SMED30015597

Overview
NameSMED30015597
Smed IDSMED30015597
Length (bp)1634
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of SMED30015597 (SMED30015597) t-SNE clustered cells

Violin plots show distribution of expression levels for SMED30015597 (SMED30015597) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of SMED30015597 (SMED30015597) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for SMED30015597 (SMED30015597) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30015597

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 2

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
X1 cellSMED30015597SMESG000064553.1 SmedASXL_015164SmedAsxl_ww_GCZZ01PMID:26114597
Zhu et al., 2015
FACS sorted cell population asexual adult RNA-sequencing evidence
zeta neoblastSMED30015597SMESG000064553.1 dd_Smed_v4_13402_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Alignments
SMED30015597 aligns in the following genomic locations:
Alignment LocationAlignment Score
v31.000202:187946..198291 +8019
Homology
BLAST of SMED30015597 vs. Ensembl Celegans
Match: dcp-66 (Deacetylase Complex Protein [Source:UniProtKB/TrEMBL;Acc:G5ED89])

HSP 1 Score: 51.6026 bits (122), Expect = 1.275e-6
Identity = 35/132 (26.52%), Postives = 61/132 (46.21%), Query Frame = 3
Query:  552 SQLEKTLYEIPIKRQQVQYTNEFIPNTSNPEFIALVGFSQVI-DVLKEQQNENPESTDESSFVDTIDVCHNCQSEASSVWKKRKISNDIEETICSTCNNEINQSQNQKDLEEQIKKIKMQFDEQEKNLIRDY 944
            +Q +K L  IP ++ Q  +   F+PN +   F+AL G   V+  VLK++ NE P       +      C  C++E +  WK    + D     C  C     + +N+ D    +K+   +   QEK L++++
Sbjct:  383 AQADKQLTTIPTQKSQP-HDITFLPNPNASAFLALHGLDLVVQHVLKDRSNETP-------YAGPSYECEECKTECAHTWKAIGSTQDDLHLYCENCVRSAQKRKNRTDQTALLKRAFQKITAQEK-LLQEF 505          
BLAST of SMED30015597 vs. Ensembl Celegans
Match: dcp-66 (Deacetylase Complex Protein [Source:UniProtKB/TrEMBL;Acc:G5ED89])

HSP 1 Score: 51.6026 bits (122), Expect = 1.275e-6
Identity = 35/132 (26.52%), Postives = 61/132 (46.21%), Query Frame = 3
Query:  552 SQLEKTLYEIPIKRQQVQYTNEFIPNTSNPEFIALVGFSQVI-DVLKEQQNENPESTDESSFVDTIDVCHNCQSEASSVWKKRKISNDIEETICSTCNNEINQSQNQKDLEEQIKKIKMQFDEQEKNLIRDY 944
            +Q +K L  IP ++ Q  +   F+PN +   F+AL G   V+  VLK++ NE P       +      C  C++E +  WK    + D     C  C     + +N+ D    +K+   +   QEK L++++
Sbjct:  383 AQADKQLTTIPTQKSQP-HDITFLPNPNASAFLALHGLDLVVQHVLKDRSNETP-------YAGPSYECEECKTECAHTWKAIGSTQDDLHLYCENCVRSAQKRKNRTDQTALLKRAFQKITAQEK-LLQEF 505          
BLAST of SMED30015597 vs. Ensembl Celegans
Match: dcp-66 (Deacetylase Complex Protein [Source:UniProtKB/TrEMBL;Acc:G5ED89])

HSP 1 Score: 51.2174 bits (121), Expect = 1.580e-6
Identity = 37/132 (28.03%), Postives = 59/132 (44.70%), Query Frame = 3
Query:  552 SQLEKTLYEIPIKRQQVQYTNEFIPNTSNPEFIALVGFSQVI-DVLKEQQNENPESTDESSFVDTIDVCHNCQSEASSVWKKRKISNDIEETICSTCNNEINQSQNQKD----LEEQIKKIKMQFDEQEKNL 932
            +Q +K L  IP ++ Q  +   F+PN +   F+AL G   V+  VLK++ NE P       +      C  C++E +  WK    + D     C  C     + +N+ D    L+   +KI  Q  E EK +
Sbjct:  383 AQADKQLTTIPTQKSQP-HDITFLPNPNASAFLALHGLDLVVQHVLKDRSNETP-------YAGPSYECEECKTECAHTWKAIGSTQDDLHLYCENCVRSAQKRKNRTDQTALLKRAFQKITAQEKEFEKKI 506          
BLAST of SMED30015597 vs. Ensembl Fly
Match: simj (gene:FBgn0010762 transcript:FBtr0076263)

HSP 1 Score: 49.2914 bits (116), Expect = 8.384e-6
Identity = 31/98 (31.63%), Postives = 44/98 (44.90%), Query Frame = 3
Query:  546 INSQLEKTLYEIPIKRQQVQYTNEFIPNTSNPEFIALVGFSQVIDVLKEQQNENPESTDESSFVDTIDVCHNCQSEASSVWKKRKISNDIEETICSTC 839
            +  QLEKTL +I    +       FIPN SN +F+ L+G   V+D L   +  N         V     C  C+ + + VWK  K +N   + IC  C
Sbjct:  434 LRKQLEKTLLQI-PPPKPPPPEMHFIPNPSNTDFVYLLGLETVVDYLTVNKKAN--------AVAAPFRCAQCKIDFTPVWKWEKQTNKDPKVICEQC 522          
BLAST of SMED30015597 vs. Ensembl Fly
Match: simj (gene:FBgn0010762 transcript:FBtr0076262)

HSP 1 Score: 49.2914 bits (116), Expect = 8.384e-6
Identity = 31/98 (31.63%), Postives = 44/98 (44.90%), Query Frame = 3
Query:  546 INSQLEKTLYEIPIKRQQVQYTNEFIPNTSNPEFIALVGFSQVIDVLKEQQNENPESTDESSFVDTIDVCHNCQSEASSVWKKRKISNDIEETICSTC 839
            +  QLEKTL +I    +       FIPN SN +F+ L+G   V+D L   +  N         V     C  C+ + + VWK  K +N   + IC  C
Sbjct:  434 LRKQLEKTLLQI-PPPKPPPPEMHFIPNPSNTDFVYLLGLETVVDYLTVNKKAN--------AVAAPFRCAQCKIDFTPVWKWEKQTNKDPKVICEQC 522          
BLAST of SMED30015597 vs. Ensembl Fly
Match: simj (gene:FBgn0010762 transcript:FBtr0076264)

