Dual specificity protein phosphatase 14

Overview
NameDual specificity protein phosphatase 14
Smed IDSMED30015587
Length (bp)1188
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Dual specificity protein phosphatase 14 (SMED30015587) t-SNE clustered cells

Violin plots show distribution of expression levels for Dual specificity protein phosphatase 14 (SMED30015587) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Dual specificity protein phosphatase 14 (SMED30015587) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Dual specificity protein phosphatase 14 (SMED30015587) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30015587

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 11

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
head regionSMED30015587h1SMcG0002406 SmedASXL_013073SmedAsxl_ww_GCZZ01PMID:27034770
Currie et al., 2016
whole organism asexual adult RNA-sequencing evidence
Smed sexual biotypeSMED30015587h1SMcG0002406 Contig54125newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30015587h1SMcG0002406 Contig54125uc_Smed_v2PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
pharynxSMED30015587h1SMcG0002406 dd_Smed_v4_7558_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
protonephridiaSMED30015587h1SMcG0002406 dd_Smed_v4_7558_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
nervous systemSMED30015587h1SMcG0002406 dd_Smed_v4_7558_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
epidermisSMED30015587h1SMcG0002406 dd_Smed_v4_7558_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
cephalic gangliaSMED30015587h1SMcG0002406 dd_Smed_v4_7558_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
neuronSMED30015587h1SMcG0002406 dd_Smed_v4_7558_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult colorimetric in situ hybridization evidence
head regionSMED30015587h1SMcG0002406 dd_Smed_v6_7558_0_1dd_Smed_v6PMID:28171748
Stückemann et al., 2017
whole organism asexual adult RNA-sequencing evidence
epidermisSMED30015587h1SMcG0002406 dd_Smed_v4_7558_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Dual specificity protein phosphatase 14 vs. Ensembl Human
Match: DUSP14 (dual specificity phosphatase 14 [Source:HGNC Symbol;Acc:HGNC:17007])

HSP 1 Score: 140.584 bits (353), Expect = 2.906e-39
Identity = 72/169 (42.60%), Postives = 113/169 (66.86%), Query Frame = 2
Query:  380 VSQIARITDNLYLSGLHAITSER--LKSLGISLVVSLIAENSSMRLP----PSIERIQVNIEDTENVNIRRHFDKVLERMNTEERRQGRILVHCVAGISRSSTIILAYLMRYHNMRLREAYNLVHSQRPYIQPNLGFWRQLIDYEKSIFGGSSVNMVPMEGTRILVPDV 868
            +  IA+IT +L+L G  ++ S R  L++ GI+ +V     N+++ +P    P  E ++V + D  +  I  +FD V +++++  R+ G  LVHC AG+SRS+T+ +AYLM++HN+ L EAYN V ++RP I+PN+GFWRQLIDYE+ +FG S+V MV  +    +VPDV
Sbjct:   24 IGGIAQITSSLFL-GRGSVASNRHLLQARGITCIV-----NATIEIPNFNWPQFEYVKVPLADMPHAPIGLYFDTVADKIHSVSRKHGATLVHCAAGVSRSATLCIAYLMKFHNVCLLEAYNWVKARRPVIRPNVGFWRQLIDYERQLFGKSTVKMV--QTPYGIVPDV 184          
BLAST of Dual specificity protein phosphatase 14 vs. Ensembl Human
Match: DUSP14 (dual specificity phosphatase 14 [Source:HGNC Symbol;Acc:HGNC:17007])

HSP 1 Score: 140.584 bits (353), Expect = 2.906e-39
Identity = 72/169 (42.60%), Postives = 113/169 (66.86%), Query Frame = 2
Query:  380 VSQIARITDNLYLSGLHAITSER--LKSLGISLVVSLIAENSSMRLP----PSIERIQVNIEDTENVNIRRHFDKVLERMNTEERRQGRILVHCVAGISRSSTIILAYLMRYHNMRLREAYNLVHSQRPYIQPNLGFWRQLIDYEKSIFGGSSVNMVPMEGTRILVPDV 868
            +  IA+IT +L+L G  ++ S R  L++ GI+ +V     N+++ +P    P  E ++V + D  +  I  +FD V +++++  R+ G  LVHC AG+SRS+T+ +AYLM++HN+ L EAYN V ++RP I+PN+GFWRQLIDYE+ +FG S+V MV  +    +VPDV
Sbjct:   24 IGGIAQITSSLFL-GRGSVASNRHLLQARGITCIV-----NATIEIPNFNWPQFEYVKVPLADMPHAPIGLYFDTVADKIHSVSRKHGATLVHCAAGVSRSATLCIAYLMKFHNVCLLEAYNWVKARRPVIRPNVGFWRQLIDYERQLFGKSTVKMV--QTPYGIVPDV 184          
BLAST of Dual specificity protein phosphatase 14 vs. Ensembl Human
Match: DUSP14 (dual specificity phosphatase 14 [Source:HGNC Symbol;Acc:HGNC:17007])

HSP 1 Score: 140.584 bits (353), Expect = 2.906e-39
Identity = 72/169 (42.60%), Postives = 113/169 (66.86%), Query Frame = 2
Query:  380 VSQIARITDNLYLSGLHAITSER--LKSLGISLVVSLIAENSSMRLP----PSIERIQVNIEDTENVNIRRHFDKVLERMNTEERRQGRILVHCVAGISRSSTIILAYLMRYHNMRLREAYNLVHSQRPYIQPNLGFWRQLIDYEKSIFGGSSVNMVPMEGTRILVPDV 868
            +  IA+IT +L+L G  ++ S R  L++ GI+ +V     N+++ +P    P  E ++V + D  +  I  +FD V +++++  R+ G  LVHC AG+SRS+T+ +AYLM++HN+ L EAYN V ++RP I+PN+GFWRQLIDYE+ +FG S+V MV  +    +VPDV
Sbjct:   24 IGGIAQITSSLFL-GRGSVASNRHLLQARGITCIV-----NATIEIPNFNWPQFEYVKVPLADMPHAPIGLYFDTVADKIHSVSRKHGATLVHCAAGVSRSATLCIAYLMKFHNVCLLEAYNWVKARRPVIRPNVGFWRQLIDYERQLFGKSTVKMV--QTPYGIVPDV 184          
BLAST of Dual specificity protein phosphatase 14 vs. Ensembl Human
Match: DUSP14 (dual specificity phosphatase 14 [Source:HGNC Symbol;Acc:HGNC:17007])

HSP 1 Score: 140.584 bits (353), Expect = 2.906e-39
Identity = 72/169 (42.60%), Postives = 113/169 (66.86%), Query Frame = 2
Query:  380 VSQIARITDNLYLSGLHAITSER--LKSLGISLVVSLIAENSSMRLP----PSIERIQVNIEDTENVNIRRHFDKVLERMNTEERRQGRILVHCVAGISRSSTIILAYLMRYHNMRLREAYNLVHSQRPYIQPNLGFWRQLIDYEKSIFGGSSVNMVPMEGTRILVPDV 868
            +  IA+IT +L+L G  ++ S R  L++ GI+ +V     N+++ +P    P  E ++V + D  +  I  +FD V +++++  R+ G  LVHC AG+SRS+T+ +AYLM++HN+ L EAYN V ++RP I+PN+GFWRQLIDYE+ +FG S+V MV  +    +VPDV
Sbjct:   24 IGGIAQITSSLFL-GRGSVASNRHLLQARGITCIV-----NATIEIPNFNWPQFEYVKVPLADMPHAPIGLYFDTVADKIHSVSRKHGATLVHCAAGVSRSATLCIAYLMKFHNVCLLEAYNWVKARRPVIRPNVGFWRQLIDYERQLFGKSTVKMV--QTPYGIVPDV 184          
BLAST of Dual specificity protein phosphatase 14 vs. Ensembl Human
Match: DUSP14 (dual specificity phosphatase 14 [Source:HGNC Symbol;Acc:HGNC:17007])

HSP 1 Score: 140.584 bits (353), Expect = 2.906e-39
Identity = 72/169 (42.60%), Postives = 113/169 (66.86%), Query Frame = 2
Query:  380 VSQIARITDNLYLSGLHAITSER--LKSLGISLVVSLIAENSSMRLP----PSIERIQVNIEDTENVNIRRHFDKVLERMNTEERRQGRILVHCVAGISRSSTIILAYLMRYHNMRLREAYNLVHSQRPYIQPNLGFWRQLIDYEKSIFGGSSVNMVPMEGTRILVPDV 868
            +  IA+IT +L+L G  ++ S R  L++ GI+ +V     N+++ +P    P  E ++V + D  +  I  +FD V +++++  R+ G  LVHC AG+SRS+T+ +AYLM++HN+ L EAYN V ++RP I+PN+GFWRQLIDYE+ +FG S+V MV  +    +VPDV
Sbjct:   24 IGGIAQITSSLFL-GRGSVASNRHLLQARGITCIV-----NATIEIPNFNWPQFEYVKVPLADMPHAPIGLYFDTVADKIHSVSRKHGATLVHCAAGVSRSATLCIAYLMKFHNVCLLEAYNWVKARRPVIRPNVGFWRQLIDYERQLFGKSTVKMV--QTPYGIVPDV 184          
BLAST of Dual specificity protein phosphatase 14 vs. Ensembl Celegans
Match: C04F12.8 (pep chromosome:WBcel235:I:9697237:9699561:-1 gene:WBGene00007302.1 transcript:C04F12.8.1 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:C04F12.8)

HSP 1 Score: 136.346 bits (342), Expect = 2.982e-37
Identity = 60/164 (36.59%), Postives = 108/164 (65.85%), Query Frame = 2
Query:  377 MVSQIARITDNLYLSGLHAITSERLKSLGISLVVSLIAENSSMRLPPSIERIQVNIEDTENVNIRRHFDKVLERMNTEERRQGRILVHCVAGISRSSTIILAYLMRYHNMRLREAYNLVHSQRPYIQPNLGFWRQLIDYEKSIFGGSSVNMVPMEGTRILVPDV 868
            ++ Q++ I D+LYLSG   +  +++K   I+++V+   E  S  +   ++ +++ IED     +  HFD V +++   + R G+ LVHC+AG+SRS+++++ YL+++ +M LR+AY+ V + RP I+PN+GFW+Q++DYEK + G +SV MV      + +PDV
Sbjct:    7 VLGQMSEINDHLYLSGAGVLKPDKIKQRKINMIVNATTEEPSTYMQ-GVDTMKIRIEDHPYARLSEHFDVVADKIRNVKERGGKTLVHCMAGVSRSASLVMIYLVKHEHMTLRQAYHYVKAARPIIRPNVGFWKQMVDYEKRLRGTASVKMVQTPECDMPIPDV 169          
BLAST of Dual specificity protein phosphatase 14 vs. Ensembl Celegans
Match: F26A3.4 (pep chromosome:WBcel235:I:7656978:7658291:-1 gene:WBGene00009142.1 transcript:F26A3.4.1 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:F26A3.4)

HSP 1 Score: 112.464 bits (280), Expect = 8.474e-29
Identity = 60/171 (35.09%), Postives = 103/171 (60.23%), Query Frame = 2
Query:  362 YDYNHMVSQIARITDNLYLSGLHAITSERLKSLGISLVVSLIAENSSMRLPPSIERIQVNIEDTENVNIRRHFDKVLERMNTEERRQGRILVHCVAGISRSSTIILAYLMRYHNMRLREAYNLVHSQRPYIQPNLGFWRQLIDYEKSIF-GGSSVNMVPMEG-TRILVPDV 868
            +  N   + ++ I   L++ G+ A++ + +K   I+ +++   E  ++R    I+R ++ +EDT    I  H +   +++       G++LVHCVAG+SRS++I LA+L++Y    LREAY+L+ S+R  ++PNLGFWRQLI YE+++     SV +V  E     L+PDV
Sbjct:    5 FRVNPEYAAMSEIVPGLFICGVSALSKDEMKKHKITHIINATTEVPNLRSLGDIQRTKLWLEDTPQTYIYPHLELQSDQIQALIADGGKVLVHCVAGVSRSASICLAFLLKYRCRNLREAYHLMKSKRSMVRPNLGFWRQLIAYEQNVKENAGSVRLVRDEAQPEQLLPDV 175          
BLAST of Dual specificity protein phosphatase 14 vs. Ensembl Celegans
Match: F13D11.3 (pep chromosome:WBcel235:X:5804379:5805922:-1 gene:WBGene00017428.1 transcript:F13D11.3.1 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:F13D11.3)

HSP 1 Score: 101.293 bits (251), Expect = 2.803e-25
Identity = 52/156 (33.33%), Postives = 93/156 (59.62%), Query Frame = 2
Query:  371 NHMVSQIARITDNLYLSGLHAITSERLKSLGISLVVSLIAENSSMRLPP--SIERIQVNIEDTENVNIRRHFDKVLERMNTEERRQGRILVHCVAGISRSSTIILAYLMRYHNMRLREAYNLVHSQRPYIQPNLGFWRQLIDYEKSIFGGSSVNMV 832
            N  +  I ++  +L+L+G   IT   LK   I+  V    + ++++  P   ++RI+V ++D     I ++F+ V++ +   +++    +++C AG+SRS+T+ + YLM   N+ L EAY  V+  RP I PN+GFWRQ+ID+EK   G +SV ++
Sbjct:    5 NKALLSITQVRPHLFLAGYGCITPSLLKQYNITHGV----DCTNLKTKPIKGLDRIEVPVDDNTLAKITQYFEPVVKYIEDAKQQGHNTVIYCAAGVSRSATLTIVYLMVTENLSLEEAYLQVNQVRPIISPNIGFWRQMIDFEKQRNGNASVELI 156          
BLAST of Dual specificity protein phosphatase 14 vs. Ensembl Celegans
Match: ZK757.2 (pep chromosome:WBcel235:III:9874142:9877476:-1 gene:WBGene00014074.1 transcript:ZK757.2.1 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:ZK757.2)

