BED-type domain-containing protein

Overview
NameBED-type domain-containing protein
Smed IDSMED30015600
Length (bp)3154
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of BED-type domain-containing protein (SMED30015600) t-SNE clustered cells

Violin plots show distribution of expression levels for BED-type domain-containing protein (SMED30015600) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of BED-type domain-containing protein (SMED30015600) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for BED-type domain-containing protein (SMED30015600) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Homology
BLAST of BED-type domain-containing protein vs. TrEMBL
Match: A0A150FTT0 (Uncharacterized protein OS=Gonium pectorale OX=33097 GN=GPECTOR_962g228 PE=4 SV=1)

HSP 1 Score: 137.502 bits (345), Expect = 6.667e-62
Identity = 75/235 (31.91%), Postives = 128/235 (54.47%), Query Frame = 2
Query: 1193 NNFGKKCQLYLYINKPVFELLRLVDGDAPVTGKIYFKMFTIQESINN----FPNISQAQRKELYDSFARRWAMMHTTLHAAGFLLDPEYVNMA-QHANDEVMTGFYQLVELLHPDVEEQVIITNQLNKFRSSQGIFTCL---VAKAAASTMPAHQWWHSFGSCVPELQRFAIRVLRQTATSSAAERNWSLFGFFQNKRRSRLNPKTIEKMVYIHANTRLMDKVEEVDYVEENVKW 1873
            + F  + Q  + +  P+  +LRL D  AP TGKIY +   +Q+ +        +    ++K+L +S   R  M+H  LHAAG+LLDPE+ ++  +    +VM GF ++V  +  + +       +L  F+  +G +  +    A+A AS +P   W H   S    LQ+ A+RVL Q  ++ A ERNWS + F  + RR++L+P+  +K+VY+  N R++++V +  + EE V W
Sbjct:  224 DGFWVRVQELVDLTGPIVVVLRLADSSAPTTGKIYHECLKLQQHVEEKAEAMTSFKLGEKKQLKESVKSRCEMLHNPLHAAGYLLDPEFWDVPLKDVGRKVMDGFREVVRAMLDNTDLSAKAEEELVLFKRKEGPWGGMQLASAQANASKLPGSAW-HQMYSMDTLLQKIAVRVLAQPTSACACERNWSAYEFIHSTRRNKLDPERAKKLVYVFTNRRILNRVRKPGFREEVVPW 457          

HSP 2 Score: 109.383 bits (272), Expect = 6.667e-62
Identity = 51/112 (45.54%), Postives = 75/112 (66.96%), Query Frame = 2
Query:  569 YIFTDLNLKMGTIVSDGWSDAQQKPLLNILLVTSSGSTFIESIDTTGNTKDFGYIAQVIMSSIEKIRPELILQVITDSAANCKAAWQIIAKKFPKIVCGPCSAHCLDLLLED 904
            + ++ ++    T+  DGWSDAQ +P+ N +L  ++ + F +S D TG TKD   +A  +M +I +I PE ++ VITDSA+NCKAA +II +  P I   PC+AHCLDL+LED
Sbjct:   15 FFYSKVDETGCTVAGDGWSDAQHRPIQNTMLCANNLAVFHDSFDMTGLTKDAQTVAGKMMKAITEIGPEKVVCVITDSASNCKAAGEIIHEAHPHIFWVPCAAHCLDLMLED 126          

HSP 3 Score: 44.2838 bits (103), Expect = 6.667e-62
Identity = 27/86 (31.40%), Postives = 46/86 (53.49%), Query Frame = 1
Query:  961 FIKGHDGSRAMLKKHSPNKFLLHPAETSFGTCVIMTQRLVELKDALQKMIVSKEYKAWL--SNKSYKIAGEEVSFSVLYEQFWKKV 1212
            F+K      A+  KHS  K LL P ET F T  ++  R ++++ AL+KM+  ++++ W     KS K    E++  +  + FW +V
Sbjct:  146 FVKNKHTPLAIFNKHSKLKVLL-PGETRFATEFLVLDRSIKVRRALKKMLADRKFEKWTKAGGKSRKDEVAEIAKLINADGFWVRV 230          
BLAST of BED-type domain-containing protein vs. TrEMBL
Match: A0A3Q0EXI4 (uncharacterized protein LOC106758329 OS=Vigna radiata var. radiata OX=3916 GN=LOC106758329 PE=4 SV=1)

