Octopamine receptor

Overview
NameOctopamine receptor
Smed IDSMED30015590
Length (bp)1637
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Octopamine receptor (SMED30015590) t-SNE clustered cells

Violin plots show distribution of expression levels for Octopamine receptor (SMED30015590) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Octopamine receptor (SMED30015590) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Octopamine receptor (SMED30015590) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30015590

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 1

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
parenchymaSMED30015590SMESG000059264.1 dd_Smed_v4_19063_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Octopamine receptor vs. Ensembl Human
Match: ADRA1B (adrenoceptor alpha 1B [Source:HGNC Symbol;Acc:HGNC:278])

HSP 1 Score: 166.007 bits (419), Expect = 1.929e-44
Identity = 128/401 (31.92%), Postives = 183/401 (45.64%), Query Frame = 3
Query:  225 IALGLIV--FNLVVIFGNIFVIFGVATIWKLKRSVTTNFIISLAISDLLLGAFVLPFSSTTELLKQTWIFGYKICHLWLAVDVLLSTASIYNLVIIGLDRYLAICWPFKYPVLMNNSKAKFLVGFVWIFSFIICSPTIQLIFSDSTSISYNNSLFPSKIHEKYIRINSSMCSIKNSNKYYKVYSAFGSFYIPLVILIFFYTRIFTKVNENFRNIHKGTIKIDQSSIENCMRIHKGIVLNQKPKRATNRFPDNHNNDKHEMLKRKISSPVVKVTTDECSTPARTSTTDNQPLLKVRXXXXXXXXXXXXXXTLALSYKTKRLFNKISSETKAARMLGVICGAFIVCWLPFF-SWYLTSAFVELDEASTIFSVFFWLGYVNSALNPIIYVIWSKNFRQAFKTLL 1418
            I++GL++  F L  I GNI VI  VA    L R+ T  FI++LA++DLLL   VLPFS+  E+L   W+ G   C +W AVDVL  TASI +L  I +DRY+ + +  +YP L+   KA   +  VW+ S +I                   S+ P    ++    +   C +     +Y ++S+ GSFYIPL +++  Y R++         + K T K  ++ +   M   K + L    K        N + D     K K  +P   +                                              +LF K S E KAA+ LG++ G FI+CWLPFF +  L S F  L     +F V FWLGY NS LNPIIY   SK F++AF  +L
Sbjct:   46 ISVGLVLGAFILFAIVGNILVILSVACNRHL-RTPTNYFIVNLAMADLLLSFTVLPFSAALEVLGY-WVLGRIFCDIWAAVDVLCCTASILSLCAISIDRYIGVRYSLQYPTLVTRRKAILALLSVWVLSTVI-------------------SIGPLLGWKEPAPNDDKECGV-TEEPFYALFSSLGSFYIPLAVILVMYCRVYI--------VAKRTTKNLEAGVMKEMSNSKELTLRIHSK--------NFHEDTLSSTKAKGHNPRSSIAV--------------------------------------------KLF-KFSREKKAAKTLGIVVGMFILCWLPFFIALPLGSLFSTLKPPDAVFKVVFWLGYFNSCLNPIIYPCSSKEFKRAFVRIL 363          
BLAST of Octopamine receptor vs. Ensembl Human
Match: DRD2 (dopamine receptor D2 [Source:HGNC Symbol;Acc:HGNC:3023])

HSP 1 Score: 150.984 bits (380), Expect = 8.346e-40
Identity = 114/410 (27.80%), Postives = 193/410 (47.07%), Query Frame = 3
Query:  255 VVIFGNIFVIFGVATIWKLKRSVTTNF-IISLAISDLLLGAFVLPFSSTTELLKQTWIFGYKICHLWLAVDVLLSTASIYNLVIIGLDRYLAICWPFKYPVLMNNSK-AKFLVGFVWIFSFIICSPTIQLIFSDSTSISYNNSLFPSKIHEKYIRINSSMCSIKNSNKYYKVYSAFGSFYIPLVILIFFYTRIFTKVNENFRNIHKGTIKIDQSSIENCMRIHKGIVLNQKPKRAT------------------NRFPDNHNNDKHEMLKRKISSPVVKVTTDECSTPARTSTTDNQPLLKVRXXXXXXXXXXXXXXTLALSYKTKRLFNKISSETKAARMLGVICGAFIVCWLPFFSWYLTSAFVELDEASTIFSVFFWLGYVNSALNPIIYVIWSKNFRQAF-KTLLC 1421
            V++FGN+ V   V+    L+   TTN+ I+SLA++DLL+   V+P+    E++ + W F    C +++ +DV++ TASI NL  I +DRY A+  P  Y    ++ +    ++  VW+ SF I  P   L+F        NN+             + + C I  +N  + VYS+  SFY+P ++ +  Y +I+  +    +       +++        R H    L +  +RA                   +  P +H    H++     S   +  T D  + P +     + P  K+ K           + T +L   ++R  ++   E KA +ML ++ G FI+CWLPFF  ++ +   + +    ++S F WLGYVNSA+NPIIY  ++  FR+AF K L C
Sbjct:   47 VIVFGNVLVCMAVSREKALQ--TTTNYLIVSLAVADLLVATLVMPWVVYLEVVGE-WKFSRIHCDIFVTLDVMMCTASILNLCAISIDRYTAVAMPMLYNTRYSSKRRVTVMISIVWVLSFTISCP---LLFG------LNNA-------------DQNECII--ANPAFVVYSSIVSFYVPFIVTLLVYIKIYIVLRRRRK-------RVNTKRSSRAFRAHLRAPLKEAARRAQELEMEMLSSTSPPERTRYSPIPPSH----HQLTLPDPSHHGLHSTPDSPAKPEKNGHAKDHP--KIAKIFEIQTMPNGKTRT-SLKTMSRRKLSQ-QKEKKATQMLAIVLGVFIICWLPFFITHILNIHCDCNIPPVLYSAFTWLGYVNSAVNPIIYTTFNIEFRKAFLKILHC 414          
BLAST of Octopamine receptor vs. Ensembl Human
Match: ADRA2A (adrenoceptor alpha 2A [Source:HGNC Symbol;Acc:HGNC:281])

HSP 1 Score: 150.984 bits (380), Expect = 2.008e-39
Identity = 122/451 (27.05%), Postives = 190/451 (42.13%), Query Frame = 3
Query:  198 MEINISFVLIALGLIVFNLVVIFGNIFVIFGVATIWKLKRSVTTNFIISLAISDLLLGAFVLPFSSTTELLKQTWIFGYKICHLWLAVDVLLSTASIYNLVIIGLDRYLAICWPFKYPVLMNNSKAKFLVGFVWIFSFIICSPTIQLIFSDSTSISYNNSLFPSKIHEKYIRINSSMCSIKNSNKYYKVYSAFGSFYIPLVILIFFYTRIFTKVNENFRNIHKGTIKIDQSSIENCMRIHKGIVLNQKPKRATNRFPDNHNNDKHEMLKRKISSPVVKVTTDECSTPARTSTTDNQPL----------------------------------LKVRXXXXXXXXXXXXXXTLALSYKTKRLFNKISSETKAAR--------MLGVICGAFIVCWLPFFSWYLTSAFVELDEASTIFSVFFWLGYVNSALNPIIYVIWSKNFRQAFKTLLCR 1424
            +++ ++ V +A GL++  L+ +FGN+ VI  V T   LK +    F++SLA +D+L+   V+PFS   E++   W FG   C ++LA+DVL  T+SI +L  I LDRY +I    +Y +     + K ++  VW+ S +I  P +        SI         +  E    I        N  K+Y + S  GSF+ P +I+I  Y RI+         I K   ++  S         +G      P   T R P+    ++        + P+          PA     D   L                                  +K      +         T A     +R+    +S  +  +        +L V+ G F+VCW PFF  Y  +A V      T+F  FFW GY NS+LNP+IY I++ +FR+AFK +LCR
Sbjct:   45 LQVTLTLVCLA-GLLM--LLTVFGNVLVIIAVFTSRALK-APQNLFLVSLASADILVATLVIPFSLANEVMGY-WYFGKAWCEIYLALDVLFCTSSIVHLCAISLDRYWSITQAIEYNLKRTPRRIKAIIITVWVISAVISFPPL-------ISIEKKGGGGGPQPAEPRCEI--------NDQKWYVISSCIGSFFAPCLIMILVYVRIY--------QIAKRRTRVPPS--------RRGPDAVAAPPGGTERRPNGLGPERSAGPGGAEAEPLPTQLNGAPGEPAPAGPRDTDALDLEESSSSDHAERPPGPRRPERGPRGKGKARASQVKPGDSLPRRGPGATGIGTPAAGPGEERVGAAKASRWRGRQNREKRFTFVLAVVIGVFVVCWFPFFFTYTLTA-VGCSVPRTLFKFFFWFGYCNSSLNPVIYTIFNHDFRRAFKKILCR 458          
BLAST of Octopamine receptor vs. Ensembl Human
Match: HTR1A (5-hydroxytryptamine receptor 1A [Source:HGNC Symbol;Acc:HGNC:5286])

HSP 1 Score: 148.288 bits (373), Expect = 1.100e-38
Identity = 123/434 (28.34%), Postives = 200/434 (46.08%), Query Frame = 3
Query:  201 EINISFVLIA---LGLIVFNLVVIFGNIFVIFGVATIWKLKRSVT--TNFII-SLAISDLLLGAFVLPFSSTTELLKQTWIFGYKICHLWLAVDVLLSTASIYNLVIIGLDRYLAICWPFKYPVLMNNSKAKFLVGFVWIFSFIICSPTIQLIFSDSTSISYNNSLFPSKIHEKYIRINSSMCSIKNSNKYYKVYSAFGSFYIPLVILIFFYTRIFTKVNENFRNIHKGTIKIDQSSIENCMRIHKGIVLNQKPKRATNRFPDNHNNDKHEMLKRKISSPVVKVTTDECSTPARTSTTDNQPLLKVRXXXXXXXXXXXXXXTLA-------LSYKTKRLFN-------KISSETKAARMLGVICGAFIVCWLPFFSWYLTSAFVE--LDEASTIFSVFFWLGYVNSALNPIIYVIWSKNFRQAFKTLL----CR 1424
            ++ +S+ +I    LG ++F    + GN  V+  +A    L+RS+    N++I SLA++DL++   VLP ++  ++L + W  G   C L++A+DVL  T+SI +L  I LDRY AI  P  Y       +A  L+   W+  F+I  P                 +   +  E   R +   C+I + +  Y +YS FG+FYIPL++++  Y RIF      FR I K   K++++  +       G     +PK++ N    + N       +  + S   K     C+  A     D   L  +         +     + A        S++ K   N        ++ E K  + LG+I G FI+CWLPFF   L   F E      + + ++  WLGY NS LNP+IY  ++K+F+ AFK ++    CR
Sbjct:   30 DVTVSYQVITSLLLGTLIF--CAVLGNACVVAAIA----LERSLQNVANYLIGSLAVTDLMVSVLVLPMAALYQVLNK-WTLGQVTCDLFIALDVLCCTSSILHLCAIALDRYWAITDPIDYVNKRTPRRAAALISLTWLIGFLISIP----------------PMLGWRTPED--RSDPDACTI-SKDHGYTIYSTFGAFYIPLLLMLVLYGRIFRAA--RFR-IRKTVKKVEKTGADT----RHGASPAPQPKKSVNGESGSRN------WRLGVES---KAGGALCANGAVRQGDDGAALEVIEVHRVGNSKEHLPLPSEAGPTPCAPASFERKNERNAEAKRKMALARERKTVKTLGIIMGTFILCWLPFFIVALVLPFCESSCHMPTLLGAIINWLGYSNSLLNPVIYAYFNKDFQNAFKKIIKCKFCR 421          
BLAST of Octopamine receptor vs. Ensembl Human
Match: HTR1B (5-hydroxytryptamine receptor 1B [Source:HGNC Symbol;Acc:HGNC:5287])

HSP 1 Score: 146.362 bits (368), Expect = 3.084e-38
Identity = 121/406 (29.80%), Postives = 177/406 (43.60%), Query Frame = 3
Query:  219 VLIALGLIVFNLVVIFGNIFVIFGVATIWKLKRSVT-TNFII-SLAISDLLLGAFVLPFSSTTELLKQTWIFGYKICHLWLAVDVLLSTASIYNLVIIGLDRYLAICWPFKYPVLMNNSKAKFLVGFVWIFSFIICSPTIQLIFSDSTSISYNNSLFPSKIHEKYIRINSSMCSIKNSNKYYKVYSAFGSFYIPLVILIFFYTRIFTKVNENFRNIHKGTIKIDQSSIENCMRIHKGIVLNQKPKRATNRFPDNHNNDKHEMLKRKISSPVVKVTTDECSTPARTSTTDNQPLLKVRXXXXXXXXXXXXXXTLALSYKTKRLFNKISSETKAARMLGVICGAFIVCWLPFFSWYLTSAFVELDEAS----TIFSVFFWLGYVNSALNPIIYVIWSKNFRQAFKTLL 1418
            VL+ + L +  L     N FVI   AT+++ ++  T  N++I SLA++DLL+   V+P S T   +   W  G  +C  WL+ D+   TASI +L +I LDRY AI    +Y       +A  ++  VW+FS  I                   SL P    +       S C +   +  Y VYS  G+FY P ++LI  Y RI+ +                              +L Q P R   R                       +T    ST + TS     P +     S  + + +K+  + AL  K K +  +   E KA + LG+I GAFIVCWLPFF   L     +  +A      IF  F WLGY+NS +NPIIY + +++F+QAF  L+
Sbjct:   50 VLLVMLLALITLATTLSNAFVI---ATVYRTRKLHTPANYLIASLAVTDLLVSILVMPIS-TMYTVTGRWTLGQVVCDFWLSSDITCCTASILHLCVIALDRYWAITDAVEYSAKRTPKRAAVMIALVWVFSISI-------------------SLPPFFWRQAKAEEEVSECVVNTDHILYTVYSTVGAFYFPTLLLIALYGRIYVEARSR--------------------------ILKQTPNRTGKRLTRAQ-----------------LITDSPGSTSSVTSINSRVPDVPSESGSPVYVNQVKVRVSDALLEKKKLMAAR---ERKATKTLGIILGAFIVCWLPFFIISLVMPICK--DACWFHLAIFDFFTWLGYLNSLINPIIYTMSNEDFKQAFHKLI 384          
BLAST of Octopamine receptor vs. Ensembl Celegans
Match: ser-6 (SERotonin/octopamine receptor family [Source:UniProtKB/TrEMBL;Acc:U4PLH7])

HSP 1 Score: 178.333 bits (451), Expect = 1.838e-50
Identity = 125/410 (30.49%), Postives = 209/410 (50.98%), Query Frame = 3
Query:  216 FVLIALGLIVFNLVVIFGNIFVIFGVATIWKLKRSVTTNFIISLAISDLLLGAFVLPFSSTTELLKQTWIFGYKICHLWLAVDVLLSTASIYNLVIIGLDRYLAICWPFKYPVLMNNSKAKFLVGFVWIFSFIICSPTIQLIFSDSTSISYNNSLFPSKIHEKYIRINSSMCSIKNSNKYYKVYSAFGSFYIPLVILIFFYTRIFTKVNENFRNIHKGTIKIDQSSIENCMRIHK---GIVLNQKPKRATNRFPDNHNNDKHEMLKRKISSPVVKVTTDECSTPARTSTTDNQPLLKVRXXXXXXXXXXXXXXTLALSYKTKR--LFNKISSETKAARMLGVICGAFIVCWLPFFSWYLTSAFVELDEA-----STIFSVFFWLGYVNSALNPIIYVIWSKNFRQAFKTL 1415
             +L++L L V N  V+ GN+ V + + T   L+ S T + ++SL ISDLLLG  +LPF+   E   + WIFG+  C LWL+VDV LSTASIYNL+ I  DRY+A+  P KYP++ +    + +   VW      CS  + +I     +++ ++S  P+K            C   +    Y ++SA  SF +P  +++    RIF  V    R +   T+K    S    +R+H+    I+  +K  +   R   +H  +      +++  P+  V   E       S+  + P ++     +     ++   T  +++ T++  +   + +E + AR  G++  AFIVCW+PF + Y+  A+     A     +++F+  FWLGY NSA+NPI+Y  +S++FR A K L
Sbjct:    1 MILLSLTLGVVNCFVVIGNLLVFYVILTKKSLQTS-TNHLVLSLTISDLLLGILILPFAIIQEHSNE-WIFGHFGCRLWLSVDVFLSTASIYNLLAISFDRYMAVRQPIKYPIISSTKVVRLMTFLVW-----FCSLLLAVILFVLLTLNAHDSE-PTK-----------DCQPTSLPSMYIIFSAMASFIVPAFVMVILNVRIFQTVLHTSRTM---TVKSKNGS----LRVHRRKEPIIPVKKHDKYETRL--SHEEECVGSPSKEVIDPIPVVAVVE---KHHKSSAVDAPAIRSFLTHTVVFGVLEAKKTNIINHITQKKCMRRSLRTEIRVARTTGIVVAAFIVCWIPFTTIYVLQAYAVCTVAAGCIPASLFTTAFWLGYSNSAVNPILYAAFSRDFRIALKRL 379          
BLAST of Octopamine receptor vs. Ensembl Celegans
Match: ser-6 (SERotonin/octopamine receptor family [Source:UniProtKB/TrEMBL;Acc:U4PLH7])

HSP 1 Score: 170.629 bits (431), Expect = 2.084e-47
Identity = 125/425 (29.41%), Postives = 208/425 (48.94%), Query Frame = 3
Query:  216 FVLIALGLIVFNLVVIFGNIFVIFGVATIWKLKRSVTTNFIISLAISDLLLGAFVLPFSSTTELLKQTWIFGYKICHLWLAVDVLLSTASIYNLVIIGLDRYLAICWPFKYPVLMNNSKAKFLVGFVWIFSFIICSPTIQLIFSDSTSISYNNSLFPSKIHEKYIRINSSMCSIKNSNKYYKVYSAFGSFYIPLVILIFFYTRIFTKVNENFRNIHKGTIKIDQSSIENCMRIHK---GIVLNQKPKRATNRFPDNHNNDKHEMLKRKISSPVVKVTTDECSTPARTSTTDNQPLLKVRXXXXXXXXXXXXXXTLALSY-----------------KTKRLFNKISSETKAARMLGVICGAFIVCWLPFFSWYLTSAFVELDEA-----STIFSVFFWLGYVNSALNPIIYVIWSKNFRQAFKTL 1415
             +L++L L V N  V+ GN+ V + + T   L+ S T + ++SL ISDLLLG  +LPF+   E   + WIFG+  C LWL+VDV LSTASIYNL+ I  DRY+A+  P KYP++ +    + +   VW      CS  + +I     +++ ++S  P+K            C   +    Y ++SA  SF +P  +++    RIF  V    R +   T+K    S    +R+H+    I+  +K  +   R   +H  +      +++  P+  V   E       S+  + P ++     +     ++   T  +++                 + K +   + +E + AR  G++  AFIVCW+PF + Y+  A+     A     +++F+  FWLGY NSA+NPI+Y  +S++FR A K L
Sbjct:    1 MILLSLTLGVVNCFVVIGNLLVFYVILTKKSLQTS-TNHLVLSLTISDLLLGILILPFAIIQEHSNE-WIFGHFGCRLWLSVDVFLSTASIYNLLAISFDRYMAVRQPIKYPIISSTKVVRLMTFLVW-----FCSLLLAVILFVLLTLNAHDSE-PTK-----------DCQPTSLPSMYIIFSAMASFIVPAFVMVILNVRIFQTVLHTSRTM---TVKSKNGS----LRVHRRKEPIIPVKKHDKYETRL--SHEEECVGSPSKEVIDPIPVVAVVE---KHHKSSAVDAPAIRSFLTHTVVFGVLEAKKTNIINHITQWWRRSTVRSPNPSTRKKCMRRSLRTEIRVARTTGIVVAAFIVCWIPFTTIYVLQAYAVCTVAAGCIPASLFTTAFWLGYSNSAVNPILYAAFSRDFRIALKRL 394          
BLAST of Octopamine receptor vs. Ensembl Celegans
Match: octr-1 (OCTopamine Receptor (GPCR) [Source:UniProtKB/TrEMBL;Acc:Q7JP61])

HSP 1 Score: 167.933 bits (424), Expect = 1.672e-46
Identity = 121/413 (29.30%), Postives = 191/413 (46.25%), Query Frame = 3
Query:  219 VLIALGLIVFNLVVIFGNIFVIFGVATIWKLKRSVTTNFIISLAISDLLLGAFVLPFSSTTELLKQTWIFGYKICHLWLAVDVLLSTASIYNLVIIGLDRYLAICWPFKYPVLMNNSKAKFLVGFVWIFSFIICSPTIQLIFSDSTSISYNNSLFPSKIHEKYIRINSSMCSIKNSNKYYKVYSAFGSFYIPLVILIFFYTRIFTKVNENFRNIHKGTIKIDQS--------------SIENCMRIHKGIVLNQKPKRATNRFPDNHNNDKHEMLKRKISSPVVKVTTDECSTPARTSTTDNQPLLKVRXXXXXXXXXXXXXXTLALSYK---TKRLFNKISSETKAARMLGVICGAFIVCWLPFFSWYLTSAFVELDEASTIFSVFFWLGYVNSALNPIIYVIWSKNFRQAF 1406
            VL    ++   L++IFGN+ V+  V    KL+       I+SLA++D+L+G  V+P + T E++ + W  G  +C +WLA+DVL  TASI ++  I LDRY ++  P  YP      +    +G  WI S +IC P I                 P +   +        CS+ +++  Y +YS+ GSFYIP+VILI  Y +I++    + R   K T + D +              ++E  +  +   + ++K K  TNR   N    +   +  ++    VK+  D         T  N P                   T  L  K    KR     + E +A  +LG+I  AFI+ WLPFF  Y+  AF   +    +F  FFWLGY NS +NP+IY ++++ F++  
Sbjct:   22 VLTISSMLTVMLLIIFGNLLVVVTVYRDRKLRMQRQNWLIVSLAVADMLVGLLVMPLTLTYEIVGE-WTMGNILCEIWLALDVLFVTASILHICAISLDRYFSVTSPLTYPATRTPLRMFIYIGVSWIVSLLICLPPI-------------FGWRPERAEGE--------CSV-STDLGYVLYSSLGSFYIPVVILIIVYAKIYSITIRHSRQRLKETERRDHTLNMLTIRSSTNERYNMEYELEENSDPIEDEKEKVVTNRDMINKVCWQLRKISEELPRQGVKIALD---------TNHNSP--------------PASDLTRKLEEKKFCEKRKRKLKAKERQATLLLGIILSAFILSWLPFFLIYVIGAFGH-EAPPLVFKFFFWLGYCNSGINPVIYTVFNREFKRGL 387          
BLAST of Octopamine receptor vs. Ensembl Celegans
Match: octr-1 (OCTopamine Receptor (GPCR) [Source:UniProtKB/TrEMBL;Acc:Q7JP61])