HSP 1 Score: 93.5893 bits (231), Expect = 2.279e-21
Identity = 53/162 (32.72%), Postives = 90/162 (55.56%), Query Frame = 2
Query:  386 QIARITDNLYLSGLHAITSERLKSLGISLVVSLIAENSSMRLPPSIERIQVNIEDTENVNIRRHFDKVLERMNTEERRQGRILVHCVAGISRSSTIILAYLMRYHNMRLREAYNLVHSQRPYIQPNLGFWRQLIDYEKSIFGGSSVNMV-PMEGTRILVPDV 868
            Q ++I   LY+SGL A++   L    +   ++LI     +  PP ++ + + ++D E  ++  H+  V + +    +  GR L+ C  GISRS+T  +AY+M+Y    L ++Y  V   R  I PN+GF++QLID E+ + G  S  ++ P+ G +  VPDV
Sbjct:   13 QCSQIRPYLYVSGLAALSPRVLSRFCV--CINLIP-GFRLSAPPHMKVVHLPLQDNETTDLSPHWANVYKEIEEARKGAGRALLLCAMGISRSATFGIAYVMQYEKKTLHDSYKAVQLARNIICPNVGFFQQLIDLEQKLRGKVSCKIIEPLPGCK--VPDV 169          
BLAST of Dual specificity protein phosphatase 14 vs. Ensembl Celegans
Match: vhp-1 (Tyrosine-protein phosphatase vhp-1 [Source:UniProtKB/Swiss-Prot;Acc:Q10038])

HSP 1 Score: 85.1149 bits (209), Expect = 1.035e-17
Identity = 53/145 (36.55%), Postives = 77/145 (53.10%), Query Frame = 2
Query:  389 IARITDNLYL-SGLHAITSERLKSLGISLVVSLIAENSSMRLPPSI--------ERIQVNIEDTENVNIRRHFDKVLERMNTEERRQGRILVHCVAGISRSSTIILAYLMRYHNMRLREAYNLVHSQRPYIQPNLGFWRQLIDYE 796
            I  IT N+YL S + ++    L +L IS+V++L     SM  P S+         RI VN  D+    +  +F    E +    R   + L+HC+AGISRS T+ ++Y+MRY  M   +AY  V  +RP I PN  F  QL++YE
Sbjct:   21 ITLITPNIYLGSQIDSLDETMLDALDISVVINL-----SMTCPKSVCIKEDKNFMRIPVN--DSYQEKLSPYFPMAYEFLEKCRRAGKKCLIHCLAGISRSPTLAISYIMRYMKMGSDDAYRYVKERRPSISPNFNFMGQLLEYE 158          
BLAST of Dual specificity protein phosphatase 14 vs. Ensembl Fly
Match: CG15528 (gene:FBgn0039742 transcript:FBtr0303240)

HSP 1 Score: 115.161 bits (287), Expect = 9.472e-30
Identity = 60/162 (37.04%), Postives = 94/162 (58.02%), Query Frame = 2
Query:  389 IARITDNLYLSGLHAITSERLKSLGISLVVSLIAENSSMRLPPSIERIQVNI--EDTENVNIRRHFDKVLERMNTEERRQGRILVHCVAGISRSSTIILAYLMRYHNMRLREAYNLVHSQRPYIQPNLGFWRQLIDYEKSIFGGSSVNMVPMEGTRILVPDV 868
            ++RIT +L L G  A+    +  LG+S V+++  E     LP     + + I  +D   V++ +HFD+  + +       G  L+HCVAG+SRS+++ LAYLM++  M LREAY  V + RP ++PN GF++QL  YE+ + G SSV MV        +PD+
Sbjct:   44 LSRITPSLILCGAAAVVPAYMDKLGVSCVINVAPELPDTPLPSQKNPLYLRIMAQDRSEVDLAKHFDEAADLIEEVHLSGGCTLIHCVAGVSRSASLCLAYLMKHAGMSLREAYKHVQAIRPQVRPNSGFFQQLRRYEQQLRGSSSVAMVYFASLDKEIPDI 205          
BLAST of Dual specificity protein phosphatase 14 vs. Ensembl Fly
Match: puc (gene:FBgn0243512 transcript:FBtr0339722)

HSP 1 Score: 89.3521 bits (220), Expect = 1.962e-19
Identity = 42/117 (35.90%), Postives = 74/117 (63.25%), Query Frame = 2
Query:  455 SLGISLVVSLIAENSSMRLPPSIERIQVNIEDTENVNIRRHFDKVLERMNTEERRQGRILVHCVAGISRSSTIILAYLMRYHNMRLREAYNLVHSQRPYIQPNLGFWRQLIDYEKSI 805
            S+G + V+++  ++ +      ++ +Q+   DT + NI+++F +  + +    +   R+L+HC AGISRS+TI +AY+MRY ++ L EAY LV   RP I PNL F  QL++ E+++
Sbjct:   47 SVGANCVLNVTCQSPNESHLQGLKYMQIPASDTPHQNIKQYFQEAYDFIEDARKTGSRVLLHCHAGISRSATIAIAYVMRYKSLSLLEAYKLVKVARPIISPNLNFMGQLLELEQNL 163          
BLAST of Dual specificity protein phosphatase 14 vs. Ensembl Fly
Match: puc (gene:FBgn0243512 transcript:FBtr0081792)

HSP 1 Score: 88.9669 bits (219), Expect = 6.574e-19
Identity = 42/117 (35.90%), Postives = 74/117 (63.25%), Query Frame = 2
Query:  455 SLGISLVVSLIAENSSMRLPPSIERIQVNIEDTENVNIRRHFDKVLERMNTEERRQGRILVHCVAGISRSSTIILAYLMRYHNMRLREAYNLVHSQRPYIQPNLGFWRQLIDYEKSI 805
            S+G + V+++  ++ +      ++ +Q+   DT + NI+++F +  + +    +   R+L+HC AGISRS+TI +AY+MRY ++ L EAY LV   RP I PNL F  QL++ E+++
Sbjct:  154 SVGANCVLNVTCQSPNESHLQGLKYMQIPASDTPHQNIKQYFQEAYDFIEDARKTGSRVLLHCHAGISRSATIAIAYVMRYKSLSLLEAYKLVKVARPIISPNLNFMGQLLELEQNL 270          
BLAST of Dual specificity protein phosphatase 14 vs. Ensembl Fly
Match: Mkp (gene:FBgn0083992 transcript:FBtr0110976)

HSP 1 Score: 82.0333 bits (201), Expect = 7.132e-18
Identity = 43/130 (33.08%), Postives = 72/130 (55.38%), Query Frame = 2
Query:  398 ITDNLYLSGLHAITSERLKSLGISLVVSLIAENSSMRLPPSIERIQVNIEDTENVNIRRH-FDKVLERMNTEERRQGRILVHCVAGISRSSTIILAYLMRYHNMRLREAYNLVHSQRPYIQPNLGFWRQL 784
            ++D LYL    A++++ +    I+ ++S+  +   +  P  +    +   D    N+  +     +E +    R QG +LVHC AG+SRS ++++ YLM+  +M   +AYNLV S RP IQPN GF +QL
Sbjct:   70 LSDFLYLGSQDAVSADNIIKYKITHILSVGIQTPEVEWPLPVNCTFLPCLDLPETNLMNYILPASMEFIEDAHRSQGCVLVHCNAGVSRSPSVVIGYLMQRRDMCYEDAYNLVKSWRPCIQPNAGFIQQL 199          
BLAST of Dual specificity protein phosphatase 14 vs. Ensembl Fly
Match: Mkp (gene:FBgn0083992 transcript:FBtr0344094)

HSP 1 Score: 82.0333 bits (201), Expect = 7.132e-18
Identity = 43/130 (33.08%), Postives = 72/130 (55.38%), Query Frame = 2
Query:  398 ITDNLYLSGLHAITSERLKSLGISLVVSLIAENSSMRLPPSIERIQVNIEDTENVNIRRH-FDKVLERMNTEERRQGRILVHCVAGISRSSTIILAYLMRYHNMRLREAYNLVHSQRPYIQPNLGFWRQL 784
            ++D LYL    A++++ +    I+ ++S+  +   +  P  +    +   D    N+  +     +E +    R QG +LVHC AG+SRS ++++ YLM+  +M   +AYNLV S RP IQPN GF +QL
Sbjct:   70 LSDFLYLGSQDAVSADNIIKYKITHILSVGIQTPEVEWPLPVNCTFLPCLDLPETNLMNYILPASMEFIEDAHRSQGCVLVHCNAGVSRSPSVVIGYLMQRRDMCYEDAYNLVKSWRPCIQPNAGFIQQL 199          
BLAST of Dual specificity protein phosphatase 14 vs. Ensembl Zebrafish
Match: dusp14 (dual specificity phosphatase 14 [Source:ZFIN;Acc:ZDB-GENE-041010-162])

HSP 1 Score: 129.798 bits (325), Expect = 3.673e-35
Identity = 70/170 (41.18%), Postives = 112/170 (65.88%), Query Frame = 2
Query:  377 MVSQIARITDNLYLSGLHAITSER--LKSLGISLVVSLIAENSSMRLP----PSIERIQVNIEDTENVNIRRHFDKVLERMNTEERRQGRILVHCVAGISRSSTIILAYLMRYHNMRLREAYNLVHSQRPYIQPNLGFWRQLIDYEKSIFGGSSVNMVPMEGTRILVPDV 868
            ++  IA+IT +L+L G   + S R  L S GI+ VV     N+++ LP    P +E ++V + D  +  I  +FD V +++++  R++G +LVHC AG+SRS+++ LAYLM+YH + L EA+  V ++RP I+PN GFWRQLI+YE+ +FG +SV M+  +    ++PDV
Sbjct:   46 LLGGIAQITPSLFL-GRGNVASNRSLLLSKGITCVV-----NATIELPNFNWPHMEYVKVPLADMPHSPISLYFDSVADKIHSVGRKRGAVLVHCAAGVSRSASLCLAYLMKYHRVSLAEAHAWVKARRPVIRPNGGFWRQLIEYERKLFGRNSVKMI--QTPYGVIPDV 207          
BLAST of Dual specificity protein phosphatase 14 vs. Ensembl Zebrafish
Match: dusp14 (dual specificity phosphatase 14 [Source:ZFIN;Acc:ZDB-GENE-041010-162])

HSP 1 Score: 129.798 bits (325), Expect = 3.673e-35
Identity = 70/170 (41.18%), Postives = 112/170 (65.88%), Query Frame = 2
Query:  377 MVSQIARITDNLYLSGLHAITSER--LKSLGISLVVSLIAENSSMRLP----PSIERIQVNIEDTENVNIRRHFDKVLERMNTEERRQGRILVHCVAGISRSSTIILAYLMRYHNMRLREAYNLVHSQRPYIQPNLGFWRQLIDYEKSIFGGSSVNMVPMEGTRILVPDV 868
            ++  IA+IT +L+L G   + S R  L S GI+ VV     N+++ LP    P +E ++V + D  +  I  +FD V +++++  R++G +LVHC AG+SRS+++ LAYLM+YH + L EA+  V ++RP I+PN GFWRQLI+YE+ +FG +SV M+  +    ++PDV
Sbjct:   46 LLGGIAQITPSLFL-GRGNVASNRSLLLSKGITCVV-----NATIELPNFNWPHMEYVKVPLADMPHSPISLYFDSVADKIHSVGRKRGAVLVHCAAGVSRSASLCLAYLMKYHRVSLAEAHAWVKARRPVIRPNGGFWRQLIEYERKLFGRNSVKMI--QTPYGVIPDV 207          
BLAST of Dual specificity protein phosphatase 14 vs. Ensembl Zebrafish
Match: si:ch1073-184j22.2 (si:ch1073-184j22.2 [Source:ZFIN;Acc:ZDB-GENE-081104-32])

HSP 1 Score: 118.242 bits (295), Expect = 3.694e-31
Identity = 60/149 (40.27%), Postives = 95/149 (63.76%), Query Frame = 2
Query:  389 IARITDNLYLSGLHAITSERLKSL-GISLVVSLIAENSSMRLPPSIERIQVNIEDTENVNIRRHFDKVLERMNTEERRQGRILVHCVAGISRSSTIILAYLMRYHNMRLREAYNLVHSQRPYIQPNLGFWRQLIDYEKSIFGGSSVNMV 832
            I++IT  L+LSG  A  ++ L +  GI+L+V++   ++   + P +E I+V + D  N  +  HFD V  R++    R G  LVHC AG+SRS  +I+AYLM+Y  + LR+A+  V   RPYI+ N+GFW QL+DYE+ ++G ++V + 
Sbjct:    3 ISQITPTLFLSGADASMNQALMTRKGITLIVNVTLSHTC-PVYPGVECIRVAVSDLPNARLGDHFDHVSARIHNN--RPGGTLVHCAAGMSRSPAVIMAYLMKYKGVTLRQAHKWVKDSRPYIRLNVGFWTQLLDYERKLYGRNTVRVA 148          
BLAST of Dual specificity protein phosphatase 14 vs. Ensembl Zebrafish
Match: si:ch1073-184j22.2 (si:ch1073-184j22.2 [Source:ZFIN;Acc:ZDB-GENE-081104-32])

HSP 1 Score: 116.316 bits (290), Expect = 2.371e-30
Identity = 69/182 (37.91%), Postives = 105/182 (57.69%), Query Frame = 2
Query:  395 RITDNLYLSGLHAITSERLKSL-GISLVVSLIAENSSMRLPPSIERIQVNIEDTENVNIRRHFDKVLERMNTEERRQGRILVHCVAGISRSSTIILAYLMRYHNMRLREAYNLVHSQRPYIQPNLGFWRQLIDYEKSIFGGSSVNMVPMEGTRILVP-DVTPSILSEILSSTPMMRVQQRSP 934
            +IT  L+LSG  A  ++ L +  GI+L+V++   ++   + P +E I+V + D  N  +  HFD V  R++    R G  LVHC AG+SRS  +I+AYLM+Y  + LR+A+  V   RPYI+ N+GFW QL+DYE+ ++G ++V        R+  P D  P+  +  L S   MR    SP
Sbjct:   11 QITPTLFLSGADASMNQALMTRKGITLIVNVTLSHTCP-VYPGVECIRVAVSDLPNARLGDHFDHVSARIHNN--RPGGTLVHCAAGMSRSPAVIMAYLMKYKGVTLRQAHKWVKDSRPYIRLNVGFWTQLLDYERKLYGRNTV--------RVAEPVDAQPTPQTPKLPSRYKMRQCPPSP 181          
BLAST of Dual specificity protein phosphatase 14 vs. Ensembl Zebrafish
Match: zgc:153044 (zgc:153044 [Source:ZFIN;Acc:ZDB-GENE-060825-247])

