYKDNKI----CPKCKSKLILFSDR----GYGVHFEVDTNKPLVGFAAFVKENYKSVRSKDVNHKQAMSILSERFYLQK 645
            R   ++LS K+   + RL   +IHE+CHAAA++ +     HG +W+ W   A   FP +P  + CH+Y  +FKY Y+C +C   KA H+  +  K+    C  C+  + LF ++    G  V       K   GFA FVK+N++  +  ++   Q M ILS  +  QK
Sbjct:  844 RSSVVELSVKVLTTADRLRCTLIHELCHAAAWVFNG-EGGHGRVWKMWAQRANDKFPDLPQIKVCHNYSIEFKYTYKCLSCD--KASHAHSRSRKVEDLRCRICRGPITLFLNKKDKQGNTVSTPAGEAK---GFAKFVKDNFQRHKRDNMTAAQVMRILSVEYAKQK 1005          
BLAST of acidic repeat-containing protein vs. Ensembl Fly
Match: CG14814 (gene:FBgn0023515 transcript:FBtr0070369)

HSP 1 Score: 97.8265 bits (242), Expect = 1.190e-22
Identity = 56/168 (33.33%), Postives = 87/168 (51.79%), Query Frame = 1
Query:  166 RHVFIDLSPKICNDSHRLLTVMIHEMCHAAAFMISKINDCHGSIWRSWCLAAKMAFPLVPLTERCHSYRAKFKYQYRCETCPFVKAKHSKYKDNKI----CPKCKSKLILFSDR----GYGVHFEVDTNKPLVGFAAFVKENYKSVRSKDVNHKQAMSILSERFYLQK 645
            R   ++LS K+   + RL   +IHE+CHAAA++ +     HG +W+ W   A   FP +P  + CH+Y  +FKY Y+C +C   KA H+  +  K+    C  C+  + LF ++    G  V       K   GFA FVK+N++  +  ++   Q M ILS  +  QK
Sbjct:  866 RSSVVELSVKVLTTADRLRCTLIHELCHAAAWVFNG-EGGHGRVWKMWAQRANDKFPDLPQIKVCHNYSIEFKYTYKCLSCD--KASHAHSRSRKVEDLRCRICRGPITLFLNKKDKQGNTVSTPAGEAK---GFAKFVKDNFQRHKRDNMTAAQVMRILSVEYAKQK 1027          
BLAST of acidic repeat-containing protein vs. Ensembl Fly
Match: CG2694 (gene:FBgn0024991 transcript:FBtr0070482)

HSP 1 Score: 56.9954 bits (136), Expect = 6.401e-9
Identity = 39/142 (27.46%), Postives = 67/142 (47.18%), Query Frame = 1
Query:  214 RLLTVMIHEMCHAAAFMISKINDCHGSIWRSWCLAAKMAFPLVPLTERCHSYRAKFKYQYRCETCPFVKAKHSKYKDNKI-CPKCKSKLILFSDRGYGVHFEVDTNKPLVGFAAFVKENYKSVRSK-DVNHKQAMSILSERF 633
             L+ +++HEMCH AAF+ ++    HG   R W   AKMAFP VP    C +      + Y C  C       +  K   I C  C+ ++ +       +H    +++ +  F  F+++ Y  + ++  V H   M++L+E F
Sbjct:  530 ELIYLLLHEMCHVAAFLFNR-ELGHGDNCRRWTYQAKMAFPEVPALMECIA-----SFMYTCSMCSRSSYGLADLKSYNIRCYYCQFEVSVKPVSKANMHEGARSDRTMTPFKCFIRDKYLKLGAEGGVTHSSKMALLNEMF 665          
BLAST of acidic repeat-containing protein vs. Ensembl Fly
Match: CG2694 (gene:FBgn0024991 transcript:FBtr0310649)

HSP 1 Score: 56.6102 bits (135), Expect = 9.578e-9
Identity = 39/142 (27.46%), Postives = 67/142 (47.18%), Query Frame = 1
Query:  214 RLLTVMIHEMCHAAAFMISKINDCHGSIWRSWCLAAKMAFPLVPLTERCHSYRAKFKYQYRCETCPFVKAKHSKYKDNKI-CPKCKSKLILFSDRGYGVHFEVDTNKPLVGFAAFVKENYKSVRSK-DVNHKQAMSILSERF 633
             L+ +++HEMCH AAF+ ++    HG   R W   AKMAFP VP    C +      + Y C  C       +  K   I C  C+ ++ +       +H    +++ +  F  F+++ Y  + ++  V H   M++L+E F
Sbjct:  679 ELIYLLLHEMCHVAAFLFNR-ELGHGDNCRRWTYQAKMAFPEVPALMECIA-----SFMYTCSMCSRSSYGLADLKSYNIRCYYCQFEVSVKPVSKANMHEGARSDRTMTPFKCFIRDKYLKLGAEGGVTHSSKMALLNEMF 814          
BLAST of acidic repeat-containing protein vs. Ensembl Zebrafish
Match: gcna (germ cell nuclear acidic peptidase [Source:ZFIN;Acc:ZDB-GENE-050320-153])