HSP 1 Score: 123.25 bits (308), Expect = 1.015e-56
Identity = 82/243 (33.74%), Postives = 124/243 (51.03%), Query Frame = 2
Query: 1223 LYINKPVFELLRLVDGDA-PVTGKIYFKMFTIQESI-NNFPNISQAQRKELYDSFARRWA-MMHTTLHAAGFLLDPEY---VNMAQHANDEVMTGFYQLVELLHPDVEEQVIITNQLNKFRSSQGIFTCLVAKAAASTMPAHQWWHSFGSCVPELQRFAIRVLRQTATSSAAERNWSLFGFFQNKRRSRLNPKTIEKMVYIHANTRLMDKVEEVDYVEENVKWNEPNDDISETSEDSVQEESD 1933
            L +  P+  +LRLVD D  P  G IY +M + +E I +NF NI ++  +E++     RW   +H  LHAA + L+P +    N       EV  G Y  +  L PD+ E+  I  Q+ +F +++ +F    AK     +   +WW  FG   PEL+RFAIR+L  T +SS  ERNWS F     K R+ L+ K +  +VY+  N++L  +      + + +    P DDI    E  V+E  D
Sbjct:  289 LKVAAPLMVVLRLVDSDVKPAMGFIYEEMDSAKEKIRSNFNNIKKSY-EEVWKIIDARWNNQLHRPLHAAAYFLNPHFHYEPNFRSDDGREVKEGLYFCMRRLIPDMAERRKINLQIVEFHNARELFGMEDAKECRKQLNPGEWWDMFGDGTPELKRFAIRILSLTCSSSGCERNWSSFEMVHTKGRNLLHKKKMNDLVYVMYNSKLKSR-----QIRKTIAL--PFDDIESDDEWIVEEAYD 523          

HSP 2 Score: 84.7297 bits (208), Expect = 1.015e-56
Identity = 36/102 (35.29%), Postives = 69/102 (67.65%), Query Frame = 2
Query:  602 TIVSDGWSDAQQKPLLNILLVTSSGSTFIESIDTTGNTKDFGYIAQVIMSSIEKIRPELILQVITDSAANCKAAWQIIAKKFPKIVCGPCSAHCLDLLLEDW 907
            TI+SDGW+D +++ + N L+ +  G+ F+ S+DT+  +K    + +++   +E +  E ++QV+TD+ AN KAA +++ +K  K+   PC+AHC+D++ ED+
Sbjct:   83 TIMSDGWTDRKRRSICNFLVNSPKGTIFLSSLDTSDISKTADKVFKMLDDVVEFVGEENVVQVVTDNVANFKAAGELLMQKREKLYWTPCAAHCIDMIFEDF 184          

HSP 3 Score: 46.2098 bits (108), Expect = 1.015e-56
Identity = 27/67 (40.30%), Postives = 31/67 (46.27%), Query Frame = 3
Query:  423 FNVVNNKHFREMCSQIGKFGPAYKPLSDHPIRTTLL-------DKEYAKVKIESKRISLLI*ISRWV 602
            FNV+ N  F +MC  IGK+G  YKP S H IR  LL       D    + K E KR    I    W 
Sbjct:   24 FNVIRNPTFAKMCEMIGKYGVGYKPPSYHDIREKLLKQVVKKIDANLEEYKEERKRTGCTIMSDGWT 90          

HSP 4 Score: 40.0466 bits (92), Expect = 1.015e-56
Identity = 29/91 (31.87%), Postives = 42/91 (46.15%), Query Frame = 1
Query:  952 VAKFIKGHDGSRAMLKKHSPNKFLLHPAETSFGTCVIMTQRLVELKDALQKMIVSKEYKAWLSNKSYKIAGEEVSFSVLYEQFWKKVSVIL 1224
            +  +I G     ++LKK +  + L+ P  T F T  +    L ELK +L  M  S+E+K   S       G +V   VL  +FW  VS  L
Sbjct:  201 ITTYIYGRSMLISLLKKFTKGRGLIRPCVTRFATAYLTLACLHELKASLLTMFSSEEWKT--SKFGTSQEGRKVENVVLDSRFWNNVSTCL 289          
BLAST of BED-type domain-containing protein vs. TrEMBL
Match: A0A5A7V8P5 (BED-type domain-containing protein OS=Cucumis melo var. makuwa OX=1194695 GN=E6C27_scaffold89G004030 PE=4 SV=1)