HSP 1 Score: 167.548 bits (423), Expect = 2.573e-46
Identity = 120/414 (28.99%), Postives = 191/414 (46.14%), Query Frame = 3
Query:  219 VLIALGLIVFNLVVIFGNIFVIFGVATIWKLKRSVTTNFIISLAISDLLLGAFVLPFSSTTELLKQTWIFGYKICHLWLAVDVLLSTASIYNLVIIGLDRYLAICWPFKYPVLMNNSKAKFLVGFVWIFSFIICSPTIQLIFSDSTSISYNNSLFPSKIHEKYIRINSSMCSIKNSNKYYKVYSAFGSFYIPLVILIFFYTRIFTKVNENFRNIHKGTIKIDQS--------------SIENCMRIHKGIVLNQKPKRATNRFPDN----HNNDKHEMLKRKISSPVVKVTTDECSTPARTSTTDNQPLLKVRXXXXXXXXXXXXXXTLALSYKTKRLFNKISSETKAARMLGVICGAFIVCWLPFFSWYLTSAFVELDEASTIFSVFFWLGYVNSALNPIIYVIWSKNFRQAF 1406
            VL    ++   L++IFGN+ V+  V    KL+       I+SLA++D+L+G  V+P + T E++ + W  G  +C +WLA+DVL  TASI ++  I LDRY ++  P  YP      +    +G  WI S +IC P I                 P +   +        CS+ +++  Y +YS+ GSFYIP+VILI  Y +I++    + R   K T + D +              ++E  +  +   + ++K K  TNR   N          E L R+     + + T+  S PA   T   +                         +  KR     + E +A  +LG+I  AFI+ WLPFF  Y+  AF   +    +F  FFWLGY NS +NP+IY ++++ F++  
Sbjct:   22 VLTISSMLTVMLLIIFGNLLVVVTVYRDRKLRMQRQNWLIVSLAVADMLVGLLVMPLTLTYEIVGE-WTMGNILCEIWLALDVLFVTASILHICAISLDRYFSVTSPLTYPATRTPLRMFIYIGVSWIVSLLICLPPI-------------FGWRPERAEGE--------CSV-STDLGYVLYSSLGSFYIPVVILIIVYAKIYSITIRHSRQRLKETERRDHTLNMLTIRSSTNERYNMEYELEENSDPIEDEKEKVVTNRDMINKVCWQLRKISEELPRQGVKVSIALDTNHNSPPASDLTRKLE----------------------EKKFCEKRKRKLKAKERQATLLLGIILSAFILSWLPFFLIYVIGAFGH-EAPPLVFKFFFWLGYCNSGINPVIYTVFNREFKRGL 389          
BLAST of Octopamine receptor vs. Ensembl Celegans
Match: dop-4 (Dopamine receptor 4 [Source:UniProtKB/Swiss-Prot;Acc:Q18775])

HSP 1 Score: 163.696 bits (413), Expect = 5.277e-44
Identity = 134/457 (29.32%), Postives = 217/457 (47.48%), Query Frame = 3
Query:  222 LIALGLIVFNLVVIFGNIFVIFGVATIWKLKRSVTTNFIISLAISDLLLGAFVLPFSSTTELLKQTWIFGYKICHLWLAVDVLLSTASIYNLVIIGLDRYLAICWPFKYPVLMNNSKAKFLVGFVWIFSFIICSPTIQLIFSDSTSISYNNSLFPSKIHEKYIRINSSMCSIKNSNKYYKVYSAFGSFYIPLVILIFFYTRIFTKVNENFRNIHKG-----------------TIKIDQSSIENCMRIHKGIVLNQKPKRATNRFPDNHNNDKHEMLKRKIS-----------------SPVVKVTTDECSTP--ARTSTTD------------NQPLLKV-RXXXXXXXXXXXXXXTLALSYKTK-------RLFNKISSETKAARMLGVICGAFIVCWLPFFSWYLTSAFVE--LDEASTIFSVFFWLGYVNSALNPIIYVIWSKNFRQAFKTLL 1418
            L+A+ L    L+ + GN  V+  V T  K  R+ T   IISLAI+DL++G  V+P +S  E+   TW+FG  +C ++ A+D+L STASI+NL +I LDRY+A   P  Y   ++  +    +  VW+ S I+  P I  I+  ++S               ++  + S C   +S K Y  +S+  SFYIPL +++F Y +++     + + +  G                 T  I  S  E  +RIH G           +RF   H  +   +L +++S                  P+++  T+ C +   +R+S  +            +  LL+V +       S+ ++  T  LS + K       R   +   E +AAR L ++ GAFI+CW PFF +   +AF E       TIF+   W G++NS LNP+IY  +S++FR+AFK +L
Sbjct:   44 LLAIALFSICLLTVAGNCLVVIAVCTK-KYLRNPTGYLIISLAIADLIVGVIVMPMNSLFEIANHTWLFGLMMCDVFHAMDILASTASIWNLCVISLDRYMAGQDPIGYRDKVSKRRILMAILSVWVLSAILSFPGI--IWWRTSS--------------PHLYEDQSQCLFTDS-KMYVSFSSLVSFYIPLFLILFAYGKVYIIATRHSKGMRMGIKTVSIKKRNGKKSNTETESILSSENEPTLRIHFGRGKQSSSSLRNSRF---HARESTRLLLKQVSCKSLNDRGEHNNNNTVRQPLLR-GTEGCHSDSISRSSQRNFRGRNVTIGSNCSSTLLQVDQPDRMSLSSNSQMVMTSPLSTRRKLNVREKSRQMMRYVHEQRAARTLSIVVGAFILCWTPFFVFTPLTAFCESCFSNKETIFTFVTWAGHLNSMLNPLIYSRFSRDFRRAFKQIL 478          
BLAST of Octopamine receptor vs. Ensembl Fly
Match: Dop1R2 (gene:FBgn0266137 transcript:FBtr0085467)

HSP 1 Score: 176.407 bits (446), Expect = 2.235e-48
Identity = 129/396 (32.58%), Postives = 194/396 (48.99%), Query Frame = 3
Query:  261 IFGNIFVIFGVATIWKLKRSVTTNFIISLAISDLLLGAFVLPFSSTTELLKQTWIFGYKICHLWLAVDVLLSTASIYNLVIIGLDRYLAICWPFKYPVLMNNSKAKFLVGFVWIFSFIICSPTIQLIFSDSTSISYNNSLFPSKIHEKYIRINSSMCSIK---NSNKYYKVYSAFGSFYIPLVILIFFYTRIFTKVNENFRNIHKGTIKIDQSS--IENCMRIHKGIVLNQKPKR--ATNRFPDNHNNDKHEMLKRKISSPVVKVTTDECSTPARTSTTDNQPLLKVRXXXXXXXXXXXXXXTLALSYKTKRLFNKISSETKAARMLGVICGAFIVCWLPFFSWYLTSAF-VELDEASTIFS-VFFWLGYVNSALNPIIYVIWSKNFRQAFKTLLC 1421
            +FGN  VI  V    +   + T  FI SLA++D L+G  V+PFS+  E+L+ TW FG   C +W ++DVL STASI NL +I LDRY AI  PF YP+ M   +A  L+  VWI     CS  I                FP+ +  +  R +  M + K     +  Y V+S+  SFY+PL++++F Y RI+       R++  GT ++  +S  ++  +RIH+G     +  +                 +      S          +T +     D++PL  +                +  ++   R   K + E KAA+ LG++ G FI+CWLPFF   L S F +E  E   I S +  WLG++NS +NP+IY  WS++FR+AF  LLC
Sbjct:  123 VFGNSLVILAVIRE-RYLHTATNYFITSLAVADCLVGLVVMPFSALYEVLENTWFFGTDWCDIWRSLDVLFSTASILNLCVISLDRYWAITDPFSYPMRMTVKRAAGLIAAVWI-----CSSAIS---------------FPAIVWWRAAR-DGEMPAYKCTFTEHLGYLVFSSTISFYLPLLVMVFTYCRIYRAAVIQTRSLKIGTKQVLMASGELQLTLRIHRGGTTRDQQNQVSGGGGGGGGGGGGGGSLSHSHSHSHHHHHNHGGGTTTSTPEEPDDEPLSALHNNGLARHRH------MGKNFSLSRKLAKFAKEKKAAKTLGIVMGVFIICWLPFFVVNLLSGFCIECIEHEEIVSAIVTWLGWINSCMNPVIYACWSRDFRRAFVRLLC 490          
BLAST of Octopamine receptor vs. Ensembl Fly
Match: Dop1R2 (gene:FBgn0266137 transcript:FBtr0085468)

HSP 1 Score: 176.022 bits (445), Expect = 3.459e-48
Identity = 130/396 (32.83%), Postives = 194/396 (48.99%), Query Frame = 3
Query:  261 IFGNIFVIFGVATIWKLKRSVTTNFIISLAISDLLLGAFVLPFSSTTELLKQTWIFGYKICHLWLAVDVLLSTASIYNLVIIGLDRYLAICWPFKYPVLMNNSKAKFLVGFVWIFSFIICSPTIQLIFSDSTSISYNNSLFPSKIHEKYIRINSSMCSIK---NSNKYYKVYSAFGSFYIPLVILIFFYTRIFTKVNENFRNIHKGTIKIDQSS--IENCMRIHKGIVLNQKPKRA--TNRFPDNHNNDKHEMLKRKISSPVVKVTTDECSTPARTSTTDNQPLLKVRXXXXXXXXXXXXXXTLALSYKTKRLFNKISSETKAARMLGVICGAFIVCWLPFFSWYLTSAF-VELDEASTIFS-VFFWLGYVNSALNPIIYVIWSKNFRQAFKTLLC 1421
            +FGN  VI  V     L  + T  FI SLA++D L+G  V+PFS+  E+L+ TW FG   C +W ++DVL STASI NL +I LDRY AI  PF YP+ M   +A  L+  VWI     CS  I                FP+ +  +  R +  M + K     +  Y V+S+  SFY+PL++++F Y RI+       R++  GT ++  +S  ++  +RIH+G     +  +                 +      S          +T +     D++PL  +                +  ++   R   K + E KAA+ LG++ G FI+CWLPFF   L S F +E  E   I S +  WLG++NS +NP+IY  WS++FR+AF  LLC
Sbjct:  123 VFGNSLVILAVIRERYLH-TATNYFITSLAVADCLVGLVVMPFSALYEVLENTWFFGTDWCDIWRSLDVLFSTASILNLCVISLDRYWAITDPFSYPMRMTVKRAAGLIAAVWI-----CSSAIS---------------FPAIVWWRAAR-DGEMPAYKCTFTEHLGYLVFSSTISFYLPLLVMVFTYCRIYRAAVIQTRSLKIGTKQVLMASGELQLTLRIHRGGTTRDQQNQVSGGGGGGGGGGGGGGSLSHSHSHSHHHHHNHGGGTTTSTPEEPDDEPLSALHNNGLARHRH------MGKNFSLSRKLAKFAKEKKAAKTLGIVMGVFIICWLPFFVVNLLSGFCIECIEHEEIVSAIVTWLGWINSCMNPVIYACWSRDFRRAFVRLLC 490          
BLAST of Octopamine receptor vs. Ensembl Fly
Match: Dop1R2 (gene:FBgn0266137 transcript:FBtr0330293)

HSP 1 Score: 176.022 bits (445), Expect = 6.140e-47
Identity = 130/396 (32.83%), Postives = 194/396 (48.99%), Query Frame = 3
Query:  261 IFGNIFVIFGVATIWKLKRSVTTNFIISLAISDLLLGAFVLPFSSTTELLKQTWIFGYKICHLWLAVDVLLSTASIYNLVIIGLDRYLAICWPFKYPVLMNNSKAKFLVGFVWIFSFIICSPTIQLIFSDSTSISYNNSLFPSKIHEKYIRINSSMCSIK---NSNKYYKVYSAFGSFYIPLVILIFFYTRIFTKVNENFRNIHKGTIKIDQSS--IENCMRIHKGIVLNQKPKR--ATNRFPDNHNNDKHEMLKRKISSPVVKVTTDECSTPARTSTTDNQPLLKVRXXXXXXXXXXXXXXTLALSYKTKRLFNKISSETKAARMLGVICGAFIVCWLPFFSWYLTSAF-VELDEASTIFS-VFFWLGYVNSALNPIIYVIWSKNFRQAFKTLLC 1421
            +FGN  VI  V     L  + T  FI SLA++D L+G  V+PFS+  E+L+ TW FG   C +W ++DVL STASI NL +I LDRY AI  PF YP+ M   +A  L+  VWI     CS  I                FP+ +  +  R +  M + K     +  Y V+S+  SFY+PL++++F Y RI+       R++  GT ++  +S  ++  +RIH+G     +  +                 +      S          +T +     D++PL  +                +  ++   R   K + E KAA+ LG++ G FI+CWLPFF   L S F +E  E   I S +  WLG++NS +NP+IY  WS++FR+AF  LLC
Sbjct:  123 VFGNSLVILAVIRERYL-HTATNYFITSLAVADCLVGLVVMPFSALYEVLENTWFFGTDWCDIWRSLDVLFSTASILNLCVISLDRYWAITDPFSYPMRMTVKRAAGLIAAVWI-----CSSAIS---------------FPAIVWWRAAR-DGEMPAYKCTFTEHLGYLVFSSTISFYLPLLVMVFTYCRIYRAAVIQTRSLKIGTKQVLMASGELQLTLRIHRGGTTRDQQNQVSGGGGGGGGGGGGGGSLSHSHSHSHHHHHNHGGGTTTSTPEEPDDEPLSALHNNGLARHRH------MGKNFSLSRKLAKFAKEKKAAKTLGIVMGVFIICWLPFFVVNLLSGFCIECIEHEEIVSAIVTWLGWINSCMNPVIYACWSRDFRRAFVRLLC 490          
BLAST of Octopamine receptor vs. Ensembl Fly
Match: 5-HT7 (gene:FBgn0004573 transcript:FBtr0334508)

HSP 1 Score: 169.474 bits (428), Expect = 1.325e-45
Identity = 118/401 (29.43%), Postives = 185/401 (46.13%), Query Frame = 3
Query:  216 FVLIALGLIVFNLVVIFGNIFVIFGVATIWKLKRSVTTNFIISLAISDLLLGAFVLPFSSTTELLKQTWIFGYKICHLWLAVDVLLSTASIYNLVIIGLDRYLAICWPFKYPVLMNNSKAKFLVGFVWIFSFIICSPTIQLIFSDSTSISYNNSLFPSKIHEKYIRINSSMCSIKNSNKYYKVYSAFGSFYIPLVILIFFYTRIFTKVNENFRNIHKGTIKIDQSSIENCMRIHKGIVLNQKPKRATNRFPDNHNNDKHEMLKRKISSPVVKVTTDECSTPARTSTTDNQPLLKVRXXXXXXXXXXXXXXTLALSYKTKRLFNKISSETKAARMLGVICGAFIVCWLPFFSWYLTSAFVELDEASTIFSVFFWLGYVNSALNPIIYVIWSKNFRQAFKTLL 1418
            FV I L +++   VV  GN+ V   V  + KL+R      ++SLA+SDL +   V+P +   E+L++ W FG  +C +W++ DVL  TASI NL  I +DRYLAI  P +Y V     +    VG VW+ +  I  P + ++ ++               HE        +C++   N  Y++Y+  GSFYIPL +++F Y +IF           +      Q+ ++  +         Q P         + N  +H  +                +T    ST                   +  S+ L  S   K+L  +++ E KA+  LG+I  AF VCWLPFF   L   F  +   +++ S+F WLGY NS LNPIIY   +++FR+ F+ +L
Sbjct:  164 FVSIVLLIVILGTVV--GNVLVCIAVCMVRKLRRPCNY-LLVSLALSDLCVALLVMPMALLYEVLEK-WNFGPLLCDIWVSFDVLCCTASILNLCAISVDRYLAITKPLEYGVKRTPRRMMLCVGIVWLAAACISLPPLLILGNE---------------HED--EEGQPICTVCQ-NFAYQIYATLGSFYIPLSVMLFVYYQIFRAARRIVLEEKRA-----QTHLQQALNGTGSPSAPQAPPLGHTELASSGNGQRHSSVG---------------NTSLTYSTCGGLSSGGGALAGHGSGGGVSGSTGLLGSPHHKKLRFQLAKEKKASTTLGIIMSAFTVCWLPFFILALIRPFETMHVPASLSSLFLWLGYANSLLNPIIYATLNRDFRKPFQEIL 522          
BLAST of Octopamine receptor vs. Ensembl Fly
Match: 5-HT7 (gene:FBgn0004573 transcript:FBtr0085746)

HSP 1 Score: 169.474 bits (428), Expect = 1.325e-45
Identity = 118/401 (29.43%), Postives = 185/401 (46.13%), Query Frame = 3
Query:  216 FVLIALGLIVFNLVVIFGNIFVIFGVATIWKLKRSVTTNFIISLAISDLLLGAFVLPFSSTTELLKQTWIFGYKICHLWLAVDVLLSTASIYNLVIIGLDRYLAICWPFKYPVLMNNSKAKFLVGFVWIFSFIICSPTIQLIFSDSTSISYNNSLFPSKIHEKYIRINSSMCSIKNSNKYYKVYSAFGSFYIPLVILIFFYTRIFTKVNENFRNIHKGTIKIDQSSIENCMRIHKGIVLNQKPKRATNRFPDNHNNDKHEMLKRKISSPVVKVTTDECSTPARTSTTDNQPLLKVRXXXXXXXXXXXXXXTLALSYKTKRLFNKISSETKAARMLGVICGAFIVCWLPFFSWYLTSAFVELDEASTIFSVFFWLGYVNSALNPIIYVIWSKNFRQAFKTLL 1418
            FV I L +++   VV  GN+ V   V  + KL+R      ++SLA+SDL +   V+P +   E+L++ W FG  +C +W++ DVL  TASI NL  I +DRYLAI  P +Y V     +    VG VW+ +  I  P + ++ ++               HE        +C++   N  Y++Y+  GSFYIPL +++F Y +IF           +      Q+ ++  +         Q P         + N  +H  +                +T    ST                   +  S+ L  S   K+L  +++ E KA+  LG+I  AF VCWLPFF   L   F  +   +++ S+F WLGY NS LNPIIY   +++FR+ F+ +L
Sbjct:  164 FVSIVLLIVILGTVV--GNVLVCIAVCMVRKLRRPCNY-LLVSLALSDLCVALLVMPMALLYEVLEK-WNFGPLLCDIWVSFDVLCCTASILNLCAISVDRYLAITKPLEYGVKRTPRRMMLCVGIVWLAAACISLPPLLILGNE---------------HED--EEGQPICTVCQ-NFAYQIYATLGSFYIPLSVMLFVYYQIFRAARRIVLEEKRA-----QTHLQQALNGTGSPSAPQAPPLGHTELASSGNGQRHSSVG---------------NTSLTYSTCGGLSSGGGALAGHGSGGGVSGSTGLLGSPHHKKLRFQLAKEKKASTTLGIIMSAFTVCWLPFFILALIRPFETMHVPASLSSLFLWLGYANSLLNPIIYATLNRDFRKPFQEIL 522          
BLAST of Octopamine receptor vs. Ensembl Zebrafish
Match: adra1aa (adrenoceptor alpha 1Aa [Source:ZFIN;Acc:ZDB-GENE-030131-2831])

HSP 1 Score: 177.948 bits (450), Expect = 3.144e-49
Identity = 127/412 (30.83%), Postives = 197/412 (47.82%), Query Frame = 3
Query:  201 EINISFVLIALGLIVFNLVV--IFGNIFVIFGVATIWKLKRSVTTNFIISLAISDLLLGAFVLPFSSTTELLKQTWIFGYKICHLWLAVDVLLSTASIYNLVIIGLDRYLAICWPFKYPVLMNNSKAKFLVGFVWIFSFIICSPTIQLIFSDSTSISYNNSLFPSKIHEKYIRINSSMCSIKNSNKYYKVYSAFGSFYIPLVILIFFYTRIFTKVNENFRNIHKGTIKIDQSSIENCMRIHKGIVLNQKPKRATNRFPDNHNNDKHEMLKRKISSPVVKVTTDECSTPARTSTTDNQPLLKVRXXXXXXXXXXXXXXTLALSYKTK---RLFNKISSETKAARMLGVICGAFIVCWLPFF-SWYLTSAFVELDEASTIFSVFFWLGYVNSALNPIIYVIWSKNFRQAFKTLL 1418
            E+N+    +ALG+++   +V  + GNI VI  VA    L R+VT  FI++LA++DLLL + VLPFS+  E+L + WIFG   C +W A+DVL  TASI +L +I +DRY+ + +P +YP ++   +A   +  +W+ S  I                   S+ P    ++    + S+C I      Y ++SA GSFY+PLV+++  Y R++       R                      G++  QK +++          D  E +  +I    + V+ DE                                   AL  +T    RL  K S E KAA+ LG++ G F++CWLPFF    + S F     + T+F + FWLGY NS +NPIIY   S+ F++AF ++L
Sbjct:   34 ELNV-MKAVALGVVLAIFIVFGVLGNILVILSVACHRNL-RTVTHYFIVNLAVADLLLSSTVLPFSTVFEMLGR-WIFGRPFCDVWAAMDVLCCTASIMSLCVISVDRYIGVSYPLQYPSIVTERRALLALIALWVLSITI-------------------SIGPLFGWKEPAPDDESICKI-TEEPGYAIFSALGSFYLPLVVILSMYCRVYVVARRETR----------------------GLISGQKTEKS----------DHAETVTLRIHRGNMTVSEDE-----------------------------------ALRNRTHFALRLL-KFSREKKAAKTLGIVVGCFVLCWLPFFLVLPIGSIFPTYRPSDTVFKITFWLGYFNSCINPIIYPCSSQEFKKAFLSVL 354          
BLAST of Octopamine receptor vs. Ensembl Zebrafish
Match: adra1d (adrenoceptor alpha 1D [Source:ZFIN;Acc:ZDB-GENE-090312-203])

HSP 1 Score: 172.94 bits (437), Expect = 2.969e-47
Identity = 123/395 (31.14%), Postives = 183/395 (46.33%), Query Frame = 3
Query:  225 IALGLIVFNLVVIFGNIFVIFGVATIWKLKRSVTTNFIISLAISDLLLGAFVLPFSSTTELLKQTWIFGYKICHLWLAVDVLLSTASIYNLVIIGLDRYLAICWPFKYPVLMNNSKAKFLVGFVWIFSFIICSPTIQLIFSDSTSISYNNSLFPSKIHEKYIRINSSMCSIKNSNKYYKVYSAFGSFYIPLVILIFFYTRIFTKVNENFRNIHKGTIKIDQSSIENCMRIHKGIVLNQKPKRATNRFPDNHNNDKHEMLKRKISSPVVKVTTDECSTPARTSTTDNQPLLKVRXXXXXXXXXXXXXXTLALSYKTKRLFNKISSETKAARMLGVICGAFIVCWLP-FFSWYLTSAFVELDEASTIFSVFFWLGYVNSALNPIIYVIWSKNFRQAF 1406
            + + L +F  V I GNI VI  V     L+ +VT  FI++LAI+DLLL   VLPFS++ E+L   W+FG   C++W AVDVL  TASI +L +I +DRY+ +    KYP +M   KA  ++  VW+ S +I                   S+ P    ++    + S+C I      Y ++S+  SFY+PL++++  Y R++       +++  G  +    S+E  +RIH                                     +   ++ ST ++T     +  L VR                           K S E KAA+ L ++ G FI+CWLP FF   L S F  L  +  +F V FWLGY NS +NPIIY   SK F++AF
Sbjct:   39 VGIFLAIFISVAIVGNILVILSVLCNKHLQ-TVTNFFIVNLAIADLLLSIIVLPFSASLEVLG-CWVFGRVFCNIWAAVDVLCCTASILSLCVISIDRYIGVKHCLKYPTIMTERKAGVILVLVWVSSMVI-------------------SIGPLLGWKEPPPSDESICRI-TEEPGYALFSSLFSFYLPLMVILVMYIRVYIVARRTTKSLEAGVKRERDKSMEVVLRIH------------------------------------CRSMPEDSSTSSKTKNHPFRSSLSVRLM-------------------------KFSREKKAAKTLAIVVGMFILCWLPFFFVLPLGSFFPALKPSDMVFKVIFWLGYFNSCINPIIYPCSSKEFQRAF 350          
BLAST of Octopamine receptor vs. Ensembl Zebrafish
Match: AL928672.1 (pep chromosome:GRCz11:CHR_ALT_CTG10_1_14:18996850:19006570:-1 gene:ENSDARG00000117157.1 transcript:ENSDART00000185602.1 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:AL928672.1)