HSP 1 Score: 111.309 bits (277), Expect = 3.194e-27
Identity = 60/162 (37.04%), Postives = 87/162 (53.70%), Query Frame = 1
Query:  166 RHVFIDLSPKICNDSHRLLTVMIHEMCHAAAFMISKINDCHGSIWRSWCLAAKMAFPLVPLTERCHSYRAKFKYQYRCETCPFVKAKHSKYKDNK--ICPKCKSKLILFSDRGYGVHFEVDTNKP--LVGFAAFVKENYKSVRSK--DVNHKQAMSILSERF 633
            R+  I+LS K+C+ + RL   +IHEMCHAA ++I+ + D HG  WR +   A +A P +P+  RCHSY   +K+QY+C  C     +HSK  D    +C  C  +L+L +            +KP     FA FVKENY S + +    +H + M  LS  F
Sbjct:  427 RYARIELSVKVCDSADRLRDTLIHEMCHAATWLINNVRDGHGPFWRLYARKAMLAHPELPMVSRCHSYDINYKFQYQCNRCKNTIGRHSKSLDTTKFVCALCTGQLVLLT-----------PSKPRAPTPFATFVKENYGSTKQELTGQSHAEIMRKLSADF 577          
BLAST of acidic repeat-containing protein vs. Ensembl Xenopus
Match: ENSXETT00000038004.1 (germ cell nuclear acidic peptidase [Source:NCBI gene;Acc:100379792])

HSP 1 Score: 111.309 bits (277), Expect = 4.178e-27
Identity = 60/161 (37.27%), Postives = 86/161 (53.42%), Query Frame = 1
Query:  166 RHVFIDLSPKICNDSHRLLTVMIHEMCHAAAFMISKINDCHGSIWRSWCLAAKMAFPLVPLTERCHSYRAKFKYQYRCETCPFVKAKHSKYKDNK--ICPKCKSKLILFSD-RGYGVHFEVDTNKPLVGFAAFVKENYKSVRS--KDVNHKQAMSILSERF 633
            R+  I+LS K+C+ + RL   +IHE+CHAA ++I+ + D HG  WR +   A +  P +P+  RCH+Y   +KY Y C  C     +HSK  D +  +C  CK KL+L S  R  G          L  FA +VKENY S +     ++H + M  LS  F
Sbjct:  436 RYARIELSEKVCDSADRLRDTLIHEICHAATWLINGVRDGHGQFWRFYAKKATVVHPELPMVTRCHTYEINYKYTYECSRCKNTIGRHSKSLDTEKFVCALCKGKLVLLSSTRKDGSP----AGGQLTPFAKYVKENYGSTKKVMTGMSHAEVMRKLSADF 592          
BLAST of acidic repeat-containing protein vs. UniProt/SwissProt
Match: sp|Q96QF7|ACRC_HUMAN (Acidic repeat-containing protein OS=Homo sapiens OX=9606 GN=GCNA PE=1 SV=1)

HSP 1 Score: 78.5666 bits (192), Expect = 4.396e-15
Identity = 37/109 (33.94%), Postives = 58/109 (53.21%), Query Frame = 1
Query:  166 RHVFIDLSPKICNDSHRLLTVMIHEMCHAAAFMISKINDCHGSIWRSWCLAAKMAFPLVPLTERCHSYRAKFKYQYRCETCPFVKAKHSKYKDNK--ICPKCKSKLILF 486
            R   I +  K+C+ + R+   +IHEMCHAA+++I  I+D HG  W+ +   +    P +P   RCH+Y+  +K  Y C  C      ++K  D    IC KCK  L++ 
Sbjct:  569 RFAKIQIGLKVCDSADRIRDTLIHEMCHAASWLIDGIHDSHGDAWKYYARKSNRIHPELPRVTRCHNYKINYKVHYECTGCKTRIGCYTKSLDTSRFICAKCKGSLVMV 677          
BLAST of acidic repeat-containing protein vs. UniProt/SwissProt
Match: sp|O42953|YGM4_SCHPO (HMG box-containing protein C19G7.04 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=SPBC19G7.04 PE=4 SV=2)