HSP 1 Score: 49.2914 bits (116), Expect = 8.894e-6
Identity = 31/95 (32.63%), Postives = 43/95 (45.26%), Query Frame = 3
Query:  555 QLEKTLYEIPIKRQQVQYTNEFIPNTSNPEFIALVGFSQVIDVLKEQQNENPESTDESSFVDTIDVCHNCQSEASSVWKKRKISNDIEETICSTC 839
            QLEKTL +I    +       FIPN SN +F+ L+G   V+D L   +  N         V     C  C+ + + VWK  K +N   + IC  C
Sbjct:  437 QLEKTLLQI-PPPKPPPPEMHFIPNPSNTDFVYLLGLETVVDYLTVNKKAN--------AVAAPFRCAQCKIDFTPVWKWEKQTNKDPKVICEQC 522          
BLAST of SMED30015597 vs. Ensembl Fly
Match: simj (gene:FBgn0010762 transcript:FBtr0331573)

HSP 1 Score: 49.2914 bits (116), Expect = 9.156e-6
Identity = 31/95 (32.63%), Postives = 43/95 (45.26%), Query Frame = 3
Query:  555 QLEKTLYEIPIKRQQVQYTNEFIPNTSNPEFIALVGFSQVIDVLKEQQNENPESTDESSFVDTIDVCHNCQSEASSVWKKRKISNDIEETICSTC 839
            QLEKTL +I    +       FIPN SN +F+ L+G   V+D L   +  N         V     C  C+ + + VWK  K +N   + IC  C
Sbjct:  445 QLEKTLLQI-PPPKPPPPEMHFIPNPSNTDFVYLLGLETVVDYLTVNKKAN--------AVAAPFRCAQCKIDFTPVWKWEKQTNKDPKVICEQC 530          
BLAST of SMED30015597 vs. Ensembl Fly
Match: simj (gene:FBgn0010762 transcript:FBtr0331574)

HSP 1 Score: 49.2914 bits (116), Expect = 9.426e-6
Identity = 31/98 (31.63%), Postives = 44/98 (44.90%), Query Frame = 3
Query:  546 INSQLEKTLYEIPIKRQQVQYTNEFIPNTSNPEFIALVGFSQVIDVLKEQQNENPESTDESSFVDTIDVCHNCQSEASSVWKKRKISNDIEETICSTC 839
            +  QLEKTL +I    +       FIPN SN +F+ L+G   V+D L   +  N         V     C  C+ + + VWK  K +N   + IC  C
Sbjct:  434 LRKQLEKTLLQI-PPPKPPPPEMHFIPNPSNTDFVYLLGLETVVDYLTVNKKAN--------AVAAPFRCAQCKIDFTPVWKWEKQTNKDPKVICEQC 522          
BLAST of SMED30015597 vs. Ensembl Zebrafish
Match: gatad2ab (GATA zinc finger domain containing 2Ab [Source:ZFIN;Acc:ZDB-GENE-040426-2372])

HSP 1 Score: 50.0618 bits (118), Expect = 6.312e-6
Identity = 39/128 (30.47%), Postives = 63/128 (49.22%), Query Frame = 3
Query:  546 INSQLEKTLYEIPIKRQQVQYTNEFIPNTSNPEFIALVGFSQVI----DVLKEQQNENPESTDESSFVDTIDVCHNCQSEASSVWKKRKISNDIEETICSTCNNEINQSQNQKDL--EEQIKKIKMQF 911
            +  QLEKTL EIP  +      N F+P+ +N EFI LVG   V+    D L + +++  +S   ++  +    C  CQ++ +S W++ K +  I   +C  C      S NQK +   E   ++K  F
Sbjct:  328 LRKQLEKTLLEIPPPKPPAPELN-FLPSAANNEFIYLVGLEMVVQNLLDTLAKSKHQQSDSASNTAPKEPF-TCAQCQTDFTSRWRQEKNNGSI---LCEHC-----MSSNQKKVLKAEHTSRLKAAF 445          
BLAST of SMED30015597 vs. Ensembl Zebrafish
Match: gatad2ab (GATA zinc finger domain containing 2Ab [Source:ZFIN;Acc:ZDB-GENE-040426-2372])

HSP 1 Score: 50.0618 bits (118), Expect = 6.312e-6
Identity = 39/128 (30.47%), Postives = 63/128 (49.22%), Query Frame = 3
Query:  546 INSQLEKTLYEIPIKRQQVQYTNEFIPNTSNPEFIALVGFSQVI----DVLKEQQNENPESTDESSFVDTIDVCHNCQSEASSVWKKRKISNDIEETICSTCNNEINQSQNQKDL--EEQIKKIKMQF 911
            +  QLEKTL EIP  +      N F+P+ +N EFI LVG   V+    D L + +++  +S   ++  +    C  CQ++ +S W++ K +  I   +C  C      S NQK +   E   ++K  F
Sbjct:  328 LRKQLEKTLLEIPPPKPPAPELN-FLPSAANNEFIYLVGLEMVVQNLLDTLAKSKHQQSDSASNTAPKEPF-TCAQCQTDFTSRWRQEKNNGSI---LCEHC-----MSSNQKKVLKAEHTSRLKAAF 445          
BLAST of SMED30015597 vs. Ensembl Zebrafish
Match: gatad2ab (GATA zinc finger domain containing 2Ab [Source:ZFIN;Acc:ZDB-GENE-040426-2372])

HSP 1 Score: 50.0618 bits (118), Expect = 6.563e-6
Identity = 39/128 (30.47%), Postives = 63/128 (49.22%), Query Frame = 3
Query:  546 INSQLEKTLYEIPIKRQQVQYTNEFIPNTSNPEFIALVGFSQVI----DVLKEQQNENPESTDESSFVDTIDVCHNCQSEASSVWKKRKISNDIEETICSTCNNEINQSQNQKDL--EEQIKKIKMQF 911
            +  QLEKTL EIP  +      N F+P+ +N EFI LVG   V+    D L + +++  +S   ++  +    C  CQ++ +S W++ K +  I   +C  C      S NQK +   E   ++K  F
Sbjct:  335 LRKQLEKTLLEIPPPKPPAPELN-FLPSAANNEFIYLVGLEMVVQNLLDTLAKSKHQQSDSASNTAPKEPF-TCAQCQTDFTSRWRQEKNNGSI---LCEHC-----MSSNQKKVLKAEHTSRLKAAF 452          
BLAST of SMED30015597 vs. Ensembl Zebrafish
Match: gatad2ab (GATA zinc finger domain containing 2Ab [Source:ZFIN;Acc:ZDB-GENE-040426-2372])