HSP 1 Score: 167.933 bits (424), Expect = 3.893e-46
Identity = 119/387 (30.75%), Postives = 179/387 (46.25%), Query Frame = 3
Query:  261 IFGNIFVIFGVATIWKLKRSVTTNFIISLAISDLLLGAFVLPFSSTTELLKQTWIFGYKICHLWLAVDVLLSTASIYNLVIIGLDRYLAICWPFKYPVLMNNSKAKFLVGFVWIFSFIICSPTIQLIFSDSTSISYNNSLFPSKIHEKYIRINSSMCSIKNSNKYYKVYSAFGSFYIPLVILIFFYTRIFTKVNENFRNIHKGTIKIDQSSIENCMRIHKGIVLNQKPKRATNRFPDNHNNDKHEMLKRKISSPVVKVTTDECSTPARTSTTDNQPLLKVRXXXXXXXXXXXXXXTLALSYKTKRLFNKISSETKAARMLGVICGAFIVCWLPFF-SWYLTSAFVELDEASTIFSVFFWLGYVNSALNPIIYVIWSKNFRQAFKTLL 1418
            + GNI VI  VA    L RSVT  FI +LAI+DLLL + VLPFS+ +E L + W+FG  +C+ W A+DVL  TASI +L +I +DR +A+ +P +YP      +A   V  +W  S  I                   S+ P     + +  + S+C + N +  Y ++SA  SFY+PL +++  Y R++       R + K        S E      +G+ L    ++A N      +  K + ++ K S                                                +   RL  K S E KAA+ LG++ G F++CWLPFF    ++S F        +F + FWLGY NS LNPIIY  +S+ F++AF+ +L
Sbjct:   48 VMGNILVILSVACHRNL-RSVTHYFIGNLAIADLLLSSVVLPFSAVSEALGR-WVFGRHLCNAWTALDVLCCTASILSLCVISVDRCMAVSYPLQYPSFATGRRAMTAVAALWALSAAI-------------------SVGPLFGWREPMPEDESVCRV-NEDPGYAIFSAACSFYVPLAVILAMYCRVYVVARHKTRAMSK--------SRETNGLSEQGMTLRIHCRKAQN------DTRKEDAMRLKNSH-----------------------------------------------FAFMRLL-KFSREKKAAKTLGIVVGCFVLCWLPFFLVLPISSIFPSHRPPDAVFKITFWLGYFNSCLNPIIYPCFSQEFKKAFQNVL 350          
BLAST of Octopamine receptor vs. Ensembl Zebrafish
Match: adra1ab (adrenoceptor alpha 1Ab [Source:ZFIN;Acc:ZDB-GENE-060503-384])

HSP 1 Score: 167.548 bits (423), Expect = 7.036e-46
Identity = 120/387 (31.01%), Postives = 182/387 (47.03%), Query Frame = 3
Query:  261 IFGNIFVIFGVATIWKLKRSVTTNFIISLAISDLLLGAFVLPFSSTTELLKQTWIFGYKICHLWLAVDVLLSTASIYNLVIIGLDRYLAICWPFKYPVLMNNSKAKFLVGFVWIFSFIICSPTIQLIFSDSTSISYNNSLFPSKIHEKYIRINSSMCSIKNSNKYYKVYSAFGSFYIPLVILIFFYTRIFTKVNENFRNIHKGTIKIDQSSIENCMRIHKGIVLNQKPKRATNRFPDNHNNDKHEMLKRKISSPVVKVTTDECSTPARTSTTDNQPLLKVRXXXXXXXXXXXXXXTLALSYKTKRLFNKISSETKAARMLGVICGAFIVCWLPFF-SWYLTSAFVELDEASTIFSVFFWLGYVNSALNPIIYVIWSKNFRQAFKTLL 1418
            + GNI VI  VA    L RSVT  FI +LAI+DLLL + VLPFS+ +E L + W+FG  +C+ W A+DVL  TASI +L +I +DR +A+ +P +YP      +A   V  +W  S  I                   S+ P     + +  + S+C + N +  Y ++SA  SFY+PL +++  Y R++          HK T  + +S   N +   +G+ L    ++A N      +  K + ++ K S                                                +   RL  K S E KAA+ LG++ G F++CWLPFF    ++S F        +F + FWLGY NS LNPIIY  +S+ F++AF+ +L
Sbjct:   51 VMGNILVILSVACHRNL-RSVTHYFIGNLAIADLLLSSVVLPFSAVSEALGR-WVFGRHLCNAWTALDVLCCTASILSLCVISVDRCMAVSYPLQYPSFATGRRAMTAVAALWALSAAI-------------------SVGPLFGWREPMPEDESVCRV-NEDPGYAIFSAACSFYVPLAVILAMYCRVYVVAR------HK-TRAMSKSRETNGLS-EQGMTLRIHCRKAQN------DTRKEDAMRLKNSH-----------------------------------------------FAFMRLL-KFSREKKAAKTLGIVVGCFVLCWLPFFLVLPISSIFPSHRPPDAVFKITFWLGYFNSCLNPIIYPCFSQEFKKAFQNVL 353          
BLAST of Octopamine receptor vs. Ensembl Zebrafish
Match: adra1ab (adrenoceptor alpha 1Ab [Source:ZFIN;Acc:ZDB-GENE-060503-384])

HSP 1 Score: 167.548 bits (423), Expect = 8.355e-46
Identity = 120/387 (31.01%), Postives = 182/387 (47.03%), Query Frame = 3
Query:  261 IFGNIFVIFGVATIWKLKRSVTTNFIISLAISDLLLGAFVLPFSSTTELLKQTWIFGYKICHLWLAVDVLLSTASIYNLVIIGLDRYLAICWPFKYPVLMNNSKAKFLVGFVWIFSFIICSPTIQLIFSDSTSISYNNSLFPSKIHEKYIRINSSMCSIKNSNKYYKVYSAFGSFYIPLVILIFFYTRIFTKVNENFRNIHKGTIKIDQSSIENCMRIHKGIVLNQKPKRATNRFPDNHNNDKHEMLKRKISSPVVKVTTDECSTPARTSTTDNQPLLKVRXXXXXXXXXXXXXXTLALSYKTKRLFNKISSETKAARMLGVICGAFIVCWLPFF-SWYLTSAFVELDEASTIFSVFFWLGYVNSALNPIIYVIWSKNFRQAFKTLL 1418
            + GNI VI  VA    L RSVT  FI +LAI+DLLL + VLPFS+ +E L + W+FG  +C+ W A+DVL  TASI +L +I +DR +A+ +P +YP      +A   V  +W  S  I                   S+ P     + +  + S+C + N +  Y ++SA  SFY+PL +++  Y R++          HK T  + +S   N +   +G+ L    ++A N      +  K + ++ K S                                                +   RL  K S E KAA+ LG++ G F++CWLPFF    ++S F        +F + FWLGY NS LNPIIY  +S+ F++AF+ +L
Sbjct:   51 VMGNILVILSVACHRNL-RSVTHYFIGNLAIADLLLSSVVLPFSAVSEALGR-WVFGRHLCNAWTALDVLCCTASILSLCVISVDRCMAVSYPLQYPSFATGRRAMTAVAALWALSAAI-------------------SVGPLFGWREPMPEDESVCRV-NEDPGYAIFSAACSFYVPLAVILAMYCRVYVVAR------HK-TRAMSKSRETNGLS-EQGMTLRIHCRKAQN------DTRKEDAMRLKNSH-----------------------------------------------FAFMRLL-KFSREKKAAKTLGIVVGCFVLCWLPFFLVLPISSIFPSHRPPDAVFKITFWLGYFNSCLNPIIYPCFSQEFKKAFQNVL 353          
BLAST of Octopamine receptor vs. Ensembl Xenopus
Match: ENSXETT00000011711.1 (adrenoceptor alpha 1B [Source:NCBI gene;Acc:100488806])

HSP 1 Score: 180.644 bits (457), Expect = 5.060e-50
Identity = 132/421 (31.35%), Postives = 202/421 (47.98%), Query Frame = 3
Query:  219 VLIALGLIVFNLVVIFGNIFVIFGVATIWKLKRSVTTNF-IISLAISDLLLGAFVLPFSSTTELLKQTWIFGYKICHLWLAVDVLLSTASIYNLVIIGLDRYLAICWPFKYPVLMNNSKAKFLVGFVWIFSFIICSPTIQLIFSDSTSISYNNSLFPSKIHEKYIRINSSMCSIKNSNKYYKVYSAFGSFYIPLVILIFFYTRIFTKVNENFRNIHKGTIKIDQSSIENCMRIHKGIVLNQKPKRATNRFPDNHNNDKHEMLKRKISSPVVKVTTDECSTPARTSTTDNQPLLKVRXXXXXXXXXXXXXXTLALSYKTKRLFNKISSETKAARMLGVICGAFIVCWLPFFSWYLTSAFVE-LDEASTIFSVFFWLGYVNSALNPIIYVIWSKNFRQAF-KTLLCRIF**KNNVYQFYHLSP 1472
            +L+   L  F  V I GNI VI  V T  +L+  + TN+ I++LAI+DLLL + VLPFS+T E++   W+FG  +C +W A+DVL  TASI++L  I +DRY+ +    +YP ++   +    +  VW+FS +I                   S+ P    ++    ++ +C I  +  +Y ++S+  SFYIPL++++  Y R++       +N+  G +K    S E  +RIH             N+  D+ NN K +                           +NQP                     ALS K      K S E KAA+ LG++ G FI+CWLPFF+    S+  E L    T+  + FWLGY NS +NPIIY   SK F++AF + L C+    KN+ ++     P
Sbjct:   45 MLLGFTLGAFISVAIIGNIMVIISVVTNKQLR--IPTNYLIVNLAIADLLLSSTVLPFSATKEIVGY-WVFGRILCDVWAAMDVLCCTASIFSLCTISIDRYIGVRHSLRYPTIVTRKRTILALLGVWMFSTVI-------------------SIGPLLGWKEPAPPDTYVCEI-TTEIFYAIFSSLASFYIPLIVILVMYCRVYVVAKRITKNLEAGVMKERMDSKELTLRIH-----------CRNKQDDSPNNSKVQ---------------------------NNQP-------------------RSALSLK----LLKFSREKKAAKTLGIVVGMFILCWLPFFTVLPLSSLSEHLTPPVTLEKIIFWLGYFNSCINPIIYPCSSKEFKRAFIRILKCQWGNRKNSAFRRSQYRP 381          
BLAST of Octopamine receptor vs. Ensembl Xenopus
Match: efr3b (EFR3 homolog B [Source:Xenbase;Acc:XB-GENE-6033491])

HSP 1 Score: 169.859 bits (429), Expect = 4.343e-46
Identity = 127/408 (31.13%), Postives = 196/408 (48.04%), Query Frame = 3
Query:  204 INISFVLIALGLI--VFNLVVIFGNIFVIFGVATIWKLKRSVTTNFIISLAISDLLLGAFVLPFSSTTELLKQTWIFGYKICHLWLAVDVLLSTASIYNLVIIGLDRYLAICWPFKYPVLMNNSKAKFLVGFVWIFSFIICSPTIQLIFSDSTSISYNNSLFPSKIHEKYIRINSSMCSIKNSNKYYKVYSAFGSFYIPLVILIFFYTRIFTKVNENFRNIHKGTIKIDQSSIENCMRIHKGIVLNQKPKRATNRFPDNHNNDKHEMLKRKISSPVVKVTTDECSTPARTSTTDNQPLLKVRXXXXXXXXXXXXXXTLALSYKTKRLFNKISSETKAARMLGVICGAFIVCWLPFF-SWYLTSAFVELDEASTIFSVFFWLGYVNSALNPIIYVIWSKNFRQAFKTLL 1418
            INIS  ++ +G+I  VF    + GNI VI  VA    L+ +VT  FI +LA++DLLL + VLPFS+T E+ +  W+FG   C++W AVDVL  TASI +L  I +DRY+ + +P +YP +M   +    +  +W+ S +I   +I  +F             P+   +K       +C I     Y  ++SAFGSFY+PL I++  Y R++       + +  G            M++ K                    +D  E+  R     + + +T E  +   TS++  +    VR                           K S E KAA+ LG++ G F++CWLPFF    + S +   + + TIF + FWLGY NS +NP+IY   S  FR+AF+ +L
Sbjct:   45 INISKAIV-VGVIFGVFITFGVLGNILVILSVACHRHLQ-TVTHYFIANLAVADLLLMSMVLPFSATFEI-QGYWLFGRIFCNIWAAVDVLCCTASIMSLCAISIDRYIGVSYPLRYPSIMTEKRGVLALLCIWVLSLVI---SIGPLFGWKQ---------PAPEDDK-------ICEITKEPGY-ALFSAFGSFYLPLSIILVMYFRVYIVAKRESKVLTSG------------MKLEK--------------------SDSEEVTLR-----IHRKSTPE--SIGSTSSSKQKTQFSVRLL-------------------------KFSREKKAAKTLGIVVGCFVLCWLPFFLVMPIGSIYPPANSSDTIFKITFWLGYFNSCINPVIYPCSSPEFRKAFQNIL 365          
BLAST of Octopamine receptor vs. Ensembl Xenopus
Match: HTR1F (5-hydroxytryptamine (serotonin) receptor 1F, G protein-coupled [Source:NCBI gene;Acc:100494586])

HSP 1 Score: 150.214 bits (378), Expect = 5.068e-40
Identity = 125/411 (30.41%), Postives = 184/411 (44.77%), Query Frame = 3
Query:  219 VLIALGLIVFNLVVIFGNIFVIFGVATIWKLKRSVTTNFII-SLAISDLLLGAFVLPFSSTTELLKQTWIFGYKICHLWLAVDVLLSTASIYNLVIIGLDRYLAICWPFKYPVLMNNSKAKFLVGFVWIFSFIICSPTIQLIFSDSTSISYNNSLFPSKIHEKYIRINSSMCSIKNSNKYYKVYSAFGSFYIPLVILIFFYTRIFTKVNENFRNIHKGTIKIDQSSIENCMRIHKGIVLNQKPKR---ATNRFPDNHNN-DKHEMLKRKISSPVVKVTTDECSTPARTSTTDNQPLLKVRXXXXXXXXXXXXXXTLALSYKTKRLFNKISS--ETKAARMLGVICGAFIVCWLPFFSWYLTSAFVELDEASTIFSVFF-WLGYVNSALNPIIYVIWSKNFRQAFKTLL-CR 1424
            +LI+L L +  L+    N  VI  +    KL      N++I SLA++D L+   V+PFS    ++K+TWI G  IC +WL+VD+   T SI +L  I LDRY AI    +Y        A F++  VWI S  I  P    +F    +++  +                  C IK+ +  + +YS FG+FYIPL +++  Y +I+      +   HK ++    S +E   R   G VL         A   F D+  + DK  +  R                 AR      +   K                             KISS  E KAA  LG+I GAF++CWLPFF   +     E    S   S F  WLGY+NS +NP+IY I++++F++AF+ L+ CR
Sbjct:   24 ILISLTLSILTLMTTAINSLVIAAIIVTRKLHHP--ANYLICSLAVTDFLVAVLVMPFS-IMYIMKETWIMGQAICDIWLSVDITCCTCSILHLSAIALDRYRAITDAVEYARKRTPKHAAFMIAVVWIISIFISMPP---LFWRHQALNKEDE-----------------CIIKHDHIVFTIYSTFGAFYIPLALILILYYKIYKAAKTLY---HKRSV----SRVE---REQNGQVLLDATTTLCIAEKSFSDHSTDFDKIHITVRN----------------ARVEMKQEKAYRK----------------------------QKISSTRERKAATTLGLILGAFVICWLPFFVKEVIVNICESCYISDDMSNFLTWLGYLNSLINPLIYTIFNEDFKKAFQKLMRCR 357          
BLAST of Octopamine receptor vs. Ensembl Xenopus
Match: exd2 (exonuclease 3'-5' domain containing 2 [Source:Xenbase;Acc:XB-GENE-5752408])

HSP 1 Score: 150.984 bits (380), Expect = 1.378e-39
Identity = 118/411 (28.71%), Postives = 184/411 (44.77%), Query Frame = 3
Query:  207 NISFVLIALGLIVFNLVVIFGNIFVIFGVATIWKLKRSVTTNFIISLAISDLLLGAFVLPFSSTTELLKQTWIFGYKICHLWLAVDVLLSTASIYNLVIIGLDRYLAICWPFKYPVLMNNSKAKFLVGFVWIFSFIICSPTIQLIFSDSTSISYNNSLFPSKIHEKYIRINSSMCSIKNSNKYYKVYSAFGSFYIPLVILIFFYTRIFTKVNENFRNIHKGTIKIDQSSIENCMRIHKGIVLNQKPKRATNRFPDNHNNDKHEMLKRKISSPVVKVTTDECSTPARTSTTDNQPLLKVRXXXXXXXXXXXXXXTLALSYKTKRLFNKISSETKAARMLGVICGAFIVCWLPFFSWYLTSAFVELDEASTI----FSVFFWLGYVNSALNPIIYVIWSKNFRQAFKTLL-CR 1424
            +I  ++I   L +  L+ I GN  V+  V  + KL R  +   I+SLA++DL +   V+PF S T+L+   WIFG+  C++++A+DV+  TASI  L +I +DRYL I  P  YPV  N      ++  VW+ S    S T+  +F  + +++                 +  +C I + +  Y +YS   +FYIP+ +++F Y RIF K  +     HK T                G+    +P+ +      N N   H+              ++EC+  ++    D                            K   +F +   E KAA  LG+I GAF +CWLPFF       F+   E S I       F WLGY NS +NP IY  ++++ R  ++ LL CR
Sbjct:   75 HIEKLVIGAILSLITLLTIAGNCLVVISVCFVKKL-RQPSNYLIVSLALADLSVAIAVMPFVSVTDLIGGEWIFGHVFCNVFIAMDVMCCTASIMTLCVISIDRYLGITRPLTYPVRQNGRCMAKMILCVWLLS---ASITLPPLFGWAQNVN-----------------DDKVCLI-SQDFGYTIYSTAVAFYIPMSVMLFMYYRIF-KAAKRSAAKHKFT----------------GL---PRPEESEGMISANGNVKTHK-------------ESEECTNLSKLLRNDR---------------------------KNISIFKR---EQKAATTLGIIVGAFTICWLPFFLLSTARPFICGTECSCIPLWLERTFLWLGYANSLINPFIYAFFNRDLRTTYRNLLQCR 400          
BLAST of Octopamine receptor vs. Ensembl Xenopus
Match: adra2c (adrenoceptor alpha 2C [Source:NCBI gene;Acc:100145449])

HSP 1 Score: 147.902 bits (372), Expect = 1.791e-38
Identity = 123/413 (29.78%), Postives = 198/413 (47.94%), Query Frame = 3
Query:  237 LIVFNLVVIFGNIFVIFGVATIWKLKRSVTTNFIISLAISDLLLGAFVLPFSSTTELLKQTWIFGYKICHLWLAVDVLLSTASIYNLVIIGLDRYLAICWPFKYPVLMNNSKAKFLVGFVWIFSFIICSPTIQLIFSDSTSISYNNSLFPSKIHEKYIRINSSMCSIKNSNKYYKVYSAFGSFYIPLVILIFFYTRIFTKVNENFRNIHKGTIKIDQSS-IENCMRIHKGIVLNQKPKRATNRFPDNHNNDKHEMLKRKISSPVVKVTTDECSTPARTSTTDNQPLLKVRXXXXXXXXXXXXXXTLALSYKTKRLFNKIS------------SETKAAR---MLGVICGAFIVCWLPFF-SWYLTSAFVELDE-ASTIFSVFFWLGYVNSALNPIIYVIWSKNFRQAFKTLLC 1421
            LI+F +V   GN+FV+  V T   LK +    F++SLA +D+L+ A V+PFS   EL+   W FG   C ++LA+DVL  T+SI +L  I LDRY ++    +Y +     + K ++  VW+ S +I  P +  +  D+      + ++P              C + N + +Y + S  GSF+ P +I+I  Y RI+       R + +     D SS  EN     KG  +     +     P   +  K   ++           +    + ++   TD+    K  K +S  K   ++S T   S K+  LF+               S+ +  R   +L V+ G F+VCW PFF S+ L     E  E   T+F  FFW+GY NS+LNP+IY I++++FR++FK ++C
Sbjct:   41 LIIFTIV---GNVFVVIAVLTSRALK-APQNLFLVSLASADILVAALVMPFSLANELMGY-WYFGNVWCDIYLALDVLFCTSSIVHLCAISLDRYWSVTQAVEYNLKRTPRRIKGIIVTVWLISAVISFPPLISMDRDT-----EDDVYP-------------QCKL-NDDTWYILSSCIGSFFAPCIIMILVYIRIYQVAKLRTRTLSEKKPTRDGSSHTEN--GFSKGTTVKMPGDKENGHCPPRPSPPKATDVEDLELEESSMSESKRRKSSSKEDNTDSSKERKCSKGNSFSKQSSRLSRT---SNKSMELFSSRKKKKRSSVSRRKLSQAREKRFTFVLAVVMGVFVVCWFPFFFSYSLYGICREACEVPETLFKFFFWIGYCNSSLNPVIYTIFNQDFRRSFKKIIC 424          
BLAST of Octopamine receptor vs. Ensembl Mouse
Match: Adra1b (adrenergic receptor, alpha 1b [Source:MGI Symbol;Acc:MGI:104774])

HSP 1 Score: 178.333 bits (451), Expect = 1.520e-49
Identity = 131/401 (32.67%), Postives = 187/401 (46.63%), Query Frame = 3
Query:  225 IALGLIV--FNLVVIFGNIFVIFGVATIWKLKRSVTTNFIISLAISDLLLGAFVLPFSSTTELLKQTWIFGYKICHLWLAVDVLLSTASIYNLVIIGLDRYLAICWPFKYPVLMNNSKAKFLVGFVWIFSFIICSPTIQLIFSDSTSISYNNSLFPSKIHEKYIRINSSMCSIKNSNKYYKVYSAFGSFYIPLVILIFFYTRIFTKVNENFRNIHKGTIKIDQSSIENCMRIHKGIVLNQKPKRATNRFPDNHNNDKHEMLKRKISSPVVKVTTDECSTPARTSTTDNQPLLKVRXXXXXXXXXXXXXXTLALSYKTKRLFNKISSETKAARMLGVICGAFIVCWLPFF-SWYLTSAFVELDEASTIFSVFFWLGYVNSALNPIIYVIWSKNFRQAFKTLL 1418
            I++GL++  F L  I GNI VI  VA    L R+ T  FI++LAI+DLLL   VLPFS+T E+L   W+ G   C +W AVDVL  TASI +L  I +DRY+ + +  +YP L+   KA   +  VW+ S +I                   S+ P    ++    +   C +     +Y ++S+ GSFYIPL +++  Y R++       +N+  G +K   +S E  +RI                    H+ + HE                   T + T    + P   +                        +LF K S E KAA+ LG++ G FI+CWLPFF +  L S F  L     +F V FWLGY NS LNPIIY   SK F++AF  +L
Sbjct:   46 ISVGLVLGAFILFAIVGNILVILSVACNRHL-RTPTNYFIVNLAIADLLLSFTVLPFSATLEVLGY-WVLGRIFCDIWAAVDVLCCTASILSLCAISIDRYIGVRYSLQYPTLVTRRKAILALLSVWVLSTVI-------------------SIGPLLGWKEPAPNDDKECGV-TEEPFYALFSSLGSFYIPLAVILVMYCRVYIVAKRTTKNLEAGVMKEMSNSKELTLRI--------------------HSKNFHE------------------DTLSSTKAKGHNPRSSIAV----------------------KLF-KFSREKKAAKTLGIVVGMFILCWLPFFIALPLGSLFSTLKPPDAVFKVVFWLGYFNSCLNPIIYPCSSKEFKRAFMRIL 363          
BLAST of Octopamine receptor vs. Ensembl Mouse
Match: Adra1b (adrenergic receptor, alpha 1b [Source:MGI Symbol;Acc:MGI:104774])