HSP 1 Score: 62.3882 bits (150), Expect = 7.034e-10
Identity = 46/166 (27.71%), Postives = 83/166 (50.00%), Query Frame = 1
Query:  169 HVFIDLSPKICNDSHRLLTVMIHEMCHAAAFMI-SKINDCHGSIWRSWCLAAKMAFPLVPLTERCHSYRAKFKYQYRC--ETCPFVKAKHSKYKD--NKICPKCKSKLILFSDRGYGVHFEVDTNKPLVGFAAFVKENYKSVRS--KDVNHKQAMSILSERFYLQK 645
            + +I+LS K+     RL   + HE+CH A ++I +++ + HG+ +++W        P + +T + H+Y   FKY++ C  E C  +  +HSK  +   ++C  CKS++     +           K    F  F+KEN K +R     + HK+ M  LS+ ++  K
Sbjct:  190 YAYIELSDKVIVTKERLYNTLAHEVCHLACWIIDNEMQNPHGACFKAWGKRIMNNMPYIEITSK-HNYDIDFKYKWLCINEKCNKLYGRHSKSINPQKQVCRLCKSQIKQICPKI----------KQPNAFQIFLKENSKRLRKLHPHITHKELMKKLSDEYHRTK 344          
BLAST of acidic repeat-containing protein vs. TrEMBL
Match: F7AS59 (SprT-like domain-containing protein OS=Ciona intestinalis OX=7719 PE=4 SV=2)

HSP 1 Score: 129.028 bits (323), Expect = 6.119e-33
Identity = 69/172 (40.12%), Postives = 99/172 (57.56%), Query Frame = 1
Query:  142 LTQTEETPRHVFIDLSPKICNDSHRLLTVMIHEMCHAAAFMISKINDCHGSIWRSWCLAAKMAFPLVPLTERCHSYRAKFKYQYRCETCPFVKAKHSKYKDN--KICPKCKSKLILFSDRGYGVHFEVDTNKPLVGFAAFVKENYKS----VRSKDV--NHKQAMSILSERF 633
            +  T  T  H  I LS K+ + S+RL   +IHEMCHAA ++I+  N+ HG  W+SW  AA+   P +P  +RCH+Y  ++KY Y C  C     +HSK  D   K+C +C+  L+L    G  +      ++PL  FA FVKENYKS    ++S DV  +HK  M+ LS++F
Sbjct:   25 VNGTASTTHHAAISLSEKVIDSSYRLRDTLIHEMCHAAVWLINNANESHGPYWKSWAAAARRIHPELPSIDRCHNYDIEYKYIYECSRCKTTIGRHSKSLDTTKKVCGRCRGPLVLTQPNGTPLK-----SQPLNPFAKFVKENYKSTKVRLQSIDVASSHKDVMTSLSQQF 191          
BLAST of acidic repeat-containing protein vs. TrEMBL
Match: A0A553NPW6 (SprT-like domain-containing protein OS=Tigriopus californicus OX=6832 GN=TCAL_03735 PE=4 SV=1)

HSP 1 Score: 134.035 bits (336), Expect = 1.228e-31
Identity = 71/170 (41.76%), Postives = 96/170 (56.47%), Query Frame = 1
Query:  166 RHVFIDLSPKICNDSHRLLTVMIHEMCHAAAFMISKINDCHGSIWRSWCLAAKMAFPLVPLTERCHSYRAKFKYQYRCETCPFVKAKHSKY--KDNKICPKCKSKLILFSDRGYGVHFE-----VDTNKPLVG--FAAFVKENYKSVRSKDVNHKQAMSILSERFYLQKL 648
            R   I+LS K+ + S RL   +IHEMCHAAA++IS   D HG IWR W   +   FP +P+  RCH+Y  + K+ YRC  C +   +HSK    D K+C  C+ +  L  +R  G + E     V+   P     FA FVKENYK VR   V+H+ AM +LS +F L K+
Sbjct:  636 RFSSIELSSKVLDSSDRLRDTLIHEMCHAAAWIISGYRDGHGPIWRDWANRSMREFPELPIINRCHNYAIRTKFTYRCVKCGYQLGRHSKSLDTDRKVCGLCRGRFELLVNRKAGANTETPGRRVEPTTPRTPNKFALFVKENYKHVRLPGVDHRDAMMMLSSQFALSKI 805          
BLAST of acidic repeat-containing protein vs. TrEMBL
Match: A0A5K3FNH5 (Uncharacterized protein OS=Mesocestoides corti OX=53468 PE=4 SV=1)

HSP 1 Score: 122.094 bits (305), Expect = 2.333e-30
Identity = 68/184 (36.96%), Postives = 99/184 (53.80%), Query Frame = 1
Query:  151 TEETPRHVFIDLSPKICNDSHRLLTVMIHEMCHAAAFMISKINDCHGSIWRSWCLAAKMAFPLVPLTERCHSYRAKFKYQYRCETCPFVKAKHSKY--KDNKICPKCKSK--LILFSDRGYGV-----------HFEVDTNKPLVGFAAFVKENYKSVRSKDVNHKQAMSILSERFYLQKLEIQ 657
            +  T RHV I+LS K+C  + R+   ++HE CHAA +++  +ND HG +WR +   A  AFPL+P     H+Y    ++ YRC  C     +HSK    + K+C +C S+  LI+ + RG GV           H E  T +P   FA FVKE+YK VR +  NHK+ M+ L   F   K+ + 
Sbjct:   11 SSTTTRHVRIELSGKVCTSAERVRDTLLHEACHAAVWVVHGVNDGHGRLWREFVRKANAAFPLLPPVTVRHTYAIDTRFTYRCTGCFATINRHSKSLNLEKKVCGRCHSRFELIVNTKRG-GVHPRHVVSSKVDHGEDSTTRPRPPFADFVKEHYKHVRQQTPNHKETMAQLGSMFRSMKIGVN 193          
BLAST of acidic repeat-containing protein vs. TrEMBL
Match: A0A1W2WDZ5 (uncharacterized protein LOC100181834 OS=Ciona intestinalis OX=7719 GN=LOC100181834 PE=4 SV=1)