HSP 1 Score: 50.0618 bits (118), Expect = 6.878e-6
Identity = 39/128 (30.47%), Postives = 63/128 (49.22%), Query Frame = 3
Query:  546 INSQLEKTLYEIPIKRQQVQYTNEFIPNTSNPEFIALVGFSQVI----DVLKEQQNENPESTDESSFVDTIDVCHNCQSEASSVWKKRKISNDIEETICSTCNNEINQSQNQKDL--EEQIKKIKMQF 911
            +  QLEKTL EIP  +      N F+P+ +N EFI LVG   V+    D L + +++  +S   ++  +    C  CQ++ +S W++ K +  I   +C  C      S NQK +   E   ++K  F
Sbjct:  370 LRKQLEKTLLEIPPPKPPAPELN-FLPSAANNEFIYLVGLEMVVQNLLDTLAKSKHQQSDSASNTAPKEPF-TCAQCQTDFTSRWRQEKNNGSI---LCEHC-----MSSNQKKVLKAEHTSRLKAAF 487          
BLAST of SMED30015597 vs. TrEMBL
Match: A0A183MMK6 (GATA-type domain-containing protein OS=Schistosoma margrebowiei OX=48269 GN=SMRZ_LOCUS17281 PE=4 SV=1)

HSP 1 Score: 95.5153 bits (236), Expect = 7.192e-17
Identity = 86/322 (26.71%), Postives = 150/322 (46.58%), Query Frame = 3
Query:  159 DVLDLSKKSFLDNFSPDVKIIIKDYNNDVLIINDIQELEKIEA--------------KINNELQVEESISTLLLAMKSSQTKSFLNP--------------VKPT-----INSRPQLDLVHDSKSKQKSEVAPEGSKSDEFFLTLEMSRKLLDHQFITRQKMINSQLEKTLYEIPIKRQQVQ---YTNEFIPNTSNPEFIALVGFSQVIDVLKEQQNENPESTDESS----FVDTIDVCHNCQSEASSVWKKRKISNDIEETICSTCNNEINQSQNQKDLEEQIKKIKMQFDEQEKNLIRDYNDMLSSPKKLEMFRQEQEKR 1004
            DVLDLS+KS   N + D  I++ +  +D L+ +   E+EK  A              K+ NEL+ EES   LL  ++++Q    L P              ++P      I S P       + S+  + V P  + +    +T  M+   L+ Q   ++ M+  QLE+TL ++ + +  V        F+P+T   EF A++G  +++  +   Q+ +P STD+SS    FV+    C  C ++ + VWK+++  +   E +C  C  +  +S   K     I     Q    E+ +  +Y D+++SP KLE F +E E++
Sbjct:   23 DVLDLSRKS---NHNDDDVIMLSEDEDDRLLGSLCDEMEKENAPKQSLLSKSRAFLLKLENELRNEESALVLLQQLRANQRSHALQPKSTKVSSSVTNTVRIRPAVSQAVIRSVPSTTGGRATLSQNTAAVTPTNATAITK-VTKGMAIHALEQQCSGKKAMLRKQLERTLDKVVLPKPAVGNGLSVVPFVPSTLTNEFTAMIGLEEIVTTI---QDFDPLSTDKSSEQSRFVNPFS-CSRCGTDFTPVWKRKRPGSS--EVVCEACIVDSQRSVIHKAYNSVISAALKQHAASEREIEHEYQDVVNSPAKLEAFIKEHERK 334          
BLAST of SMED30015597 vs. TrEMBL
Match: A0A0X3Q2U7 (GATA-type domain-containing protein OS=Schistocephalus solidus OX=70667 GN=TR148600 PE=4 SV=1)

HSP 1 Score: 92.0485 bits (227), Expect = 8.768e-16
Identity = 87/340 (25.59%), Postives = 145/340 (42.65%), Query Frame = 3
Query:  159 DVLDLSKKSFLDNFSPDVKIIIKDYNN---DVLII-----------------NDIQELEKIEAKI-----NNELQVEESISTLLLAMKSSQTKSFLNPVKPTINSR---------PQLDLVHDSKSKQKSEVA---------------------PEGSKSDEFFLTLEMSRKLLDHQFITRQKMINSQLEKTLYEIPIKRQQVQYT---NEFIPNTSNPEFIALVGFSQVIDVLKEQQNENPESTDESSFVDTIDVCHNCQSEASSVWKKRKISNDIEETICSTCNNEINQSQNQKDLEEQIKKIKMQFDEQEKNLIRDYNDMLSSPKKLEMFRQEQEKR 1004
            DVLDLS+KSF    SP       +YN    DV+++                 N+    + ++ KI      NEL+ EE    LL  ++ SQ  S   P K  + S          PQ ++ H S       VA                     P+ S      +T   + + L+ Q   ++ ++  QLE++L +IP+ R           FIP+T   EF +L+G  +V+  ++E    +  S  E     +   C  C  + + VWK+ K+ +     IC  C     +S  QK+ E  +K++  Q    E+ + R+Y +++++P KLE + +EQEK+
Sbjct:   13 DVLDLSRKSF----SPASPFANGNYNVSNVDVIVLSEDEDKPSPISSDTEKENNPHGKDPVDGKILLIRLENELRQEEYTLMLLQKLRDSQKSSSPQPTKHYVKSSNSVQVPIPNPQGNITHASAVSTGVTVAVQKNVPVSQPSKAITPTQQTVPQNSAHPAPKVTKVAALQSLEQQCNAKKSVLKKQLERSLEKIPLPRPSAGTGLCEIAFIPSTLTSEFTSLLGLEEVVKNMQEFDPSSTGSQPEPRRTFSPFSCVKCGIDFTPVWKREKVGSST--VICEACLAGTQRSSLQKEYENSVKQVLQQNGAAEREIEREYQEIIANPTKLENYIREQEKK 346          
BLAST of SMED30015597 vs. TrEMBL
Match: A0A0X3Q4H7 (GATA-type domain-containing protein OS=Schistocephalus solidus OX=70667 GN=TR148600 PE=4 SV=1)