HSP 1 Score: 169.474 bits (428), Expect = 7.364e-46
Identity = 130/401 (32.42%), Postives = 184/401 (45.89%), Query Frame = 3
Query:  225 IALGLIV--FNLVVIFGNIFVIFGVATIWKLKRSVTTNFIISLAISDLLLGAFVLPFSSTTELLKQTWIFGYKICHLWLAVDVLLSTASIYNLVIIGLDRYLAICWPFKYPVLMNNSKAKFLVGFVWIFSFIICSPTIQLIFSDSTSISYNNSLFPSKIHEKYIRINSSMCSIKNSNKYYKVYSAFGSFYIPLVILIFFYTRIFTKVNENFRNIHKGTIKIDQSSIENCMRIHKGIVLNQKPKRATNRFPDNHNNDKHEMLKRKISSPVVKVTTDECSTPARTSTTDNQPLLKVRXXXXXXXXXXXXXXTLALSYKTKRLFNKISSETKAARMLGVICGAFIVCWLPFF-SWYLTSAFVELDEASTIFSVFFWLGYVNSALNPIIYVIWSKNFRQAFKTLL 1418
            I++GL++  F L  I GNI VI  VA    L R+ T  FI++LAI+DLLL   VLPFS+T E+L   W+ G   C +W AVDVL  TASI +L  I +DRY+ + +  +YP L+   KA   +  VW+ S +I                   S+ P    ++    +   C +     +Y ++S+ GSFYIPL +++  Y R++         + K T K  ++ +   M   K + L    K        N + D     K K  +P   +                                              +LF K S E KAA+ LG++ G FI+CWLPFF +  L S F  L     +F V FWLGY NS LNPIIY   SK F++AF  +L
Sbjct:   46 ISVGLVLGAFILFAIVGNILVILSVACNRHL-RTPTNYFIVNLAIADLLLSFTVLPFSATLEVLGY-WVLGRIFCDIWAAVDVLCCTASILSLCAISIDRYIGVRYSLQYPTLVTRRKAILALLSVWVLSTVI-------------------SIGPLLGWKEPAPNDDKECGV-TEEPFYALFSSLGSFYIPLAVILVMYCRVYI--------VAKRTTKNLEAGVMKEMSNSKELTLRIHSK--------NFHEDTLSSTKAKGHNPRSSIAV--------------------------------------------KLF-KFSREKKAAKTLGIVVGMFILCWLPFFIALPLGSLFSTLKPPDAVFKVVFWLGYFNSCLNPIIYPCSSKEFKRAFMRIL 363          
BLAST of Octopamine receptor vs. Ensembl Mouse
Match: Adra1b (adrenergic receptor, alpha 1b [Source:MGI Symbol;Acc:MGI:104774])

HSP 1 Score: 169.474 bits (428), Expect = 7.364e-46
Identity = 130/401 (32.42%), Postives = 184/401 (45.89%), Query Frame = 3
Query:  225 IALGLIV--FNLVVIFGNIFVIFGVATIWKLKRSVTTNFIISLAISDLLLGAFVLPFSSTTELLKQTWIFGYKICHLWLAVDVLLSTASIYNLVIIGLDRYLAICWPFKYPVLMNNSKAKFLVGFVWIFSFIICSPTIQLIFSDSTSISYNNSLFPSKIHEKYIRINSSMCSIKNSNKYYKVYSAFGSFYIPLVILIFFYTRIFTKVNENFRNIHKGTIKIDQSSIENCMRIHKGIVLNQKPKRATNRFPDNHNNDKHEMLKRKISSPVVKVTTDECSTPARTSTTDNQPLLKVRXXXXXXXXXXXXXXTLALSYKTKRLFNKISSETKAARMLGVICGAFIVCWLPFF-SWYLTSAFVELDEASTIFSVFFWLGYVNSALNPIIYVIWSKNFRQAFKTLL 1418
            I++GL++  F L  I GNI VI  VA    L R+ T  FI++LAI+DLLL   VLPFS+T E+L   W+ G   C +W AVDVL  TASI +L  I +DRY+ + +  +YP L+   KA   +  VW+ S +I                   S+ P    ++    +   C +     +Y ++S+ GSFYIPL +++  Y R++         + K T K  ++ +   M   K + L    K        N + D     K K  +P   +                                              +LF K S E KAA+ LG++ G FI+CWLPFF +  L S F  L     +F V FWLGY NS LNPIIY   SK F++AF  +L
Sbjct:   46 ISVGLVLGAFILFAIVGNILVILSVACNRHL-RTPTNYFIVNLAIADLLLSFTVLPFSATLEVLGY-WVLGRIFCDIWAAVDVLCCTASILSLCAISIDRYIGVRYSLQYPTLVTRRKAILALLSVWVLSTVI-------------------SIGPLLGWKEPAPNDDKECGV-TEEPFYALFSSLGSFYIPLAVILVMYCRVYI--------VAKRTTKNLEAGVMKEMSNSKELTLRIHSK--------NFHEDTLSSTKAKGHNPRSSIAV--------------------------------------------KLF-KFSREKKAAKTLGIVVGMFILCWLPFFIALPLGSLFSTLKPPDAVFKVVFWLGYFNSCLNPIIYPCSSKEFKRAFMRIL 363          
BLAST of Octopamine receptor vs. Ensembl Mouse
Match: Adra1d (adrenergic receptor, alpha 1d [Source:MGI Symbol;Acc:MGI:106673])

HSP 1 Score: 159.458 bits (402), Expect = 7.203e-42
Identity = 118/408 (28.92%), Postives = 182/408 (44.61%), Query Frame = 3
Query:  189 VQRMEINISFVLIALGLIVFNLVVIFGNIFVIFGVATIWKLKRSVTTNFIISLAISDLLLGAFVLPFSSTTELLKQTWIFGYKICHLWLAVDVLLSTASIYNLVIIGLDRYLAICWPFKYPVLMNNSKAKFLVGFVWIFSFIICSPTIQLIFSDSTSISYNNSLFPSKIHEKYIRINSSMCSIKNSNKYYKVYSAFGSFYIPLVILIFFYTRIFTKVNENFRNIHKGTIKIDQSSIENCMRIH-KGIVLNQKPKRATNRFPDNHNNDKHEMLKRKISSPVVKVTTDECSTPARTSTTDNQPLLKVRXXXXXXXXXXXXXXTLALSYKTKRLFNKISSETKAARMLGVICGAFIVCWLPFF-SWYLTSAFVELDEASTIFSVFFWLGYVNSALNPIIYVIWSKNFRQAF 1406
            V  + ++   V + + L  F L  + GN+ VI  VA    L+ +VT  FI++LA++DLLL A VLPFS+T E+L   W FG   C +W AVDVL  TASI +L  I +DRY+ +    KYP +M   K                      I +   +++   S+ P    ++ +  +   C I      Y ++S+  SFY+P+ +++  Y R++       R++  G  +    + E  +RIH +G   + K        P   ++  H +                     R+S       L VR                           K S E KAA+ L ++ G F++CW PFF    L S F +L  +  +F V FWLGY NS +NP+IY   S+ F++AF
Sbjct:   81 VGGLVVSAQGVGVGVFLAAFILTAVAGNLLVILSVACNRHLQ-TVTNYFIVNLAVADLLLSAAVLPFSATMEVLG-FWAFGRTFCDVWAAVDVLCCTASILSLCTISVDRYVGVRHSLKYPAIMTERK-------------------AAAILALLWAVALVVSVGPLLGWKEPVPPDERFCGI-TEEVGYAIFSSVCSFYLPMAVIVVMYCRVYVVARSTTRSLEAGIKREPGKASEVVLRIHCRGAATSAKGN------PGTQSSKGHTL---------------------RSS-------LSVRLL-------------------------KFSREKKAAKTLAIVVGVFVLCWFPFFFVLPLGSLFPQLKPSEGVFKVIFWLGYFNSCVNPLIYPCSSREFKRAF 407          
BLAST of Octopamine receptor vs. Ensembl Mouse
Match: Htr1a (5-hydroxytryptamine (serotonin) receptor 1A [Source:MGI Symbol;Acc:MGI:96273])

HSP 1 Score: 153.295 bits (386), Expect = 1.156e-40
Identity = 125/421 (29.69%), Postives = 195/421 (46.32%), Query Frame = 3
Query:  231 LGLIVFNLVVIFGNIFVIFGVATIWKLKRSVT--TNFII-SLAISDLLLGAFVLPFSSTTELLKQTWIFGYKICHLWLAVDVLLSTASIYNLVIIGLDRYLAICWPFKYPVLMNNSKAKFLVGFVWIFSFIICSPTIQLIFSDSTSISYNNSLFPSKIHEKYIRINSSMCSIKNSNKYYKVYSAFGSFYIPLVILIFFYTRIFTKVNENFRNIHKGTIKIDQSSIENCMRIHKGIVLNQKPKRATNRFPDNHNNDKHEMLKRKISSPVVKVTTDECSTPARTSTTDNQPL--LKVRXXXXXXXXXXXXXXTLALSYKTKRLFNK------------ISSETKAARMLGVICGAFIVCWLPFFSWYLTSAFVE--LDEASTIFSVFFWLGYVNSALNPIIYVIWSKNFRQAFKTLL----CR 1424
            LG ++F    + GN  V+  +A    L+RS+    N++I SLA++DL++   VLP ++  ++L + W  G   C L++A+DVL  T+SI +L  I LDRY AI  P  Y       +A  L+   W+  F+I  P                 +   +  E   R N + C+I   +  Y +YS FG+FYIPL++++  Y RIF      FR I K   K+++           G      PK++ N  P +  + +     R + +P        C+  A     D+  L  ++V +  +        S + A SY    L  K            ++ E K  + LG+I G FI+CWLPFF   L   F E        + ++  WLGY NS LNP+IY  ++K+F+ AFK ++    CR
Sbjct:   43 LGTLIF--CAVLGNACVVAAIA----LERSLQNVANYLIGSLAVTDLMVSVLVLPMAALYQVLNK-WTLGQVTCDLFIALDVLCCTSSILHLCAIALDRYWAITDPIDYVNKRTPRRAAALISLTWLIGFLISIP----------------PMLGWRTPED--RSNPNECTISKDHG-YTIYSTFGAFYIPLLLMLVLYGRIFRAA--RFR-IRKTVKKVEKKGAGTSF----GTSSAPPPKKSLNGQPGS-GDCRRSAENRAVGTP--------CANGAVRQGEDDATLEVIEVHRVGNSKGHLPLPSESGATSYVPACLERKNERTAEAKRKMALARERKTVKTLGIIMGTFILCWLPFFIVALVLPFCESSCHMPELLGAIINWLGYSNSLLNPVIYAYFNKDFQNAFKKIIKCKFCR 421          
BLAST of Octopamine receptor vs. UniProt/SwissProt
Match: sp|Q93126|GPR9_AMPAM (Probable G-protein coupled receptor No9 OS=Amphibalanus amphitrite OX=1232801 PE=3 SV=1)

HSP 1 Score: 230.335 bits (586), Expect = 6.503e-68
Identity = 152/428 (35.51%), Postives = 222/428 (51.87%), Query Frame = 3
Query:  231 LGLIVFNLVVIFGNIFVIFGVATIWKLKRSVTTNFIISLAISDLLLGAFVLPFSSTTELLKQTWIFGYKICHLWLAVDVLLSTASIYNLVIIGLDRYLAICWPFKYPVLMNNSKAKFLVGFVWIFSFIICSPTIQLIFSDSTSISYNN---SLFPSKIHEKYIRINSSMCSIK---NSNKYYKVYSAFGSFYIPLVILIFFYTRIFTKVNENFRNIHKG--TIKIDQSSIENCMRIHKGIVLNQKPK-------------RATNRFPDNHNNDK-------HEMLKRKISSPVVKVTTDECSTPARTSTTDNQPLLKVRXXXXXXXXXXXXXXTLALSYK--TKRLFNKISSETKAARMLGVICGAFIVCWLPFFSWYLTSAFVELDEASTIFSVFFWLGYVNSALNPIIYVIWSKNFRQAFKTLLCR 1424
            L L   NL+V+ GN+ V+  V    KL R+VT  FI+SLA +DLL+G  VLPFS+T E+L   W++G   C +WLAVDV + T+SI NL  I LDRYLA+  P  YP LM+  +AK L+  VW+ SF+IC P +         + +N+   +L  S+         SS C +     + + Y +YSA GSF++P  +++FFY RI+       R I +G  T K D+      +RIH+G  + Q+ +             R T   P     +K        E  + K    +  V   + S P R      +P  K+   S   + D +    ++   +   +    +   ETKAA+ +G+I G FI+CWLPFF  YL   F        +FSVFFWLGY NSA+NP +Y + S++FR AF ++LC+
Sbjct:   38 LALAFLNLMVVAGNLLVVMAVFVHSKL-RTVTNLFIVSLACADLLVGMLVLPFSATLEVL-DVWLYGDVWCSVWLAVDVWMCTSSILNLCAISLDRYLAVSQPISYPSLMSTRRAKQLIAAVWVLSFVICFPPL---------VGWNDRPGTLIGSR--------GSSACRLTCELTNERGYVIYSALGSFFLPSTVMLFFYGRIYRTAVSTTRAIAQGFRTTKEDEEG-RLTLRIHRGRSVTQRAEQAAAGGARAHGQVRLTLSEPGARRQNKPSFVVHCREDSRAKNQYEIYTVVEGD-SRPGRRVPQPQRPAKKLSSASQSSEDDSRPPRFISRVSRRNVRHQARRFRMETKAAKTVGIIVGLFILCWLPFFVCYLVRGFCADCVPPLLFSVFFWLGYCNSAVNPCVYALCSRDFRFAFSSILCK 444          
BLAST of Octopamine receptor vs. UniProt/SwissProt
Match: sp|Q91175|ADA1A_ORYLA (Alpha-1A adrenergic receptor OS=Oryzias latipes OX=8090 GN=adra1a PE=3 SV=1)

HSP 1 Score: 177.563 bits (449), Expect = 2.578e-48
Identity = 126/411 (30.66%), Postives = 195/411 (47.45%), Query Frame = 3
Query:  201 EIN-ISFVLIALGLIVFNLVVIFGNIFVIFGVATIWKLKRSVTTNFIISLAISDLLLGAFVLPFSSTTELLKQTWIFGYKICHLWLAVDVLLSTASIYNLVIIGLDRYLAICWPFKYPVLMNNSKAKFLVGFVWIFSFIICSPTIQLIFSDSTSISYNNSLFPSKIHEKYIRINSSMCSIKNSNKYYKVYSAFGSFYIPLVILIFFYTRIFTKVNENFRNIHKGTIKIDQSSIENCMRIHKGIVLNQKPKRATNRFPDNHNNDKHEMLKRKISSPVVKVTTDECSTPARTSTTDNQPLLKVRXXXXXXXXXXXXXXTLALSYKTK---RLFNKISSETKAARMLGVICGAFIVCWLPFF-SWYLTSAFVELDEASTIFSVFFWLGYVNSALNPIIYVIWSKNFRQAFKTLL 1418
            E+N +  V++ + L +F L  + GNI VI  V     L+ +VT  FI++LA++DLLL + VLPFS+  E+L + W+FG   C++W AVDVL  TASI +L +I +DRY+ + +P +YP +M   +A   V  +W+ S II                   S+ P    ++    + ++C I      Y ++SA GSFY+PL I++  Y R++                                V+ QK  R          +D  +++ R +      V+ DE                                   AL  +T    RL  K S E KAA+ LG++ G F++CWLPFF    + S F     + T+F + FWLGY NS +NPIIY+  ++ F++AF++LL
Sbjct:   20 ELNTVKAVVLGMVLGIFILFGVIGNILVILSVVCHRHLQ-TVTYYFIVNLAVADLLLSSTVLPFSAIFEILDR-WVFGRVFCNIWAAVDVLCCTASIMSLCVISVDRYIGVSYPLRYPAIMTKRRALLAVMLLWVLSVII-------------------SIGPLFGWKEPAPEDETVCKI-TEEPGYAIFSAVGSFYLPLAIILAMYCRVY--------------------------------VVAQKESRGLKEGQKIEKSDSEQVILR-MHRGNTTVSEDE-----------------------------------ALRSRTHFALRLL-KFSREKKAAKTLGIVVGCFVLCWLPFFLVLPIGSIFPAYRPSDTVFKITFWLGYFNSCINPIIYLCSNQEFKKAFQSLL 339          
BLAST of Octopamine receptor vs. UniProt/SwissProt
Match: sp|Q24563|DOPR2_DROME (Dopamine receptor 2 OS=Drosophila melanogaster OX=7227 GN=Dop1R2 PE=2 SV=1)

HSP 1 Score: 176.022 bits (445), Expect = 3.467e-47
Identity = 130/396 (32.83%), Postives = 194/396 (48.99%), Query Frame = 3
Query:  261 IFGNIFVIFGVATIWKLKRSVTTNFIISLAISDLLLGAFVLPFSSTTELLKQTWIFGYKICHLWLAVDVLLSTASIYNLVIIGLDRYLAICWPFKYPVLMNNSKAKFLVGFVWIFSFIICSPTIQLIFSDSTSISYNNSLFPSKIHEKYIRINSSMCSIK---NSNKYYKVYSAFGSFYIPLVILIFFYTRIFTKVNENFRNIHKGTIKIDQSS--IENCMRIHKGIVLNQKPKRA--TNRFPDNHNNDKHEMLKRKISSPVVKVTTDECSTPARTSTTDNQPLLKVRXXXXXXXXXXXXXXTLALSYKTKRLFNKISSETKAARMLGVICGAFIVCWLPFFSWYLTSAF-VELDEASTIFS-VFFWLGYVNSALNPIIYVIWSKNFRQAFKTLLC 1421
            +FGN  VI  V     L  + T  FI SLA++D L+G  V+PFS+  E+L+ TW FG   C +W ++DVL STASI NL +I LDRY AI  PF YP+ M   +A  L+  VWI     CS  I                FP+ +  +  R +  M + K     +  Y V+S+  SFY+PL++++F Y RI+       R++  GT ++  +S  ++  +RIH+G     +  +                 +      S          +T +     D++PL  +                +  ++   R   K + E KAA+ LG++ G FI+CWLPFF   L S F +E  E   I S +  WLG++NS +NP+IY  WS++FR+AF  LLC
Sbjct:  123 VFGNSLVILAVIRERYLH-TATNYFITSLAVADCLVGLVVMPFSALYEVLENTWFFGTDWCDIWRSLDVLFSTASILNLCVISLDRYWAITDPFSYPMRMTVKRAAGLIAAVWI-----CSSAIS---------------FPAIVWWRAAR-DGEMPAYKCTFTEHLGYLVFSSTISFYLPLLVMVFTYCRIYRAAVIQTRSLKIGTKQVLMASGELQLTLRIHRGGTTRDQQNQVSGGGGGGGGGGGGGGSLSHSHSHSHHHHHNHGGGTTTSTPEEPDDEPLSALHNNGLARHRH------MGKNFSLSRKLAKFAKEKKAAKTLGIVMGVFIICWLPFFVVNLLSGFCIECIEHEEIVSAIVTWLGWINSCMNPVIYACWSRDFRRAFVRLLC 490          
BLAST of Octopamine receptor vs. UniProt/SwissProt
Match: sp|Q25188|OAR_HELVI (Octopamine receptor OS=Heliothis virescens OX=7102 PE=2 SV=1)

HSP 1 Score: 174.481 bits (441), Expect = 4.296e-47
Identity = 139/441 (31.52%), Postives = 205/441 (46.49%), Query Frame = 3
Query:  225 IALGLIVFNLVVIFGNIFVIFGVATIWKLKRSVTTNFIISLAISDLLLGAFVLPFSSTTELLKQTWIFGYKICHLWLAVDVLLSTASIYNLVIIGLDRYLAICWPFKYPVLMNNSKAKFLVGFVWIFSFIICSPTIQLIFSDSTSISYNNSLFPSKIHEKYIRINSSMCSIKNSNKYYKVYSAFGSFYIPLVILIFFYTRIFTKVNENFRNIHKGTIKI-----------------DQSSI--ENCMRIHKGIVL----NQKPKRATNRFPDNHNNDKH----EMLKRKISSPVV-----------KVTTDECSTPARTSTTDNQPLLKVRXXXXXXXXXXX---XXXTLALSYKTKRLFNKISSETKAARMLGVICGAFIVCWLPFFSWYLTSAFVELDEASTIFSVFF-WLGYVNSALNPIIYVIWSKNFRQAFKTLLC 1421
            I L LI+ + +V  GNI VI  V T +K  R V   FI+SLA++DL +   VLP +    +L Q W+FG  +C +WL  D++  T+SI NL  I LDRY AI  P  Y       +   ++G VW+ S II SP +         + +N+  +P            + C +  S   + ++S+ GSFYIPLVI+   Y  I+    +  R+  K T KI                 DQ S+  E     H+G+      N+K KR     P      K+    +  + K+  P++            +     S+ + +  T    L++V +         K      +    +  ++    ++ E +AAR LG+I G F+VCWLPFF  YL   F      S  F  F  WLGY NSALNP+IY I++ +FR+AFK LLC
Sbjct:   57 IVLTLIIISTIV--GNILVILSVFT-YKPLRIVQNFFIVSLAVADLTVAILVLPLNVAYSILGQ-WVFGIYVCKMWLTCDIMCCTSSILNLCAIALDRYWAITDPINYAQKRTLERVLLMIGVVWVLSLIISSPPL---------LGWND--WPDVFEP------DTPCRL-TSQPGFVIFSSSGSFYIPLVIMTVVYFEIYLATKKRLRDRAKAT-KISTISSGQNKYNNKDDHHDQDSVSSEANHNEHQGVTRLVSDNEKKKRTRKLTPKKKPKRKYWSKDDKSQNKLIIPILSNENSVTDMGENLENRNTSSESNSKETHEDDLIEVNETVPVKTHHKKPKPNQQSAVYQFIEEKQRISLTRERRAARTLGIIMGVFVVCWLPFFVIYLVIPFCASCCLSNKFINFITWLGYCNSALNPLIYTIFNMDFRRAFKKLLC 474          
BLAST of Octopamine receptor vs. UniProt/SwissProt
Match: sp|Q17232|OAR_BOMMO (Octopamine receptor OS=Bombyx mori OX=7091 PE=2 SV=1)

HSP 1 Score: 171.014 bits (432), Expect = 9.342e-46
Identity = 140/440 (31.82%), Postives = 207/440 (47.05%), Query Frame = 3
Query:  225 IALGLIVFNLVVIFGNIFVIFGVATIWKLKRSVTTNFIISLAISDLLLGAFVLPFSSTTELLKQTWIFGYKICHLWLAVDVLLSTASIYNLVIIGLDRYLAICWPFKYPVLMNNSKAKFLVGFVWIFSFIICSPTIQLIFSDSTSISYNNSLFPSKIHEKYIRINSSMCSIKNSNKYYKVYSAFGSFYIPLVILIFFYTRIFTKVNENFRNIHKGTIKI------------------DQSSIENCMRI--HKG----IVLNQK--------PKRATNRFPDNHNNDKHEMLKRKISSPVVKVT-------TDECSTPARTSTTDNQPLLKVRXXXXXXXXXXXXXXTLALSYKTKRLFNKIS--SETKAARMLGVICGAFIVCWLPFFSWYLTSAF-VELDEASTIFSVFFWLGYVNSALNPIIYVIWSKNFRQAFKTLL 1418
            I L +I+ + VV  GNI VI  V T +K  R V   FI+SLA++DL +   VLP +    +L Q W+FG  +C +WL  D++  T+SI NL  I LDRY AI  P  Y       +  F++G VWI S +I SP +         + +N+  +P            + C +  S   + ++S+ GSFYIPLVI+   Y  I+    +  R+  K T KI                  DQ S+ +      H+G    +  N+K        PK+   R   + ++  H  L   I S    VT           S+ + +  T    ++++ + +          +     Y+      +IS   E +AAR LG+I G F+VCWLPFF  YL   F V    ++   +   WLGYVNSALNP+IY I++ +FR+AFK LL
Sbjct:   59 IILTMIIISTVV--GNILVILSVFT-YKPLRIVQNFFIVSLAVADLTVAILVLPLNVAYSILGQ-WVFGIYVCKMWLTCDIMCCTSSILNLCAIALDRYWAITDPINYAQKRTLERVLFMIGIVWILSLVISSPPL---------LGWND--WPEVFEP------DTPCRL-TSQPGFVIFSSSGSFYIPLVIMTVVYFEIYLATKKRLRDRAKAT-KISTISSGRNKYETKESDPNDQDSVSSDANPNEHQGGTRLVAENEKKHRTRKLTPKKKPKRRYWSKDDKSHNKLIIPILSNENSVTDIGENLENRNTSSESNSKETHEDNMIEITEAAPVKIQKRPKQNQTNAVYQFIEEKQRISLTRERRAARTLGIIMGVFVVCWLPFFVIYLVIPFCVSCCLSNKFINFITWLGYVNSALNPLIYTIFNMDFRRAFKKLL 475          
BLAST of Octopamine receptor vs. TrEMBL
Match: V4A2Q6 (G_PROTEIN_RECEP_F1_2 domain-containing protein OS=Lottia gigantea OX=225164 GN=LOTGIDRAFT_178787 PE=3 SV=1)