HSP 1 Score: 129.413 bits (324), Expect = 3.835e-30
Identity = 69/169 (40.83%), Postives = 97/169 (57.40%), Query Frame = 1
Query:  151 TEETPRHVFIDLSPKICNDSHRLLTVMIHEMCHAAAFMISKINDCHGSIWRSWCLAAKMAFPLVPLTERCHSYRAKFKYQYRCETCPFVKAKHSKYKDN--KICPKCKSKLILFSDRGYGVHFEVDTNKPLVGFAAFVKENYKSVR----SKDV--NHKQAMSILSERF 633
            T  T  H  I LS K+ + S+RL   +IHEMCHAA ++I+  N+ HG  W+SW  AA+   P +P  +RCH+Y  ++KY Y C  C     +HSK  D   K+C +C+  L+L    G  +      ++PL  FA FVKENYKS +    S DV  +HK  M+ LS++F
Sbjct:  528 TASTTHHAAISLSEKVIDSSYRLRDTLIHEMCHAAVWLINNANESHGPYWKSWAAAARRIHPELPSIDRCHNYDIEYKYIYECSRCKTTIGRHSKSLDTTKKVCGRCRGPLVLTQPNGTPLK-----SQPLNPFAKFVKENYKSTKVRLQSIDVASSHKDVMTSLSQQF 691          
BLAST of acidic repeat-containing protein vs. TrEMBL
Match: A0A1S3H5D5 (uncharacterized protein LOC106152248 OS=Lingula unguis OX=7574 GN=LOC106152248 PE=4 SV=1)

HSP 1 Score: 126.716 bits (317), Expect = 4.986e-29
Identity = 67/172 (38.95%), Postives = 92/172 (53.49%), Query Frame = 1
Query:  145 TQTEETPRHVFIDLSPKICNDSHRLLTVMIHEMCHAAAFMISKINDCHGSIWRSWCLAAKMAFPLVPLTERCHSYRAKFKYQYRCETCPFVKAKHSKYKD--NKICPKCKSKLILFSDRGYGVHFEVDTNKPLVGFAAFVKENYKSVR--SKDVNHKQAMSILSERFYLQKL 648
            T  E T R   I+LS K+C+ + R+   +IHEMCHAA ++++  ND HG  W+ W   A +  P +P+  RCH+Y  + KY YRC  C +   +HSK  D   K+C  C+    L  +   G      T K L  FA FVKENY  V+   K + HK  M  LSE+F   K+
Sbjct:  945 TAEERTAR---IELSDKVCDSAERVRNTLIHEMCHAAVWLLNGKNDGHGPYWKYWAKKANVVHPDLPVISRCHTYAIQTKYTYRCTKCSYQFGRHSKSLDITKKVCGHCRGTFELLINSKDGSKSTPSTTKALTPFAKFVKENYGIVKGGQKGLQHKDVMRQLSEQFASSKI 1113          
BLAST of acidic repeat-containing protein vs. Ensembl Cavefish
Match: gcna (germ cell nuclear acidic peptidase [Source:NCBI gene;Acc:103028451])

HSP 1 Score: 116.701 bits (291), Expect = 2.938e-29
Identity = 61/165 (36.97%), Postives = 90/165 (54.55%), Query Frame = 1
Query:  166 RHVFIDLSPKICNDSHRLLTVMIHEMCHAAAFMISKINDCHGSIWRSWCLAAKMAFPLVPLTERCHSYRAKFKYQYRCETCPFVKAKHSKYKDNK--ICPKCKSKLILFSDRGYGVHFEVDTNKPLVGFAAFVKENYKSVRSK--DVNHKQAMSILSERFYLQKL 648
            R+  I+LS K+C+ + RL   ++HEMCHAA ++I+ + D HG  W+ +   A +A P +P+  RCHSY   +KYQY+C  C     +HSK  D +  +C  C  KL+L +          ++  P   FA FVKENY  VR +    +H + M  LS  F   +L
Sbjct:  430 RYARIELSVKVCDSADRLRDTLVHEMCHAATWLINNVRDGHGPFWKIYARKATLAHPELPMVTRCHSYDINYKYQYQCSRCKNTIGRHSKSLDTERFVCALCTGKLVLLT--------PANSRGP-TPFATFVKENYGPVRQELAGQSHAEVMRKLSADFSKTRL 585          
BLAST of acidic repeat-containing protein vs. Ensembl Cavefish
Match: gcna (germ cell nuclear acidic peptidase [Source:NCBI gene;Acc:103028451])