HSP 1 Score: 107.071 bits (266), Expect = 4.711e-27
Identity = 52/150 (34.67%), Postives = 96/150 (64.00%), Query Frame = 2
Query:  389 IARITDNLYLSGLHAITSER-LKSLGISLVV-SLIAENSSMRLPPSIERIQVNIEDTENVNIRRHFDKVLERMNTEERRQGRILVHCVAGISRSSTIILAYLMRYHNMRLREAYNLVHSQRPYIQPNLGFWRQLIDYEKSIFGGSSVNMV 832
             A++TD+L++      +  R L+SL I+ ++ S    +SS    PS   +Q+ + D  +  +  +F  V +++      +GR+L+HC AG+SRS+++ LA+L+++H + LREA+ ++ ++RP I+PN GFW QL+++E SI G ++V M+
Sbjct:   12 FAQVTDHLFIGTSKTASDSRILQSLHITCIINSTQNTHSSDTHLPSAHYMQIPVPDDPSCRLSEYFHSVSDKIQQVSEERGRVLLHCNAGVSRSASLCLAFLIKHHRLTLREAHQMLKAKRPIIRPNNGFWSQLVEFELSIHGRNTVRMI 161          
BLAST of Dual specificity protein phosphatase 14 vs. Ensembl Xenopus
Match: dusp14 (dual specificity phosphatase 14 [Source:NCBI gene;Acc:779639])

HSP 1 Score: 131.724 bits (330), Expect = 7.966e-36
Identity = 67/165 (40.61%), Postives = 107/165 (64.85%), Query Frame = 2
Query:  389 IARITDNLYLSGLHAITSERL-KSLGISLVVSLIAENSSMRLP----PSIERIQVNIEDTENVNIRRHFDKVLERMNTEERRQGRILVHCVAGISRSSTIILAYLMRYHNMRLREAYNLVHSQRPYIQPNLGFWRQLIDYEKSIFGGSSVNMVPMEGTRILVPDV 868
            IA+I+  LYLS  +A  S  L  S  ++ +V     N+++ +P    P ++ I+V + D  +  +  +FD V +R++   +R GR LVHCVAG+SRS+T+ +AYLM+YH + L +AY  V ++RP ++PN+GFW+QLI YEK +FG ++V +VP      L+PD+
Sbjct:   40 IAQISPCLYLSSGNAAGSRHLVYSRNVTCIV-----NATLEIPNSNWPDVDYIKVPVPDLPHAPLALYFDTVADRIHQNGKRNGRTLVHCVAGVSRSATLCIAYLMKYHRLALLDAYQWVKTRRPVVRPNMGFWQQLIQYEKKLFGKNTVRLVPSPLG--LIPDI 197          
BLAST of Dual specificity protein phosphatase 14 vs. Ensembl Xenopus
Match: ENSXETT00000005765.1 (pep primary_assembly:Xenopus_tropicalis_v9.1:1:157865320:157866044:-1 gene:ENSXETG00000003110.1 transcript:ENSXETT00000005765.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 110.538 bits (275), Expect = 4.458e-28
Identity = 55/156 (35.26%), Postives = 97/156 (62.18%), Query Frame = 2
Query:  377 MVSQIARITDNLYLSGLHAITSERL-KSLGISLVVSL---IAENSSMRLPPSIERIQVNIEDTENVNIRRHFDKVLERMNTEERRQGRILVHCVAGISRSSTIILAYLMRYHNMRLREAYNLVHSQRPYIQPNLGFWRQLIDYEKSIFGGSSVNMV 832
             +S +  I++ LYL+   A  +  L  +  I+ V+++   I +N S    P +E + + + DT +  + ++FD + ++++  +   G  L+HCVAGISRS T+ LAYLM+YH++ L  A+  V   RP I+PNLGFW+QL+ YE ++FG +++ ++
Sbjct:   21 FLSGLNSISEGLYLASAKAARNRTLLATHCITCVINVSLEIDKNES----PELEYVHIPVPDTPDTCLLQYFDDIADKIHNIKVSGGSTLLHCVAGISRSPTLCLAYLMKYHSLSLLAAHARVKMCRPIIRPNLGFWKQLMSYEMTLFGKNTITII 172          
BLAST of Dual specificity protein phosphatase 14 vs. Ensembl Xenopus
Match: dusp28 (dual specificity phosphatase 28 [Source:NCBI gene;Acc:100135072])

HSP 1 Score: 92.8189 bits (229), Expect = 3.824e-22
Identity = 53/144 (36.81%), Postives = 85/144 (59.03%), Query Frame = 2
Query:  386 QIARITDNLYLSGLHAITSERL-KSLGISLVVSLIAENSSMRLP-PSIERIQVNIEDTEN--VNIRRHFDKVLERMNTEERRQGRILVHCVAGISRSSTIILAYLMRYHNMRLREAYNLVHSQRPYIQPNLGFWRQLIDYEKSI 805
            ++ ++T++L++S + A   + L    G++  +     N SM+ P P I    + I   +N   N+  HFD+  + +     R G+ LV+C  G SRS+TI +AYLM+Y NM L+EA+ +V + RP I+PN GFW QL  YE+S+
Sbjct:    5 RLFKVTNSLFISNVKAACKKNLLMDEGVTCCI-----NVSMQQPFPDINLCTLRIPVFDNPLQNLSDHFDQSGDLIEHTISRGGKCLVYCRHGRSRSATICIAYLMKYKNMSLQEAFQVVKAGRPGIEPNEGFWSQLKQYEESL 143          
BLAST of Dual specificity protein phosphatase 14 vs. Ensembl Xenopus
Match: tor2a (torsin family 2, member A [Source:Xenbase;Acc:XB-GENE-5806617])

HSP 1 Score: 95.1301 bits (235), Expect = 4.516e-21
Identity = 52/134 (38.81%), Postives = 76/134 (56.72%), Query Frame = 2
Query:  410 LYL-SGLHAITSERLKSLGISLVVSLIAENSSMRLPPSIERIQVNIEDTENVNIRRHFDKVLERMNTEERRQGRILVHCVAGISRSSTIILAYLMRYHNMRLREAYNLVHSQRPYIQPNLGFWRQLIDYEKSIF 808
            LYL S  HA   E L +L I+ ++++  ++SS           + +ED    +I  HF + ++ ++T +R  GR+LVHC AGISRS TI +AYLM+    RL EA+  +  +R  I PN  F  QL+ YE  IF
Sbjct:  178 LYLGSAYHASRCEFLANLHITALLNVSRKSSSDLCKEQYSYKWIPVEDNHTADISSHFQEAIDFIDTIKRAGGRVLVHCEAGISRSPTICMAYLMKTRRFRLEEAFEYIKQRRSLISPNFSFMGQLLHYESEIF 311          
BLAST of Dual specificity protein phosphatase 14 vs. Ensembl Xenopus
Match: ibtk (inhibitor of Bruton tyrosine kinase [Source:Xenbase;Acc:XB-GENE-5755983])

HSP 1 Score: 91.6633 bits (226), Expect = 6.689e-20
Identity = 47/138 (34.06%), Postives = 78/138 (56.52%), Query Frame = 2
Query:  410 LYL-SGLHAITSERLKSLGISLVVSLIAENSSMRLPPSIERIQVNIEDTENVNIRRHFDKVLERMNTEERRQGRILVHCVAGISRSSTIILAYLMRYHNMRLREAYNLVHSQRPYIQPNLGFWRQLIDYEKSIFGGSS 820
            LYL S  HA   + L +LGI+ +++ ++ N         +   + +ED+   +I   F++ ++ +++ +   GR+ VHC AGISRS+TI LAYLMR + ++L EA+  V  +R  I PN  F  QL+ +E  +   S 
Sbjct:  183 LYLGSAYHASRKDMLDALGITALIN-VSANCPNHFEGHFQYKSIPVEDSHKADISSWFNEAIDFIDSVKNSGGRVFVHCQAGISRSATICLAYLMRTNRVKLDEAFEFVKQRRSIISPNFSFMGQLLQFESQVLAPSC 319          
BLAST of Dual specificity protein phosphatase 14 vs. Ensembl Mouse
Match: Dusp14 (dual specificity phosphatase 14 [Source:MGI Symbol;Acc:MGI:1927168])

HSP 1 Score: 141.354 bits (355), Expect = 9.643e-40
Identity = 72/169 (42.60%), Postives = 112/169 (66.27%), Query Frame = 2
Query:  380 VSQIARITDNLYLSGLHAITSER--LKSLGISLVVSLIAENSSMRLP----PSIERIQVNIEDTENVNIRRHFDKVLERMNTEERRQGRILVHCVAGISRSSTIILAYLMRYHNMRLREAYNLVHSQRPYIQPNLGFWRQLIDYEKSIFGGSSVNMVPMEGTRILVPDV 868
            +  IA+IT +L+L G  ++ S    L++ GI+ V+     N+++ +P    P  E ++V + D  +  IR +FD V +++++  ++ G  LVHC AG+SRS+T+ +AYLM++HN+ L EAYN V ++RP I+PNLGFWRQLIDYE  +FG SSV MV  +    ++PDV
Sbjct:   24 IGGIAQITSSLFL-GRASVASNWHLLQARGITCVI-----NATIEIPNFNWPQFEYVKVPLADIPHAPIRLYFDTVADKIHSVSKKHGATLVHCAAGVSRSATLCIAYLMKFHNLCLLEAYNWVKARRPVIRPNLGFWRQLIDYESQLFGKSSVKMV--QTPYGIIPDV 184          
BLAST of Dual specificity protein phosphatase 14 vs. Ensembl Mouse
Match: Dusp14 (dual specificity phosphatase 14 [Source:MGI Symbol;Acc:MGI:1927168])

HSP 1 Score: 141.354 bits (355), Expect = 9.643e-40
Identity = 72/169 (42.60%), Postives = 112/169 (66.27%), Query Frame = 2
Query:  380 VSQIARITDNLYLSGLHAITSER--LKSLGISLVVSLIAENSSMRLP----PSIERIQVNIEDTENVNIRRHFDKVLERMNTEERRQGRILVHCVAGISRSSTIILAYLMRYHNMRLREAYNLVHSQRPYIQPNLGFWRQLIDYEKSIFGGSSVNMVPMEGTRILVPDV 868
            +  IA+IT +L+L G  ++ S    L++ GI+ V+     N+++ +P    P  E ++V + D  +  IR +FD V +++++  ++ G  LVHC AG+SRS+T+ +AYLM++HN+ L EAYN V ++RP I+PNLGFWRQLIDYE  +FG SSV MV  +    ++PDV
Sbjct:   24 IGGIAQITSSLFL-GRASVASNWHLLQARGITCVI-----NATIEIPNFNWPQFEYVKVPLADIPHAPIRLYFDTVADKIHSVSKKHGATLVHCAAGVSRSATLCIAYLMKFHNLCLLEAYNWVKARRPVIRPNLGFWRQLIDYESQLFGKSSVKMV--QTPYGIIPDV 184          
BLAST of Dual specificity protein phosphatase 14 vs. Ensembl Mouse
Match: Dusp14 (dual specificity phosphatase 14 [Source:MGI Symbol;Acc:MGI:1927168])

HSP 1 Score: 141.354 bits (355), Expect = 9.643e-40
Identity = 72/169 (42.60%), Postives = 112/169 (66.27%), Query Frame = 2
Query:  380 VSQIARITDNLYLSGLHAITSER--LKSLGISLVVSLIAENSSMRLP----PSIERIQVNIEDTENVNIRRHFDKVLERMNTEERRQGRILVHCVAGISRSSTIILAYLMRYHNMRLREAYNLVHSQRPYIQPNLGFWRQLIDYEKSIFGGSSVNMVPMEGTRILVPDV 868
            +  IA+IT +L+L G  ++ S    L++ GI+ V+     N+++ +P    P  E ++V + D  +  IR +FD V +++++  ++ G  LVHC AG+SRS+T+ +AYLM++HN+ L EAYN V ++RP I+PNLGFWRQLIDYE  +FG SSV MV  +    ++PDV
Sbjct:   24 IGGIAQITSSLFL-GRASVASNWHLLQARGITCVI-----NATIEIPNFNWPQFEYVKVPLADIPHAPIRLYFDTVADKIHSVSKKHGATLVHCAAGVSRSATLCIAYLMKFHNLCLLEAYNWVKARRPVIRPNLGFWRQLIDYESQLFGKSSVKMV--QTPYGIIPDV 184          
BLAST of Dual specificity protein phosphatase 14 vs. Ensembl Mouse
Match: Dusp14 (dual specificity phosphatase 14 [Source:MGI Symbol;Acc:MGI:1927168])

HSP 1 Score: 141.354 bits (355), Expect = 9.643e-40
Identity = 72/169 (42.60%), Postives = 112/169 (66.27%), Query Frame = 2
Query:  380 VSQIARITDNLYLSGLHAITSER--LKSLGISLVVSLIAENSSMRLP----PSIERIQVNIEDTENVNIRRHFDKVLERMNTEERRQGRILVHCVAGISRSSTIILAYLMRYHNMRLREAYNLVHSQRPYIQPNLGFWRQLIDYEKSIFGGSSVNMVPMEGTRILVPDV 868
            +  IA+IT +L+L G  ++ S    L++ GI+ V+     N+++ +P    P  E ++V + D  +  IR +FD V +++++  ++ G  LVHC AG+SRS+T+ +AYLM++HN+ L EAYN V ++RP I+PNLGFWRQLIDYE  +FG SSV MV  +    ++PDV
Sbjct:   24 IGGIAQITSSLFL-GRASVASNWHLLQARGITCVI-----NATIEIPNFNWPQFEYVKVPLADIPHAPIRLYFDTVADKIHSVSKKHGATLVHCAAGVSRSATLCIAYLMKFHNLCLLEAYNWVKARRPVIRPNLGFWRQLIDYESQLFGKSSVKMV--QTPYGIIPDV 184          
BLAST of Dual specificity protein phosphatase 14 vs. Ensembl Mouse
Match: Dusp18 (dual specificity phosphatase 18 [Source:MGI Symbol;Acc:MGI:1922469])