HSP 1 Score: 255.758 bits (652), Expect = 1.407e-75
Identity = 162/411 (39.42%), Postives = 231/411 (56.20%), Query Frame = 3
Query:  201 EINISFVLIALGLIVFNLVVIFGNIFVIFGVATIWKLKRSVTTNFIISLAISDLLLGAFVLPFSSTTELLKQTWIFGYKICHLWLAVDVLLSTASIYNLVIIGLDRYLAICWPFKYPVLMNNSKAKFLVGFVWIFSFIICSPTIQLIFSDSTSISYNNSLFPSKIHEKYIRINSSMCSIKNSNKYYKVYSAFGSFYIPLVILIFFYTRIFTKVNENFRNIHKG--TIKIDQSSIEN--CMRIHKG-IVLNQKPKRATNRFPDNHNNDKHEMLKRKISSPVVKVTTDECSTPARTSTTDNQPLLKVRXXXXXXXXXXXXXXTLALSYKTKRLFNKISSETKAARMLGVICGAFIVCWLPFFSWYLTSAFVELDEASTIFSVFFWLGYVNSALNPIIYVIWSKNFRQAFKTLL 1418
            E++  FV+  + L +   VVI GNI VI  V T  KL R+VT  FI++LA +DLLLG FVLPFS+  E+L  +WIFG   CH+WLA DVLL TASI+NL  I LDRY+AI  P KYP LM++ + K LV   WI SF+I  P +      +   S   +  P +    +I +    C + N+ + Y++YSA GS++IP+ I++FFY RI+    +      KG  T K +  ++ N   +R+H+G   +N      +NR   +    +    K+++SS      + + +   R  +   +P   VR K S        S+        K    K + E KAA+ L +I GAFI+CWLPFFS YL  AF +    + +FSV FWLGY NSA+NP +Y +++K+FR AFK LL
Sbjct:    9 EVDAGFVISTICLTLLVAVVIAGNILVIAAVLTTRKL-RTVTNIFIVNLACADLLLGIFVLPFSAALEVL-DSWIFGTIWCHVWLATDVLLCTASIFNLCCISLDRYIAITRPMKYPGLMSSKRGKLLVAATWIVSFLISLPPLIGWNDGNDETSQQTTSQPCE----FIPVK---CELINT-RGYRIYSALGSYFIPMFIMVFFYIRIYRAAVKTISAYQKGVLTTKSNGVTVNNKVTLRVHRGGSYINHN---TSNRSNKDSVERRKSAEKQQLSSTNGINPSRDKNQKGRKGSDRLKPTNGVRIKFSGNGPTRTSSALQKTGKNMKTQMRKFNREQKAAKTLAIIVGAFILCWLPFFSIYLIGAFCDDCIPAVLFSVLFWLGYCNSAINPCVYALFAKDFRFAFKKLL 406          
BLAST of Octopamine receptor vs. TrEMBL
Match: A0A1B0CRD4 (Octopamine receptor (GPRoar1) OS=Lutzomyia longipalpis OX=7200 PE=3 SV=1)

HSP 1 Score: 247.284 bits (630), Expect = 1.756e-71
Identity = 167/435 (38.39%), Postives = 225/435 (51.72%), Query Frame = 3
Query:  237 LIVFNLVVIFGNIFVIFGVATIWKLKRSVTTNFIISLAISDLLLGAFVLPFSSTTELLKQTWIFGYKICHLWLAVDVLLSTASIYNLVIIGLDRYLAICWPFKYPVLMNNSKAKFLVGFVWIFSFIICSPTI-----QLIFSDSTSISYNNSLFPSKIHEKYIRINSSMCSIKNSNKYYKVYSAFGSFYIPLVILIFFYTRIFTKVNENFRNIHKG---TIKIDQSSIEN---CMRIHKGIVLNQKPKR---------------ATNRFP---------------DNHNNDKHEMLKRKISSPVVKVTTDECSTPARTSTTDNQPLLKVRXXXXXXXXXXXXXXTLALSYKTKRLFNKISSETKAARMLGVICGAFIVCWLPFFSWYLTSAFVELDEASTIFSVFFWLGYVNSALNPIIYVIWSKNFRQAFKTLL 1418
            L V N++VI GN  VI  V    KL RSVT  FI+SLA++DLL+G  VLPFS+T E+ K  WIFG   C +WLAVDV + TASI NL  I LDRY+A+  P  YP +M+ +KAK L+  +W+ SF+IC P +     Q + +D T    N +L+      +        C + N +  Y VYSA GSFYIP+++++FFY RI+       R I++G   T       +E+    +RIH+G    Q P                 A  RFP                      H  +K  +S P V       STP R S       L + ++ S      K       S +TK    +  +ETKAA+ L +I G FI CWLPFF+ YLT AF        +FSV FWLGY NSA+NP+IY ++SK+FR AFK ++
Sbjct:   44 LAVINVLVIVGNCLVIAAVFCSHKL-RSVTNFFIVSLAVADLLVGLAVLPFSATWEVFK-VWIFGDLWCRIWLAVDVWMCTASILNLCAISLDRYVAVTRPVSYPSIMSTTKAKSLIAGIWVLSFVICFPPLVGWKDQKLPADLTYRVRNYTLYSMTPPPEPPPPCPWTCELTN-DAGYVVYSALGSFYIPMLVMLFFYWRIYRAAVRTTRAINQGFKTTKGTKAGPMEDTPLTLRIHRGRATAQVPPASPHSLGSGHSLTTPTAPERFPMRPRRRAATSASERLAEKPRRAHAKVKISVSYPSVDNLAGS-STPHRASARARTKYLDIPEEGSNHMQQPKN------SKRTKAQVKRFRNETKAAKTLAIIVGGFIFCWLPFFTIYLTRAFCPDCIHPLLFSVMFWLGYCNSAINPVIYALFSKDFRFAFKRII 468          
BLAST of Octopamine receptor vs. TrEMBL
Match: E9FX33 (G_PROTEIN_RECEP_F1_2 domain-containing protein OS=Daphnia pulex OX=6669 GN=DAPPUDRAFT_42083 PE=3 SV=1)

HSP 1 Score: 243.047 bits (619), Expect = 3.816e-70
Identity = 156/417 (37.41%), Postives = 230/417 (55.16%), Query Frame = 3
Query:  222 LIALGLIVFNLVVIFGNIFVIFGVATIWKLKRSVTTNFIISLAISDLLLGAFVLPFSSTTELLKQTWIFGYKICHLWLAVDVLLSTASIYNLVIIGLDRYLAICWPFKYPVLMNNSKAKFLVGFVWIFSFIICSPTIQLIFSDSTSISYNN---SLFPSKIHEKYIRINSSMCSIKNSNKYYKVYSAFGSFYIPLVILIFFYTRIFTKVNENFRNIHKG--TIKIDQSSIENCMRIHKGIVLNQKPKRATNRFPDNHNNDKHEMLK---------RKISSPVVKVTTDECSTPARTSTTDN--QPLLKVRXXXXXXXXXXXXXXTLALSYKTKRLFNKISSETKAARMLGVICGAFIVCWLPFFSWYLTSAFVELDEASTIFSVFFWLGYVNSALNPIIYVIWSKNFRQAFKTLLCR 1424
            L+ LG++  N++V+FGN  V+  V    KL R+VT  FI+SLA++DL +G  VLPFS++ E+L   WIFG   C +WLAVDV + TASI NL  I LDRYLA+  P  YP +M   +AK L+  VW+ SF+IC P +         + +N+   +  PS+ H      +   C + N +  Y VYSA GSF+IP+++++FFY RI+    E  + I++G  T K  ++     +RIH+G    QKP   TN       N+K   L+         +K +          C +P  +   D+   PL      ++     +   S +    K  ++      ETKAA+ LG+I G FIVCW+PFF+ Y+  AF      S +FSV FWLGY NSA+NP IY ++S++FR AF+ ++C+
Sbjct:   55 LVILGVV--NVLVLFGNCLVVLAVFLDSKL-RTVTNLFIVSLAMADLSVGLAVLPFSASLEVL-DMWIFGEIWCSIWLAVDVWMCTASILNLCAISLDRYLAVTRPVSYPSIMTPFRAKILLAVVWLLSFVICFPPL---------VGWNDRKINRHPSQQH-----CDDWSCELTN-DPGYVVYSALGSFFIPMLVMLFFYWRIYRAAVETTKAINQGFRTTKCVENKERLTLRIHRGRS-GQKP--GTNGRASKAGNNKRSALEIFQTGGNHGKKNNRSKYNNGGHRCLSPRMSGGVDDGVDPLGSANNHNNAKPLKMNRRSNIKAQVKRFKM------ETKAAKTLGIIVGGFIVCWMPFFTMYVVRAFCPQCIPSVLFSVLFWLGYCNSAINPCIYALFSRDFRYAFQKIVCQ 443          
BLAST of Octopamine receptor vs. TrEMBL
Match: A0A147BAW5 (Putative octopamine receptor oamb (Fragment) OS=Ixodes ricinus OX=34613 PE=3 SV=1)

HSP 1 Score: 243.047 bits (619), Expect = 4.897e-70
Identity = 160/440 (36.36%), Postives = 231/440 (52.50%), Query Frame = 3
Query:  231 LGLIVFNLVVIFGNIFVIFGVATIWKLKRSVTTNFIISLAISDLLLGAFVLPFSSTTELLKQTWIFGYKICHLWLAVDVLLSTASIYNLVIIGLDRYLAICWPFKYPVLMNNSKAKFLVGFVWIFSFIICSP--------TIQLIFSDSTSISYNNSLFPSKIHEKYIRINSSMCSIKNSNKYYKVYSAFGSFYIPLVILIFFYTRIFTKVNENFRNIHKGTIKIDQSSIEN-------CMRIHKGIVLNQKPKRATNRFPDNHNNDKHEMLKRKISSPVVKVTTDECSTPARTSTTDNQPLLKVRXXXXXXXXXXXXXXTLALSYKTKR---------------------------LFNKISSETKAARMLGVICGAFIVCWLPFFSWYLTSAFVELDEASTIFSVFFWLGYVNSALNPIIYVIWSKNFRQAFKTLLCR 1424
            LGLI  N++VIFGN+ V+  V    KL R+VT  F++SLA++DL +G  VLP+S   E+L + WIFG+  C +WLAVDV L T+SI NL  I +DRYLAI  P +Y  LM++ +AK L+  VW+ +F+IC P        T  L+   S++ + N S+  +          S+ C + N NK Y +YSA GSFYIP++ ++FF  RI+    +  R + +G I      I+         +R+H+G       KR +         D     +R+   P +K + DE S  AR+S   ++         +      + + +   S+K+KR                              +  +E KA + +G I G FI CWLPFF+ YL  AF E    + +FSVFFWLGY NSALNP+IY + SK+FR AFK +LCR
Sbjct:   47 LGLI--NVLVIFGNLLVMVAVLCSTKL-RTVTNYFVVSLAVADLSVGIIVLPYSIVLEVL-EVWIFGHTWCQIWLAVDVWLCTSSILNLCAISVDRYLAITRPVRYRSLMSSKRAKLLIVAVWVIAFVICFPPLVGWNDGTENLVPYLSSNATTNGSV--TVADAPLPLCESAQCVLIN-NKGYVIYSALGSFYIPMLFMLFFNYRIYRAAIQTGRALERGFITTKSGKIKGRTQEQRLTLRVHRGNDSGLNVKRGSEHVGAETCIDGIVTGRRR---PGLKKSRDEPSASARSSGKKSR---------ASQADVERATRSAPPSFKSKRGSVRNSGRNGTSGGSKSSRSSKRSQRWQAKRFRTEAKATKTVGTIVGGFICCWLPFFTVYLVRAFCEHCIPNLLFSVFFWLGYCNSALNPLIYALVSKDFRLAFKRILCR 467          
BLAST of Octopamine receptor vs. TrEMBL
Match: B7PJX6 (GPR octopamine receptor 1 (Fragment) OS=Ixodes scapularis OX=6945 GN=8030066 PE=3 SV=1)

HSP 1 Score: 241.121 bits (614), Expect = 6.794e-70
Identity = 155/432 (35.88%), Postives = 225/432 (52.08%), Query Frame = 3
Query:  231 LGLIVFNLVVIFGNIFVIFGVATIWKLKRSVTTNFIISLAISDLLLGAFVLPFSSTTELLKQTWIFGYKICHLWLAVDVLLSTASIYNLVIIGLDRYLAICWPFKYPVLMNNSKAKFLVGFVWIFSFIICSPTIQLIFSDSTSISYNNSLFPSKIHEKYIRINSSMCSIKNSNKYYKVYSAFGSFYIPLVILIFFYTRIFTKVNENFRNIHKGTIKIDQSSIEN-------CMRIHKGIVLNQKPKRATNRFPDNHNNDKHEMLKRKISSPVVKVTTDECSTPARTSTTDNQPLLKVRXXXXXXXXXXXXXXTLALSYKTKR---------------------------LFNKISSETKAARMLGVICGAFIVCWLPFFSWYLTSAFVELDEASTIFSVFFWLGYVNSALNPIIYVIWSKNFRQAFKTLLCR 1424
            LGLI  N++VIFGN+ V+  V    KL R+VT  F++SLA++DL +G  VLP+S   E+L + WIFG+  C +WLAVDV L T+SI NL  I +DRYLAI  P +Y  LM++ +AK L+  VW+ +F+IC P +         + +N+      +  + + IN         NK Y +YSA GSFYIP++ ++FF  RI+    +  R + +G I      I+         +R+H+G       KR +         D     +R+   P +K + DE S  AR+S   ++         +      + + +   S+K+KR                              +  +E KA + +G I G FI CWLPFF+ YL  AF E    + +FSVFFWLGY NSALNP+IY + SK+FR AFK +LCR
Sbjct:   47 LGLI--NVLVIFGNLLVMVAVLCSTKL-RTVTNYFVVSLAVADLSVGIIVLPYSIVLEVL-EVWIFGHTWCQIWLAVDVWLCTSSILNLCAISVDRYLAITRPVRYRSLMSSKRAKLLIVAVWVIAFVICFPPL---------VGWNDG--TENLSAQCVLIN---------NKGYVIYSALGSFYIPMLFMLFFNYRIYRAAIQTGRALERGFITTKSGKIKGRTQEQRLTLRVHRGNDSGLNVKRGSEHVGAETCIDGIVTGRRR---PGLKKSRDEPSASARSSGKKSR---------ASQADVERATRSAPPSFKSKRGSVRNSGRNGTSGGSKSSRSSKRSQRWQAKRFRTEAKATKTVGTIVGGFICCWLPFFTVYLVRAFCEHCIPNLLFSVFFWLGYCNSALNPLIYALVSKDFRLAFKRILCR 442          
BLAST of Octopamine receptor vs. Ensembl Cavefish
Match: adra1ab (alpha-1A adrenergic receptor-like [Source:NCBI gene;Acc:103037444])

HSP 1 Score: 182.956 bits (463), Expect = 3.363e-51
Identity = 136/402 (33.83%), Postives = 193/402 (48.01%), Query Frame = 3
Query:  225 IALGLIVFNLVVIFG---NIFVIFGVATIWKLKRSVTTNFIISLAISDLLLGAFVLPFSSTTELLKQTWIFGYKICHLWLAVDVLLSTASIYNLVIIGLDRYLAICWPFKYPVLMNNSKAKFLVGFVWIFSFIICSPTIQLIFSDSTSISYNNSLFPSKIHEKYIRINSSMCSIKNSNKYYKVYSAFGSFYIPLVILIFFYTRIFTKVNENFRNIHKGTIKIDQSSIENCMRIHKGIVLNQKPKRATNRFPDNHNNDKHEMLKRKISSPVVKVTTDECSTPARTSTTDNQPLLKVRXXXXXXXXXXXXXXTLALSYKTKRLFNKISSETKAARMLGVICGAFIVCWLPFF-SWYLTSAFVELDEASTIFSVFFWLGYVNSALNPIIYVIWSKNFRQAFKTLL 1418
            +A+GL VF L VIFG   NI VI  VA    L RSVT  FI +LA++DLLL + VLPFS+ +ELL + W+FG  +C  W A+DVL  TASI +L +I +DR +A+ +P +YP L  + +    V  VW  S  I                   S+ P     + +  + S+C + N +  Y ++SA  SFY+PL +++  Y R++       R++ +G  ++   S    +RIH G          T R  D  + D H  +  K  S                                               +   RL  K S E KAA+ LGV+ G FI+CWLPFF    ++S F       T+F + FWLGY NS LNPIIY  +S+ F++AF+ LL
Sbjct:   34 VAMGL-VFTLFVIFGVMGNILVILSVACHRHL-RSVTHYFIANLAMADLLLSSTVLPFSAFSELLGR-WVFGRMLCCAWTALDVLCCTASILSLSVISIDRCVAVSYPLRYPSLATSGRGLGAVAAVWGLSAAI-------------------SVGPLFGWREPMPEDESVCRV-NEDPGYAIFSAACSFYVPLTVILVMYCRVYVVARRKSRSLREGR-QLGGGS----LRIHCG---------NTQRCSD--HRDGHITVVGKCRS----------------------------------------------HFSLLRLL-KFSREKKAAKTLGVVVGCFILCWLPFFLVLPISSIFPSHRPPETVFKITFWLGYFNSCLNPIIYPCFSQEFKKAFQNLL 349          
BLAST of Octopamine receptor vs. Ensembl Cavefish
Match: ADRA1D (adrenoceptor alpha 1D [Source:NCBI gene;Acc:103027862])

HSP 1 Score: 180.259 bits (456), Expect = 6.679e-50
Identity = 130/401 (32.42%), Postives = 189/401 (47.13%), Query Frame = 3
Query:  219 VLIALGLIVFNLVVIFGNIFVIFGVATIWKLKRSVTTNFIISLAISDLLLGAFVLPFSSTTELLKQTWIFGYKICHLWLAVDVLLSTASIYNLVIIGLDRYLAICWPFKYPVLMNNSKAKFLVGFVWIFSFIICSPTIQLIFSDSTSISYNNSLFPSKIHEKYIRINSSMCSIKNSNKYYKVYSAFGSFYIPLVILIFFYTRIFTKVNENFRNIHKGTIKIDQSSIENCMRIHKGIVLNQKPKRATNRFPDNHNNDKHEMLKRKISSPVVKVTTDECSTPARTSTTDNQPLLKVRXXXXXXXXXXXXXXTLALSYKTKRLFNKISSETKAARMLGVICGAFIVCWLP-FFSWYLTSAFVELDEASTIFSVFFWLGYVNSALNPIIYVIWSKNFRQAFKTLL 1418
            V + + L +F  V I GNI VI  V     L R+VT  FI++LAI+DLLLG  VLPFS++ E+L   W+FG   C++W AVDVL  TASI +L II +DRY+ + +  +YP +M   KA  ++  +W+ S +I                   S+ P    ++    + S+CSI      Y ++S+  SFY+PL +++  Y R++       R++  G  +   +S +  +RIH        P+ A       H+  +                      P R+S       L VR                           K S E KAA+ L ++ G F++CWLP FF   L S F  L  +  +F V FWLGY NS +NPIIY   SK F++AF  LL
Sbjct:   56 VAVGVFLAIFITVAIVGNILVILSVLCNRHL-RTVTNFFIVNLAIADLLLGVVVLPFSASLEVLG-CWVFGRVFCNIWAAVDVLCCTASILSLCIISVDRYVGVKYCLRYPTIMTERKAGVILVVIWVASAVI-------------------SIGPLLGWKEPPPADESVCSI-TEEPGYALFSSLFSFYLPLSVILVMYFRVYVVARRTSRSLEAGVKRERGTSTDVVLRIH----CRSLPEEAL-----EHSRSRGR------------------GQPFRSS-------LSVR-------------------------LMKFSREKKAAKTLAIVVGMFVLCWLPFFFVLPLGSFFPALKPSDMVFKVIFWLGYFNSCINPIIYPCSSKEFQRAFTRLL 375          
BLAST of Octopamine receptor vs. Ensembl Cavefish
Match: adra1aa (alpha-1A adrenergic receptor-like [Source:NCBI gene;Acc:103024013])

HSP 1 Score: 172.555 bits (436), Expect = 2.415e-47
Identity = 122/411 (29.68%), Postives = 189/411 (45.99%), Query Frame = 3
Query:  201 EINIS-FVLIALGLIVFNLVVIFGNIFVIFGVATIWKLKRSVTTNFIISLAISDLLLGAFVLPFSSTTELLKQTWIFGYKICHLWLAVDVLLSTASIYNLVIIGLDRYLAICWPFKYPVLMNNSKAKFLVGFVWIFSFIICSPTIQLIFSDSTSISYNNSLFPSKIHEKYIRINSSMCSIKNSNKYYKVYSAFGSFYIPLVILIFFYTRIFTKVNENFRNIHKGTIKIDQSSIENCMRIHKGIVLNQKPKRATNRFPDNHNNDKHEMLKRKISSPVVKVTTDECSTPARTSTTDNQPLLKVRXXXXXXXXXXXXXXTLALSYKTK---RLFNKISSETKAARMLGVICGAFIVCWLPFF-SWYLTSAFVELDEASTIFSVFFWLGYVNSALNPIIYVIWSKNFRQAFKTLL 1418
            E+N++  V++ + L +F +  + GNI VI  VA    L R+VT  FI +LA++DLLL + VLPFS+  E+L   W+FG   C +W A+DVL  TASI +L  I +DRY+ + +P +YP ++   +A   +  VW  S  I                   S+ P    ++    + ++C I      Y ++SA GSFY+PLV+++  Y R++                                V+ ++  R   +      +D  E +  +I       + DE                                   AL  +T    RL  K S E KAA+ LG++ G F++CWLPFF    + S F     + T+F + FWLGY NS +NPIIY   S+ F++AF ++L
Sbjct:   34 ELNVTKAVVLGIVLAIFIVFGVMGNILVILSVACHRNL-RTVTHYFIANLAVADLLLSSTVLPFSAIFEMLGH-WVFGRAFCDVWAAMDVLCCTASIMSLCAISVDRYIGVSYPLRYPTIVTERRALLALMGVWALSITI-------------------SVGPLFGWKEPAPEDETVCKI-TEEPGYAIFSAVGSFYLPLVVILVMYCRVY--------------------------------VVARRETRGLRKGQKTEKSDHAEAVTLRIHRGNTSASEDE-----------------------------------ALRSRTHFALRLL-KFSREKKAAKTLGIVVGCFVLCWLPFFLVLPIGSIFPAYRPSDTVFKITFWLGYFNSCINPIIYPCSSQEFKKAFLSVL 354          
BLAST of Octopamine receptor vs. Ensembl Cavefish
Match: adrb3a (beta-1 adrenergic receptor-like [Source:NCBI gene;Acc:103047240])