HSP 1 Score: 89.3521 bits (220), Expect = 2.495e-15
Identity = 87/340 (25.59%), Postives = 145/340 (42.65%), Query Frame = 3
Query:  159 DVLDLSKKSFLDNFSPDVKIIIKDYNN---DVLII-----------------NDIQELEKIEAKI-----NNELQVEESISTLLLAMKSSQTKSFLNPVKPTINSR---------PQLDLVHDSKSKQKSEVA---------------------PEGSKSDEFFLTLEMSRKLLDHQFITRQKMINSQLEKTLYEIPIKRQQVQYT---NEFIPNTSNPEFIALVGFSQVIDVLKEQQNENPESTDESSFVDTIDVCHNCQSEASSVWKKRKISNDIEETICSTCNNEINQSQNQKDLEEQIKKIKMQFDEQEKNLIRDYNDMLSSPKKLEMFRQEQEKR 1004
            DVLDLS+KSF    SP       +YN    DV+++                 N+    + ++ KI      NEL+ EE    LL  ++ SQ  S   P K  + S          PQ ++ H S       VA                     P+ S      +T   + + L+ Q   ++ ++  QLE++L +IP+ R           FIP+T   EF +L+G  +V+  ++E    +  S  E     +   C  C  + + VWK+ K+ +     IC  C     +S  QK+ E  +K++  Q    E+ + R+Y +++++P KLE + +EQEK+
Sbjct:   13 DVLDLSRKSF----SPASPFANGNYNVSNVDVIVLSEDEDKPSPISSDTEKENNPHGKDPVDGKILLIRLENELRQEEYTLMLLQKLRDSQKSSSPQPTKHYVKSSNSVQVPIPNPQGNITHASAVSTGVTVAVQKNVPVSQPSKAITPTQQTVPQNSAHPAPKVTKVAALQSLEQQCNAKKSVLKKQLERSLEKIPLPRPSAGTGLCEIAFIPSTLTSEFTSLLGLEEVVKNMQEFDPSSTGSQPEPRRTFSPFSCVKCGIDFTPVWKREKVGSST--VICEACLAGTQRSSLQKEYENSVKQVLQQNGAAEREIEREYQEIIANPTKLENYIREQEKK 346          
BLAST of SMED30015597 vs. TrEMBL
Match: A0A0X3P9L0 (GATA-type domain-containing protein (Fragment) OS=Schistocephalus solidus OX=70667 GN=TR148600 PE=4 SV=1)

HSP 1 Score: 88.9669 bits (219), Expect = 3.742e-15
Identity = 87/340 (25.59%), Postives = 145/340 (42.65%), Query Frame = 3
Query:  159 DVLDLSKKSFLDNFSPDVKIIIKDYNN---DVLII-----------------NDIQELEKIEAKI-----NNELQVEESISTLLLAMKSSQTKSFLNPVKPTINSR---------PQLDLVHDSKSKQKSEVA---------------------PEGSKSDEFFLTLEMSRKLLDHQFITRQKMINSQLEKTLYEIPIKRQQVQYT---NEFIPNTSNPEFIALVGFSQVIDVLKEQQNENPESTDESSFVDTIDVCHNCQSEASSVWKKRKISNDIEETICSTCNNEINQSQNQKDLEEQIKKIKMQFDEQEKNLIRDYNDMLSSPKKLEMFRQEQEKR 1004
            DVLDLS+KSF    SP       +YN    DV+++                 N+    + ++ KI      NEL+ EE    LL  ++ SQ  S   P K  + S          PQ ++ H S       VA                     P+ S      +T   + + L+ Q   ++ ++  QLE++L +IP+ R           FIP+T   EF +L+G  +V+  ++E    +  S  E     +   C  C  + + VWK+ K+ +     IC  C     +S  QK+ E  +K++  Q    E+ + R+Y +++++P KLE + +EQEK+
Sbjct:   57 DVLDLSRKSF----SPASPFANGNYNVSNVDVIVLSEDEDKPSPISSDTEKENNPHGKDPVDGKILLIRLENELRQEEYTLMLLQKLRDSQKSSSPQPTKHYVKSSNSVQVPIPNPQGNITHASAVSTGVTVAVQKNVPVSQPSKAITPTQQTVPQNSAHPAPKVTKVAALQSLEQQCNAKKSVLKKQLERSLEKIPLPRPSAGTGLCEIAFIPSTLTSEFTSLLGLEEVVKNMQEFDPSSTGSQPEPRRTFSPFSCVKCGIDFTPVWKREKVGSST--VICEACLAGTQRSSLQKEYENSVKQVLQQNGAAEREIEREYQEIIANPTKLENYIREQEKK 390          
BLAST of SMED30015597 vs. TrEMBL
Match: A0A183JYP2 (Uncharacterized protein OS=Schistosoma curassoni OX=6186 GN=SCUD_LOCUS7848 PE=4 SV=1)