HSP 1 Score: 116.701 bits (291), Expect = 3.072e-29
Identity = 61/165 (36.97%), Postives = 90/165 (54.55%), Query Frame = 1
Query:  166 RHVFIDLSPKICNDSHRLLTVMIHEMCHAAAFMISKINDCHGSIWRSWCLAAKMAFPLVPLTERCHSYRAKFKYQYRCETCPFVKAKHSKYKDNK--ICPKCKSKLILFSDRGYGVHFEVDTNKPLVGFAAFVKENYKSVRSK--DVNHKQAMSILSERFYLQKL 648
            R+  I+LS K+C+ + RL   ++HEMCHAA ++I+ + D HG  W+ +   A +A P +P+  RCHSY   +KYQY+C  C     +HSK  D +  +C  C  KL+L +          ++  P   FA FVKENY  VR +    +H + M  LS  F   +L
Sbjct:  448 RYARIELSVKVCDSADRLRDTLVHEMCHAATWLINNVRDGHGPFWKIYARKATLAHPELPMVTRCHSYDINYKYQYQCSRCKNTIGRHSKSLDTERFVCALCTGKLVLLT--------PANSRGP-TPFATFVKENYGPVRQELAGQSHAEVMRKLSADFSKTRL 603          
BLAST of acidic repeat-containing protein vs. Ensembl Sea Lamprey
Match: ENSPMAT00000003196.1 (pep scaffold:Pmarinus_7.0:GL481285:6911:9692:1 gene:ENSPMAG00000002918.1 transcript:ENSPMAT00000003196.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 114.39 bits (285), Expect = 5.108e-31
Identity = 58/162 (35.80%), Postives = 87/162 (53.70%), Query Frame = 1
Query:  178 IDLSPKICNDSHRLLTVMIHEMCHAAAFMISKINDCHGSIWRSWCLAAKMAFPLVPLTERCHSYRAKFKYQYRCETCPFVKAKHSKYKDNK--ICPKCKSKLILFSDRGYGVHFEVDTNKPLVGFAAFVKENYKSVRS--KDVNHKQAMSILSERFYLQKLE 651
            I+LS K+C++  RL   ++HEMCHAA ++I+   D HG +W+ +   A +  P +P   RCH+Y   FKY+Y C  C     +HSK  D +  +C  C+ + +L    G        T++ L  F  FVKE Y + RS   D +H   M IL E+F   +L+
Sbjct:   85 IELSVKVCDNPERLRDTLVHEMCHAATWLINGQRDGHGRLWQLYARTATLVHPELPTVSRCHTYNITFKYRYECTRCKNSIGRHSKSLDTERFVCALCQGRFVLLPPEGR--DGTPVTSRALTPFTRFVKEQYGTTRSARPDSSHADIMRILGEQFSKTRLQ 244          
BLAST of acidic repeat-containing protein vs. Ensembl Sea Lamprey
Match: ENSPMAT00000003198.1 (pep scaffold:Pmarinus_7.0:GL481285:6974:9692:1 gene:ENSPMAG00000002918.1 transcript:ENSPMAT00000003198.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 103.605 bits (257), Expect = 3.408e-27
Identity = 54/157 (34.39%), Postives = 82/157 (52.23%), Query Frame = 1
Query:  196 ICNDSHRLLTVMIHEMCHAAAFMISKINDCHGSIWRSWCLAAKMAFPLVPLTERCHSYRAKFKYQYRCETCPFVKAKHSKYKDNK--ICPKCKSKLILFSDRGY-GVHFEVDTNKPLVGFAAFVKENYKSVRSK--DVNHKQAMSILSERFYLQKLE 651
            + + + RL   ++HEMCHAA ++I+   D HG +W+ +   A +  P +P   RCH+Y   FKY+Y C  C     +HSK  D +  +C  C+ + +L    G  G      T++ L  F  FVKE Y + RS   D +H   M IL E+F   +L+
Sbjct:   64 LMHGTERLRDTLVHEMCHAATWLINGQRDGHGRLWQLYARTATLVHPELPTVSRCHTYNITFKYRYECTRCKNSIGRHSKSLDTERFVCALCQGRFVLLPPEGRDGTPV---TSRALTPFTRFVKEQYGTTRSARPDSSHADIMRILGEQFSKTRLQ 217          
BLAST of acidic repeat-containing protein vs. Ensembl Nematostella
Match: EDO49719 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RFH1])

HSP 1 Score: 74.3294 bits (181), Expect = 2.498e-16
Identity = 34/88 (38.64%), Postives = 52/88 (59.09%), Query Frame = 1
Query:  178 IDLSPKICNDSHRLLTVMIHEMCHAAAFMISKINDCHGSIWRSWCLAAKMAFPLVPLTERCHSYRAKFKYQYRC--ETCPFVKAKHSK 435
            I+L+ K+ + + RL   +IHEMCHAAA++IS +   HG +W+ W + A      +P   RCH+Y+   K+ Y C  E C    ++HSK
Sbjct:   74 IELADKVIDSADRLRDTLIHEMCHAAAWLISGVKAGHGPVWKKWQVKANYILQDLPPISRCHTYKINAKFVYACTNEFCSNTISRHSK 161          
BLAST of acidic repeat-containing protein vs. Ensembl Medaka
Match: gcna (germ cell nuclear acidic peptidase [Source:NCBI gene;Acc:101164819])