HSP 1 Score: 129.028 bits (323), Expect = 2.056e-56
Identity = 70/216 (32.41%), Postives = 119/216 (55.09%), Query Frame = 2
Query: 1223 LYINKPVFELLRLVDGDA-PVTGKIYFKMFTIQESINNFPNISQAQRKELYDSFARRWAM-MHTTLHAAGFLLDPE--YVNMAQHANDEVMTGFYQLVELLHPDVEEQVIITNQLNKFRSSQGIFTCLVAKAAASTMPAHQWWHSFGSCVPELQRFAIRVLRQTATSSAAERNWSLFGFFQNKRRSRLNPKTIEKMVYIHANTRLMDKVEEVDYVE 1858
            L ++ P+  +LRLVDG+  P  G IY  M   +E+I    N ++ + K+++    RRW + +H  LHAAG+ L+P   Y N +   +DE++ G Y  +  +   ++ Q  I  +L+K++ ++ +F   +A      +   +WW +FG   P LQ+FAIR+L  T ++S  ERNWS+F    +K+R+RL    +  +V+I  N  L  +    D V+
Sbjct:  440 LKVSGPLVRVLRLVDGEKKPPMGYIYEAMDRAKEAIAKSFNNNEEKYKDIFTIIDRRWELQLHRPLHAAGYYLNPSFYYSNPSIQEDDEIVNGLYSCITKMVASLDVQDKILAELSKYKRAEALFGQPLAIRQRDKISPVEWWDNFGQSTPNLQKFAIRILGLTCSASGCERNWSVFEQLHSKKRNRLAQSRLNDLVFIKYNRALKRRYNLRDIVD 655          

HSP 2 Score: 89.3521 bits (220), Expect = 2.056e-56
Identity = 41/105 (39.05%), Postives = 72/105 (68.57%), Query Frame = 2
Query:  593 KMG-TIVSDGWSDAQQKPLLNILLVTSSGSTFIESIDTTGNTKDFGYIAQVIMSSIEKIRPELILQVITDSAANCKAAWQIIAKKFPKIVCGPCSAHCLDLLLED 904
            K+G T+++DGW+D + + L+N L+ +  G+ FIESID +   KD   + +++ + +E+I    ++QV+TDSA+    A +++  K P+++  PC+AHCLDL+LED
Sbjct:  231 KVGCTVMADGWTDRRNRTLINFLVNSPKGTMFIESIDASSYVKDGKKMFELLDNFVERIGEANVVQVVTDSASANVMAGRLLEAKRPQLIWSPCAAHCLDLMLED 335          

HSP 3 Score: 41.2022 bits (95), Expect = 2.056e-56
Identity = 27/93 (29.03%), Postives = 44/93 (47.31%), Query Frame = 1
Query:  946 IAVAKFIKGHDGSRAMLKKHSPNKFLLHPAETSFGTCVIMTQRLVELKDALQKMIVSKEYKAWLSNKSYKIAGEEVSFSVLYEQFWKKVSVIL 1224
            + ++ FI    G   M+++ +  K L+ PA+T F T  I    +   K+ L+KM  S E+K   S  S +  G  V  ++L   FW  +   L
Sbjct:  350 MEISNFIYVRPGLLNMMRRFTKQKELVRPAKTRFATACITLSSIHHQKNNLRKMFTSDEWKD--SKWSKEQQGRRVVQTILLASFWTTIVFTL 440          

HSP 4 Score: 33.113 bits (74), Expect = 2.056e-56
Identity = 16/43 (37.21%), Postives = 19/43 (44.19%), Query Frame = 3
Query:  411 TGTSFNVVNNKHFREMCSQIGKFGPAYKPLSDHPIRTTLLDKE 539
             G   N      F  M   IG+FGP  KP + H +R   L KE
Sbjct:  172 AGVPLNACTYDSFAPMIESIGQFGPGLKPPTYHELRVPCLKKE 214          
BLAST of BED-type domain-containing protein vs. TrEMBL
Match: A0A5A7TY62 (BED-type domain-containing protein OS=Cucumis melo var. makuwa OX=1194695 GN=E6C27_scaffold61G001320 PE=4 SV=1)