HSP 1 Score: 89.7373 bits (221), Expect = 6.236e-15
Identity = 85/310 (27.42%), Postives = 150/310 (48.39%), Query Frame = 3
Query:  159 DVLDLSKKS-FLDNFSPDVKIIIKDYNNDVLIINDIQELEKIEA--------------KINNELQVEESISTLLLAMKSSQTKSFLNPVKPTINS------RPQLDLVHDSKSKQKSEVAPEGSKSDEFFLTLEMSRKLLDHQFITRQKMINSQLEKTLYEIPIKRQQVQ---YTNEFIPNTSNPEFIALVGFSQVIDVLKEQQNENPESTDESS----FVDTIDVCHNCQSEASSVWKKRKISNDIEETICSTCNNEINQSQNQKDLEEQIKKIKMQFDEQEKNLIRDYNDMLSSPKKLEMFRQEQEKR 1004
            DVLDLS+KS  + N S   K+  +D  +D L+ +   E+EK  A              K+ NEL+ EES   LL  ++++Q    L P    ++S      R     V+ + ++  + V P  + +    +T  M+   L+ Q   ++ M+  QLE+TL ++ + +  V        F+P+T   EF A++G  +++  +   Q+ +P STD+SS    FV+    C  C ++ + VWK+++  +   E +C  C  +  +S   K     I     Q    E+ +  +Y D+++SP KLE F +E E++
Sbjct:  195 DVLDLSRKSNHVTNGSE--KLSSRD-EDDRLLGSLCDEMEKENAPKQSLLSKSRAFLLKLENELRNEESALVLLQQLRANQRSHALQPKSTKVSSSVTNTVRNTQSPVNQAPAQNTTAVNPTNATAITK-VTKGMAIHALEQQCSGKKAMLRKQLERTLDKVVLPKPAVGNGLSVVPFVPSTLTNEFTAMIGLEEIVTTI---QDFDPLSTDKSSEQSRFVNPFS-CSRCGTDFTPVWKRKRPGSS--EVVCEACIVDSQRSVIHKAYSSVISAALKQHAASEREIEHEYQDVVNSPAKLEAFIKEHERK 494          
BLAST of SMED30015597 vs. Ensembl Cavefish
Match: gatad2ab (transcriptional repressor p66-alpha-like [Source:NCBI gene;Acc:111192506])

HSP 1 Score: 50.8322 bits (120), Expect = 2.967e-6
Identity = 40/128 (31.25%), Postives = 61/128 (47.66%), Query Frame = 3
Query:  546 INSQLEKTLYEIPIKRQQVQYTNEFIPNTSNPEFIALVGFSQVI----DVLKEQQNENPESTDESSFVDTIDVCHNCQSEASSVWKKRKISNDIEETICSTCNNEINQSQNQKDL--EEQIKKIKMQF 911
            +  QLEKTL EIP  +      N F+P+ +N EFI LVG   V+    D+ K +Q     ++ +  +      C  CQ++ +S W++ K +N I   +C  C      S NQK     E   ++K  F
Sbjct:  329 LRKQLEKTLLEIPPPKPPAPELN-FLPSAANNEFIYLVGLEMVVQNLLDLAKSKQQAQQGTSAKDPY-----TCAQCQTDFTSRWRQEKGNNTI---LCEQC-----MSSNQKKALKAEHTNRLKAAF 442          
BLAST of SMED30015597 vs. Ensembl Cavefish
Match: gatad2ab (transcriptional repressor p66-alpha-like [Source:NCBI gene;Acc:111192506])

HSP 1 Score: 50.8322 bits (120), Expect = 3.351e-6
Identity = 40/128 (31.25%), Postives = 61/128 (47.66%), Query Frame = 3
Query:  546 INSQLEKTLYEIPIKRQQVQYTNEFIPNTSNPEFIALVGFSQVI----DVLKEQQNENPESTDESSFVDTIDVCHNCQSEASSVWKKRKISNDIEETICSTCNNEINQSQNQKDL--EEQIKKIKMQF 911
            +  QLEKTL EIP  +      N F+P+ +N EFI LVG   V+    D+ K +Q     ++ +  +      C  CQ++ +S W++ K +N I   +C  C      S NQK     E   ++K  F
Sbjct:  344 LRKQLEKTLLEIPPPKPPAPELN-FLPSAANNEFIYLVGLEMVVQNLLDLAKSKQQAQQGTSAKDPY-----TCAQCQTDFTSRWRQEKGNNTI---LCEQC-----MSSNQKKALKAEHTNRLKAAF 457          
BLAST of SMED30015597 vs. Ensembl Cavefish
Match: ENSAMXT00000001845.2 (transcriptional repressor p66-beta [Source:NCBI gene;Acc:103037451])

HSP 1 Score: 50.0618 bits (118), Expect = 5.632e-6
Identity = 44/182 (24.18%), Postives = 84/182 (46.15%), Query Frame = 3
Query:  546 INSQLEKTLYEIPIKRQQVQYTNEFIPNTSNPEFIALVGFSQVIDVLKEQQNENPESTDE-SSFVDTIDVCHNCQSEASSVWKKRKISNDIEETICSTCNNEINQSQNQKDLEEQIKKIKMQFDEQEKNLIRDYNDMLSSPKKLEMFRQEQEKRHRMQRLNINSNKTARPATVNSSQIIVSN 1088
            +  QLEKTL EIP  +      + F+P+ +N EFI L+G  +V+  + + Q +   +  +   F      C  C+++ +  WK+ K        +C TC      + NQK      K +K +   + KN              ++  +QEQE   R+Q+  ++++ T   A+V+ ++ ++ +
Sbjct:  376 LRKQLEKTLLEIPPPKPPAPLLH-FLPSAANSEFIYLLGLEEVVQCVLDSQGKLRGALGQLEPF-----ACAQCKTDFTPHWKQEKGGR----ILCETC-----MTSNQK------KALKAEHTNRLKNAF------------VKALQQEQEIEQRLQQAALSTSPTVSAASVSKAESMIRH 524          
BLAST of SMED30015597 vs. Ensembl Sea Lamprey
Match: gatad2ab (GATA zinc finger domain containing 2Ab [Source:ZFIN;Acc:ZDB-GENE-040426-2372])

HSP 1 Score: 51.6026 bits (122), Expect = 3.395e-7
Identity = 36/123 (29.27%), Postives = 58/123 (47.15%), Query Frame = 3
Query:  546 INSQLEKTLYEIPIKRQQVQYTNEFIPNTSNPEFIALVGFSQVIDVLKEQQNE-NPESTDESSFVDTIDVCHNCQSEASSVWKKRKISNDIEETICSTCNNEINQSQNQKDLEEQIKKIKMQF 911
            +  QLEKTL EIP  +      N F+P+ +N EF+ L+G  +V+  L E Q +  P+      F      C  CQ++ ++ W+  K        IC  C   ++ +Q +    E   ++KM F
Sbjct:  245 LRKQLEKTLLEIPPPKPPPPELN-FLPSAANSEFVYLIGLEEVVQSLLETQGKAAPQPMGREPF-----KCLQCQTDFTARWRHEKGGT----VICEQC---LSSNQKKALKAEHTNRLKMAF 354          
BLAST of SMED30015597 vs. Ensembl Medaka
Match: gatad2ab (transcriptional repressor p66-alpha [Source:NCBI gene;Acc:101167110])