HSP 1 Score: 108.227 bits (269), Expect = 2.105e-26
Identity = 58/162 (35.80%), Postives = 89/162 (54.94%), Query Frame = 1
Query:  166 RHVFIDLSPKICNDSHRLLTVMIHEMCHAAAFMISKINDCHGSIWRSWCLAAKMAFPLVPLTERCHSYRAKFKYQYRCETCPFVKAKHSKYKDNK--ICPKCKSKLILFSDRGYGVHFEVDTNKPL--VGFAAFVKENYKSVRSK--DVNHKQAMSILSERF 633
            R+  I+LS K+C+ + RL   +IHE+CHAA ++I+ + D HG+ W+ +   A +  P +P+  RCHSY   +K++Y+C  C     +HSK  D +  +C  C  +L+L +            +KP     FA FVKENY SVR +    +H + M  LS  F
Sbjct:  346 RYARIELSEKVCDSADRLRDTLIHELCHAATWLINGVRDGHGAFWKLYARKATVLHPELPMVTRCHSYDITYKFRYQCTRCQNTIGRHSKSLDTQKFVCALCTGRLVLMT-----------PSKPRAPTPFANFVKENYGSVRQELAGQSHAEVMRKLSTDF 496          
BLAST of acidic repeat-containing protein vs. Ensembl Medaka
Match: gcna (germ cell nuclear acidic peptidase [Source:NCBI gene;Acc:101164819])

HSP 1 Score: 108.612 bits (270), Expect = 2.205e-26
Identity = 58/162 (35.80%), Postives = 89/162 (54.94%), Query Frame = 1
Query:  166 RHVFIDLSPKICNDSHRLLTVMIHEMCHAAAFMISKINDCHGSIWRSWCLAAKMAFPLVPLTERCHSYRAKFKYQYRCETCPFVKAKHSKYKDNK--ICPKCKSKLILFSDRGYGVHFEVDTNKPL--VGFAAFVKENYKSVRSK--DVNHKQAMSILSERF 633
            R+  I+LS K+C+ + RL   +IHE+CHAA ++I+ + D HG+ W+ +   A +  P +P+  RCHSY   +K++Y+C  C     +HSK  D +  +C  C  +L+L +            +KP     FA FVKENY SVR +    +H + M  LS  F
Sbjct:  386 RYARIELSEKVCDSADRLRDTLIHELCHAATWLINGVRDGHGAFWKLYARKATVLHPELPMVTRCHSYDITYKFRYQCTRCQNTIGRHSKSLDTQKFVCALCTGRLVLMT-----------PSKPRAPTPFANFVKENYGSVRQELAGQSHAEVMRKLSTDF 536          
BLAST of acidic repeat-containing protein vs. Ensembl Medaka
Match: gcna (germ cell nuclear acidic peptidase [Source:NCBI gene;Acc:101164819])

HSP 1 Score: 108.612 bits (270), Expect = 2.205e-26
Identity = 58/162 (35.80%), Postives = 89/162 (54.94%), Query Frame = 1
Query:  166 RHVFIDLSPKICNDSHRLLTVMIHEMCHAAAFMISKINDCHGSIWRSWCLAAKMAFPLVPLTERCHSYRAKFKYQYRCETCPFVKAKHSKYKDNK--ICPKCKSKLILFSDRGYGVHFEVDTNKPL--VGFAAFVKENYKSVRSK--DVNHKQAMSILSERF 633
            R+  I+LS K+C+ + RL   +IHE+CHAA ++I+ + D HG+ W+ +   A +  P +P+  RCHSY   +K++Y+C  C     +HSK  D +  +C  C  +L+L +            +KP     FA FVKENY SVR +    +H + M  LS  F
Sbjct:  386 RYARIELSEKVCDSADRLRDTLIHELCHAATWLINGVRDGHGAFWKLYARKATVLHPELPMVTRCHSYDITYKFRYQCTRCQNTIGRHSKSLDTQKFVCALCTGRLVLMT-----------PSKPRAPTPFANFVKENYGSVRQELAGQSHAEVMRKLSTDF 536          
BLAST of acidic repeat-containing protein vs. Planmine SMEST
Match: SMESG000016996.1 (SMESG000016996.1)