HSP 1 Score: 129.028 bits (323), Expect = 2.829e-56
Identity = 70/216 (32.41%), Postives = 119/216 (55.09%), Query Frame = 2
Query: 1223 LYINKPVFELLRLVDGDA-PVTGKIYFKMFTIQESINNFPNISQAQRKELYDSFARRWAM-MHTTLHAAGFLLDPE--YVNMAQHANDEVMTGFYQLVELLHPDVEEQVIITNQLNKFRSSQGIFTCLVAKAAASTMPAHQWWHSFGSCVPELQRFAIRVLRQTATSSAAERNWSLFGFFQNKRRSRLNPKTIEKMVYIHANTRLMDKVEEVDYVE 1858
            L ++ P+  +LRLVDG+  P  G IY  M   +E+I    N ++ + K+++    RRW + +H  LHAAG+ L+P   Y N +   +DE++ G Y  +  +   ++ Q  I  +L+K++ ++ +F   +A      +   +WW +FG   P LQ+FAIR+L  T ++S  ERNWS+F    +K+R+RL    +  +V+I  N  L  +    D V+
Sbjct:  440 LKVSGPLVRVLRLVDGEKKPPMGYIYEAMDRAKEAIAKSFNNNEEKYKDIFTIIDRRWELQLHRPLHAAGYYLNPSFYYSNPSIQEDDEIVNGLYSCITKMVASLDIQDKILAELSKYKRAEALFGQPLAIRQRDKISPVEWWDNFGQSTPNLQKFAIRILGLTCSASGCERNWSVFEQLHSKKRNRLAQSRLNDLVFIKYNRALKRRYNLRDIVD 655          

HSP 2 Score: 89.3521 bits (220), Expect = 2.829e-56
Identity = 41/105 (39.05%), Postives = 72/105 (68.57%), Query Frame = 2
Query:  593 KMG-TIVSDGWSDAQQKPLLNILLVTSSGSTFIESIDTTGNTKDFGYIAQVIMSSIEKIRPELILQVITDSAANCKAAWQIIAKKFPKIVCGPCSAHCLDLLLED 904
            K+G T+++DGW+D + + L+N L+ +  G+ FIESID +   KD   + +++ + +E+I    ++QV+TDSA+    A +++  K P+++  PC+AHCLDL+LED
Sbjct:  231 KVGCTVMADGWTDRRNRTLINFLVNSPKGTMFIESIDASSYVKDGKKMFELLDNFVERIGEANVVQVVTDSASANVMAGRLLEAKRPQLIWSPCAAHCLDLMLED 335          

HSP 3 Score: 41.2022 bits (95), Expect = 2.829e-56
Identity = 27/93 (29.03%), Postives = 44/93 (47.31%), Query Frame = 1
Query:  946 IAVAKFIKGHDGSRAMLKKHSPNKFLLHPAETSFGTCVIMTQRLVELKDALQKMIVSKEYKAWLSNKSYKIAGEEVSFSVLYEQFWKKVSVIL 1224
            + ++ FI    G   M+++ +  K L+ PA+T F T  I    +   K+ L+KM  S E+K   S  S +  G  V  ++L   FW  +   L
Sbjct:  350 MEISNFIYVRPGLLNMMRRFTNQKELVRPAKTRFATACITLSSIHHQKNNLRKMFTSDEWKD--SKWSKEQQGRRVVQTILLASFWTTIVFAL 440          

HSP 4 Score: 33.113 bits (74), Expect = 2.829e-56
Identity = 16/43 (37.21%), Postives = 19/43 (44.19%), Query Frame = 3
Query:  411 TGTSFNVVNNKHFREMCSQIGKFGPAYKPLSDHPIRTTLLDKE 539
             G   N      F  M   IG+FGP  KP + H +R   L KE
Sbjct:  172 AGVPLNACTYDSFAPMIESIGQFGPGLKPPTYHELRVPCLKKE 214          
BLAST of BED-type domain-containing protein vs. TrEMBL
Match: A0A5A7VJR4 (BED-type domain-containing protein OS=Cucumis melo var. makuwa OX=1194695 GN=E6C27_scaffold238G00160 PE=4 SV=1)