HSP 1 Score: 111.694 bits (278), Expect = 1.059e-28
Identity = 62/169 (36.69%), Postives = 102/169 (60.36%), Query Frame = 2
Query:  389 IARITDNLYLS-GLHAITSERLKSLGISLVVSLIAENSSMRLPPSIERIQVNIEDTENVNIRRHFDKVLERMNTEERRQGRILVHCVAGISRSSTIILAYLMRYHNMRLREAYNLVHSQRPYIQPNLGFWRQLIDYEKSIFGGSSVNMV--PM--------EGTRILVP 862
            +++IT +L++S G+ A     L S  I+ V+++  E ++      I+ +QV + D     +   FD V +R+++ E ++GR L+HC AG+SRS+ + LAYLM+YH M L +A+    S RP I+PN GFW QLI YE  +FG +++ M+  PM        + TR+++P
Sbjct:   20 LSQITKSLFISNGVAANNKLLLSSNQITTVINVSVEVAN-TFYEDIQYVQVPVVDAPVARLSNFFDSVADRIHSVEMQKGRTLLHCAAGVSRSAALCLAYLMKYHAMSLVDAHTWTKSCRPIIRPNSGFWEQLIHYELQLFGKNTMQMMDSPMGRIPDIYEKETRLMIP 187          
BLAST of Dual specificity protein phosphatase 14 vs. UniProt/SwissProt
Match: sp|Q9JLY7|DUS14_MOUSE (Dual specificity protein phosphatase 14 OS=Mus musculus OX=10090 GN=Dusp14 PE=2 SV=2)

HSP 1 Score: 141.354 bits (355), Expect = 6.745e-39
Identity = 72/169 (42.60%), Postives = 112/169 (66.27%), Query Frame = 2
Query:  380 VSQIARITDNLYLSGLHAITSER--LKSLGISLVVSLIAENSSMRLP----PSIERIQVNIEDTENVNIRRHFDKVLERMNTEERRQGRILVHCVAGISRSSTIILAYLMRYHNMRLREAYNLVHSQRPYIQPNLGFWRQLIDYEKSIFGGSSVNMVPMEGTRILVPDV 868
            +  IA+IT +L+L G  ++ S    L++ GI+ V+     N+++ +P    P  E ++V + D  +  IR +FD V +++++  ++ G  LVHC AG+SRS+T+ +AYLM++HN+ L EAYN V ++RP I+PNLGFWRQLIDYE  +FG SSV MV  +    ++PDV
Sbjct:   24 IGGIAQITSSLFL-GRASVASNWHLLQARGITCVI-----NATIEIPNFNWPQFEYVKVPLADIPHAPIRLYFDTVADKIHSVSKKHGATLVHCAAGVSRSATLCIAYLMKFHNLCLLEAYNWVKARRPVIRPNLGFWRQLIDYESQLFGKSSVKMV--QTPYGIIPDV 184          
BLAST of Dual specificity protein phosphatase 14 vs. UniProt/SwissProt
Match: sp|O95147|DUS14_HUMAN (Dual specificity protein phosphatase 14 OS=Homo sapiens OX=9606 GN=DUSP14 PE=1 SV=1)

HSP 1 Score: 140.584 bits (353), Expect = 1.396e-38
Identity = 72/169 (42.60%), Postives = 113/169 (66.86%), Query Frame = 2
Query:  380 VSQIARITDNLYLSGLHAITSER--LKSLGISLVVSLIAENSSMRLP----PSIERIQVNIEDTENVNIRRHFDKVLERMNTEERRQGRILVHCVAGISRSSTIILAYLMRYHNMRLREAYNLVHSQRPYIQPNLGFWRQLIDYEKSIFGGSSVNMVPMEGTRILVPDV 868
            +  IA+IT +L+L G  ++ S R  L++ GI+ +V     N+++ +P    P  E ++V + D  +  I  +FD V +++++  R+ G  LVHC AG+SRS+T+ +AYLM++HN+ L EAYN V ++RP I+PN+GFWRQLIDYE+ +FG S+V MV  +    +VPDV
Sbjct:   24 IGGIAQITSSLFL-GRGSVASNRHLLQARGITCIV-----NATIEIPNFNWPQFEYVKVPLADMPHAPIGLYFDTVADKIHSVSRKHGATLVHCAAGVSRSATLCIAYLMKFHNVCLLEAYNWVKARRPVIRPNVGFWRQLIDYERQLFGKSTVKMV--QTPYGIVPDV 184          
BLAST of Dual specificity protein phosphatase 14 vs. UniProt/SwissProt
Match: sp|Q17QM8|DUS14_BOVIN (Dual specificity protein phosphatase 14 OS=Bos taurus OX=9913 GN=DUSP14 PE=2 SV=1)

HSP 1 Score: 139.813 bits (351), Expect = 2.389e-38
Identity = 72/169 (42.60%), Postives = 113/169 (66.86%), Query Frame = 2
Query:  380 VSQIARITDNLYLSGLHAITSER--LKSLGISLVVSLIAENSSMRLP----PSIERIQVNIEDTENVNIRRHFDKVLERMNTEERRQGRILVHCVAGISRSSTIILAYLMRYHNMRLREAYNLVHSQRPYIQPNLGFWRQLIDYEKSIFGGSSVNMVPMEGTRILVPDV 868
            +  IA+IT +L+L G  ++ S R  L++ GI+ +V     N+++ +P    P  E ++V + D  +  I  +FD V +++++  R+ G  LVHC AG+SRS+T+ +AYLM++HN+ L EAYN V ++RP I+PN+GFWRQLIDYE+ +FG S+V MV  +    +VPDV
Sbjct:   24 LGGIAQITSSLFL-GRGSVASNRHLLQARGITCIV-----NATIEIPNFNWPQFEYVKVPLADMPHAPIGLYFDTVADKIHSVSRKHGATLVHCAAGVSRSATLCIAYLMKFHNVCLLEAYNWVKARRPVIRPNVGFWRQLIDYERQLFGKSTVKMV--QTPYGIVPDV 184          
BLAST of Dual specificity protein phosphatase 14 vs. UniProt/SwissProt
Match: sp|Q5R8X2|DUS18_PONAB (Dual specificity protein phosphatase 18 OS=Pongo abelii OX=9601 GN=DUSP18 PE=2 SV=1)

HSP 1 Score: 120.939 bits (302), Expect = 2.725e-31
Identity = 67/166 (40.36%), Postives = 104/166 (62.65%), Query Frame = 2
Query:  380 VSQIARITDNLYLS-GLHAITSERLKSLGISLVVSLIAENSSMRLPPSIERIQVNIEDTENVNIRRHFDKVLERMNTEERRQGRILVHCVAGISRSSTIILAYLMRYHNMRLREAYNLVHSQRPYIQPNLGFWRQLIDYEKSIFGGSSVNMV--PMEGTRILVPDV 868
            VS +++IT +LY+S G+ A     L S  I++V+++  E  +  L   I+ +QV + D  +  +   FD V + +++ E +QGR L+HC AG+SRS+ + LAYLM+YH M L +A+    S RP I+PN GFW QLI YE  +FG ++V+MV  PM     ++PD+
Sbjct:   17 VSGLSQITKSLYISNGVAANNKLMLSSNQITMVINVSVEVVN-TLYEDIQYLQVPVADAPDSRLCDFFDPVADHIHSVEMKQGRTLLHCAAGVSRSAALCLAYLMKYHAMSLLDAHTWTKSCRPIIRPNSGFWEQLIHYEFQLFGKNTVHMVSSPMG----MIPDI 177          
BLAST of Dual specificity protein phosphatase 14 vs. UniProt/SwissProt
Match: sp|Q8NEJ0|DUS18_HUMAN (Dual specificity protein phosphatase 18 OS=Homo sapiens OX=9606 GN=DUSP18 PE=1 SV=1)

HSP 1 Score: 120.553 bits (301), Expect = 3.645e-31
Identity = 65/164 (39.63%), Postives = 103/164 (62.80%), Query Frame = 2
Query:  380 VSQIARITDNLYLS-GLHAITSERLKSLGISLVVSLIAENSSMRLPPSIERIQVNIEDTENVNIRRHFDKVLERMNTEERRQGRILVHCVAGISRSSTIILAYLMRYHNMRLREAYNLVHSQRPYIQPNLGFWRQLIDYEKSIFGGSSVNMVPMEGTRILVPDV 868
            VS +++IT +LY+S G+ A     L S  I++V+++  E  +  L   I+ +QV + D+ N  +   FD + + +++ E +QGR L+HC AG+SRS+ + LAYLM+YH M L +A+    S RP I+PN GFW QLI YE  +FG ++V+MV       ++PD+
Sbjct:   17 VSGLSQITKSLYISNGVAANNKLMLSSNQITMVINVSVEVVN-TLYEDIQYMQVPVADSPNSRLCDFFDPIADHIHSVEMKQGRTLLHCAAGVSRSAALCLAYLMKYHAMSLLDAHTWTKSCRPIIRPNSGFWEQLIHYEFQLFGKNTVHMV--SSPVGMIPDI 177          
BLAST of Dual specificity protein phosphatase 14 vs. TrEMBL
Match: A0A5J4NAZ9 (Uncharacterized protein OS=Paragonimus westermani OX=34504 GN=DEA37_0012314 PE=4 SV=1)

HSP 1 Score: 176.792 bits (447), Expect = 9.022e-47
Identity = 88/173 (50.87%), Postives = 118/173 (68.21%), Query Frame = 2
Query:  344 FDAFKQYDYNHMVSQIARITDNLYLSGLHAITSERLKSLGISLVVSLIAENSSMRLPPSIER------IQVNIEDTENVNIRRHFDKVLERMNTEERRQGRILVHCVAGISRSSTIILAYLMRYHNMRLREAYNLVHSQRPYIQPNLGFWRQLIDYEKSIFGGSSVNMVPMEG 844
            +    Q+D+  M SQIARI ++LYLS L+A+T +RL+  GI+L++S +     M  PP+  R      + V +ED E+ NIR HFD+V +R+  E RR GR LVHC+AG+SRSST+ILAYLMR+ NM L EAY LV S RP IQPN  FWRQL+++E+ I G  SV ++P  G
Sbjct:  264 YQLVSQFDFGQMFSQIARINNHLYLSSLNALTPDRLRQHGITLLISAM-----MDAPPAQLRNAVSSSMHVAVEDMESANIRVHFDRVSDRIAAEHRRGGRTLVHCMAGVSRSSTLILAYLMRHMNMSLAEAYQLVRSVRPCIQPNPSFWRQLLEFEERIRGVRSVRLLPPVG 431          
BLAST of Dual specificity protein phosphatase 14 vs. TrEMBL
Match: A0A3P7NZ77 (Uncharacterized protein OS=Dibothriocephalus latus OX=60516 GN=DILT_LOCUS9730 PE=4 SV=1)

HSP 1 Score: 169.474 bits (428), Expect = 2.887e-46
Identity = 81/165 (49.09%), Postives = 118/165 (71.52%), Query Frame = 2
Query:  377 MVSQIARITDNLYLSGLHAITSERLKSLGISLVVSLIAENSSMRLPPSI-ERIQVNIEDTENVNIRRHFDKVLERMNTEERRQGRILVHCVAGISRSSTIILAYLMRYHNMRLREAYNLVHSQRPYIQPNLGFWRQLIDYEKSIFGGSSVNMVPMEGTRILVPDV 868
            M SQIARITD+LYLSGL A++ ERL+  GI+ V++ + +     L  S+   IQ+++ED E  N+R +FD V ER+  E++R G+ LVHC+AGISRS++++LAYL+R+ NM L +AY+LV   RP+IQPN GFWRQLI YE+ + G  S+ ++    +++ VP V
Sbjct:   49 MFSQIARITDHLYLSGLQALSPERLRQYGITQVITAMIDPPPSSLLSSVNSHIQISVEDAETSNLRIYFDSVGERIAAEKKRGGKTLVHCMAGISRSASLVLAYLIRHQNMSLADAYDLVRGVRPFIQPNAGFWRQLISYEEMVRGTRSMRILSDATSQLTVPAV 213          
BLAST of Dual specificity protein phosphatase 14 vs. TrEMBL
Match: A0A183W7F3 (Uncharacterized protein OS=Trichobilharzia regenti OX=157069 GN=TRE_LOCUS8106 PE=4 SV=1)

HSP 1 Score: 175.252 bits (443), Expect = 2.965e-46
Identity = 87/165 (52.73%), Postives = 115/165 (69.70%), Query Frame = 2
Query:  359 QYDYNHMVSQIARITDNLYLSGLHAITSERLKSLGISLVVSLIAENSSMRLPPS------IERIQVNIEDTENVNIRRHFDKVLERMNTEERRQGRILVHCVAGISRSSTIILAYLMRYHNMRLREAYNLVHSQRPYIQPNLGFWRQLIDYEKSIFGGSSVNMVP 835
            Q D+  M SQIARI ++L+LS L+AIT ERL+  GI+L+VS + ++     PPS      I  I V +ED E  N+R HFD+V +R+  E RR G+ LVHC+AG+SRSST+ILAYLMR+ NM L +AY  V S RP IQPN GFWRQL++YE+ + G  SV ++P
Sbjct:  261 QIDFTQMFSQIARINNHLFLSSLNAITPERLRQHGITLLVSAMIDS-----PPSHIRNAVINTIHVPVEDVETANLRVHFDRVSDRIAAESRRGGKTLVHCMAGVSRSSTLILAYLMRHTNMSLADAYQHVRSIRPCIQPNPGFWRQLLEYEEKLRGSRSVRLLP 420          
BLAST of Dual specificity protein phosphatase 14 vs. TrEMBL
Match: A0A3S5BG49 (Uncharacterized protein OS=Protopolystoma xenopodis OX=117903 GN=PXEA_LOCUS16365 PE=4 SV=1)