HSP 1 Score: 159.073 bits (401), Expect = 1.233e-42
Identity = 123/402 (30.60%), Postives = 188/402 (46.77%), Query Frame = 3
Query:  225 IALGLIVFNLVVIFGNIFVIFGVATIWKLKRSVTTNFIISLAISDLLLGAFVLPFSSTTELLKQTWIFGYKICHLWLAVDVLLSTASIYNLVIIGLDRYLAICWPFKYPVLMNNSKAKFLVGFVWIFSFIICSPTI--QLIFSDSTSISYNNSLFPSKIHEKYIRINSSMCSIKNSNKYYKVYSAFGSFYIPLVILIFFYTRIFTKVNENFRNIHKGTIKIDQSSIENCMRIHKGIVLNQKPKRATNRFPDNHNNDKHEMLKRKISSPVVKVTTDECSTPARTSTTDNQPLLKVRXXXXXXXXXXXXXXTLALSYKTKRLFNKIS--SETKAARMLGVICGAFIVCWLPFFSWYLTSAFVELDEASTIFSVFFWLGYVNSALNPIIYVIWSKNFRQAFKTLL 1418
            I L +++  L++I GN+ VI  +A   +L+ +VT  FI+SLA +DL++G  V+P S+T  +    W+     C LW +VD+L  TASI  L  I +DRY+AI  P ++ VL+N  +A+ +V  +W+ S ++    I  QL  SD             K+ + Y   ++  C     N+ + + S+  SFYIPL I+IF Y ++F    +  + I K      +S  +N     + +     P    N  P ++N+    + KRK S                                                   +R  +K++   E KA + LG+I G F +CWLPFF   + +AF     +   F +  WLGY NSALNPIIY   S  FR AFK+LL
Sbjct:   31 ILLPVVIILLMIIVGNLLVIIAIARTSQLQ-TVTNIFIMSLAFADLIMGVLVVPLSATIAV-TGNWLLDKTSCDLWTSVDILCVTASIETLCAIAVDRYIAITRPLRHKVLLNKCRARLIVCVIWVVSALLSFLPIMNQLWRSDH-----------PKVKDCY---SNEKCCDFLVNEVFAIISSVISFYIPLFIMIFVYAKVFRIATKQIKLIDK-----SRSRFKNECATSQAL----PPVPGNNNLPLSYNSAGAPVAKRKSS---------------------------------------------------RRRPSKLTVIKEHKALKTLGIIMGCFTLCWLPFFVANIINAFEPTIISQGTFLLLNWLGYFNSALNPIIYC-RSPEFRAAFKSLL 355          
BLAST of Octopamine receptor vs. Ensembl Cavefish
Match: adra2a (adrenoceptor alpha 2A [Source:NCBI gene;Acc:266750])

HSP 1 Score: 155.606 bits (392), Expect = 6.837e-42
Identity = 118/391 (30.18%), Postives = 182/391 (46.55%), Query Frame = 3
Query:  267 GNIFVIFGVATIWKLKRSVTTNFIISLAISDLLLGAFVLPFSSTTELLKQTWIFGYKICHLWLAVDVLLSTASIYNLVIIGLDRYLAICWPFKYPVLMNNSKAKFLVGFVWIFSFIICSPTIQLIFSDSTSISYNNSLFPSKIHEKYIRINSSMCSIKNSNKYYKVYSAFGSFYIPLVILIFFYTRIFTKVNENFRNIHKGTIKIDQSSIEN--CMRIHKGIVLNQKPKRATNRFPDNHNNDKHEMLKRKISSPVVKVTTDECSTPARTSTTDNQPLLKVRXXXXXXXXXXXXXXTLALSYKTKRLFNKISSETKAARMLGVICGAFIVCWLPFFSWYLTSAFVE---LDEASTIFSVFFWLGYVNSALNPIIYVIWSKNFRQAFKTLLCR 1424
            GN+  +  V T   LK +    F++SLA +D+L+   V+PFS   EL+   W FG   C ++LA+DVL  TASI +L  I LDRY +I    +Y +     + K ++  VW+ + +I  P + ++  D                     IN       N +K+Y + S  GSF++P +I++  Y RI+       R       K D    EN  C     G   N   K        +   D + +   + SS   KV T+ C++  +        L +++      K +     T     K+ R   + + E +   +L V+ G F++CW PFF  Y   A  E   ++E  T+F  FFW GY NS+LNPIIY I++ +FR+AFK +LCR
Sbjct:   29 GNLLAVIAVFTSRALK-APQNLFLVSLASADILVATLVMPFSLANELMGY-WYFGPVWCKIYLALDVLFCTASIAHLCAISLDRYWSITRAVEYNLKRTPRRIKCVILVVWVIAAVISFPPLTIMKEDEP-------------------INDPPSCQINKDKWYIISSCIGSFFLPCIIMVLVYIRIYQIAKSRTRTPPGDRRKRDDEKKENGHCHERLNGDAANGNDK--------DDKGDVNAVDMEESSSSDHKV-TNPCAS-KKKRAKGKTKLSQIKPGDDINKRENANRGT-----KSSRWKGRQNREKRFTFVLAVVIGVFMICWFPFFFTYTLRALCESCCVNE--TLFKFFFWFGYCNSSLNPIIYTIFNNDFRRAFKKILCR 381          
BLAST of Octopamine receptor vs. Ensembl Sea Lamprey
Match: HTR1F (5-hydroxytryptamine receptor 1F [Source:HGNC Symbol;Acc:HGNC:5292])

HSP 1 Score: 140.584 bits (353), Expect = 7.672e-37
Identity = 110/398 (27.64%), Postives = 179/398 (44.97%), Query Frame = 3
Query:  270 NIFVIFGVATIWKLKRSVTTNFII-SLAISDLLLGAFVLPFSSTTELLKQTWIFGYKICHLWLAVDVLLSTASIYNLVIIGLDRYLAICWPFKYPVLMNNSKAKFLVGFVWIFSFIICSPTIQLIFSDSTSISYNNSLFPSKIHEKYIRINSSMCSIKNSNKYYKVYSAFGSFYIPLVILIFFYTRIFTKVNENFRNIHKGTIKIDQSSIENCMRIHKGIVLNQ---------KPKRATNRFPDNHNNDKHEMLKRKISSPVVKVTTDECSTPARTSTTDNQPLLKVRXXXXXXXXXXXXXXTLALSYKTKRLFNKISS--ETKAARMLGVICGAFIVCWLPFFSWYLTSAFVELDEAS-TIFSVFFWLGYVNSALNPIIYVIWSKNFRQAFKTLLCR 1424
            N  VI  ++   KL++    N++I SLA++DLL+ A V+P ++   ++   W  G  +C LWL++DV   TASI +L  I LDR+ AI    +Y       +A  ++   W+ +  I  P +     D           P+K            C I++ +  Y +YS FG+FY+PL +L+  Y RIF      +        +    S E+ + + +               K  R    F  +  +   + L +   S   + +    S  AR S    +P   VR              +  L  +   L  +IS   E +AA+ LG+I GAF+VCWLPFF   L     +    S  +  +  WLGY+NS +NP+IY +++++F+ AF+ L+ R
Sbjct:   65 NALVIAAISATRKLRQPA--NYLIGSLAVADLLVAALVMPVAAAY-VVTGEWALGGALCDLWLSLDVTCCTASILHLCAIALDRFWAITDAAEYAHKRTPGRAALMIAASWLLAACISVPPLFWRRRD-----------PAKPR----------CIIEHDHVLYTIYSTFGAFYVPLALLLALYCRIFRAAKRLYEKRESKQREKLSVSAESAVSLEQPSQSQHQQQQQQPAGKLFRLPQPFCMSETSSSDQTLAQAERSGQHQQSV---SAVARRSKRSLRPPRSVR------------FMSARLDQRRPCLQERISGSRERRAAKTLGLILGAFVVCWLPFFIKELVVNLCKSCAVSPEVADLLTWLGYMNSLINPLIYTMFNEDFKSAFRKLVSR 423          
BLAST of Octopamine receptor vs. Ensembl Sea Lamprey
Match: ENSPMAT00000004593.1 (pep scaffold:Pmarinus_7.0:GL476854:168999:207459:1 gene:ENSPMAG00000004184.1 transcript:ENSPMAT00000004593.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 126.331 bits (316), Expect = 3.423e-32
Identity = 103/390 (26.41%), Postives = 178/390 (45.64%), Query Frame = 3
Query:  267 GNIFVIFGVATIWKLKRSVTTNFIISLAISDLLLGAFVLPFSSTTELLKQTWIFGYKICHLWLAVDVLLSTASIYNLVIIGLDRYLAICWPFKYPVLMNNSKAKFLVGFVWIFSFIICSPTIQLIFSDSTSISYNNSLFPSKIHEKYIRINSSMCSIKNSNKYYKVYSAFGSFYIPLVILIFFYTRIFTKVNENFRNIHKGTIKIDQSSIENCMRIHKGIVLNQKPKRATNRFPDNHNNDKHEMLKRKISSPVVKVTTDECSTPARTSTTDNQPLLKVRXXXXXXXXXXXXXXTLALSYKTK----RLFNKISSETKAARMLGVICGAFIVCWLPFFSWYLTSA-----FVELDEASTIFSVFFWLGYVNSALNPIIYVIWSKNFRQAFK 1409
            GN+ VI  V    KL+ + T  F++SLA++DLL+G  V+P S    L    W    ++C +W+ +DVL STASI +L  I LDRY+AI  P ++    + SK    +  VW  S  I SP   L   D   +  N +                 C +   N  + +Y +  SF++PL+I++  Y                 TI++ +  +   M + +G         A+ R    H                 +V      T  R  T     LL   + S+   +   +++++    +T+    R    +S+E +A+++LG++   F+V W PFF   +TSA        ++  + +  +F W+GYV+S +NP++Y ++++ +RQAF+
Sbjct:   21 GNLLVILAVWLEKKLQ-TATNYFLMSLAVADLLVGLTVMPISVINILYNMRWPLPCEMCPVWVFLDVLFSTASIMHLCAISLDRYIAIKRPIQHSRFNSRSKTLLKITAVWAISIGIASPIPVLGLQDQQHVFVNGA-----------------CILNIQN--FIIYGSVVSFFLPLLIMVVIYVL---------------TIRLLRGQV-GLMEVSRGSSSVSAVTSASTRRGSEHQ----------------RVIFRHKETLERLPT-----LLDGERLSAVGGAAAAVAASMGTLRRTQAAHSRSAQALSNERRASKVLGIVFTLFLVMWCPFFVTNVTSALCPESLCSVEAMAKLMDIFVWVGYVSSGVNPLVYTLFNQTYRQAFR 353          
BLAST of Octopamine receptor vs. Ensembl Sea Lamprey
Match: ENSPMAT00000009127.1 (pep scaffold:Pmarinus_7.0:GL478629:43196:44446:-1 gene:ENSPMAG00000008256.1 transcript:ENSPMAT00000009127.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 126.331 bits (316), Expect = 3.704e-32
Identity = 108/404 (26.73%), Postives = 174/404 (43.07%), Query Frame = 3
Query:  219 VLIALGLIVFNLVVIFGNIFVIFGVATIWKLKRSVTTNFIISLAISDLLLGAFVLPFSSTTELLKQTWIFGYKICHLWLAVDVLLSTASIYNLVIIGLDRYLAICWPFKYPVLMNNSKAKFLVGFVWIFSFIICSPTIQLIFSDSTSISYNNSLFPSKIHEKYIRINSSMCSIKNSNKYYKVYSAFGSFYIPLVILIFFYTRIFTKVNENFR-NIHKGTIKIDQSSIENCMRIHKGIVLNQKPKRATNRFPDNH---NNDKHEMLKRKISSPVVKVTTDECSTPARTSTTDNQPLLKVRXXXXXXXXXXXXXXTLALSYKTKRLFNKISSETKAARMLGVICGAFIVCWLPFFSWYLTSAFVELDEASTIFSVFFWLGYVNSALNPIIYVIWSKNFRQAFKTLL 1418
            V+ +L L    L  IFGN  VI  +A + +  ++V    I SLA++DLL+   VLP ++  ++L + W  G  +C +++A+DVL  T+SI +L +I LDRY AI  P  Y       +A  ++   W+  F I  P                 +   +  E   R + + C I   +  Y +YS FG+FYIPL++++  Y+RIF       R N+ K T   ++ S +    I     +      A    P +    N D  +   R ++ P          +P+  + +  +P L      ++ +     +   A   KT  L +    E                C LP                  +F+V  WLGY NS LNPIIY  ++K+F+ AFK ++
Sbjct:   37 VISSLCLTALILCAIFGNSCVIAAIA-LERTLQNVANYLIGSLAVTDLLVSILVLPMAALYQVLDR-WTLGQVVCDIFIALDVLCCTSSILHLCVIALDRYWAITNPIDYVNKRTPRRAVIMISLTWLVGFSISIPP----------------MLGWRTPED--RADPNACKISQDHG-YTIYSTFGAFYIPLILMLVLYSRIFRAARFRIRKNVKKAT---EKKSFDAPFAISNRAEMPSAAAEAETAAPPSPAPCNGDSKQRSHRDLALP----EAVGARSPSSLAHSSARPHLSPAMMPTQQQQHGNGTGADACRRKTALLISPFCGER---------------CHLP----------------PGVFAVINWLGYSNSLLNPIIYAYFNKDFQNAFKKII 381          
BLAST of Octopamine receptor vs. Ensembl Sea Lamprey
Match: ENSPMAT00000006953.1 (pep scaffold:Pmarinus_7.0:GL477632:7596:14007:1 gene:ENSPMAG00000006283.1 transcript:ENSPMAT00000006953.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 125.946 bits (315), Expect = 6.069e-32
Identity = 107/388 (27.58%), Postives = 179/388 (46.13%), Query Frame = 3
Query:  261 IFGNIFVIFGVATIWKLKRSVTTNFIISLAISDLLLGAFVLPFSSTTELLKQTWIFGYKICHLWLAVDVLLSTASIYNLVIIGLDRYLAICWPFKYPVLMNNSKAKFLVGFVWIFSFIICSPTIQLIFSDSTSISYNNSLFPSKIHEKYIRINSSMCSIKNSNKYYKVYSAFGSFYIPLVILIFFYTRIFTKVNENFRNIHKGTIKIDQSSIENCMRIHKGIVLNQKPKRATNRFPDNHNNDKHEMLKRKISSPVVKVTT-DECSTPARTSTTDNQPLLKVRXXXXXXXXXXXXXXTLALSYKTKRLFNKISSETKAARMLGVICGAFIVCWLPFFSWYLTSAFVELDEA-----STIFSVFFWLGYVNSALNPIIYVIWSKNFRQAF 1406
            I GN+ VI  V+   KL+ + T  F++SLA++D+L+G  V+P S    L    W     +C +W+ +DVL STASI +L  I LDRY+AI  P ++    + +KA   +  VW+ S  I  P   L   D   +  + S                 C +  S+  + +Y +  SF++PL+I++  Y    T+V      + +G      SS  +      G   N    RAT+      +    E +      P V ++  D  S P   +      LL  R            + + +++   KR    I++E +A+++LG++   F+  W PFF   + SA    D       + +  VF W+GYV+S +NP++Y ++++ +RQAF
Sbjct:   39 IAGNVLVILAVSLEKKLQ-TATNYFLMSLAVADMLVGILVMPISLLNILYGFKWPLPLSLCPVWIYLDVLFSTASIMHLCAISLDRYIAIKKPIEHSRFNSRTKALLKILAVWVISVGISMPVPVLGLQDLAYVYTDGS-----------------CQMNISD--FIIYGSLSSFFLPLIIMVASYVST-TRVLRQQALLCEGMNGCSNSSSYSSSYSSGGGNNNHGRGRATSL----TSATPPEAVGLPGGGPHVALSALDGVSAPPEAA------LLPHR---------AGRAKSRSVTPSQKRTMQAITNEQRASKVLGIVFLLFVGMWCPFFITNVLSALCPADACNRHAMAALLDVFVWVGYVSSGVNPLVYTLFNRTYRQAF 386          
BLAST of Octopamine receptor vs. Ensembl Sea Lamprey
Match: adra2c (adrenoceptor alpha 2C [Source:NCBI gene;Acc:266752])

HSP 1 Score: 97.0561 bits (240), Expect = 9.349e-22
Identity = 67/208 (32.21%), Postives = 104/208 (50.00%), Query Frame = 3
Query:  219 VLIALGL----IVFNLVVIFGNIFVIFGVATIWKLKRSVTTNFIISLAISDLLLGAFVLPFSSTTELLKQTWIFGYKICHLWLAVDVLLSTASIYNLVIIGLDRYLAICWPFKYPVLMNNSKAKFLVGFVWIFSFIICSPTIQLIFSDSTSISYNNSLFPSKIHEKYIRINSSMCSIKNSNKYYKVYSAFGSFYIPLVILIFFYTRIF 830
            VL  LGL    ++     +FGN  VI  V T   LK +    F++SLA +D+L+   V+PFS   EL+   W FG   C ++LA+DVL  T+SI +L  I LDRY ++    +Y +     + K ++  VW  +  I  P +         IS N      K  ++   +    C + N+N +Y + S  GSF+ P +I++  Y RI+
Sbjct:   48 VLAGLGLSSLVLILVFATVFGNCLVIIAVLTRPSLK-APQNLFLVSLATADILVATLVIPFSLFNELMGY-WYFGRVWCEIYLALDVLFCTSSIVHLCAISLDRYWSVSQAVEYNIKRTPRRIKRIIVIVWFIAIAISLPPL---------ISMNQ-----KNRQQQEEVGRPNCEL-NTNTWYILGSCIGSFFAPCLIMVLVYARIY 238          

HSP 2 Score: 77.0258 bits (188), Expect = 2.443e-15
Identity = 35/83 (42.17%), Postives = 52/83 (62.65%), Query Frame = 3
Query: 1191 SSETKAARMLGVICGAFIVCWLPFFSWYLTSAFVELDEAS---TIFSVFFWLGYVNSALNPIIYVIWSKNFRQAFKTLLCRIF 1430
            + E +   +L V+ G F++CW PFF  Y  SA    +  +   T+F  FFW GY NS LNP+IY +++++FR+AFK +LC  F
Sbjct:  376 ARERRFTFVLSVMIGVFVICWFPFFFTYSLSALCSPESCAIPETLFKFFFWFGYCNSCLNPVIYTVFNRDFRRAFKKILCMQF 458          
BLAST of Octopamine receptor vs. Ensembl Nematostella
Match: EDO47359 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RMJ9])

HSP 1 Score: 115.931 bits (289), Expect = 2.887e-28
Identity = 107/404 (26.49%), Postives = 175/404 (43.32%), Query Frame = 3
Query:  237 LIVFNLVVIFGNIFVIFGVATIWKLKRSVTTNFIISLAISDLLLGAFVLPFSSTTELLKQTWI--FGYKICHLWLAVDVLLSTASIYNLVIIGLDRYLAICWPFKYPVLMNNSKAKFLVGFVWIFSFIICSPTIQLIFSDSTSISYNNSLFPSKIHEKYIRINSSMCSIKNSNKYYKVYSAFGSFYIPLVILIFFYTRIFTKVNENFRNIHKGTIKIDQSSIENCMRIHKGIVLNQKPKRATNRFPDNHNNDKHEMLKRKISS-PVVKVTTDECSTPARTSTTDNQPLLKVRXXXXXXXXXXXXXXTLALSYKTKRLFNKISSETKAARMLGVICGAFIVCWLPFFSWYLTSAFVELD----------EASTIFSVFFW-LGYVNSALNPIIYVIWSKNFRQAF 1406
            +++  L+ I GN+ V + V    +L RS T   ++SLA+SDLL+G   LPF     L ++ W    G + C  W+ VD+L S AS+ NL  I  DR LAI  P +Y   M + +A  L+  VWI++      +      +ST  +Y                    C I+   + Y    A  +F+ PL+I+I  Y  +                   Q +I + +++ K     +K + A N  P+ ++N+  E  +  ++S PV+++ T   S+  +     N    K R  +S                        I  + KA + L V+ G FI+CW PFF  ++T  + + +              +  +F + L   NSA NPIIY  +++ FR AF
Sbjct:   30 IVIVMLLTIMGNLLVCYSVFYYRRL-RSPTNYLVVSLAVSDLLVGTLSLPFRLAQLLNEENWPSHLGREGCQFWIWVDMLCSGASMVNLAGISFDRLLAIKQPLRYREKMTSKRALILILVVWIYAASCAFLSFVEWEGESTIAAY------------------PQCGIR--ARVYITLMALAAFFCPLLIVIICYGMVL------------------QVAIRHALQVQK-----EKEQIALNVSPEPNSNNHEESGETSLASPPVIRLKTSRSSSHRKDINFANGH-AKHRNPASSTF--------------------HIMKQIKATKTLAVVVGVFILCWFPFFVIFVTFQYCDTECFGEERIPPAVKRVLLIIFVYVLPVSNSAANPIIYSCFNQEFRVAF 368          
BLAST of Octopamine receptor vs. Ensembl Nematostella
Match: EDO35450 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SLG6])

HSP 1 Score: 102.449 bits (254), Expect = 3.275e-24
Identity = 63/209 (30.14%), Postives = 108/209 (51.67%), Query Frame = 3
Query:  240 IVFNLVV-IFGNIFVIFGVATIWKLKRSVTTNFIISLAISDLLLGAFVLPFSSTTELLKQTWIFGYKICHLWLAVDVLLSTASIYNLVIIGLDRYLAICWPFKYPVLMNNSKAKFLVGFVWIFSFIICSPTIQLIFSDSTSISYNNSLFPSKIHEKYIRINSSMCSIKNSNKYYKVYSAFGSFYIPLVILIFFYTRIFTKVNENFRNIH 863
            ++F L++ + GN+ V   + +  +L R+VT  FIISLA+SDLL+    +PF     L    W  G  +C  W+ VD++ S+ASI NL +I +DR+LA+ +P  YP +M   +    +  VW +S +I            +++S+     P  + +     +   CS+K  +KYY  +     F++PLV+L+  Y+ +F       R + 
Sbjct:   16 VIFILILDVCGNLLVCGAILSYRRL-RTVTNYFIISLAVSDLLVAGLSMPFRIHHTLHSMCWDLGISVCEFWIFVDLVCSSASICNLSMISVDRFLALSYPLTYPSIMTKRRGLLAIAMVWGYSLLI------------SALSFTLPWSPDGLMQ-----DIPACSLK--DKYYYTFVITVGFFLPLVVLVIAYSLVFKVALHQARKLQ 204          

HSP 2 Score: 59.3066 bits (142), Expect = 1.105e-9
Identity = 36/89 (40.45%), Postives = 50/89 (56.18%), Query Frame = 3
Query: 1185 KISSETKAARMLGVICGAFIVCWLPFFSWYLTSAF----------VELDEASTIFSVFFW-LGYVNSALNPIIYVIWSKNFRQAFKTLL 1418
             I  E KA + L ++ G+FIVCWLPFF    T  F          + +     I +VF + L  +NSA+NPIIY  ++ NFR+AFK +L
Sbjct:  214 SIIRELKATKTLAIVVGSFIVCWLPFFVIMFTVQFCPECFQDHRSLPVKAQLAIGTVFVYVLPLLNSAVNPIIYSSFNANFRRAFKDIL 302          
BLAST of Octopamine receptor vs. Ensembl Nematostella
Match: EDO43835 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RXF3])

HSP 1 Score: 98.5969 bits (244), Expect = 1.775e-22
Identity = 97/401 (24.19%), Postives = 170/401 (42.39%), Query Frame = 3
Query:  240 IVFNLVV---IFGNIFVIFGVATIWKLKRSVTTNFIISLAISDLLLGAFVLPFSSTTELLKQTWIFGYKICHLWLAVDVLLSTASIYNLVIIGLDRYLAICWP---FKYPVLMNNSKAKFLVGFVWIFSFIICSPTIQLIFSDSTSISYNNSLFPSKIHEKYIRINSSMCSIKNSNKYYKVYSAFGSFYIPLVILIFFYTRIFTKVNENFRNIHKGTIKIDQSSIENCMRIHKGIVLNQKPKRATN--RFPDNHNNDKHEMLKRKISSPVVKVTTDECSTPARTSTTDNQPLLKVRXXXXXXXXXXXXXXTLALSYKTKRLFNKISSETKAARMLGVICGAFIVCWLPF--FSWYLTSAFVELDEAST--IFSVFFWLGYVNSALNPIIYVIWSKNFRQAF 1406
            I++ LV+   I GN+ V   V     L+  V++ FI+SLAISDL    F +PF     +    W  G   C +W  V ++    SI NL+++ +DRY  +  P   F+    +   +A   +  +W +S       I       T + +    +PS +++         C I N    Y V  +F +F +P++I+   Y +IF   +  +R   +    + Q        + +   +N++ K   +  + P   NN ++    R       K            +  + +P+                 S   L+ + K+ F K     KAAR + VI GAF++CW PF  FS  +   ++    A    +  VF  +GY+NS +NP+++   +  FR+A+
Sbjct:    1 ILYALVITATIVGNLLVCAAVVVNANLRHVVSSYFIVSLAISDLATACFSMPFDMEYLITSGLWPRGEDFCIVWTTVYMIAIPTSILNLLVLSIDRYKTLKDPWDRFRESPFITKRRAVIAILVLWGYSLAFALVPI-------TGVKH----YPSSLYQ-------GTC-IFNMAPIYSVVGSFVNFVLPMLIMCCMYYKIFRIAHTKYRMPSRPKRDMHQ--------VMQLPAMNEESKSPPDAEKVPPAVNNIRNSTKLRSRKKSAKKNNNSPEKAGLENAGFEEKPM--------------NFGSMEDLTIRRKKYFVK---NAKAARTISVIVGAFLLCWGPFVLFSIVMNICWMPCAMAVPYHVHHVFLLMGYINSMVNPLLFSYQNHQFRKAY 357          
BLAST of Octopamine receptor vs. Ensembl Nematostella
Match: EDO28603 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7T607])