HSP 1 Score: 128.642 bits (322), Expect = 3.147e-56
Identity = 70/216 (32.41%), Postives = 119/216 (55.09%), Query Frame = 2
Query: 1223 LYINKPVFELLRLVDGDA-PVTGKIYFKMFTIQESINNFPNISQAQRKELYDSFARRWAM-MHTTLHAAGFLLDPE--YVNMAQHANDEVMTGFYQLVELLHPDVEEQVIITNQLNKFRSSQGIFTCLVAKAAASTMPAHQWWHSFGSCVPELQRFAIRVLRQTATSSAAERNWSLFGFFQNKRRSRLNPKTIEKMVYIHANTRLMDKVEEVDYVE 1858
            L ++ P+  +LRLVDG+  P  G IY  M   +E+I    N ++ + K+++    RRW + +H  LHAAG+ L+P   Y N +   +DE++ G Y  +  +   ++ Q  I  +L+K++ ++ +F   +A      +   +WW +FG   P LQ+FAIR+L  T ++S  ERNWS+F    +K+R+RL    +  +V+I  N  L  +    D V+
Sbjct:  440 LKVSGPLVRVLRLVDGEKKPPMGYIYEAMDRAKEAIAKSFNNNEEKYKDIFTIIDRRWELQLHRPLHAAGYYLNPSFYYSNPSIQEDDEIVNGLYSCITKMVASLDIQDKILAELSKYKRAEALFGQPLAIRQRDKISPVEWWDNFGQSTPNLQKFAIRILGLTCSASGCERNWSVFEQLHSKKRNRLAQSRLNDLVFIKYNRALKRRYNLRDIVD 655          

HSP 2 Score: 89.3521 bits (220), Expect = 3.147e-56
Identity = 39/101 (38.61%), Postives = 69/101 (68.32%), Query Frame = 2
Query:  602 TIVSDGWSDAQQKPLLNILLVTSSGSTFIESIDTTGNTKDFGYIAQVIMSSIEKIRPELILQVITDSAANCKAAWQIIAKKFPKIVCGPCSAHCLDLLLED 904
            T+++DGW+D + + L+N L+ +  G+ FIESID +   KD   + +++ + +E+I    ++QV+TDSA+    A +++  K P+++  PC+AHCLDL+LED
Sbjct:  235 TVMADGWTDRRNRTLINFLVNSPKGTMFIESIDASSYVKDGKKMFELLDNFVERIGEANVVQVVTDSASANVMAGRLLEAKRPQLIWSPCAAHCLDLMLED 335          

HSP 3 Score: 41.2022 bits (95), Expect = 3.147e-56
Identity = 27/93 (29.03%), Postives = 44/93 (47.31%), Query Frame = 1
Query:  946 IAVAKFIKGHDGSRAMLKKHSPNKFLLHPAETSFGTCVIMTQRLVELKDALQKMIVSKEYKAWLSNKSYKIAGEEVSFSVLYEQFWKKVSVIL 1224
            + ++ FI    G   M+++ +  K L+ PA+T F T  I    +   K+ L+KM  S E+K   S  S +  G  V  ++L   FW  +   L
Sbjct:  350 MEISNFIYVRPGLLNMMRRFTNQKELVRPAKTRFATACITLSSIHHQKNNLRKMFTSDEWKD--SKWSKEQQGRRVVQTILLASFWTTIVFAL 440          