HSP 1 Score: 174.866 bits (442), Expect = 4.974e-46
Identity = 84/168 (50.00%), Postives = 116/168 (69.05%), Query Frame = 2
Query:  350 AFKQYDYNHMVSQIARITDNLYLSGLHAITSERLKSLGISLVVSLIAENSSMRLPPSIER------IQVNIEDTENVNIRRHFDKVLERMNTEERRQGRILVHCVAGISRSSTIILAYLMRYHNMRLREAYNLVHSQRPYIQPNLGFWRQLIDYEKSIFGGSSVNMVP 835
            A   YD N M SQIAR+TD+LYLS L+A+T +RL+   I+L+VS + +      PP+  R      + +++ED E+ N+  HFD+V +R+  E RR GR LVHC+AGISRS++++LAYL+R+  M L EAY LV S RP +QPN  FWRQL+DYE+ + GG SV +VP
Sbjct:  207 AVGGYDLNKMFSQIARVTDHLYLSSLNALTPDRLRQNEITLLVSAMIDP-----PPAALRSAVANSLHISVEDVESTNLGVHFDRVADRIAAEARRGGRALVHCMAGISRSTSLVLAYLVRHRGMSLAEAYQLVRSVRPCVQPNPSFWRQLVDYEERLRGGRSVRLVP 369          
BLAST of Dual specificity protein phosphatase 14 vs. TrEMBL
Match: H2KQA2 (Dual specificity protein phosphatase 14 OS=Clonorchis sinensis OX=79923 GN=CLF_103516 PE=4 SV=1)

HSP 1 Score: 173.326 bits (438), Expect = 1.039e-45
Identity = 82/163 (50.31%), Postives = 116/163 (71.17%), Query Frame = 2
Query:  359 QYDYNHMVSQIARITDNLYLSGLHAITSERLKSLGISLVVSLIAENSSMRLPPS-IERIQVNIEDTENVNIRRHFDKVLERMNTEERRQGRILVHCVAGISRSSTIILAYLMRYHNMRLREAYNLVHSQRPYIQPNLGFWRQLIDYEKSIFGGSSVNMVPMEG 844
            Q D+  M SQ+ARI ++LYLS L+A+T +RL+  GI+L+VS + +    +L  + I  + V +ED E  N+R HFD+V +R+ +E+RR GR LVHC+AG+SRSS+++LAYLMR+ NM L +AY  V S RP IQPN  FWRQL++YE+ I G  SV ++P  G
Sbjct:  242 QLDFTQMYSQVARINNHLYLSSLNALTPDRLRQYGITLLVSAMVDPPPAQLRNAVISSMHVAVEDMEGANLRAHFDRVGDRIASEQRRGGRTLVHCMAGVSRSSSLVLAYLMRHMNMTLADAYQHVRSIRPCIQPNPSFWRQLLEYEERIHGRRSVRLLPPVG 404          
BLAST of Dual specificity protein phosphatase 14 vs. Ensembl Cavefish
Match: dusp14 (dual specificity phosphatase 14 [Source:ZFIN;Acc:ZDB-GENE-041010-162])

HSP 1 Score: 132.88 bits (333), Expect = 1.045e-36
Identity = 72/169 (42.60%), Postives = 110/169 (65.09%), Query Frame = 2
Query:  377 MVSQIARITDNLYLS-GLHAITSERLKSLGISLVVSLIAENSSMRLP----PSIERIQVNIEDTENVNIRRHFDKVLERMNTEERRQGRILVHCVAGISRSSTIILAYLMRYHNMRLREAYNLVHSQRPYIQPNLGFWRQLIDYEKSIFGGSSVNMVPMEGTRILVPDV 868
            ++  IA+IT  L+LS G  A     L S GI+ VV     N+++ LP    P +E ++V + D  +  I  +FD V +++++  R++G +LVHC AG+SRS+++ LAYLM+YH + L EA+  V ++RP I+PN GFWRQLI+YE+ +FG +SV MV  +    +VPDV
Sbjct:   18 LLGGIAQITPTLFLSRGNVASNRSLLLSKGITCVV-----NATIELPNFNWPHVEYVKVPLADMPHSPISLYFDSVADKIHSVGRKRGAVLVHCAAGVSRSASLCLAYLMKYHRVSLAEAHAWVKARRPVIRPNGGFWRQLIEYERKLFGKTSVKMV--QTPYGVVPDV 179          
BLAST of Dual specificity protein phosphatase 14 vs. Ensembl Cavefish
Match: zgc:153044 (dual specificity protein phosphatase 18-like [Source:NCBI gene;Acc:103034919])

HSP 1 Score: 129.798 bits (325), Expect = 9.554e-36
Identity = 68/166 (40.96%), Postives = 107/166 (64.46%), Query Frame = 2
Query:  380 VSQIARITDNLYLS-GLHAITSERLKSLGISLVVSLIAENSSMRLPPSIERIQVNIEDTENVNIRRHFDKVLERMNTEERRQGRILVHCVAGISRSSTIILAYLMRYHNMRLREAYNLVHSQRPYIQPNLGFWRQLIDYEKSIFGGSSVNMV--PMEGTRILVPDV 868
            ++ +A++TD LY+S G  A  S  +  L I+ +++   +N +  LP S+E + V + D+    +  HFD V +R++    + GR+LVHC AG+SRS+T+ LA+L+++  M L EA+ LV S+RP ++PN GFW+QLIDYE  + G SSV MV  P+     L+PD+
Sbjct:    8 LAGLAQVTDYLYISNGRAAKDSTVITRLNITCIINATQDNGNPCLP-SVEYVWVPVTDSPETQLEEHFDTVADRIDEVRAQCGRVLVHCCAGVSRSATLCLAFLVKHCGMSLIEAHGLVKSRRPIVRPNSGFWKQLIDYEVKLRGTSSVMMVSSPLG----LIPDL 168          
BLAST of Dual specificity protein phosphatase 14 vs. Ensembl Cavefish
Match: si:ch1073-184j22.2 (si:ch1073-184j22.2 [Source:ZFIN;Acc:ZDB-GENE-081104-32])

HSP 1 Score: 117.472 bits (293), Expect = 5.819e-31
Identity = 58/142 (40.85%), Postives = 93/142 (65.49%), Query Frame = 2
Query:  389 IARITDNLYLSGLHAITSERLKSL-GISLVVSLIAENSSMRLPPSIERIQVNIEDTENVNIRRHFDKVLERMNTEERRQGRILVHCVAGISRSSTIILAYLMRYHNMRLREAYNLVHSQRPYIQPNLGFWRQLIDYEKSIFG 811
            +++IT  L+LSG  A  ++ L S  GI+L+V+    +S  R P  +E I+V + D  +  +  HFD+V  R+++ +   G  LVHC AG+SRS  +I+AYLM+Y  + L++A++ V   RPYI+ N GFW+QL+DYE+ ++G
Sbjct:   49 MSQITPTLFLSGADASLNQALLSRKGITLIVNATLSHSCPRYP-GVECIRVAVSDLPSARLSEHFDRVASRIHSNQ--AGGTLVHCAAGMSRSPALIMAYLMKYKGVTLQQAHSWVQRSRPYIRLNAGFWQQLLDYERGLYG 187          
BLAST of Dual specificity protein phosphatase 14 vs. Ensembl Cavefish
Match: ENSAMXT00000026376.2 (pep primary_assembly:Astyanax_mexicanus-2.0:17:26775472:26778719:-1 gene:ENSAMXG00000025650.2 transcript:ENSAMXT00000026376.2 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 98.9821 bits (245), Expect = 1.230e-23
Identity = 55/148 (37.16%), Postives = 89/148 (60.14%), Query Frame = 2
Query:  389 IARITDNLYLSGLHAITSERLKSLGISLVVSLIAENSSMRLPPSIERIQVNIEDTENVNIRRHFDKVLERMNTEERRQGRILVHCVAGISRSSTIILAYLMRYHNMRLREAYNLVHSQRPYIQPNLGFWRQLIDYEKSIFGGSSVNMV 832
            I++IT +L+LSG+ A+    L    ++L+V L A+         I+ +++ I D  +  + +HFD V ER+  ++ R G  LV C AG SRS  +++A+L++   + L +AY  V   RP+I+PN GFWRQL++YE+     +SV MV
Sbjct:    3 ISQITPSLFLSGV-AVNPAALARRKVTLLV-LAADELPFPESAGIDLLRLPIRDEPHAPLAQHFDSVAERI--QQNRSGSTLVCCAAGRSRSPALVMAFLIKNEGLSLLQAYQRVLEVRPFIRPNAGFWRQLLEYERRFHLCNSVRMV 146          
BLAST of Dual specificity protein phosphatase 14 vs. Ensembl Cavefish
Match: dusp1 (dual specificity phosphatase 1 [Source:NCBI gene;Acc:103038437])

HSP 1 Score: 92.0485 bits (227), Expect = 3.169e-20
Identity = 48/140 (34.29%), Postives = 78/140 (55.71%), Query Frame = 2
Query:  410 LYL-SGLHAITSERLKSLGISLVVSLIAENSSMRLPPSIERIQVNIEDTENVNIRRHFDKVLERMNTEERRQGRILVHCVAGISRSSTIILAYLMRYHNMRLREAYNLVHSQRPYIQPNLGFWRQLIDYEKSIFGGSSVN 826
            LYL S  HA   + L  LGI+ +++ ++ N         +   + +ED    +I   F++ +E +++   + GR+ VHC AGISRS+TI LAYLMR + ++L EA+  V  +R  I PN  F  QL+ +E  +   S+ +
Sbjct:  193 LYLGSAYHASRKDMLDMLGITALIN-VSANCPNHFEEHYQYKSIPVEDNHKADISSWFNEAIEFIDSVRNKGGRVFVHCQAGISRSATICLAYLMRTNRVKLDEAFEFVKQRRSIISPNFSFMGQLLQFESQVLASSTCS 331          
BLAST of Dual specificity protein phosphatase 14 vs. Ensembl Sea Lamprey
Match: dusp14 (dual specificity phosphatase 14 [Source:ZFIN;Acc:ZDB-GENE-041010-162])

HSP 1 Score: 130.183 bits (326), Expect = 2.268e-36
Identity = 62/139 (44.60%), Postives = 90/139 (64.75%), Query Frame = 2
Query:  416 LSGLHAITSERLKSLGISLVVSLIAENSSMRLPPSIERIQVNIEDTENVNIRRHFDKVLERMNTEERRQGRILVHCVAGISRSSTIILAYLMRYHNMRLREAYNLVHSQRPYIQPNLGFWRQLIDYEKSIFGGSSVNMV 832
            +SG  A  +  L++ GI+ VV+   E +  RLP  +  ++V + D  +  I R+FD V ER+  E RR GR LVHC AG+SRS+++ +AYLMR   + LR+A+  V ++RP + PN GFWRQLI YE+ +FG  SV +V
Sbjct:   27 ISGRCASNASLLRARGITCVVNASLEVADARLP-GVRYVRVPVPDCPHAPISRYFDPVAERIAGEARRGGRTLVHCAAGVSRSASLCIAYLMRGEGLVLRDAFRWVRARRPAVCPNSGFWRQLIRYERELFGRCSVRLV 164          
BLAST of Dual specificity protein phosphatase 14 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000006071.1 (pep scaffold:Pmarinus_7.0:GL479824:161791:175185:-1 gene:ENSPMAG00000005490.1 transcript:ENSPMAT00000006071.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 92.4337 bits (228), Expect = 6.734e-23
Identity = 47/125 (37.60%), Postives = 77/125 (61.60%), Query Frame = 2
Query:  446 RLKSLGISLVVSLIAENSSMRLPPSIERIQVNIED--TENVNIRRHFDKVLERMNTEERRQGRILVHCVAGISRSSTIILAYLMRYHNMRLREAYNLVHSQRPYIQPNLGFWRQLIDYEKSIFGG 814
            +L+ LGI LV+++ A      L    +R+  N  D  ++  N+R++F++  E +    RR   +LVHC AG+SRS+TI++AYLM++  M + +AY  V  +RP I PNL F  QL+++E+ +  G
Sbjct:    7 KLQRLGIGLVLNVTAHYERGGL--HYKRLPANDSDNDSDKQNLRQYFEEAFEFIEDAHRRGQGLLVHCQAGVSRSATIVIAYLMKHTRMTMTDAYKFVKGKRPIISPNLNFMGQLLEFEEDLNSG 129          
BLAST of Dual specificity protein phosphatase 14 vs. Ensembl Sea Lamprey
Match: dusp4 (dual specificity phosphatase 4 [Source:ZFIN;Acc:ZDB-GENE-040426-709])

HSP 1 Score: 85.5001 bits (210), Expect = 6.755e-19
Identity = 51/137 (37.23%), Postives = 74/137 (54.01%), Query Frame = 2
Query:  410 LYL-SGLHAITSERLKSLGISLVVSLIAENSSMRLPPSIERI----QVNIEDTENVNIRRHFDKVLERMNTEERRQGRILVHCVAGISRSSTIILAYLMRYHNMRLREAYNLVHSQRPYIQPNLGFWRQLIDYEKSI 805
            LYL S  HA   E L ++GI+ ++     N S  LP   E +     + +ED    +I   F + ++ +++  R  GR+ VHC AG+SRS+TI LAYLM+   +RL EA+  V  +R  I PN  F  QL  +E  I
Sbjct:  202 LYLGSAYHASRRELLDAIGITALL-----NVSADLPNHFEGLFTYKSIPVEDNHKADIGAWFLEAIDFIDSTRRGGGRVFVHCHAGVSRSATICLAYLMKTRRLRLDEAFEFVRQRRSVISPNFNFLGQLQSFEVQI 333          
BLAST of Dual specificity protein phosphatase 14 vs. Ensembl Sea Lamprey
Match: dusp28 (dual specificity phosphatase 28 [Source:ZFIN;Acc:ZDB-GENE-131127-257])