HSP 1 Score: 390.578 bits (1002), Expect = 2.716e-135
Identity = 181/184 (98.37%), Postives = 183/184 (99.46%), Query Frame = 1
Query:  148 QTEETPRHVFIDLSPKICNDSHRLLTVMIHEMCHAAAFMISKINDCHGSIWRSWCLAAKMAFPLVPLTERCHSYRAKFKYQYRCETCPFVKAKHSKYKDNKICPKCKSKLILFSDRGYGVHFEVDTNKPLVGFAAFVKENYKSVRSKDVNHKQAMSILSERFYLQKLEIQVNKAKAFMSEQSQA 699
            +TEETPRHVFIDLSPKICNDSHRLLTVMIHEMCHAAAFMISKINDCHGSIWRSWCLAAKMAFPLVPL+ERCHSYRAKFKYQYRCETCPFVKAKHSKYKDNKICPKCKSKLILFSDRGYGVHFEVDTNKPLVGFAAFVKENYKS RSKDVNHKQAMSILSERFYLQKLEIQVNKAKAFMSEQSQA
Sbjct:  286 KTEETPRHVFIDLSPKICNDSHRLLTVMIHEMCHAAAFMISKINDCHGSIWRSWCLAAKMAFPLVPLSERCHSYRAKFKYQYRCETCPFVKAKHSKYKDNKICPKCKSKLILFSDRGYGVHFEVDTNKPLVGFAAFVKENYKSARSKDVNHKQAMSILSERFYLQKLEIQVNKAKAFMSEQSQA 469          
BLAST of acidic repeat-containing protein vs. Planmine SMEST
Match: SMESG000004184.1 (SMESG000004184.1)