HSP 1 Score: 98.2117 bits (243), Expect = 2.151e-22
Identity = 65/190 (34.21%), Postives = 96/190 (50.53%), Query Frame = 3
Query:  261 IFGNIFVIFGVATIWKLKRSVTTNFIISLAISDLLLGAFVLPFSSTTELLKQTWIFGYKICHLWLAVDVLLSTASIYNLVIIGLDRYLAICWPFKYPVLMNNSKAKFLVGFVWIFSFIICSPTIQLIFSDSTSISYNNSLFPSKIHEKYIRINSSMCSIKNSNKYYKVYSAFGSFYIPLVILIFFYTRIF 830
            +FGN+ V   +    +L RSVT   I SLA+SDLL+    +PF     L    W  G  +C  W+ VD L S ASI NL +I +DRYL +  PF Y   M   +    +  VW+++F+I S    L  ++  S    N+ FP+             C+    +KYY  ++   SF++PLV+LI  Y+ +F
Sbjct:   34 LFGNLLVCVAIYRYRRL-RSVTNYLIGSLAVSDLLVACLSMPFRIYHTLHLMCWDLGLSVCKFWIFVDALCSGASICNLSLIAIDRYLVLSCPFSYREKMRKPRGFIAILAVWLYAFVIAS----LSLTEPWSPDGFNASFPA-------------CA--KMDKYYYAFAITMSFFLPLVVLIIAYSMVF 203          

HSP 2 Score: 51.6026 bits (122), Expect = 4.380e-7
Identity = 36/91 (39.56%), Postives = 47/91 (51.65%), Query Frame = 3
Query: 1188 ISSETKAARMLGVICGAFIVCWLPFFSWYLTSAFVE--------LDEAS-TIFSVFFW-LGYVNSALNPIIYVIWSKNFRQAFKTLLCRIF 1430
            I  E KA + L ++ G FI CW PFF       F            EA  TI +VF + L  +NSA NPIIY  ++ +FR AFK +L  +F
Sbjct:  254 IVRELKATKTLSIVIGTFIACWAPFFIIMFIVQFCHDCVYNSWLTKEAQMTIGTVFVYVLPLLNSAANPIIYSKFNADFRLAFKDILMSMF 344          
BLAST of Octopamine receptor vs. Ensembl Nematostella
Match: EDO40999 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S5M0])

HSP 1 Score: 97.8265 bits (242), Expect = 3.232e-22
Identity = 65/190 (34.21%), Postives = 96/190 (50.53%), Query Frame = 3
Query:  261 IFGNIFVIFGVATIWKLKRSVTTNFIISLAISDLLLGAFVLPFSSTTELLKQTWIFGYKICHLWLAVDVLLSTASIYNLVIIGLDRYLAICWPFKYPVLMNNSKAKFLVGFVWIFSFIICSPTIQLIFSDSTSISYNNSLFPSKIHEKYIRINSSMCSIKNSNKYYKVYSAFGSFYIPLVILIFFYTRIF 830
            +FGN+ V   +    +L RSVT   I SLA+SDLL+    +PF     L    W  G  +C  W+ VD L S ASI NL +I +DRYL +  PF Y   M   +    +  VW+++F+I S    L  ++  S    N+ FP+             C+    +KYY  ++   SF++PLV+LI  Y+ +F
Sbjct:   45 LFGNLLVCVAIYRYRRL-RSVTNYLIGSLAVSDLLVACLSMPFRIYHTLHLMCWDLGLSVCKFWIFVDALCSGASICNLSLIAIDRYLVLSCPFSYREKMRKPRGFIAILAVWLYAFVIAS----LSLTEPWSPDGFNASFPA-------------CA--KMDKYYYAFAITMSFFLPLVVLIIAYSMVF 214          

HSP 2 Score: 51.9878 bits (123), Expect = 3.674e-7
Identity = 36/91 (39.56%), Postives = 47/91 (51.65%), Query Frame = 3
Query: 1188 ISSETKAARMLGVICGAFIVCWLPFFSWYLTSAFVE--------LDEAS-TIFSVFFW-LGYVNSALNPIIYVIWSKNFRQAFKTLLCRIF 1430
            I  E KA + L ++ G FI CW PFF       F            EA  TI +VF + L  +NSA NPIIY  ++ +FR AFK +L  +F
Sbjct:  265 IVRELKATKTLSIVIGTFIACWAPFFIIMFIVQFCHDCVYNSWLTKEAQMTIGTVFVYVLPLLNSAANPIIYSKFNADFRLAFKDILMSMF 355          
BLAST of Octopamine receptor vs. Ensembl Medaka
Match: adra1d (adrenoceptor alpha 1D [Source:NCBI gene;Acc:101157273])

HSP 1 Score: 184.882 bits (468), Expect = 1.202e-51
Identity = 135/422 (31.99%), Postives = 207/422 (49.05%), Query Frame = 3
Query:  204 INISFVLIALGLIVFNLVVIFGNIFVIFGVATIWKLKRSVTTNFIISLAISDLLLGAFVLPFSSTTELLKQTWIFGYKICHLWLAVDVLLSTASIYNLVIIGLDRYLAICWPFKYPVLMNNSKAKFLVGFVWIFSFIICSPTIQLIFSDSTSISYNNSLFPSKIHEKYIRINSSMCSIKNSNKYYKVYSAFGSFYIPLVILIFFYTRIFTKVNENFRNIHKGTIKIDQSSIENCMRIH-KGIVLNQKPKRATNRFPDNHNNDKHEMLKRKISSPVVKVTTDECSTPARTSTTDNQPLLKVRXXXXXXXXXXXXXXTLALSYKTKRLFNKISSETKAARMLGVICGAFIVCWLPFFSWY-LTSAFVELDEASTIFSVFFWLGYVNSALNPIIYVIWSKNFRQAFKTLL-CRIF**KNNVYQFY 1460
            ++   V + + L VF LV I GNI VI  V    +L+ +VT  FI++LAI+DLL+   VLPFS++ E+L   W+FG   C++W AVDVL  TASI +L +I +DRY+ +    KYP +M   KA  ++  VW+ S +I                   S+ P    ++   ++ S+C I      Y ++S+  SFY+PL++++  Y R++       +++  G  +    S+E  +RIH + ++ + +P  A+++   NH                          P R+S       L VR                           K S E KAA+ L V+ G FIVCWLPFF +  + S F  L  + T+F V FWLGY NS +NP+IY   SK F++AF  LL C+    +  + +FY
Sbjct:   38 MDPQVVGVGIFLSVFILVAIVGNILVILSVVCNKQLQ-TVTNFFIVNLAIADLLVSIIVLPFSASLEVLG-CWMFGRVFCNVWAAVDVLCCTASILSLCMISIDRYIGVKHCLKYPSIMTERKAVAILMLVWVSSLVI-------------------SVGPLLGWKEPPPVDESICRI-TEEPGYALFSSLFSFYLPLLVILIMYFRVYVVARRTTKSLEAGVKRERDKSVEVVLRIHCRSVLGDARP--ASSKSSKNH--------------------------PFRSS-------LSVRLM-------------------------KFSREKKAAKTLAVVVGMFIVCWLPFFLFLPIGSVFPALKPSETVFKVVFWLGYFNSCINPMIYPCSSKEFQRAFIRLLKCQCHQKRRVLRRFY 377          
BLAST of Octopamine receptor vs. Ensembl Medaka
Match: ENSORLT00000002753.2 (beta-2 adrenergic receptor [Source:NCBI gene;Acc:101159524])

HSP 1 Score: 181.03 bits (458), Expect = 2.161e-50
Identity = 131/407 (32.19%), Postives = 196/407 (48.16%), Query Frame = 3
Query:  207 NISFVLIALGLIVFNLVVIFGNIFVIFGVATIWKLKRSVTTNFIISLAISDLLLGAFVLPFSSTTELLKQTWIFGYKICHLWLAVDVLLSTASIYNLVIIGLDRYLAICWPFKYPVLMNNSKAKFLVGFVWIFSFIICSPTIQLIFSDSTSISYNNSLFPSKIHEKYIRINSSMCSIKNSNKYYKVYSAFGSFYIPLVILIFFYTRIFTKVNENFRNI---HKGTIKIDQSSIENCMRIHKGIVLNQKPKRATNRFPDNHNNDKHEMLKRKISSPVVKVTTDECSTPARTSTTDNQPLLKVRXXXXXXXXXXXXXXTLALSYKTKRLFNKISSETKAARMLGVICGAFIVCWLPFFSWYLTSAFVELDEASTIFSVFFWLGYVNSALNPIIYVIWSKNFRQAFKTLL 1418
            +   VL+A+ + +  L ++FGN+ VI  +    +L+ +VT  FI SLA++DL++G  V+PFSS+  LL+ +W FG  +C  W A DVL  TASI  L +I LDRYLAI  P +YP L+  ++A   +  VW  + +I    I L             L+ S   +    +    C   ++NK Y V S+  SFY+PLV++IF Y+R+F +  +  + I    +   K+  S+   C       V+N    RA NR  +    D+  M +            +E    A T   + +     R               L  S K          E KA + LG+I G F +CWLPFF   +  A+ + D  +  F +  WLGY NSA NP+IY   S +FR AF+ +L
Sbjct:   22 DAELVLLAVAMAILVLAIVFGNVMVISAILRFHRLQ-TVTNLFIASLAVADLIMGVVVVPFSSSNILLR-SWKFGNFMCEFWTAADVLCVTASIETLCVIALDRYLAITLPLRYPTLLTRARAFAAILAVWAVASLISFLPIYL------------KLWLSDEQKAQDCMKKEDCCEFHTNKGYAVISSIVSFYLPLVVMIFLYSRVFQEAQKQLKKIRGRERHFYKMHYSTQLAC--PDDSPVMN--ACRADNRVLEPMAEDRLNMQQLADGESDKGEKNEE--NRANTQKEEGKHTAAKR---------------LKFSLK----------EHKALKTLGIIMGTFTLCWLPFFILNIVMAYYKGDSINVPFRLLNWLGYSNSAFNPLIYCR-SPDFRHAFQEIL 382          
BLAST of Octopamine receptor vs. Ensembl Medaka
Match: adra1aa (alpha-1A adrenergic receptor [Source:NCBI gene;Acc:101157705])

HSP 1 Score: 177.948 bits (450), Expect = 2.198e-49
Identity = 126/411 (30.66%), Postives = 194/411 (47.20%), Query Frame = 3
Query:  201 EIN-ISFVLIALGLIVFNLVVIFGNIFVIFGVATIWKLKRSVTTNFIISLAISDLLLGAFVLPFSSTTELLKQTWIFGYKICHLWLAVDVLLSTASIYNLVIIGLDRYLAICWPFKYPVLMNNSKAKFLVGFVWIFSFIICSPTIQLIFSDSTSISYNNSLFPSKIHEKYIRINSSMCSIKNSNKYYKVYSAFGSFYIPLVILIFFYTRIFTKVNENFRNIHKGTIKIDQSSIENCMRIHKGIVLNQKPKRATNRFPDNHNNDKHEMLKRKISSPVVKVTTDECSTPARTSTTDNQPLLKVRXXXXXXXXXXXXXXTLALSYKTK---RLFNKISSETKAARMLGVICGAFIVCWLPFF-SWYLTSAFVELDEASTIFSVFFWLGYVNSALNPIIYVIWSKNFRQAFKTLL 1418
            E+N +  V++ + L +F L  + GNI VI  V     L+ +VT  FI++LA++DLLL + VLPFS+  E+L + W+FG   C++W AVDVL  TASI +L +I +DRY+ + +P +YP +M   +A   V  +W+ S II                   S+ P    ++    + ++C I      Y ++SA GSFY+PL I++  Y R++                                V+ QK  R          +D  +++ R +      V+ DE                                   AL  +T    RL  K S E KAA+ LG++ G F++CWLPFF    + S F     + T+F + FWLGY NS +NPIIY   ++ F++AF++LL
Sbjct:   27 ELNTVKAVVLGMVLGIFILFGVIGNILVILSVVCHRHLQ-TVTYYFIVNLAVADLLLSSTVLPFSAIFEILDR-WVFGRVFCNIWAAVDVLCCTASIMSLCVISVDRYIGVSYPLRYPAIMTKRRALLAVMLLWVLSVII-------------------SIGPLFGWKEPAPEDETVCKI-TEEPGYAIFSAVGSFYLPLAIILAMYCRVY--------------------------------VVAQKESRGLKEGQKTEKSDSEQVILR-MHRGNTTVSEDE-----------------------------------ALRSRTHFALRLL-KFSREKKAAKTLGIVVGCFVLCWLPFFLVLPIGSIFPAYRPSDTVFKITFWLGYFNSCINPIIYPCSNQEFKKAFQSLL 346          
BLAST of Octopamine receptor vs. Ensembl Medaka
Match: adrb3a (adrenoceptor beta 3a [Source:ZFIN;Acc:ZDB-GENE-080917-21])

HSP 1 Score: 162.54 bits (410), Expect = 3.193e-44
Identity = 121/393 (30.79%), Postives = 185/393 (47.07%), Query Frame = 3
Query:  252 LVVIFGNIFVIFGVATIWKLKRSVTTNFIISLAISDLLLGAFVLPFSSTTELLKQTWIFGYKICHLWLAVDVLLSTASIYNLVIIGLDRYLAICWPFKYPVLMNNSKAKFLVGFVWIFSFIIC-SPTIQLIFSDSTSISYNNSLFPSKIHEKYIRINSSMCSIKNSNKYYKVYSAFGSFYIPLVILIFFYTRIFTKVNENFRNIHKGTIKIDQSSIENCMRIHKGIVLNQKPKRATNRFPDNHNNDKHEMLKRKISS---PVVKVTTDECSTPARTSTTDNQPLLKVRXXXXXXXXXXXXXXTLALSYKTKRLFNKISSETKAARMLGVICGAFIVCWLPFFSWYLTSAFVELDEASTIFSVFFWLGYVNSALNPIIYVIWSKNFRQAFKTLL 1418
            L+ + GN+ VI  VA   +L+ S T  FI+SLA +DL++G  V+P  ++  ++ + W  G  +C +W ++DVL  TASI  L +I +DRY+AI  P ++ VL++  +A+ +V  VW+ S +I   P +Q  +  S            K  E Y    ++ C    +N  Y + S+  SFYIPL+I+IF YTR+F       + I                             R+  RF       ++E    +I +   P V +++  C++  R  +T  +P                            RL   +  E KA + LG+I G F VCWLPFF   + +AF +      +F +  WLGY+NS LNPIIY   S  FR AFK L+
Sbjct:   27 LITVVGNLLVIIAVARTPQLQTS-TNIFIMSLACADLIMGVLVVPLGASYVVIGK-WELGTTLCDIWTSIDVLCVTASIETLCVIAVDRYIAITRPLRHKVLLSKLRARIIVCLVWLVSTLISFVPIMQGYWHSSD----------HKATECY---GNTTCCDFVTNPSYAISSSIVSFYIPLLIMIFVYTRVFVIAARQVKLI----------------------------DRSRMRF-------QNECPAAQIGANILPSVCLSSSICNSATRKKSTKRRP---------------------------SRLI--LVKEHKALKTLGIIMGTFTVCWLPFFVANIINAFKKDIPGDDLFRLLNWLGYINSGLNPIIYC-RSPEFRTAFKNLM 339          
BLAST of Octopamine receptor vs. Ensembl Medaka
Match: adra2a (adrenoceptor alpha 2A [Source:NCBI gene;Acc:266750])

HSP 1 Score: 162.155 bits (409), Expect = 3.452e-44
Identity = 121/415 (29.16%), Postives = 187/415 (45.06%), Query Frame = 3
Query:  255 VVIFGNIFVIFGVATIWKLKRSVTTNFIISLAISDLLLGAFVLPFSSTTELLKQTWIFGYKICHLWLAVDVLLSTASIYNLVIIGLDRYLAICWPFKYPVLMNNSKAKFLVGFVWIFSFIICSPTIQLIFSDSTSISYNNSLFPSKIHEKYIRINSSMCSIKNSNKYYKVYSAFGSFYIPLVILIFFYTRIFTKVNENFR--------------------NIHKGTIKIDQSSIENCMRIHKGIVLNQKPKRATNRFPDNHNNDKHEMLKRKISSPVVKVTTDECSTPARTSTTDNQPLLKVRXXXXXXXXXXXXXXTLALSYKTKRLFNKISSETKAARMLGVICGAFIVCWLPFFSWYL-----TSAFVELDEASTIFSVFFWLGYVNSALNPIIYVIWSKNFRQAFKTLLCR 1424
            +++FGN+ V+  V T   L R+    F++SLA +D+L+   V+PFS   EL+   W FG   C ++LA+DVL  TASI +L  I LDRY +I    +Y +     + K ++  VW+ + +I  P                   P    EK     S +C I N  K+Y + S  GSF++P +I++  Y RI+    +  R                        G  + D       +   + + L +  +R  +      N    E      SS         CS P +++        K + + S+ K         A S K  R   + + E +   +L V+ G F+VCW PFF  Y+     +S +V     + +F+ FFW GY NSALNPIIY I++ +FR+AFK +LCR
Sbjct:   29 LIVFGNVLVVIAVFTSRAL-RAPQNLFLVSLASADILVATLVMPFSLANELMG-FWYFGKVWCEIYLALDVLFCTASIAHLCAISLDRYWSITQAIEYNLKRTPRRIKSIIVIVWVIAAVISFP-------------------PLITMEKENGSESPVCKI-NDEKWYVISSCIGSFFLPCIIMVLVYVRIYQIAKKRTRAPPGDRQQKGLSGPGAAAAGQRENGVGEPDDGLCHEKLNGEQDVELKEGVERGADEAKVEVNGGDMEE-----SSSSDHKADHPCSIPKKSA--------KGKTRLSQVKPGDADPQRRAQSAKASRWKGRQNREKRFTFVLAVVIGVFVVCWFPFFFTYMLKTLCSSCYV----PTALFNFFFWFGYCNSALNPIIYTIFNHDFRRAFKKILCR 404          
BLAST of Octopamine receptor vs. Planmine SMEST
Match: SMESG000059264.1 (SMESG000059264.1)

HSP 1 Score: 805.053 bits (2078), Expect = 0.000e+0
Identity = 414/417 (99.28%), Postives = 415/417 (99.52%), Query Frame = 3
Query:  180 MRIVQRMEINISFVLIALGLIVFNLVVIFGNIFVIFGVATIWKLKRSVTTNFIISLAISDLLLGAFVLPFSSTTELLKQTWIFGYKICHLWLAVDVLLSTASIYNLVIIGLDRYLAICWPFKYPVLMNNSKAKFLVGFVWIFSFIICSPTIQLIFSDSTSISYNNSLFPSKIHEKYIRINSSMCSIKNSNKYYKVYSAFGSFYIPLVILIFFYTRIFTKVNENFRNIHKGTIKIDQSSIENCMRIHKGIVLNQKPKRATNRFPDNHNNDKHEMLKRKISSPVVKVTTDECSTPARTSTTDNQPLLKVRXXXXXXXXXXXXXXTLALSYKTKRLFNKISSETKAARMLGVICGAFIVCWLPFFSWYLTSAFVELDEASTIFSVFFWLGYVNSALNPIIYVIWSKNFRQAFKTLLCRIF 1430
            MRIVQRMEINISFVLIALGLIVFNL VIFGNIFVIFGVATIWKLKRSVTTNFIISLAISDLLLGAFVLPFSSTTELLKQTWIFGYKICHLWLAVDVLLSTASIYNLVIIGLDRYLAICWPFKYPVLMNNSKAKFLVGFVWIFSFIICSPTIQLIFSDSTSISY+NSLFPSKIHEKYIRINSSMCSIKNSNKYYKVYSAFGSFYIPLVILIFFYTRIFTKVNENFRNIHKGTIKIDQSSIENCMRIHKGIVLNQKPKRATNRFPDNHNNDKHEMLKRKISSPVVKVTTDECSTPARTSTTDNQPLLKVRKKSSKFKSDIKISSTLALSYKTKRLFNKISSETKAARMLGVICGAFIVCWLPFFSWYLTSAFVELDEAS IFSVFFWLGYVNSALNPIIYVIWSKNFRQAFKTLLCRIF
Sbjct:    1 MRIVQRMEINISFVLIALGLIVFNLFVIFGNIFVIFGVATIWKLKRSVTTNFIISLAISDLLLGAFVLPFSSTTELLKQTWIFGYKICHLWLAVDVLLSTASIYNLVIIGLDRYLAICWPFKYPVLMNNSKAKFLVGFVWIFSFIICSPTIQLIFSDSTSISYDNSLFPSKIHEKYIRINSSMCSIKNSNKYYKVYSAFGSFYIPLVILIFFYTRIFTKVNENFRNIHKGTIKIDQSSIENCMRIHKGIVLNQKPKRATNRFPDNHNNDKHEMLKRKISSPVVKVTTDECSTPARTSTTDNQPLLKVRKKSSKFKSDIKISSTLALSYKTKRLFNKISSETKAARMLGVICGAFIVCWLPFFSWYLTSAFVELDEASPIFSVFFWLGYVNSALNPIIYVIWSKNFRQAFKTLLCRIF 417          
BLAST of Octopamine receptor vs. Planmine SMEST
Match: SMESG000009251.1 (SMESG000009251.1)

HSP 1 Score: 325.865 bits (834), Expect = 3.393e-106
Identity = 195/453 (43.05%), Postives = 271/453 (59.82%), Query Frame = 3
Query:  132 KNDCFCAKRDEEINL*MRIVQRMEINISFVLIALGLIVFNLVVIFGNIFVIFGVATIWKLKRSVTTNFIISLAISDLLLGAFVLPFSSTTELLKQTWIFGYKICHLWLAVDVLLSTASIYNLVIIGLDRYLAICWPFKYPVLMNNSKAKFLVGFVWIFSFIICSPTI-QLIFSDSTSISYNNSLFPSKIHEKY---IRINSSMCSIKNSNKYYKVYSAFGSFYIPLVILIFFYTRIFTKVNENFRNIHKGTIKIDQSSIENCMRIHKGIVLNQKPKRATNRFPDNHNNDKHE---MLKRKISSPVVKV------------TTDECSTPARTSTTDNQPLLKVRXXXXXXXXXXXXXXTLALSYKTKRL---FNKISSETKAARMLGVICGAFIVCWLPFFSWYLTSAFVELDEASTIFSVFFWLGYVNSALNPIIYVIWSKNFRQAFKTLLCR 1424
            KN  FC   D  ++             SF+ + + L+  NL+VI GNI VI  V + W+L+ S+   FII+LA SDL LG FVLP S   ELLK+ WIFG ++C  WLA+DV LSTASI NLVI+GLDR++AIC   +Y  LM++ +A+ LV  VWI +FIIC+PTI  +I SDS ++  N S F   ++  Y    +I +  CSI+NSN+ YK+YSA GSF+IPL+ILI+FY+RIF  V EN +    G +  D+   +  MRIH G   N+K  +   + P ++++DK     +  R + + V+ V            T    ST   ++ T+   +++V  +      D K++    L  K KR     NK + ETKAAR+L ++CGAFIVCW PFF+ Y+  AFV L E   +F +FFWLGY NSALNPIIY I S++FR AF+ +  R
Sbjct:    4 KNSSFCFNEDYFLSF------------SFISLCVCLVFINLIVIVGNILVIILVKSFWRLRNSIANIFIINLAASDLFLGVFVLPLSLINELLKKHWIFGNELCGSWLAIDVCLSTASILNLVIVGLDRFIAICHSIRYTSLMSHGRARILVSLVWISAFIICAPTIFTVISSDSVNVITNQSNFVHILYYNYKYCYQIINYSCSIENSNQIYKIYSALGSFFIPLIILIYFYSRIFATVKENAKKFRTGALSTDKKG-QPAMRIHLG-SGNRKNSKIFEKLPLSNSHDKWRYAFLQDRPVETNVMPVSALGSNLALSIETIGMRSTRIMSAITE---IIEVPTQEDLPTLDQKLTDKKILISKQKRAQNKHNKYARETKAARLLAIVCGAFIVCWAPFFTLYILGAFVNLHEEGLLFDIFFWLGYTNSALNPIIYFIVSRDFRTAFRKIFLR 439          
BLAST of Octopamine receptor vs. Planmine SMEST
Match: SMESG000081069.1 (SMESG000081069.1)