HSP 1 Score: 82.0333 bits (201), Expect = 7.606e-19
Identity = 48/150 (32.00%), Postives = 76/150 (50.67%), Query Frame = 2
Query:  398 ITDNLYLSGLH-AITSERLKSLGISLVVSLIAENSSMRLPPSIER---------IQVNIEDTENVNIRRHFDKVLERMNTEERRQGRILVHCVAGISRSSTIILAYLMRYHNMRLREAYNLVHSQRPYIQPNLGFWRQLIDYEKSIFGGS 817
            +T+ L++S    A   + L + GI+L++++   +     PP             I+V + D  + ++  H     + +  E  R GR LV+C  G SRS  ++ AYLMR+  + LR A+  V S RP   PN GFWRQL+ YE  +  G+
Sbjct:   18 VTEWLFISNARSACCPDLLDAAGITLLINV---SRLQPFPPEPAPGQGQGQRVCIRVPVFDEPSESLGPHLTPCADAIEEERVRGGRTLVYCKHGRSRSVAVVTAYLMRHGELSLRSAFQKVKSVRPSASPNEGFWRQLLQYEAQLMCGT 164          
BLAST of Dual specificity protein phosphatase 14 vs. Ensembl Sea Lamprey
Match: dusp7 (dual specificity phosphatase 7 [Source:ZFIN;Acc:ZDB-GENE-030131-5457])

HSP 1 Score: 80.8777 bits (198), Expect = 8.307e-18
Identity = 44/127 (34.65%), Postives = 71/127 (55.91%), Query Frame = 2
Query:  443 ERLKSLGISLVVSLIAENSSMRLPPSIERI------QVNIEDTENVNIRRHFDKVLERMNTEERRQGRILVHCVAGISRSSTIILAYLMRYHNMRLREAYNLVHSQRPYIQPNLGFWRQLIDYEKSI 805
            E L   GI  ++     N +  LP + ERI      Q+ I D  N N+ + F + +  ++    +Q  +LVHC+AGISRS T+ +AYLM+  ++ L +AY+ V  ++  I PN  F  QL+D+E+ +
Sbjct:  116 EALAQHGIRYIL-----NVTPNLPNTFERIADFKYKQIPISDHWNQNLSQFFPEAIAFIDEARNKQCGVLVHCLAGISRSVTVTVAYLMQKLSLPLNDAYDFVKHKKSNISPNFNFMGQLLDFERRL 237          
BLAST of Dual specificity protein phosphatase 14 vs. Ensembl Yeast
Match: SDP1 (Stress-inducible dual-specificity MAP kinase phosphatase; negatively regulates Slt2p MAP kinase by direct dephosphorylation, diffuse localization under normal conditions shifts to punctate localization after heat shock; SDP1 has a paralog, MSG5, that arose from the whole genome duplication [Source:SGD;Acc:S000001375])

HSP 1 Score: 70.4774 bits (171), Expect = 1.322e-14
Identity = 28/69 (40.58%), Postives = 52/69 (75.36%), Query Frame = 2
Query:  617 RQGRILVHCVAGISRSSTIILAYLMRYHNMRLREAYNLVHSQRPYIQPNLGFWRQLIDYEKSIFGGSSV 823
            ++ +IL+HC  G+SRS+T+I+AY+M+YHN+ LR +Y+L+ S+   I P++G   QL+++E ++   ++V
Sbjct:  132 KREKILIHCQCGLSRSATLIIAYIMKYHNLSLRHSYDLLKSRADKINPSIGLIFQLMEWEVALNAKTNV 200          
BLAST of Dual specificity protein phosphatase 14 vs. Ensembl Yeast
Match: MSG5 (Dual-specificity protein phosphatase; exists in 2 isoforms; required for maintenance of a low level of signaling through the cell integrity pathway, adaptive response to pheromone; regulates and is regulated by Slt2p; dephosphorylates Fus3p; MSG5 has a paralog, SDP1, that arose from the whole genome duplication [Source:SGD;Acc:S000004998])

HSP 1 Score: 68.9366 bits (167), Expect = 3.667e-13
Identity = 38/116 (32.76%), Postives = 67/116 (57.76%), Query Frame = 2
Query:  458 LGISLVVSLIAE--NSSMRLPPSI-ERIQV-NIEDTENVNIRRHFDKVLERMNTEERRQGRILVHCVAGISRSSTIILAYLMRYHNMRLREAYNLVHSQRPYIQPNLGFWRQLIDY 793
            L   LV+++  E  N    +PP +  +I+  +IE T    I +   ++   ++T   +  +ILVHC  G+SRS+++I+AY+MRY+ + L +AYN +      I PN+G   QL+++
Sbjct:  254 LSFDLVINVAKEIPNLEFLIPPEMAHKIKYYHIEWTHTSKIVKDLSRLTRIIHTAHSQGKKILVHCQCGVSRSASLIVAYIMRYYGLSLNDAYNKLKGVAKDISPNMGLIFQLMEW 369          
BLAST of Dual specificity protein phosphatase 14 vs. Ensembl Yeast
Match: PPS1 (Protein phosphatase; has specificity for serine, threonine, and tyrosine residues; has a role in the DNA synthesis phase of the cell cycle [Source:SGD;Acc:S000000480])

HSP 1 Score: 66.2402 bits (160), Expect = 3.664e-12
Identity = 40/108 (37.04%), Postives = 61/108 (56.48%), Query Frame = 2
Query:  482 LIAENSSMRLPPSIERIQVNIEDTENVNIRRHFDKVLERMNTEERRQGRILVHCVAGISRSSTIILAYLMRYHNMRLREAYNLVHSQR--PYIQPNLGFWRQLIDYEK 799
            +I+ENS  +    I +I+ N++D     +    DKVL+ ++  E   G++LVHC+ G+SRS+T+ +A  MRY    L  AY  V  +R    IQPNL F  +L  + K
Sbjct:  677 VISENSGFQ----ICQIE-NLDDNGKDPLFHQIDKVLDFISNSEATGGKVLVHCMVGVSRSATVCIAECMRYLQCDLASAYLFVRVRRLNVIIQPNLFFVYELFKWWK 779          
BLAST of Dual specificity protein phosphatase 14 vs. Ensembl Yeast
Match: YVH1 (Dual specificity protein phosphatase; regulates growth, sporulation, and glycogen accumulation in a cAMP-dependent protein kinase cascade dependent manner; mutants are defective in 60S ribosome assembly; positively regulates pre-autophagosomal structure (PAS) formation upon nitrogen starvation or rapamycin treatment [Source:SGD;Acc:S000001465])

HSP 1 Score: 61.6178 bits (148), Expect = 4.561e-11
Identity = 47/176 (26.70%), Postives = 79/176 (44.89%), Query Frame = 2
Query:  371 NHMVSQIARITDNLYLSGLHAITSERLKSLGISLVVSLIAENSSMRLPP--------SIERIQVNIEDTENV-----NIRRHFDKVLERMNTE----------ERRQGRILVHCVAGISRSSTIILAYLMRYHNMRLREAYNLVHSQRPYIQPNLGFWRQLIDYEKSIFGGSSVNM 829
            N +  ++ RI   +YL G+  I   R   LG    ++ I      ++ P        +++ I ++ +D  +V        R  D+ L     E          + ++G +  HC AG+SRS T I+AYLM  + + L  A + V  ++P ++PN  F  QL  +EK   GG  V+ 
Sbjct:    6 NSVDEEVTRILGGIYLGGIRPIIDHR--PLGAEFNITHILSVIKFQVIPEYLIRKGYTLKNIPIDDDDVTDVLQYFDETNRFIDQCLFPNEVEYSPRLVDFKKKPQRGAVFAHCQAGLSRSVTFIVAYLMYRYGLSLSMAMHAVKRKKPSVEPNENFMEQLHLFEK--MGGDFVDF 177          
BLAST of Dual specificity protein phosphatase 14 vs. Ensembl Nematostella
Match: EDO47156 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RMT6])

HSP 1 Score: 127.872 bits (320), Expect = 2.603e-35
Identity = 62/156 (39.74%), Postives = 101/156 (64.74%), Query Frame = 2
Query:  380 VSQIARITDNLYLSGLHAITSERLK-SLGISLVVSLIAENSSMRLP----PSIERIQVNIEDTENVNIRRHFDKVLERMNTEERRQGRILVHCVAGISRSSTIILAYLMRYHNMRLREAYNLVHSQRPYIQPNLGFWRQLIDYEKSIFGGSSVNMV 832
            ++ +ARIT+ L+LS       E+L    GI+LV+     N+++  P      ++ I++ + D     I   FD V +++ +  R  G++LVHC+AG+SRS+++++AYLM+Y  + LR+A+ LV  +RP I+PN GFW++LIDYEK +FG +SV MV
Sbjct:   16 LTAMARITEWLFLSSCQVARDEKLLLEKGITLVI-----NATIEAPEQDYKKVKHIRIKVNDNPGNKIGIFFDMVSDKIESVRRVGGKVLVHCIAGVSRSASLVIAYLMKYQRLNLRDAHKLVQDKRPLIRPNTGFWKELIDYEKKLFGKNSVQMV 166          
BLAST of Dual specificity protein phosphatase 14 vs. Ensembl Nematostella
Match: EDO49250 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RGX7])

HSP 1 Score: 92.4337 bits (228), Expect = 3.423e-21
Identity = 59/159 (37.11%), Postives = 89/159 (55.97%), Query Frame = 2
Query:  338 PKFDAFKQYD-----YNHMVSQIARITDNLYL-SGLHAITSERLKSLGISLVVSLIAENSSMRLPPSIERIQVNIEDTENVNIRRHFDKVLERMNTEERRQGRILVHCVAGISRSSTIILAYLMRYHNMRLREAYNLVHSQRPYIQPNLGFWRQLIDYE 796
            P++D   + D     +++ V++   +  +LYL S LHA   + LK LGIS +V+ ++ N       S     + ++DT N +I   F++    +++ +   GR+LVHC AGISRS+TI LAYL+   N RL EAY  V  +R  I PN  F  QL+ YE
Sbjct:  150 PRWDTDNKDDQLPRAHSNSVNEPVELLPHLYLGSELHASRRDVLKRLGISAIVN-VSRNIPNTFEDSFTYKTIPVDDTYNADIGVWFEEAAGFIDSVKASGGRVLVHCQAGISRSATICLAYLISRLNFRLDEAYEYVKKRRSVISPNFNFMGQLLHYE 307          
BLAST of Dual specificity protein phosphatase 14 vs. Ensembl Nematostella
Match: EDO37000 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SGZ1])

HSP 1 Score: 83.5741 bits (205), Expect = 1.790e-19
Identity = 39/93 (41.94%), Postives = 60/93 (64.52%), Query Frame = 2
Query:  524 ERIQVNIEDTENVNIRRHFDKVLERMNTEERRQGRILVHCVAGISRSSTIILAYLMRYHNMRLREAYNLVHSQRPYIQPNLGFWRQLIDYEKS 802
            +RIQ+N  D+   +I +HFD+ +  ++    R   +LVHC AG+SRS+T+ +AY+M++  + L EAY  V  +RP I PNL F   L+ YEK+
Sbjct:   47 KRIQIN--DSYQEDIGQHFDEAIAFIDEARSRGSSVLVHCHAGVSRSATVTVAYVMQHLGLSLNEAYQFVKEKRPTISPNLNFMGHLLKYEKN 137          
BLAST of Dual specificity protein phosphatase 14 vs. Ensembl Nematostella
Match: EDO35438 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SLH2])

HSP 1 Score: 77.411 bits (189), Expect = 2.233e-17
Identity = 31/59 (52.54%), Postives = 44/59 (74.58%), Query Frame = 2
Query:  623 GRILVHCVAGISRSSTIILAYLMRYHNMRLREAYNLVHSQRPYIQPNLGFWRQLIDYEK 799
            G +LVHC AG+SRS  +++AYLM    + L +A+N+V  QRP ++PN GFWRQL +YE+
Sbjct:   75 GAVLVHCNAGVSRSPAVVIAYLMHKRLLSLGQAFNVVREQRPCVKPNEGFWRQLCNYEQ 133          
BLAST of Dual specificity protein phosphatase 14 vs. Ensembl Nematostella
Match: EDO37675 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SF21])

HSP 1 Score: 82.0333 bits (201), Expect = 2.494e-17
Identity = 48/161 (29.81%), Postives = 84/161 (52.17%), Query Frame = 2
Query:  335 QPKFDAFKQYDYNHMVS------QIARITDNLYL-SGLHAITSERLKSLGISLVVSLIAENSSMRLPPSIERIQVNIEDTENVNIRRHFDKVLERMNTEERRQGRILVHCVAGISRSSTIILAYLMRYHNMRLREAYNLVHSQRPYIQPNLGFWRQLIDYE 796
            Q     +KQY    M++        ++I D++YL S  +A   E LK  G+  V+++  E  +     +     + + D E+ N+  ++D+  + +N    +  ++LVHC  GISRS++ ++AY M+ +   L +    V S+R  + PN GFW+QLI YE
Sbjct:  199 QMDLKQYKQYIDKEMLTIFGQMDSASKIYDHVYLGSEWNASNLEELKENGVEYVLNITKEIDNF-FAGTFTYFNIRLWDLEDSNLLPYWDETFKFINQARDKGSKVLVHCKRGISRSASTVIAYGMKEYGTSLNDTMKHVKSRRQCVNPNQGFWKQLITYE 358          
BLAST of Dual specificity protein phosphatase 14 vs. Ensembl Medaka
Match: dusp14 (dual specificity phosphatase 14 [Source:ZFIN;Acc:ZDB-GENE-041010-162])