HSP 1 Score: 126.716 bits (317), Expect = 6.387e-33
Identity = 67/168 (39.88%), Postives = 92/168 (54.76%), Query Frame = 1
Query:  145 TQTEETP--RHVFIDLSPKICNDSHRLLTVMIHEMCHAAAFMISKINDCHGSIWRSWCLAAKMAFPLVPLTERCHSYRAKFKYQYRCETCPFVKAKHSKYKD--NKICPKCKSKLILFSDRGYGVHFEV-DTNKPLVGFAAFVKENYKSVRSKDVNHKQAMSILSERF 633
            T+T E P    + I LS K+  D+ RLL  ++HEMCH A ++I+K N  HG +W+ W   A ++FP V ++ERCH+Y    K++Y C  C     +HSK  D   K+C  CK K  LF     G    V D  K + GF+ FVKENY   R    +H + M  LSE +
Sbjct:  384 TKTREEPVIHSIKIQLSKKVLTDAERLLGTLVHEMCHGAVWVINKTNGNHGPVWKKWTAKAHLSFPAVVMSERCHNYDIHTKFEYTCLNCNKSVKRHSKSIDINRKVCRICKGKFTLFRLDQKGNRIAVGDATKKMNGFSMFVKENYNKYRKSGTSHAEVMKKLSELY 551          
The following BLAST results are available for this feature:
BLAST of acidic repeat-containing protein vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 2
Match NameE-valueIdentityDescription
GCNA9.154e-1633.94germ cell nuclear acidic peptidase [Source:HGNC Sy... [more]
GCNA9.154e-1633.94germ cell nuclear acidic peptidase [Source:HGNC Sy... [more]
back to top
BLAST of acidic repeat-containing protein vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 1
Match NameE-valueIdentityDescription
gcna-12.407e-1433.33Germ Cell Nuclear Antigen [Source:UniProtKB/TrEMB... [more]
back to top
BLAST of acidic repeat-containing protein vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
CG148149.173e-2333.33gene:FBgn0023515 transcript:FBtr0339494[more]
CG148149.173e-2333.33gene:FBgn0023515 transcript:FBtr0070370[more]
CG148141.190e-2233.33gene:FBgn0023515 transcript:FBtr0070369[more]
CG26946.401e-927.46gene:FBgn0024991 transcript:FBtr0070482[more]
CG26949.578e-927.46gene:FBgn0024991 transcript:FBtr0310649[more]
back to top
BLAST of acidic repeat-containing protein vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 1
Match NameE-valueIdentityDescription
gcna3.194e-2737.04germ cell nuclear acidic peptidase [Source:ZFIN;Ac... [more]
back to top
BLAST of acidic repeat-containing protein vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 1
Match NameE-valueIdentityDescription
ENSXETT00000038004.14.178e-2737.27germ cell nuclear acidic peptidase [Source:NCBI ge... [more]
back to top
BLAST of acidic repeat-containing protein vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of acidic repeat-containing protein vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 2
Match NameE-valueIdentityDescription
sp|Q96QF7|ACRC_HUMAN4.396e-1533.94Acidic repeat-containing protein OS=Homo sapiens O... [more]
sp|O42953|YGM4_SCHPO7.034e-1027.71HMG box-containing protein C19G7.04 OS=Schizosacch... [more]
back to top
BLAST of acidic repeat-containing protein vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
F7AS596.119e-3340.12SprT-like domain-containing protein OS=Ciona intes... [more]
A0A553NPW61.228e-3141.76SprT-like domain-containing protein OS=Tigriopus c... [more]
A0A5K3FNH52.333e-3036.96Uncharacterized protein OS=Mesocestoides corti OX=... [more]
A0A1W2WDZ53.835e-3040.83uncharacterized protein LOC100181834 OS=Ciona inte... [more]
A0A1S3H5D54.986e-2938.95uncharacterized protein LOC106152248 OS=Lingula un... [more]
back to top
BLAST of acidic repeat-containing protein vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 2
Match NameE-valueIdentityDescription
gcna2.938e-2936.97germ cell nuclear acidic peptidase [Source:NCBI ge... [more]
gcna3.072e-2936.97germ cell nuclear acidic peptidase [Source:NCBI ge... [more]
back to top
BLAST of acidic repeat-containing protein vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 2
Match NameE-valueIdentityDescription
ENSPMAT00000003196.15.108e-3135.80pep scaffold:Pmarinus_7.0:GL481285:6911:9692:1 gen... [more]
ENSPMAT00000003198.13.408e-2734.39pep scaffold:Pmarinus_7.0:GL481285:6974:9692:1 gen... [more]
back to top
BLAST of acidic repeat-containing protein vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of acidic repeat-containing protein vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 1
Match NameE-valueIdentityDescription
EDO497192.498e-1638.64Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of acidic repeat-containing protein vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 3
Match NameE-valueIdentityDescription
gcna2.105e-2635.80germ cell nuclear acidic peptidase [Source:NCBI ge... [more]
gcna2.205e-2635.80germ cell nuclear acidic peptidase [Source:NCBI ge... [more]
gcna2.205e-2635.80germ cell nuclear acidic peptidase [Source:NCBI ge... [more]
back to top
BLAST of acidic repeat-containing protein vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 2
Match NameE-valueIdentityDescription
SMESG000016996.12.716e-13598.37SMESG000016996.1[more]
SMESG000004184.16.387e-3339.88SMESG000004184.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30015608 ID=SMED30015608|Name=acidic repeat-containing protein|organism=Schmidtea mediterranea sexual|type=transcript|length=819bp
ATTGATAAAACGAAATAATAATGATAAAATTGAATAATTATTATTTTTAA
AACCAATATTGATTGATTTATTGATAAAACTGAATAATTATTGATTTATA
AAAAAAATTTGGCTCCTTCACAATAAATCTATTTCATCGATTTAACGCAG
ACAGAAGAAACCCCGAGACACGTATTCATTGATTTATCGCCAAAGATCTG
TAATGATTCTCATCGACTTTTGACTGTGATGATTCATGAAATGTGTCACG
CGGCGGCGTTCATGATTAGCAAGATTAATGATTGCCACGGCTCTATATGG
AGAAGTTGGTGCTTGGCGGCAAAAATGGCTTTCCCTTTAGTACCACTAAC
CGAACGTTGCCATAGTTACCGTGCAAAATTCAAATACCAATATCGCTGTG
AAACCTGTCCATTTGTCAAAGCTAAGCATTCCAAATATAAAGATAATAAA
ATATGCCCAAAATGCAAAAGTAAACTGATTTTATTTAGTGATCGGGGTTA
TGGGGTTCATTTTGAGGTCGACACTAATAAACCCTTGGTGGGATTTGCGG
CTTTCGTTAAGGAAAACTACAAATCTGTCCGGTCAAAAGATGTAAACCAC
AAACAGGCAATGAGTATTTTATCGGAGAGATTTTATTTACAGAAACTTGA
AATCCAAGTGAATAAGGCGAAGGCATTTATGAGCGAGCAATCGCAGGCTT
AACGTGTGAATATATATTTTCTATTTTATTGGTTTTTATTGATGGAAATA
ATCGGTGTAGAAATCATTTGGATTTATCAATAATTATTGAACTATTTTTA
TTTATCATTTTGTAATTAA
back to top

protein sequence of SMED30015608-orf-1

>SMED30015608-orf-1 ID=SMED30015608-orf-1|Name=SMED30015608-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=158bp
MIHEMCHAAAFMISKINDCHGSIWRSWCLAAKMAFPLVPLTERCHSYRAK
FKYQYRCETCPFVKAKHSKYKDNKICPKCKSKLILFSDRGYGVHFEVDTN
KPLVGFAAFVKENYKSVRSKDVNHKQAMSILSERFYLQKLEIQVNKAKAF
MSEQSQA*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: molecular function
TermDefinition
GO:0003677DNA binding
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000014zeta neoblast
PLANA:0000101muscle cell
PLANA:0000142posterior region of the whole animal
PLANA:0002089reproductive organ
PLANA:0002109X1 cell
Vocabulary: INTERPRO
TermDefinition
IPR006640SprT-like_domain
Vocabulary: cellular component
TermDefinition
GO:0005634nucleus
Vocabulary: biological process
TermDefinition
GO:0080111DNA demethylation
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR006640SprT-likePFAMPF10263SprT-likecoord: 2..35
e-value: 7.9E-8
score: 32.2
NoneNo IPR availablePANTHERPTHR23099TRANSCRIPTIONAL REGULATORcoord: 2..135