HSP 4 Score: 33.113 bits (74), Expect = 3.147e-56
Identity = 16/43 (37.21%), Postives = 19/43 (44.19%), Query Frame = 3
Query:  411 TGTSFNVVNNKHFREMCSQIGKFGPAYKPLSDHPIRTTLLDKE 539
             G   N      F  M   IG+FGP  KP + H +R   L KE
Sbjct:  172 AGVPLNACTYDSFAPMIESIGQFGPGLKPPTYHELRVPCLKKE 214          
The following BLAST results are available for this feature:
BLAST of BED-type domain-containing protein vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of BED-type domain-containing protein vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of BED-type domain-containing protein vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of BED-type domain-containing protein vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of BED-type domain-containing protein vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of BED-type domain-containing protein vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of BED-type domain-containing protein vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of BED-type domain-containing protein vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A150FTT06.667e-6231.91Uncharacterized protein OS=Gonium pectorale OX=330... [more]
A0A3Q0EXI41.015e-5633.74uncharacterized protein LOC106758329 OS=Vigna radi... [more]
A0A5A7V8P52.056e-5632.41BED-type domain-containing protein OS=Cucumis melo... [more]
A0A5A7TY622.829e-5632.41BED-type domain-containing protein OS=Cucumis melo... [more]
A0A5A7VJR43.147e-5632.41BED-type domain-containing protein OS=Cucumis melo... [more]
back to top
BLAST of BED-type domain-containing protein vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of BED-type domain-containing protein vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of BED-type domain-containing protein vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of BED-type domain-containing protein vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of BED-type domain-containing protein vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of BED-type domain-containing protein vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30015600 ID=SMED30015600|Name=BED-type domain-containing protein|organism=Schmidtea mediterranea sexual|type=transcript|length=3154bp
GATTTCTATTAAGTTTTATGTATTACTTAAATTGTTTATCACAGTAGGTC
GTGATCAATTGATCAGCCTACATAAAATTAGCAAAAATTTATCATTTATG
AATGTCGATTTGTGCACAAAGTATTTTGGGGTAGTGGTAATCGTATCCGA
GCACACATGGATATTGAAACTGCAACAGGCGTAGCCAAATGTGTCAAGGT
GCCAGTTGAAATTCTGGAATGCTTCAAAGCAACAGATGCTGTTAAACAAT
CTGAAAAACAAGAAAACGCAAGAAAACGAAATCTAGATAAAGCGGTTACA
TCCACATCGCTGTCCTCATCGTCTGCAAAGCAACCGAAACTAACCAATAT
GTTTAAAAATATTGAGAAAGCTGAAGTGGATTAATCTATTGCAAGAATGA
TGTATAGCACACAGGTACTAGTTTCAATGTTGTTAACAACAAACATTTTA
GAGAGATGTGCTCACAAATCGGAAAATTTGGACCAGCATACAAGCCACTA
TCTGATCATCCTATACGAACGACATTACTTGACAAAGAATATGCTAAAGT
CAAAATCGAGTCTAAACGTATATCTTTACTGATTTAAATCTCAAGATGGG
TACTATTGTAAGTGATGGTTGGTCTGATGCACAACAGAAGCCATTATTGA
ACATTTTGTTGGTGACCTCATCTGGGTCAACATTTATAGAAAGTATTGAT
ACAACTGGTAACACAAAGGATTTTGGTTACATTGCCCAAGTAATCATGTC
ATCAATAGAAAAAATTAGACCCGAGTTGATTCTTCAAGTTATCACAGACA
GTGCAGCTAACTGTAAAGCAGCATGGCAGATAATTGCAAAAAAGTTTCCA
AAAATTGTTTGTGGTCCATGTTCTGCACACTGCCTAGACCTTTTACTCGA
AGACTGGTGTAAATTAATTTGGATTTCTTCAATTTTGAAGACGTGATTGC
TGTTGCAAAGTTTATAAAAGGACATGATGGCTCACGAGCTATGTTGAAGA
AACATTCTCCTAATAAGTTTTTGCTCCATCCAGCTGAGACAAGCTTTGGC
ACTTGTGTTATCATGACTCAACGTTTAGTGGAACTTAAAGATGCTTTGCA
GAAAATGATTGTGAGCAAAGAATACAAGGCGTGGTTAAGCAACAAGAGCT
ACAAAATAGCTGGTGAAGAAGTATCTTTTTCAGTTCTGTATGAACAATTT
TGGAAAAAAGTGTCAGTTATACTTGTATATAAACAAACCAGTTTTTGAAC
TGCTACGACTTGTTGATGGGGATGCCCCTGTTACAGGAAAGATTTATTTC
AAAATGTTTACAATTCAAGAATCTATTAACAACTTTCCAAATATATCACA
AGCTCAGCGTAAAGAGTTGTACGATTCATTTGCTAGAAGATGGGCCATGA
TGCACACAACGCTTCATGCCGCAGGATTCCTTTTAGATCCGGAGTATGTG
AACATGGCTCAGCATGCAAATGATGAAGTCATGACTGGATTCTATCAACT
AGTAGAACTATTGCATCCTGATGTGGAGGAGCAAGTCATTATAACAAACC
AACTAAATAAATTTAGATCAAGTCAGGGAATATTTACATGCTTAGTAGCA
AAAGCTGCAGCAAGTACCATGCCAGCACATCAATGGTGGCACAGTTTTGG
ATCCTGTGTACCGGAGCTTCAGAGATTTGCTATACGCGTATTAAGGCAAA
CCGCAACATCGAGTGCTGCTGAAAGGAACTGGAGCTTATTTGGTTTCTTC
CAGAATAAAAGGAGGTCTCGACTGAATCCGAAGACCATTGAGAAGATGGT
CTATATCCATGCCAACACACGTTTAATGGACAAAGTGGAAGAAGTGGATT
ATGTTGAAGAGAACGTGAAATGGAATGAACCGAATGATGATATCAGTGAA
ACGTCAGAAGACTCAGTACAAGAAGAGTCTGATTCTACAGATGATTAGAA
TTTAGATACAGTTTTGCAACTTTATACATTCATTCTTTATAATACTGCTG
ATATTATTGATATTGTTAGAAAATTGGAACAAAAATACACAATTGTTCAC
GGAATTGTTTTAAAACGTTTTCCATTCTTTAATTTTTAATTTTGTTATTG
CTTGTTAATTCTATAATAAAAAAAATATTTCGACTAACACGTAATGCAGA
AAAATTAGCGTACGCTATTTATTAATTTAGTCAAAAAATAGCATACGCGT
ACGGTACGCATTTCAGCAGAAAAATAGCGTCCCGTATGTACAGTCGAACT
TTGGTGCACATTTCTGATATTGGCTGTTTATGGGTAGAACTCCAGAATAG
ATTTTAAAGGCAAATTAAACAGTTTTGGGGTAGTCATAAATGTTTCACTT
AAGTATTTTTGATGTATTTCATCATTTACTGCTTCTTTTAATGGCAAATA
GAGCAAATTTAGCTTATACCTATCTTCGCGTATTAGGTTGATTTTAAAGG
GAAATCATTATTCGTTAGAATTGTATCATTGAGTCATGGTTCTATACTGT
AACGTTCGGCTATGAATTCTAGGAGAATTTAGTTAACTGATGCTTTCCCG
CAATGCCTATAGCCATGGTAACACGTTTGATTTGATTAATCTTAGAAATT
TCTTCTCCATCCCTAGCTACCCAGTCAAATTAAGATTGAAGAGGGTTTGA
CAAACATTATATGCTTAATGATCTATTAGTGATCATTCCTATCTCCCTTA
CTTCATATCGCCATTCCCGAATTTTTAACTTGCTTGCTCAACCGACGTTT
TGATCAGCCGTTAAGAGCTGTGAAAAGGTGCCCTGCTGTTAAAGTCCTAC
GTCTTACGACTAGTCCTCGCCGCCAACAACCGAGTTGTCAAGAGTGCACG
GCCAGCAACCACAACTAACGAAAGCTAACTCGTTAGCCGGATCACCGACC
TACCCTCTTGAAATCTATTACAATACGTAAGTATAAAATATTTATCGGAC
TCTTCATATGAGTTATCGAAAATAAAAACATTGATGAACATCCAAAATTT
AATTAACTTAAAATTTACATTAACATAAAATTACAGAAATGAAAACAAAA
TCACAATCCTTACTTTCAAAATAATCGATCAAAATTTGATTAACTAGTGA
TAGTTATTTAGTAGAGTTATAAAAGTTGAAAATAATGAATTTGGTCACTG
TTTA
back to top