HSP 1 Score: 132.494 bits (332), Expect = 2.025e-36
Identity = 72/171 (42.11%), Postives = 112/171 (65.50%), Query Frame = 2
Query:  371 NHMVSQIARITDNLYLS-GLHAITSERLKSLGISLVVSLIAENSSMRLP----PSIERIQVNIEDTENVNIRRHFDKVLERMNTEERRQGRILVHCVAGISRSSTIILAYLMRYHNMRLREAYNLVHSQRPYIQPNLGFWRQLIDYEKSIFGGSSVNMVPMEGTRILVPDV 868
             +++  IA+IT NL+LS G  A     L S GI+ VV     N+++ LP    P +E ++V + D  +  I  +FD V +++++  R++G +LVHC AG+SRS+++ LAYLM+YH + L EA+  V ++RP I+PN GFWRQLI+YE+ +FG +SV MV  +    ++PDV
Sbjct:   23 GNLLGGIAQITPNLFLSRGNVASNRSLLLSKGITCVV-----NATIELPNFNWPHMEYVKVPLADMPHSPISLYFDSVADKIHSVGRKRGAVLVHCAAGVSRSASLCLAYLMKYHRVSLAEAHAWVKARRPVIRPNGGFWRQLIEYERKLFGRNSVKMV--QTPYGVIPDV 186          
BLAST of Dual specificity protein phosphatase 14 vs. Ensembl Medaka
Match: ENSORLT00000014836.2 (pep primary_assembly:ASM223467v1:9:17523780:17526387:-1 gene:ENSORLG00000011840.2 transcript:ENSORLT00000014836.2 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 119.013 bits (297), Expect = 1.891e-31
Identity = 64/154 (41.56%), Postives = 93/154 (60.39%), Query Frame = 2
Query:  380 VSQIARITDNLYLSGLH-AITSERLKSLGISLVVSLIAENSSMRLPPSI-ERIQVNIEDTENVNIRRHFDKVLERMNTEERRQGRILVHCVAGISRSSTIILAYLMRYHNMRLREAYNLVHSQRPYIQPNLGFWRQLIDYEKSIFGGSSVNMVP 835
            +S + R+TD LYLS    A  S +LK   I+ ++++    SS   PP + E + + + D+   N+R HFD V +++       GR LVHC AG+SRS+ + +A+LMR+    L +A+  + S RP I+PN GFWRQLI YE  + G SSV MVP
Sbjct:   21 LSGLCRVTDQLYLSSRKSANDSSQLKVNKITCIINVSEARSS--CPPGVDEYVHIPVSDSPLSNLRDHFDWVADKVRVTAENGGRTLVHCNAGVSRSAALCMAFLMRHRGATLLDAHAWLKSCRPIIRPNHGFWRQLIVYETELRGCSSVRMVP 172          
BLAST of Dual specificity protein phosphatase 14 vs. Ensembl Medaka
Match: ENSORLT00000026820.1 (dual specificity protein phosphatase 14 [Source:NCBI gene;Acc:101159168])

HSP 1 Score: 116.701 bits (291), Expect = 1.956e-30
Identity = 65/174 (37.36%), Postives = 102/174 (58.62%), Query Frame = 2
Query:  380 VSQIARITDNLYLSGLH-AITSERLKSLGISLVVSLIA-ENSSMRLPPSIERIQVNIEDTENVNIRRHFDKVLERMNTEERRQGRILVHCVAGISRSSTIILAYLMRYHNMRLREAYNLVHSQRPYIQPNLGFWRQLIDYEKSIFGGSSVNMVPMEGTRILVPDVTPSILSEIL 895
            V +++RI+  L+LS L  A+    L   G++LV++    +N S      ++ + V ++D  +  ++ HFD+V ER+  ++ R G  LVHC AG SRS T+++AYLMR   + L +A+  V  QRP+I+PN GFWRQL++YE  +FG SS+ M           D    +L E+L
Sbjct:   30 VMRVSRISARLFLSDLDSALDPSVLARRGVTLVINASGLQNLSYPALEGLQLLHVPVQDRPHAPLKDHFDQVAERI--QQNRTGSTLVHCTAGRSRSPTLVMAYLMRCEGLSLCQAHEQVLEQRPFIRPNCGFWRQLMEYELVLFGRSSLRMA----------DTACGVLPEVL 191          
BLAST of Dual specificity protein phosphatase 14 vs. Ensembl Medaka
Match: ENSORLT00000045858.1 (dual specificity protein phosphatase 14 [Source:NCBI gene;Acc:101159168])

HSP 1 Score: 116.316 bits (290), Expect = 1.991e-30
Identity = 65/174 (37.36%), Postives = 102/174 (58.62%), Query Frame = 2
Query:  380 VSQIARITDNLYLSGLH-AITSERLKSLGISLVVSLIA-ENSSMRLPPSIERIQVNIEDTENVNIRRHFDKVLERMNTEERRQGRILVHCVAGISRSSTIILAYLMRYHNMRLREAYNLVHSQRPYIQPNLGFWRQLIDYEKSIFGGSSVNMVPMEGTRILVPDVTPSILSEIL 895
            V +++RI+  L+LS L  A+    L   G++LV++    +N S      ++ + V ++D  +  ++ HFD+V ER+  ++ R G  LVHC AG SRS T+++AYLMR   + L +A+  V  QRP+I+PN GFWRQL++YE  +FG SS+ M           D    +L E+L
Sbjct:   13 VMRVSRISARLFLSDLDSALDPSVLARRGVTLVINASGLQNLSYPALEGLQLLHVPVQDRPHAPLKDHFDQVAERI--QQNRTGSTLVHCTAGRSRSPTLVMAYLMRCEGLSLCQAHEQVLEQRPFIRPNCGFWRQLMEYELVLFGRSSLRMA----------DTACGVLPEVL 174          
BLAST of Dual specificity protein phosphatase 14 vs. Ensembl Medaka
Match: ENSORLT00000042431.1 (dual specificity protein phosphatase 14 [Source:NCBI gene;Acc:101159168])

HSP 1 Score: 115.546 bits (288), Expect = 2.717e-30
Identity = 67/175 (38.29%), Postives = 104/175 (59.43%), Query Frame = 2
Query:  386 QIARITDNLYLSGLH-AITSERLKSLGISLVVSLIA-ENSSMRLPPSIERIQ---VNIEDTENVNIRRHFDKVLERMNTEERRQGRILVHCVAGISRSSTIILAYLMRYHNMRLREAYNLVHSQRPYIQPNLGFWRQLIDYEKSIFGGSSVNMVPMEGTRILVPDVTPSILSEIL 895
            +++RI+  L+LS L  A+    L   G++LV++    +N S    P++E +Q   V ++D  +  ++ HFD+V ER+  ++ R G  LVHC AG SRS T+++AYLMR   + L +A+  V  QRP+I+PN GFWRQL++YE  +FG SS+ M           D    +L E+L
Sbjct:    2 RVSRISARLFLSDLDSALDPSVLARRGVTLVINASGLQNLSY---PALEGLQLLHVPVQDRPHAPLKDHFDQVAERI--QQNRTGSTLVHCTAGRSRSPTLVMAYLMRCEGLSLCQAHEQVLEQRPFIRPNCGFWRQLMEYELVLFGRSSLRMA----------DTACGVLPEVL 161          
BLAST of Dual specificity protein phosphatase 14 vs. Planmine SMEST
Match: SMESG000037868.1 (SMESG000037868.1)

HSP 1 Score: 569.696 bits (1467), Expect = 0.000e+0
Identity = 308/308 (100.00%), Postives = 308/308 (100.00%), Query Frame = 2
Query:   44 MHYKKSNDTFPXXXXXXXXXXXXXXNKSFNYLSKPNVTKIQETSSTNDLKVKTDTNSYSSISKPAIKSTGDNNVKXXXXXXXXXXXXXXKDSICNLQQPKFDAFKQYDYNHMVSQIARITDNLYLSGLHAITSERLKSLGISLVVSLIAENSSMRLPPSIERIQVNIEDTENVNIRRHFDKVLERMNTEERRQGRILVHCVAGISRSSTIILAYLMRYHNMRLREAYNLVHSQRPYIQPNLGFWRQLIDYEKSIFGGSSVNMVPMEGTRILVPDVTPSILSEILSSTPMMRVQQRSPISIFPVRPTYF 967
            MHYKKSNDTFPFSSSRFETTYSSSYNKSFNYLSKPNVTKIQETSSTNDLKVKTDTNSYSSISKPAIKSTGDNNVKSSTSFISSTPISISKDSICNLQQPKFDAFKQYDYNHMVSQIARITDNLYLSGLHAITSERLKSLGISLVVSLIAENSSMRLPPSIERIQVNIEDTENVNIRRHFDKVLERMNTEERRQGRILVHCVAGISRSSTIILAYLMRYHNMRLREAYNLVHSQRPYIQPNLGFWRQLIDYEKSIFGGSSVNMVPMEGTRILVPDVTPSILSEILSSTPMMRVQQRSPISIFPVRPTYF
Sbjct:    1 MHYKKSNDTFPFSSSRFETTYSSSYNKSFNYLSKPNVTKIQETSSTNDLKVKTDTNSYSSISKPAIKSTGDNNVKSSTSFISSTPISISKDSICNLQQPKFDAFKQYDYNHMVSQIARITDNLYLSGLHAITSERLKSLGISLVVSLIAENSSMRLPPSIERIQVNIEDTENVNIRRHFDKVLERMNTEERRQGRILVHCVAGISRSSTIILAYLMRYHNMRLREAYNLVHSQRPYIQPNLGFWRQLIDYEKSIFGGSSVNMVPMEGTRILVPDVTPSILSEILSSTPMMRVQQRSPISIFPVRPTYF 308          
BLAST of Dual specificity protein phosphatase 14 vs. Planmine SMEST
Match: SMESG000032392.1 (SMESG000032392.1)

HSP 1 Score: 201.83 bits (512), Expect = 8.347e-62
Identity = 90/191 (47.12%), Postives = 144/191 (75.39%), Query Frame = 2
Query:  335 QPKFDAFKQYDYNHMVSQIARITDNLYLSGLHAITSERLKSLGISLVVSLIAENSSMRLPPSIERIQVNIEDTENVNIRRHFDKVLERMNTEERRQGRILVHCVAGISRSSTIILAYLMRYHNMRLREAYNLVHSQRPYIQPNLGFWRQLIDYEKSIFGGSSVNMVPMEGTRILVPDVTPSILSEILSSTP 907
            QP + +  +  Y H+++QIA+ITD++YLS + AIT +R++ LGI+++VS+I +   +R   ++E + V IEDTE  N+R + D+V+++++ EE + G+ILVHC+AG+SRSS++++ YLM+YH MRLR+AYN V ++RPYIQPN+GFW+QLI++EK +FG  SV+++       +VPDV PS L  +L ++P
Sbjct:  114 QPSYLSTTRLSYQHLLNQIAQITDSVYLSSISAITLDRIRELGITMLVSMITDPVPIR-ASNLENVLVPIEDTEYANLRSYLDRVIDKIHREELKGGKILVHCIAGVSRSSSLVIGYLMKYHAMRLRQAYNHVRARRPYIQPNIGFWKQLIEFEKRLFGSPSVSLLHKVSDNSVVPDVPPSALGSVLFNSP 303          
BLAST of Dual specificity protein phosphatase 14 vs. Planmine SMEST
Match: SMESG000047740.1 (SMESG000047740.1)

HSP 1 Score: 146.362 bits (368), Expect = 7.389e-41
Identity = 68/142 (47.89%), Postives = 100/142 (70.42%), Query Frame = 2
Query:  380 VSQIARITDNLYLSGLHAITSERLKSLGISLVVSLIAENSSMRLPPSIERIQVNIEDTENVNIRRHFDKVLERMNTEERRQGRILVHCVAGISRSSTIILAYLMRYHNMRLREAYNLVHSQRPYIQPNLGFWRQLIDYEKSI 805
            ++  ++I DNLYLSGL A+T ++L+ L I+++VS++ E S +R    IE ++++I+D E  +I  HF  +LE+++      GR LVHC+AGISRS+TI++AYLMRYH   L +AY  V S+R  IQPN GFW+QLI +E  I
Sbjct:  133 INDASKIIDNLYLSGLKAVTLDKLRHLSITMIVSVLREGSPVR-ASGIECVELSIDDQETSDIGFHFPSILEKIHQHISNDGRALVHCIAGISRSATIVIAYLMRYHGYSLSDAYTFVKSRRSCIQPNPGFWQQLIKFETQI 273          
BLAST of Dual specificity protein phosphatase 14 vs. Planmine SMEST
Match: SMESG000031662.1 (SMESG000031662.1)

HSP 1 Score: 125.176 bits (313), Expect = 7.026e-34
Identity = 67/168 (39.88%), Postives = 103/168 (61.31%), Query Frame = 2
Query:  380 VSQIARITDNLYLSGLHAITSERLKSLGISLVVSLIAE-----NSSMRLPPSIERIQVNIEDTENVNIRRHFDKVLERMNTEERRQGRILVHCVAGISRSSTIILAYLMRYHNMRLREAYNLVHSQRPYIQPNLGFWRQLIDYEKSIFGGSSVNMVPMEGTRILVPDV 868
            + +I+ IT  L+L+    + S  ++SLGI++ V++  E     NS      SI +++V + D     +  +FD V+E+M+ E +  G++LV+C  G SRSSTI+L YLM+   + LR+AY+    QRP I PN+GFW+QLI YEK IFG ++V M+   G    +PDV
Sbjct:   22 IPKISEITPFLFLTSAVGLRSPNIRSLGITMSVNVSLEVMFPNNSDFN---SITKVRVPVSDLSWTKLDIYFDDVIEKMDHEIKNNGKVLVNCAMGSSRSSTIVLGYLMKKMKIPLRQAYHHTKRQRPCICPNVGFWKQLISYEKKIFGKNTVKMI-YSGGFAPMPDV 185          
BLAST of Dual specificity protein phosphatase 14 vs. Planmine SMEST
Match: SMESG000029551.1 (SMESG000029551.1)