HSP 1 Score: 51.2174 bits (121), Expect = 2.136e-6
Identity = 39/127 (30.71%), Postives = 59/127 (46.46%), Query Frame = 3
Query:  546 INSQLEKTLYEIPIKRQQVQYTNEFIPNTSNPEFIALVGFSQVIDVLKE---QQNENPESTDESSFVDTIDVCHNCQSEASSVWKKRKISNDIEETICSTCNNEINQSQNQKDL--EEQIKKIKMQF 911
            +  QLEKTL EIP  +      N F+P+ +N EFI L+G  +V+  L E   + N  P +   +S       C  C+++ +S W+K K        +C  C      S NQK +   E   ++K  F
Sbjct:  346 LRKQLEKTLLEIPPPKPPAPEFN-FLPSAANNEFIYLLGLEEVVQKLLEMHGRGNLGPATAMANSISKEPHTCAQCKTDFTSRWRKEKAGT----ILCDQC-----MSSNQKKVLKAEHTSRLKSAF 462          
BLAST of SMED30015597 vs. Planmine SMEST
Match: SMESG000064553.1 (SMESG000064553.1)

HSP 1 Score: 811.987 bits (2096), Expect = 0.000e+0
Identity = 481/481 (100.00%), Postives = 481/481 (100.00%), Query Frame = 3
Query:  126 MSTSEKPSILSDVLDLSKKSFLDNFSPDVKIIIKDYNNDVLIINDIQELEKIEAKINNELQVEESISTLLLAMKSSQTKSFLNPVKPTINSRPQLDLVHDSKSKQKSEVAPEGSKSDEFFLTLEMSRKLLDHQFITRQKMINSQLEKTLYEIPIKRQQVQYTNEFIPNTSNPEFIALVGFSQVIDVLKEQQNENPESTDESSFVDTIDVCHNCQSEASSVWKKRKISNDIEETICSTCNNEINQSQNQKDLEEQIKKIKMQFDEQEKNLIRDYNDMLSSPKKLEMFRQEQEKRHRMQRLNINSNKTARPATVNSSQIIVSNAXXXXXXXXXXXXXXXXXXXXXXXXXVPNSSNKILHQLKDSSNNKSLLVNTPSNVLSNIDPSQSQITYLQFLQAFATQATNSQQTIDQENLKKLEQILSAIQSNPILANNNMSVLQLIXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXHTHLMNLLSYFV 1568
            MSTSEKPSILSDVLDLSKKSFLDNFSPDVKIIIKDYNNDVLIINDIQELEKIEAKINNELQVEESISTLLLAMKSSQTKSFLNPVKPTINSRPQLDLVHDSKSKQKSEVAPEGSKSDEFFLTLEMSRKLLDHQFITRQKMINSQLEKTLYEIPIKRQQVQYTNEFIPNTSNPEFIALVGFSQVIDVLKEQQNENPESTDESSFVDTIDVCHNCQSEASSVWKKRKISNDIEETICSTCNNEINQSQNQKDLEEQIKKIKMQFDEQEKNLIRDYNDMLSSPKKLEMFRQEQEKRHRMQRLNINSNKTARPATVNSSQIIVSNANKPNIPLSNKSNNNHNNSNICPSSSVPNSSNKILHQLKDSSNNKSLLVNTPSNVLSNIDPSQSQITYLQFLQAFATQATNSQQTIDQENLKKLEQILSAIQSNPILANNNMSVLQLIANLSNQQDTNNNNNNNSISPNANPAAVNASHTHLMNLLSYFV
Sbjct:    1 MSTSEKPSILSDVLDLSKKSFLDNFSPDVKIIIKDYNNDVLIINDIQELEKIEAKINNELQVEESISTLLLAMKSSQTKSFLNPVKPTINSRPQLDLVHDSKSKQKSEVAPEGSKSDEFFLTLEMSRKLLDHQFITRQKMINSQLEKTLYEIPIKRQQVQYTNEFIPNTSNPEFIALVGFSQVIDVLKEQQNENPESTDESSFVDTIDVCHNCQSEASSVWKKRKISNDIEETICSTCNNEINQSQNQKDLEEQIKKIKMQFDEQEKNLIRDYNDMLSSPKKLEMFRQEQEKRHRMQRLNINSNKTARPATVNSSQIIVSNANKPNIPLSNKSNNNHNNSNICPSSSVPNSSNKILHQLKDSSNNKSLLVNTPSNVLSNIDPSQSQITYLQFLQAFATQATNSQQTIDQENLKKLEQILSAIQSNPILANNNMSVLQLIANLSNQQDTNNNNNNNSISPNANPAAVNASHTHLMNLLSYFV 481          
BLAST of SMED30015597 vs. Planmine SMEST
Match: SMESG000064553.1 (SMESG000064553.1)