protein sequence of SMED30015600-orf-1

>SMED30015600-orf-1 ID=SMED30015600-orf-1|Name=SMED30015600-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=117bp
MGTIVSDGWSDAQQKPLLNILLVTSSGSTFIESIDTTGNTKDFGYIAQVI
MSSIEKIRPELILQVITDSAANCKAAWQIIAKKFPKIVCGPCSAHCLDLL
LEDWCKLIWISSILKT*
back to top

protein sequence of SMED30015600-orf-2

>SMED30015600-orf-2 ID=SMED30015600-orf-2|Name=SMED30015600-orf-2|organism=Schmidtea mediterranea sexual|type=polypeptide|length=253bp
MNNFGKKCQLYLYINKPVFELLRLVDGDAPVTGKIYFKMFTIQESINNFP
NISQAQRKELYDSFARRWAMMHTTLHAAGFLLDPEYVNMAQHANDEVMTG
FYQLVELLHPDVEEQVIITNQLNKFRSSQGIFTCLVAKAAASTMPAHQWW
HSFGSCVPELQRFAIRVLRQTATSSAAERNWSLFGFFQNKRRSRLNPKTI
EKMVYIHANTRLMDKVEEVDYVEENVKWNEPNDDISETSEDSVQEESDST
DD*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000099neuron
PLANA:0000461lateral branch
Vocabulary: molecular function
TermDefinition
GO:0003676nucleic acid binding
GO:0046983protein dimerization activity
GO:0003677DNA binding
Vocabulary: INTERPRO
TermDefinition
IPR007021DUF659
IPR012337RNaseH-like_sf
IPR008906HATC_C_dom