HSP 1 Score: 231.106 bits (588), Expect = 1.362e-69
Identity = 157/434 (36.18%), Postives = 218/434 (50.23%), Query Frame = 3
Query:  267 GNIFVIFGVATIWKLKRSVTTNFIISLAISDLLLGAFVLPFSSTTELLKQTWIFGYKICHLWLAVDVLLSTASIYNLVIIGLDRYLAICWPFKYPVLMNNSKAKFLVGFVWIFSFIICSPTIQLIFSDSTSISYNNSLFPSKIHEKYIRINSS--------MCSIKNSNKYYKVYSAFGSFYIPLVILIFFYTRIFTKVNENFRNIHKGTIK-----------------IDQSSIENCMR--IHKGIVLNQKPKR-----------------ATNRFPDNHNNDKHEMLKRKISSPVV----KVTTDECSTPARTSTTDNQPLLKVRXXXXXXXXXXXXXXTLALSYKTKRLFNKISSETKAARMLGVICGAFIVCWLPFFSWYLTSAFVELDEASTIFSVFFWLGYVNSALNPIIYVIWSKNFRQAFKTLLCR 1424
            GNI VI   +T  KL+R  T  FII+LA+SDLLLG  VLP S   ++L + W FG  +C +WLA DVLL TASI NL +I  DRY+AI  P +Y   M N   + L+  VWIF+FII  P I        ++ Y N++   KI +     N S        +CSI +S+  Y +YSAFGS+YIPL+++++FY  IF   ++    I KG +K                  D SS   C+      G ++   P+                   T +F  N +N  +  L    S   +    + T  E       S  D+  L K ++  ++      I   L+          ++  E KAARMLG+ICGAFI+CWLPFF  Y+T AF + +   + F   FWLGY NS LNP IY ++SK+FR A++  LCR
Sbjct:   42 GNILVIIAASTSVKLRRYKTNIFIINLAVSDLLLGIIVLPLSIGNQVLNRRWFFGNALCKIWLASDVLLCTASILNLTVISFDRYIAIRNPIRYLSWMTNKNCQILLTSVWIFAFIISFPNI-------LTLVYQNTIINIKISDVNPTRNMSFSNLSIHAICSITDSSPGYIIYSAFGSYYIPLIVMVYFYASIFATAHKTICGIAKGRLKNRDGKTIIMRVHCGGFRTDSSSKSQCLESSDETGKLIQSTPRHRISNCPFKFCCQNKIPFTTPKFSFNKSNSHNPNLDDCKSIESINFSQRDTGIESDYELLKSNVDSINLTKTKRSLTQTSEIKIIPVPLS----------RMQREAKAARMLGIICGAFILCWLPFFIVYVTGAFYK-NIPDSWFDGVFWLGYCNSLLNPWIYALFSKDFRLAYRRFLCR 457          
BLAST of Octopamine receptor vs. Planmine SMEST
Match: SMESG000044639.1 (SMESG000044639.1)

HSP 1 Score: 180.259 bits (456), Expect = 5.043e-51
Identity = 134/389 (34.45%), Postives = 202/389 (51.93%), Query Frame = 3
Query:  267 GNIFVIFGVATIWKLKRSVTTNFIISLAISDLLLGAFVLPFSSTTELLKQTWIFGYKICHLWLAVDVLLSTASIYNLVIIGLDRYLAICWPFKYPVLMNNSKAKFLVGFVWIFSFIICSPTIQLIFSDSTSISYNNSLFPSKIHEKYIRINSSMCSIKNSNKYYKVYSAFGSFYIPLVILIFFYTRIFTKVNENFRNIHKGTIKIDQSSIENCMRIHKGIVLNQKPKRATNRFPDNHNNDKHEMLKRKISSPVVKVTTDECSTPARTSTTDNQPLLKVRXXXXXXXXXXXXXXTLALSYKTKRLFNKISSETKAARMLGVICGAFIVCWLPFFSWYLTSAFVE-LDEASTIFSVFFWLGYVNSALNPIIYVIWSKNFRQAFKTLLCRIF 1430
            GN  V+  ++T ++LK ++   F+ SLAI+DLLLG  +LPFS   E+  + WIFG  +C LWLA+DVLL TASI +L +I +DRY +I  P +Y      ++   ++   WI S +IC P +    S S + S              I  N   C +   N+ Y +YS+ GSFYIPL+I+I  Y ++F +     R   K  +K  +        + K   L +  K+        +   +      ++ S  +    D+   P   S T+NQ  L  +K          I S LA+  K+K +  +   E +   +LGV+ GAFIVCWLPFF+ YL   F + ++E   +F  FFWLGY NS LNPIIY +++++FR+AF+ +L  I 
Sbjct:   39 GNSLVLIAISTDYRLK-NIQNWFLGSLAIADLLLGILILPFSLFNEIFGR-WIFGRLLCSLWLAIDVLLCTASIMHLCLISIDRYYSIVRPIQYKTSRTPNRVLAMIIAAWIISGLICLPPLFGWSSHSLNFS--------------ISSNEQKCEL-TQNRAYVLYSSIGSFYIPLLIIIIVYLQVFIEAKR--RANRKYVVKKPE--------VKKNPELFR--KKEVVEVDIEYTEIQQNCNCNQVDSEAISCIVDD-DDP---SVTNNQEPLNSQKHRIDRIQSKNIISKLAIR-KSKLVRYR---ERRTIVVLGVVVGAFIVCWLPFFTSYLIVIFCKCMNEH--LFGFFFWLGYCNSGLNPIIYTVYNRDFRKAFQRILSMIM 388          
BLAST of Octopamine receptor vs. Planmine SMEST
Match: SMESG000018302.1 (SMESG000018302.1)

HSP 1 Score: 165.622 bits (418), Expect = 1.392e-45
Identity = 139/427 (32.55%), Postives = 202/427 (47.31%), Query Frame = 3
Query:  210 ISFVLIALGLIVFNLVVIFGNIFVIFGVATIWKLKRSVTTNFIISLAISDLLLGAFVLPFSSTTELLKQTWIFGYKICHLWLAVDVLLSTASIYNLVIIGLDRYLAICWPFKYPVLMNNSKAKFLVGFVWIFSFIICSPTIQLIFSDSTSISYNNSLFPSKIHEKYIRINSSMCSIK-NSNKYYKVYSAFGSFYIPLVILIFFYTRIFTKVNENFRNIHKG--TIKIDQSSIENC---MRIHKGIVLN-QKPKRATNRFPDNHNNDKHEMLKRK---ISSPVVKVTTDECSTPARTSTTDNQPLLKVRXXXXXXXXXXXXXXTLALSYKTKRLFNKISSETKAARMLGVICGAFIVCWLPFFSWYLTSAFVELDEASTIF----------SVFFWLGYVNSALNPIIYVIWSKNFRQAFKTLLCRIF 1430
            +S + IA   +  +   IFGN  VI  VA+   L R+ T  FI+SLA +DLL+G  V+PF+   EL ++ WIFG   C +W A DVL +TASI NL +I ++RY     P      + N     ++  VW  S  I  P I  I+   +S +Y+                 S+CS K  ++ +Y   S+  SFY PLV+++  Y +I+         + KG   I+    ++ N    +RIHKG     QKP    N + ++ N  K    K K   IS P+  V  D CS P  +S +      K+R                   +   +   K ++E KAAR LG + G FI+CWLPFF   + +    LD  + +F           +  WLGY+NS +NPIIY    ++FR AF  LLC I+
Sbjct:   12 VSVISIASIKMFLSFGTIFGNSLVIIAVASNSNL-RTCTNYFIVSLACADLLMGLVVMPFAMLNELGQEVWIFGQIWCDMWHAFDVLSTTASILNLCMIAIERYKVTTSPLLAGRHLTNKNCIIMIFLVWFCSACISFPAI--IWWRQSSDTYD-----------------SVCSCKFPTDPFYISISSIVSFYAPLVLMLVLYWKIYRTAKRMIICLQKGERVIEDGDKALNNPPVRLRIHKGGFRALQKP----NLYQNSKNKSKWFSWKTKPMGISEPLSCVA-DLCSGPVTSSASIA---FKLR------------------HFTLGKKLIKFNTEQKAARTLGFVMGTFILCWLPFF---ICNILNSLDNQNKLFRTGSIGDHILPLVTWLGYLNSCMNPIIYAHSMRHFRMAFIRLLCPIY 389          
The following BLAST results are available for this feature:
BLAST of Octopamine receptor vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ADRA1B1.929e-4431.92adrenoceptor alpha 1B [Source:HGNC Symbol;Acc:HGNC... [more]
DRD28.346e-4027.80dopamine receptor D2 [Source:HGNC Symbol;Acc:HGNC:... [more]
ADRA2A2.008e-3927.05adrenoceptor alpha 2A [Source:HGNC Symbol;Acc:HGNC... [more]
HTR1A1.100e-3828.345-hydroxytryptamine receptor 1A [Source:HGNC Symbo... [more]
HTR1B3.084e-3829.805-hydroxytryptamine receptor 1B [Source:HGNC Symbo... [more]
back to top
BLAST of Octopamine receptor vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ser-61.838e-5030.49SERotonin/octopamine receptor family [Source:UniP... [more]
ser-62.084e-4729.41SERotonin/octopamine receptor family [Source:UniP... [more]
octr-11.672e-4629.30OCTopamine Receptor (GPCR) [Source:UniProtKB/TrEM... [more]
octr-12.573e-4628.99OCTopamine Receptor (GPCR) [Source:UniProtKB/TrEM... [more]
dop-45.277e-4429.32Dopamine receptor 4 [Source:UniProtKB/Swiss-Prot;... [more]
back to top
BLAST of Octopamine receptor vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Dop1R22.235e-4832.58gene:FBgn0266137 transcript:FBtr0085467[more]
Dop1R23.459e-4832.83gene:FBgn0266137 transcript:FBtr0085468[more]
Dop1R26.140e-4732.83gene:FBgn0266137 transcript:FBtr0330293[more]
5-HT71.325e-4529.43gene:FBgn0004573 transcript:FBtr0334508[more]
5-HT71.325e-4529.43gene:FBgn0004573 transcript:FBtr0085746[more]
back to top
BLAST of Octopamine receptor vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
adra1aa3.144e-4930.83adrenoceptor alpha 1Aa [Source:ZFIN;Acc:ZDB-GENE-0... [more]
adra1d2.969e-4731.14adrenoceptor alpha 1D [Source:ZFIN;Acc:ZDB-GENE-09... [more]
AL928672.13.893e-4630.75pep chromosome:GRCz11:CHR_ALT_CTG10_1_14:18996850:... [more]
adra1ab7.036e-4631.01adrenoceptor alpha 1Ab [Source:ZFIN;Acc:ZDB-GENE-0... [more]
adra1ab8.355e-4631.01adrenoceptor alpha 1Ab [Source:ZFIN;Acc:ZDB-GENE-0... [more]
back to top
BLAST of Octopamine receptor vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ENSXETT00000011711.15.060e-5031.35adrenoceptor alpha 1B [Source:NCBI gene;Acc:100488... [more]
efr3b4.343e-4631.13EFR3 homolog B [Source:Xenbase;Acc:XB-GENE-6033491... [more]
HTR1F5.068e-4030.415-hydroxytryptamine (serotonin) receptor 1F, G pro... [more]
exd21.378e-3928.71exonuclease 3'-5' domain containing 2 [Source:Xenb... [more]
adra2c1.791e-3829.78adrenoceptor alpha 2C [Source:NCBI gene;Acc:100145... [more]
back to top
BLAST of Octopamine receptor vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Adra1b1.520e-4932.67adrenergic receptor, alpha 1b [Source:MGI Symbol;A... [more]
Adra1b7.364e-4632.42adrenergic receptor, alpha 1b [Source:MGI Symbol;A... [more]
Adra1b7.364e-4632.42adrenergic receptor, alpha 1b [Source:MGI Symbol;A... [more]
Adra1d7.203e-4228.92adrenergic receptor, alpha 1d [Source:MGI Symbol;A... [more]
Htr1a1.156e-4029.695-hydroxytryptamine (serotonin) receptor 1A [Sourc... [more]
back to top
BLAST of Octopamine receptor vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q93126|GPR9_AMPAM6.503e-6835.51Probable G-protein coupled receptor No9 OS=Amphiba... [more]
sp|Q91175|ADA1A_ORYLA2.578e-4830.66Alpha-1A adrenergic receptor OS=Oryzias latipes OX... [more]
sp|Q24563|DOPR2_DROME3.467e-4732.83Dopamine receptor 2 OS=Drosophila melanogaster OX=... [more]
sp|Q25188|OAR_HELVI4.296e-4731.52Octopamine receptor OS=Heliothis virescens OX=7102... [more]
sp|Q17232|OAR_BOMMO9.342e-4631.82Octopamine receptor OS=Bombyx mori OX=7091 PE=2 SV... [more]
back to top
BLAST of Octopamine receptor vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
V4A2Q61.407e-7539.42G_PROTEIN_RECEP_F1_2 domain-containing protein OS=... [more]
A0A1B0CRD41.756e-7138.39Octopamine receptor (GPRoar1) OS=Lutzomyia longipa... [more]
E9FX333.816e-7037.41G_PROTEIN_RECEP_F1_2 domain-containing protein OS=... [more]
A0A147BAW54.897e-7036.36Putative octopamine receptor oamb (Fragment) OS=Ix... [more]
B7PJX66.794e-7035.88GPR octopamine receptor 1 (Fragment) OS=Ixodes sca... [more]
back to top
BLAST of Octopamine receptor vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
adra1ab3.363e-5133.83alpha-1A adrenergic receptor-like [Source:NCBI gen... [more]
ADRA1D6.679e-5032.42adrenoceptor alpha 1D [Source:NCBI gene;Acc:103027... [more]
adra1aa2.415e-4729.68alpha-1A adrenergic receptor-like [Source:NCBI gen... [more]
adrb3a1.233e-4230.60beta-1 adrenergic receptor-like [Source:NCBI gene;... [more]
adra2a6.837e-4230.18adrenoceptor alpha 2A [Source:NCBI gene;Acc:266750... [more]
back to top
BLAST of Octopamine receptor vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 5
Match NameE-valueIdentityDescription
HTR1F7.672e-3727.645-hydroxytryptamine receptor 1F [Source:HGNC Symbo... [more]
ENSPMAT00000004593.13.423e-3226.41pep scaffold:Pmarinus_7.0:GL476854:168999:207459:1... [more]
ENSPMAT00000009127.13.704e-3226.73pep scaffold:Pmarinus_7.0:GL478629:43196:44446:-1 ... [more]
ENSPMAT00000006953.16.069e-3227.58pep scaffold:Pmarinus_7.0:GL477632:7596:14007:1 ge... [more]
adra2c9.349e-2232.21adrenoceptor alpha 2C [Source:NCBI gene;Acc:266752... [more]
back to top
BLAST of Octopamine receptor vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Octopamine receptor vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
EDO473592.887e-2826.49Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO354503.275e-2430.14Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO438351.775e-2224.19Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO286032.151e-2234.21Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO409993.232e-2234.21Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Octopamine receptor vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
adra1d1.202e-5131.99adrenoceptor alpha 1D [Source:NCBI gene;Acc:101157... [more]
ENSORLT00000002753.22.161e-5032.19beta-2 adrenergic receptor [Source:NCBI gene;Acc:1... [more]
adra1aa2.198e-4930.66alpha-1A adrenergic receptor [Source:NCBI gene;Acc... [more]
adrb3a3.193e-4430.79adrenoceptor beta 3a [Source:ZFIN;Acc:ZDB-GENE-080... [more]
adra2a3.452e-4429.16adrenoceptor alpha 2A [Source:NCBI gene;Acc:266750... [more]
back to top
BLAST of Octopamine receptor vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000059264.10.000e+099.28SMESG000059264.1[more]
SMESG000009251.13.393e-10643.05SMESG000009251.1[more]
SMESG000081069.11.362e-6936.18SMESG000081069.1[more]
SMESG000044639.15.043e-5134.45SMESG000044639.1[more]
SMESG000018302.11.392e-4532.55SMESG000018302.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30015590 ID=SMED30015590|Name=Octopamine receptor|organism=Schmidtea mediterranea sexual|type=transcript|length=1637bp
GAATTTTCAACTCAGATTGACCGGGAGATTCCCAATGTTATCATTAATTG
GATATAATTTTTAATTTTCACTGAAGAAACCAACCAATCAGATGTAAGGA
AAAGAAATAATAAAATTAAAAGAATTCCTCTAAAAATGATTGCTTTTGTG
CTAAGAGAGATGAAGAAATTAATTTGTAAATGAGAATAGTTCAAAGAATG
GAAATAAATATTTCTTTCGTGTTGATTGCGTTAGGTTTGATTGTGTTCAA
CTTGGTCGTTATTTTCGGCAACATTTTTGTCATTTTTGGAGTCGCAACGA
TTTGGAAATTGAAGCGTAGTGTAACAACAAATTTTATAATCAGTCTAGCA
ATAAGCGATCTTTTATTGGGAGCGTTTGTGCTGCCATTTTCTTCCACAAC
AGAACTATTAAAACAGACTTGGATTTTCGGTTATAAAATTTGCCATTTGT
GGTTGGCAGTTGACGTTCTGTTATCAACGGCAAGTATATATAATCTCGTT
ATTATTGGTCTAGATCGGTATTTGGCGATTTGTTGGCCTTTCAAATATCC
TGTTCTAATGAATAACTCCAAGGCAAAATTTCTCGTAGGATTCGTTTGGA
TATTTTCCTTCATAATTTGCTCTCCGACAATTCAGTTGATTTTCAGTGAT
TCCACGTCCATTTCCTACAACAATTCATTATTTCCGTCGAAGATCCATGA
AAAATATATAAGAATTAACAGTTCAATGTGTTCAATAAAAAATTCCAATA
AATATTACAAAGTTTATTCAGCTTTCGGATCGTTTTATATTCCGTTAGTA
ATTCTCATTTTTTTCTACACTCGAATATTCACAAAAGTCAATGAGAACTT
CCGCAACATTCATAAAGGCACAATCAAAATCGACCAATCATCAATCGAGA
ATTGCATGCGCATCCACAAAGGCATCGTATTAAATCAGAAACCTAAAAGA
GCAACCAATCGTTTTCCTGATAATCACAATAATGACAAACACGAAATGTT
AAAAAGAAAGATTTCTAGTCCAGTTGTTAAAGTCACAACAGATGAGTGCA
GCACCCCAGCGAGAACATCGACAACGGATAATCAACCTCTCCTTAAAGTG
AGAAAAAAGTCCTCCAAATTCAAAAGTGATATTAAAATTTCATCTACTTT
AGCACTTAGTTATAAAACTAAAAGACTTTTCAACAAAATATCAAGTGAAA
CTAAAGCAGCTAGAATGCTTGGAGTCATTTGTGGAGCATTTATAGTTTGT
TGGTTGCCTTTTTTCAGTTGGTATTTAACGAGCGCATTTGTGGAACTGGA
CGAAGCCTCTACGATTTTCAGTGTTTTCTTTTGGCTGGGCTATGTCAACA
GTGCACTAAATCCCATCATTTATGTTATTTGGTCAAAAAACTTTCGTCAA
GCATTCAAAACATTATTATGTAGAATATTTTAATGAAAAAATAACGTATA
CCAATTTTATCATTTATCACCTGTGACACGCAATTGAAATTAATGCACAA
GCTGTTAAGAGAATTTTATATATTCGTGTAAGGCTAGACAATATGGTAGG
ATAATTAATAAAGAATAATTAAAAAAGCCAATTAAGGTGAAAAACATGTT
TTACGATATAATTCAACAGTTTTCCCCCATCAACGGG
back to top

protein sequence of SMED30015590-orf-1

>SMED30015590-orf-1 ID=SMED30015590-orf-1|Name=SMED30015590-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=418bp
MRIVQRMEINISFVLIALGLIVFNLVVIFGNIFVIFGVATIWKLKRSVTT
NFIISLAISDLLLGAFVLPFSSTTELLKQTWIFGYKICHLWLAVDVLLST
ASIYNLVIIGLDRYLAICWPFKYPVLMNNSKAKFLVGFVWIFSFIICSPT
IQLIFSDSTSISYNNSLFPSKIHEKYIRINSSMCSIKNSNKYYKVYSAFG
SFYIPLVILIFFYTRIFTKVNENFRNIHKGTIKIDQSSIENCMRIHKGIV
LNQKPKRATNRFPDNHNNDKHEMLKRKISSPVVKVTTDECSTPARTSTTD
NQPLLKVRKKSSKFKSDIKISSTLALSYKTKRLFNKISSETKAARMLGVI
CGAFIVCWLPFFSWYLTSAFVELDEASTIFSVFFWLGYVNSALNPIIYVI
WSKNFRQAFKTLLCRIF*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: INTERPRO
TermDefinition
IPR000276GPCR_Rhodpsn
IPR017452GPCR_Rhodpsn_7TM
Vocabulary: molecular function
TermDefinition
GO:0004930G-protein coupled receptor activity
GO:0004871signal transducer activity
GO:0004935adrenergic receptor activity
Vocabulary: cellular component
TermDefinition
GO:0016021integral component of membrane
GO:0005886plasma membrane
GO:0016020membrane
Vocabulary: biological process
TermDefinition
GO:0007186G-protein coupled receptor signaling pathway
GO:0007165signal transduction
GO:0071875adrenergic receptor signaling pathway
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR000276G protein-coupled receptor, rhodopsin-likePRINTSPR00237GPCRRHODOPSNcoord: 380..406
score: 38.23
coord: 343..367
score: 34.15
coord: 49..70
score: 35.09
coord: 15..39
score: 22.37
coord: 194..217
score: 27.48
coord: 131..152
score: 22.92
coord: 95..117
score: 37.65
IPR000276G protein-coupled receptor, rhodopsin-likePFAMPF000017tm_1coord: 30..398
e-value: 1.7E-66
score: 224.2
IPR000276G protein-coupled receptor, rhodopsin-likePROSITEPS00237G_PROTEIN_RECEP_F1_1coord: 101..117
NoneNo IPR availableGENE3DG3DSA:1.20.120.10coord: 225..336
e-value: 3.5E-87
score: 294.9
NoneNo IPR availableGENE3DG3DSA:1.20.1070.10coord: 20..412
e-value: 3.5E-87
score: 294.9
NoneNo IPR availablePANTHERPTHR24247:SF134OCTOPAMINE RECEPTOR OAMBcoord: 14..415
NoneNo IPR availablePANTHERPTHR242475-HYDROXYTRYPTAMINE RECEPTORcoord: 14..415
NoneNo IPR availableCDDcd149677tmA_amine_R-likecoord: 15..409
e-value: 8.53666E-65
score: 206.26
NoneNo IPR availableSUPERFAMILYSSF81321Family A G protein-coupled receptor-likecoord: 12..416
NoneNo IPR availableTMHMMTMhelixcoord: 379..401
NoneNo IPR availableTMHMMTMhelixcoord: 347..369
NoneNo IPR availableTMHMMTMhelixcoord: 134..156
NoneNo IPR availableTMHMMTMhelixcoord: 195..217
NoneNo IPR availableTMHMMTMhelixcoord: 87..109
NoneNo IPR availableTMHMMTMhelixcoord: 15..37
NoneNo IPR availableTMHMMTMhelixcoord: 50..72
IPR017452GPCR, rhodopsin-like, 7TMPROSITEPS50262G_PROTEIN_RECEP_F1_2coord: 30..398
score: 42.639