HSP 1 Score: 808.135 bits (2086), Expect = 0.000e+0
Identity = 481/482 (99.79%), Postives = 481/482 (99.79%), Query Frame = 3
Query:  126 MSTSEKPSILSDVLDLSKKSFLDNFSPDVKIIIKDYNNDVLIINDIQELEKIEAKINNELQVEESISTLLLAMKSSQTKSFLNPVKPTINSRPQLDLVHDSKSKQKSEVAPEGSKSDEFFLTLEMSRKLLDHQFITRQKMINSQLEKTLYEIPIKRQQVQYTNEFIPNTSNPEFIALVGFSQVIDVLK-EQQNENPESTDESSFVDTIDVCHNCQSEASSVWKKRKISNDIEETICSTCNNEINQSQNQKDLEEQIKKIKMQFDEQEKNLIRDYNDMLSSPKKLEMFRQEQEKRHRMQRLNINSNKTARPATVNSSQIIVSNAXXXXXXXXXXXXXXXXXXXXXXXXXVPNSSNKILHQLKDSSNNKSLLVNTPSNVLSNIDPSQSQITYLQFLQAFATQATNSQQTIDQENLKKLEQILSAIQSNPILANNNMSVLQLIXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXHTHLMNLLSYFV 1568
            MSTSEKPSILSDVLDLSKKSFLDNFSPDVKIIIKDYNNDVLIINDIQELEKIEAKINNELQVEESISTLLLAMKSSQTKSFLNPVKPTINSRPQLDLVHDSKSKQKSEVAPEGSKSDEFFLTLEMSRKLLDHQFITRQKMINSQLEKTLYEIPIKRQQVQYTNEFIPNTSNPEFIALVGFSQVIDVLK EQQNENPESTDESSFVDTIDVCHNCQSEASSVWKKRKISNDIEETICSTCNNEINQSQNQKDLEEQIKKIKMQFDEQEKNLIRDYNDMLSSPKKLEMFRQEQEKRHRMQRLNINSNKTARPATVNSSQIIVSNANKPNIPLSNKSNNNHNNSNICPSSSVPNSSNKILHQLKDSSNNKSLLVNTPSNVLSNIDPSQSQITYLQFLQAFATQATNSQQTIDQENLKKLEQILSAIQSNPILANNNMSVLQLIANLSNQQDTNNNNNNNSISPNANPAAVNASHTHLMNLLSYFV
Sbjct:    1 MSTSEKPSILSDVLDLSKKSFLDNFSPDVKIIIKDYNNDVLIINDIQELEKIEAKINNELQVEESISTLLLAMKSSQTKSFLNPVKPTINSRPQLDLVHDSKSKQKSEVAPEGSKSDEFFLTLEMSRKLLDHQFITRQKMINSQLEKTLYEIPIKRQQVQYTNEFIPNTSNPEFIALVGFSQVIDVLKQEQQNENPESTDESSFVDTIDVCHNCQSEASSVWKKRKISNDIEETICSTCNNEINQSQNQKDLEEQIKKIKMQFDEQEKNLIRDYNDMLSSPKKLEMFRQEQEKRHRMQRLNINSNKTARPATVNSSQIIVSNANKPNIPLSNKSNNNHNNSNICPSSSVPNSSNKILHQLKDSSNNKSLLVNTPSNVLSNIDPSQSQITYLQFLQAFATQATNSQQTIDQENLKKLEQILSAIQSNPILANNNMSVLQLIANLSNQQDTNNNNNNNSISPNANPAAVNASHTHLMNLLSYFV 482          
BLAST of SMED30015597 vs. Planmine SMEST
Match: SMESG000077622.1 (SMESG000077622.1)

HSP 1 Score: 117.857 bits (294), Expect = 7.796e-28
Identity = 63/185 (34.05%), Postives = 108/185 (58.38%), Query Frame = 3
Query:  465 SKSDEFFLTLEMSRKLLDHQFITRQKMINSQLEKTLYEIPIKR----QQVQYTNEFIPNTSNPEFIALVGFSQVIDVLKEQQN-ENPESTDESSFVDTIDVCHNCQSEASSVWKKRKISNDIEETICSTCNNEINQSQNQKDLEEQIKKIKMQFDEQEKNLIRDYNDMLSSPKKLEMFRQEQEKR 1004
            S S+   +T EM+ + LD Q++ R+ ++  Q +K L E+P+ R       Q     IP+T+  EF+ALVG  +V+  L+E +N     +T+E   V T   C  C ++ + +WK+ +  +   + +C +C  E  +   Q D +++I+ +  ++ +QE++L RDY DML SPKK E+FR+EQEK+
Sbjct:  188 SSSNGPRMTREMAMQALDQQYLARKALLRKQADKALSEVPLARPPQGAMAQSDLNLIPSTATNEFVALVGLEEVVKNLQEYRNLALGHNTNEVRMVFTPFNCVQCGTDFTPLWKRERPGS--SKVVCESCCGENYRRALQNDYQDKIRLVLKKYQDQERDLDRDYKDMLDSPKKFELFRKEQEKK 370          
The following BLAST results are available for this feature:
BLAST of SMED30015597 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30015597 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 3
Match NameE-valueIdentityDescription
dcp-661.275e-626.52Deacetylase Complex Protein [Source:UniProtKB/TrE... [more]
dcp-661.275e-626.52Deacetylase Complex Protein [Source:UniProtKB/TrE... [more]
dcp-661.580e-628.03Deacetylase Complex Protein [Source:UniProtKB/TrE... [more]
back to top
BLAST of SMED30015597 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
simj8.384e-631.63gene:FBgn0010762 transcript:FBtr0076263[more]
simj8.384e-631.63gene:FBgn0010762 transcript:FBtr0076262[more]
simj8.894e-632.63gene:FBgn0010762 transcript:FBtr0076264[more]
simj9.156e-632.63gene:FBgn0010762 transcript:FBtr0331573[more]
simj9.426e-631.63gene:FBgn0010762 transcript:FBtr0331574[more]
back to top
BLAST of SMED30015597 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 4
Match NameE-valueIdentityDescription
gatad2ab6.312e-630.47GATA zinc finger domain containing 2Ab [Source:ZFI... [more]
gatad2ab6.312e-630.47GATA zinc finger domain containing 2Ab [Source:ZFI... [more]
gatad2ab6.563e-630.47GATA zinc finger domain containing 2Ab [Source:ZFI... [more]
gatad2ab6.878e-630.47GATA zinc finger domain containing 2Ab [Source:ZFI... [more]
back to top
BLAST of SMED30015597 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30015597 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30015597 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30015597 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A183MMK67.192e-1726.71GATA-type domain-containing protein OS=Schistosoma... [more]
A0A0X3Q2U78.768e-1625.59GATA-type domain-containing protein OS=Schistoceph... [more]
A0A0X3Q4H72.495e-1525.59GATA-type domain-containing protein OS=Schistoceph... [more]
A0A0X3P9L03.742e-1525.59GATA-type domain-containing protein (Fragment) OS=... [more]
A0A183JYP26.236e-1527.42Uncharacterized protein OS=Schistosoma curassoni O... [more]
back to top
BLAST of SMED30015597 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 3
Match NameE-valueIdentityDescription
gatad2ab2.967e-631.25transcriptional repressor p66-alpha-like [Source:N... [more]
gatad2ab3.351e-631.25transcriptional repressor p66-alpha-like [Source:N... [more]
ENSAMXT00000001845.25.632e-624.18transcriptional repressor p66-beta [Source:NCBI ge... [more]
back to top
BLAST of SMED30015597 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 1
Match NameE-valueIdentityDescription
gatad2ab3.395e-729.27GATA zinc finger domain containing 2Ab [Source:ZFI... [more]
back to top
BLAST of SMED30015597 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30015597 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30015597 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 1
Match NameE-valueIdentityDescription
gatad2ab2.136e-630.71transcriptional repressor p66-alpha [Source:NCBI g... [more]
back to top
BLAST of SMED30015597 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 3
Match NameE-valueIdentityDescription
SMESG000064553.10.000e+0100.00SMESG000064553.1[more]
SMESG000064553.10.000e+099.79SMESG000064553.1[more]
SMESG000077622.17.796e-2834.05SMESG000077622.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30015597 ID=SMED30015597|Name=SMED30015597|organism=Schmidtea mediterranea sexual|type=transcript|length=1634bp
GCATAATAATTAAAATATTTTTCGAGATATTTATTTGATAAGACGTTTTT
TATAATTTTCGATTTGTAAAATTAGGCACAATCATAATTTTGAAAGTTAT
TTATTATCAAATTATAGAAATTTAAATGAGCACTAGTGAAAAGCCTTCCA
TATTATCTGATGTATTAGATTTAAGTAAGAAATCTTTCTTAGATAATTTT
AGTCCAGATGTAAAGATTATAATAAAAGATTACAACAATGATGTATTGAT
AATTAATGATATCCAAGAATTAGAAAAAATTGAAGCTAAGATTAATAATG
AACTTCAAGTTGAAGAATCAATTTCAACTTTATTACTTGCTATGAAGTCA
TCGCAAACAAAATCTTTTTTGAATCCCGTAAAACCTACAATAAATAGTCG
ACCTCAATTGGATTTAGTGCATGACAGTAAATCAAAACAAAAATCCGAGG
TAGCGCCTGAAGGATCAAAATCAGATGAGTTTTTTTTGACATTGGAAATG
TCTCGGAAACTTTTGGATCACCAATTCATAACCAGGCAAAAGATGATCAA
TAGTCAACTGGAAAAAACATTGTATGAAATTCCAATTAAACGTCAACAAG
TTCAGTATACAAACGAATTCATCCCAAACACGTCAAATCCAGAATTTATA
GCTTTAGTCGGTTTCAGTCAAGTAATTGACGTACTCAAGGAACAACAGAA
CGAAAATCCAGAATCGACAGATGAAAGTAGTTTTGTTGATACCATCGATG
TTTGTCATAATTGCCAGTCCGAAGCCAGTTCTGTGTGGAAAAAACGTAAA
ATATCAAATGATATTGAAGAAACTATATGTTCTACGTGTAATAATGAAAT
TAATCAATCTCAAAATCAGAAAGATCTAGAAGAACAAATTAAAAAAATAA
AAATGCAATTTGATGAACAAGAAAAGAATCTTATTCGTGATTACAATGAC
ATGTTATCAAGTCCTAAGAAGCTGGAAATGTTTCGCCAAGAACAAGAAAA
ACGCCATAGAATGCAAAGATTAAATATCAATTCTAACAAAACTGCTCGTC
CAGCGACAGTTAATTCATCTCAAATTATAGTATCCAATGCTAATAAACCT
AATATTCCGCTATCTAACAAGTCGAATAACAATCACAATAATAGTAATAT
TTGCCCATCAAGCAGCGTTCCGAATTCATCGAATAAAATCCTCCATCAAT
TGAAAGATTCCAGTAACAATAAATCATTATTGGTTAACACTCCCTCCAAT
GTACTCAGCAACATAGATCCATCACAATCTCAGATAACATATCTACAATT
TCTCCAAGCGTTTGCTACTCAAGCTACAAATTCACAACAAACGATAGATC
AAGAAAATTTAAAAAAATTGGAACAAATTCTTTCTGCAATCCAATCTAAT
CCAATACTTGCCAACAATAATATGAGCGTGTTACAATTAATTGCCAATTT
ATCCAACCAACAAGACACCAACAATAATAATAATAACAATAGTATTAGTC
CCAATGCAAATCCTGCAGCTGTTAACGCTTCCCATACGCATTTGATGAAT
CTTTTGTCATATTTCGTGAATCTGATGCAAACTCAGCAAAATCAGAATAA
CACTCTCTGATTGGATTGGTGGACATGTTAAAAT
back to top

protein sequence of SMED30015597-orf-1

>SMED30015597-orf-1 ID=SMED30015597-orf-1|Name=SMED30015597-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=495bp
MSTSEKPSILSDVLDLSKKSFLDNFSPDVKIIIKDYNNDVLIINDIQELE
KIEAKINNELQVEESISTLLLAMKSSQTKSFLNPVKPTINSRPQLDLVHD
SKSKQKSEVAPEGSKSDEFFLTLEMSRKLLDHQFITRQKMINSQLEKTLY
EIPIKRQQVQYTNEFIPNTSNPEFIALVGFSQVIDVLKEQQNENPESTDE
SSFVDTIDVCHNCQSEASSVWKKRKISNDIEETICSTCNNEINQSQNQKD
LEEQIKKIKMQFDEQEKNLIRDYNDMLSSPKKLEMFRQEQEKRHRMQRLN
INSNKTARPATVNSSQIIVSNANKPNIPLSNKSNNNHNNSNICPSSSVPN
SSNKILHQLKDSSNNKSLLVNTPSNVLSNIDPSQSQITYLQFLQAFATQA
TNSQQTIDQENLKKLEQILSAIQSNPILANNNMSVLQLIANLSNQQDTNN
NNNNNSISPNANPAAVNASHTHLMNLLSYFVNLMQTQQNQNNTL*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000014zeta neoblast
PLANA:0002109X1 cell
Vocabulary: INTERPRO
TermDefinition
IPR040386P66
Vocabulary: biological process
TermDefinition
GO:0000122negative regulation of transcription from RNA polymerase II promoter
GO:0006355regulation of transcription, DNA-templated
Vocabulary: molecular function
TermDefinition
GO:0003676nucleic acid binding
GO:0003700transcription factor activity, sequence-specific DNA binding
GO:0008270zinc ion binding
GO:0043565sequence-specific DNA binding
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
NoneNo IPR availableCOILSCoilCoilcoord: 248..268
NoneNo IPR availableCOILSCoilCoilcoord: 46..66
NoneNo IPR availablePANTHERPTHR13455:SF7SIMJANG, ISOFORM Ecoord: 144..482
IPR040386Transcriptional repressor p66PANTHERPTHR13455TRANSCRIPTIONAL REPRESSOR P66-RELATEDcoord: 144..482