HSP 1 Score: 125.176 bits (313), Expect = 7.026e-34
Identity = 67/168 (39.88%), Postives = 103/168 (61.31%), Query Frame = 2
Query:  380 VSQIARITDNLYLSGLHAITSERLKSLGISLVVSLIAE-----NSSMRLPPSIERIQVNIEDTENVNIRRHFDKVLERMNTEERRQGRILVHCVAGISRSSTIILAYLMRYHNMRLREAYNLVHSQRPYIQPNLGFWRQLIDYEKSIFGGSSVNMVPMEGTRILVPDV 868
            + +I+ IT  L+L+    + S  ++SLGI++ V++  E     NS      SI +++V + D     +  +FD V+E+M+ E +  G++LV+C  G SRSSTI+L YLM+   + LR+AY+    QRP I PN+GFW+QLI YEK IFG ++V M+   G    +PDV
Sbjct:   22 IPKISEITPFLFLTSAVGLRSPNIRSLGITMSVNVSLEVMFPNNSDFN---SITKVRVPVSDLSWTKLDIYFDDVIEKMDHEIKNNGKVLVNCAMGSSRSSTIVLGYLMKKMKIPLRQAYHHTKRQRPCICPNVGFWKQLISYEKKIFGKNTVKMI-YSGGFAPMPDV 185          
The following BLAST results are available for this feature:
BLAST of Dual specificity protein phosphatase 14 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
DUSP142.906e-3942.60dual specificity phosphatase 14 [Source:HGNC Symbo... [more]
DUSP142.906e-3942.60dual specificity phosphatase 14 [Source:HGNC Symbo... [more]
DUSP142.906e-3942.60dual specificity phosphatase 14 [Source:HGNC Symbo... [more]
DUSP142.906e-3942.60dual specificity phosphatase 14 [Source:HGNC Symbo... [more]
DUSP142.906e-3942.60dual specificity phosphatase 14 [Source:HGNC Symbo... [more]
back to top
BLAST of Dual specificity protein phosphatase 14 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
C04F12.82.982e-3736.59pep chromosome:WBcel235:I:9697237:9699561:-1 gene:... [more]
F26A3.48.474e-2935.09pep chromosome:WBcel235:I:7656978:7658291:-1 gene:... [more]
F13D11.32.803e-2533.33pep chromosome:WBcel235:X:5804379:5805922:-1 gene:... [more]
ZK757.22.279e-2132.72pep chromosome:WBcel235:III:9874142:9877476:-1 gen... [more]
vhp-11.035e-1736.55Tyrosine-protein phosphatase vhp-1 [Source:UniPro... [more]
back to top
BLAST of Dual specificity protein phosphatase 14 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
CG155289.472e-3037.04gene:FBgn0039742 transcript:FBtr0303240[more]
puc1.962e-1935.90gene:FBgn0243512 transcript:FBtr0339722[more]
puc6.574e-1935.90gene:FBgn0243512 transcript:FBtr0081792[more]
Mkp7.132e-1833.08gene:FBgn0083992 transcript:FBtr0110976[more]
Mkp7.132e-1833.08gene:FBgn0083992 transcript:FBtr0344094[more]
back to top
BLAST of Dual specificity protein phosphatase 14 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
dusp143.673e-3541.18dual specificity phosphatase 14 [Source:ZFIN;Acc:Z... [more]
dusp143.673e-3541.18dual specificity phosphatase 14 [Source:ZFIN;Acc:Z... [more]
si:ch1073-184j22.23.694e-3140.27si:ch1073-184j22.2 [Source:ZFIN;Acc:ZDB-GENE-08110... [more]
si:ch1073-184j22.22.371e-3037.91si:ch1073-184j22.2 [Source:ZFIN;Acc:ZDB-GENE-08110... [more]
zgc:1530444.711e-2734.67zgc:153044 [Source:ZFIN;Acc:ZDB-GENE-060825-247][more]
back to top
BLAST of Dual specificity protein phosphatase 14 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
dusp147.966e-3640.61dual specificity phosphatase 14 [Source:NCBI gene;... [more]
ENSXETT00000005765.14.458e-2835.26pep primary_assembly:Xenopus_tropicalis_v9.1:1:157... [more]
dusp283.824e-2236.81dual specificity phosphatase 28 [Source:NCBI gene;... [more]
tor2a4.516e-2138.81torsin family 2, member A [Source:Xenbase;Acc:XB-G... [more]
ibtk6.689e-2034.06inhibitor of Bruton tyrosine kinase [Source:Xenbas... [more]
back to top
BLAST of Dual specificity protein phosphatase 14 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Dusp149.643e-4042.60dual specificity phosphatase 14 [Source:MGI Symbol... [more]
Dusp149.643e-4042.60dual specificity phosphatase 14 [Source:MGI Symbol... [more]
Dusp149.643e-4042.60dual specificity phosphatase 14 [Source:MGI Symbol... [more]
Dusp149.643e-4042.60dual specificity phosphatase 14 [Source:MGI Symbol... [more]
Dusp181.059e-2836.69dual specificity phosphatase 18 [Source:MGI Symbol... [more]
back to top
BLAST of Dual specificity protein phosphatase 14 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q9JLY7|DUS14_MOUSE6.745e-3942.60Dual specificity protein phosphatase 14 OS=Mus mus... [more]
sp|O95147|DUS14_HUMAN1.396e-3842.60Dual specificity protein phosphatase 14 OS=Homo sa... [more]
sp|Q17QM8|DUS14_BOVIN2.389e-3842.60Dual specificity protein phosphatase 14 OS=Bos tau... [more]
sp|Q5R8X2|DUS18_PONAB2.725e-3140.36Dual specificity protein phosphatase 18 OS=Pongo a... [more]
sp|Q8NEJ0|DUS18_HUMAN3.645e-3139.63Dual specificity protein phosphatase 18 OS=Homo sa... [more]
back to top
BLAST of Dual specificity protein phosphatase 14 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A5J4NAZ99.022e-4750.87Uncharacterized protein OS=Paragonimus westermani ... [more]
A0A3P7NZ772.887e-4649.09Uncharacterized protein OS=Dibothriocephalus latus... [more]
A0A183W7F32.965e-4652.73Uncharacterized protein OS=Trichobilharzia regenti... [more]
A0A3S5BG494.974e-4650.00Uncharacterized protein OS=Protopolystoma xenopodi... [more]
H2KQA21.039e-4550.31Dual specificity protein phosphatase 14 OS=Clonorc... [more]
back to top
BLAST of Dual specificity protein phosphatase 14 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
dusp141.045e-3642.60dual specificity phosphatase 14 [Source:ZFIN;Acc:Z... [more]
zgc:1530449.554e-3640.96dual specificity protein phosphatase 18-like [Sour... [more]
si:ch1073-184j22.25.819e-3140.85si:ch1073-184j22.2 [Source:ZFIN;Acc:ZDB-GENE-08110... [more]
ENSAMXT00000026376.21.230e-2337.16pep primary_assembly:Astyanax_mexicanus-2.0:17:267... [more]
dusp13.169e-2034.29dual specificity phosphatase 1 [Source:NCBI gene;A... [more]
back to top
BLAST of Dual specificity protein phosphatase 14 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 5
Match NameE-valueIdentityDescription
dusp142.268e-3644.60dual specificity phosphatase 14 [Source:ZFIN;Acc:Z... [more]
ENSPMAT00000006071.16.734e-2337.60pep scaffold:Pmarinus_7.0:GL479824:161791:175185:-... [more]
dusp46.755e-1937.23dual specificity phosphatase 4 [Source:ZFIN;Acc:ZD... [more]
dusp287.606e-1932.00dual specificity phosphatase 28 [Source:ZFIN;Acc:Z... [more]
dusp78.307e-1834.65dual specificity phosphatase 7 [Source:ZFIN;Acc:ZD... [more]
back to top
BLAST of Dual specificity protein phosphatase 14 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 4
Match NameE-valueIdentityDescription
SDP11.322e-1440.58Stress-inducible dual-specificity MAP kinase phosp... [more]
MSG53.667e-1332.76Dual-specificity protein phosphatase; exists in 2 ... [more]
PPS13.664e-1237.04Protein phosphatase; has specificity for serine, t... [more]
YVH14.561e-1126.70Dual specificity protein phosphatase; regulates gr... [more]
back to top
BLAST of Dual specificity protein phosphatase 14 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
EDO471562.603e-3539.74Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO492503.423e-2137.11Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO370001.790e-1941.94Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO354382.233e-1752.54Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO376752.494e-1729.81Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Dual specificity protein phosphatase 14 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
dusp142.025e-3642.11dual specificity phosphatase 14 [Source:ZFIN;Acc:Z... [more]
ENSORLT00000014836.21.891e-3141.56pep primary_assembly:ASM223467v1:9:17523780:175263... [more]
ENSORLT00000026820.11.956e-3037.36dual specificity protein phosphatase 14 [Source:NC... [more]
ENSORLT00000045858.11.991e-3037.36dual specificity protein phosphatase 14 [Source:NC... [more]
ENSORLT00000042431.12.717e-3038.29dual specificity protein phosphatase 14 [Source:NC... [more]
back to top
BLAST of Dual specificity protein phosphatase 14 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000037868.10.000e+0100.00SMESG000037868.1[more]
SMESG000032392.18.347e-6247.12SMESG000032392.1[more]
SMESG000047740.17.389e-4147.89SMESG000047740.1[more]
SMESG000031662.17.026e-3439.88SMESG000031662.1[more]
SMESG000029551.17.026e-3439.88SMESG000029551.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30015587 ID=SMED30015587|Name=Dual specificity protein phosphatase 14|organism=Schmidtea mediterranea sexual|type=transcript|length=1188bp
TATCGATAGAGATAATTTTTAAATTACATTCAAATGATCGAGGATGCATT
ATAAGAAATCTAATGACACTTTTCCATTTTCAAGCAGCAGATTTGAAACA
ACCTACAGCAGTAGTTATAATAAATCTTTTAATTATCTCTCAAAACCAAA
TGTAACTAAAATTCAAGAAACTAGCAGTACAAACGATCTGAAAGTGAAAA
CAGATACTAATAGTTATTCTTCAATTTCTAAACCGGCTATTAAATCGACT
GGAGATAATAATGTAAAATCTTCAACATCTTTCATATCAAGTACACCCAT
TTCCATTTCAAAGGATTCTATTTGCAATTTACAACAACCAAAGTTTGATG
CATTCAAACAATATGATTATAATCATATGGTTTCACAAATAGCTAGAATA
ACTGACAATTTATACTTATCAGGTTTACATGCTATCACGAGTGAACGATT
AAAATCTCTCGGAATTAGTTTGGTGGTATCATTGATCGCTGAGAACTCGT
CGATGCGATTGCCGCCGTCAATTGAACGTATTCAAGTTAACATAGAAGAC
ACTGAAAATGTCAACATTCGACGTCATTTTGACAAAGTTCTTGAAAGAAT
GAACACTGAAGAACGTCGTCAAGGTCGCATTCTAGTTCATTGCGTCGCTG
GAATTTCTCGATCATCGACTATCATTCTAGCTTATTTGATGCGCTATCAC
AACATGAGATTACGAGAAGCTTACAATTTAGTTCATTCTCAACGGCCGTA
TATTCAACCGAATTTGGGATTTTGGCGGCAGTTGATTGATTATGAAAAAT
CGATATTTGGTGGATCTTCGGTCAATATGGTCCCAATGGAAGGCACTAGA
ATTCTGGTGCCTGATGTTACTCCATCAATTTTGTCTGAAATTCTGTCATC
TACTCCAATGATGAGAGTTCAACAGAGATCCCCGATATCGATATTCCCAG
TTCGTCCAACTTATTTTTAATGTGCCTTGAAACAAAAAGAAAACAAAGAA
GAATATTTTTGTATATCTTTTACAAATAGAAGTTATTGACGATAATAAAT
ATTTCCATATTCAGCAGAGTGCCCAAATATAGAGTAGTGGCATTGTACGA
TGGTGCCAGGAAAATCATATTTGTAATCCTCATAATAATAAATGATATTG
ACACCTTTTTCTTTCACCTAATTTTCAATGAGCCGTCA
back to top

protein sequence of SMED30015587-orf-1

>SMED30015587-orf-1 ID=SMED30015587-orf-1|Name=SMED30015587-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=309bp
MHYKKSNDTFPFSSSRFETTYSSSYNKSFNYLSKPNVTKIQETSSTNDLK
VKTDTNSYSSISKPAIKSTGDNNVKSSTSFISSTPISISKDSICNLQQPK
FDAFKQYDYNHMVSQIARITDNLYLSGLHAITSERLKSLGISLVVSLIAE
NSSMRLPPSIERIQVNIEDTENVNIRRHFDKVLERMNTEERRQGRILVHC
VAGISRSSTIILAYLMRYHNMRLREAYNLVHSQRPYIQPNLGFWRQLIDY
EKSIFGGSSVNMVPMEGTRILVPDVTPSILSEILSSTPMMRVQQRSPISI
FPVRPTYF*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: molecular function
TermDefinition
GO:0016787hydrolase activity
GO:0008138protein tyrosine/serine/threonine phosphatase activity
GO:0016791phosphatase activity
GO:0004725protein tyrosine phosphatase activity
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000016pharynx
PLANA:0000020protonephridia
PLANA:0000034epidermis
PLANA:0000099neuron
PLANA:0000418head
PLANA:0002032epidermal cell
Vocabulary: INTERPRO
TermDefinition
IPR020422TYR_PHOSPHATASE_DUAL_dom
IPR000340Dual-sp_phosphatase_cat-dom
IPR029021Prot-tyrosine_phosphatase-like
IPR016130Tyr_Pase_AS
IPR000387TYR_PHOSPHATASE_dom
Vocabulary: biological process
TermDefinition
GO:0006470protein dephosphorylation
GO:0016311dephosphorylation
GO:0035335peptidyl-tyrosine dephosphorylation
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR020422Dual specificity protein phosphatase domainSMARTSM00195dsp_5coord: 115..253
e-value: 1.1E-44
score: 164.4
IPR020422Dual specificity protein phosphatase domainPROSITEPS50054TYR_PHOSPHATASE_DUALcoord: 115..255
score: 37.716
IPR000340Dual specificity phosphatase, catalytic domainPFAMPF00782DSPccoord: 123..252
e-value: 3.1E-34
score: 117.7
IPR029021Protein-tyrosine phosphatase-likeGENE3DG3DSA:3.90.190.10coord: 114..281
e-value: 2.3E-46
score: 159.3
IPR029021Protein-tyrosine phosphatase-likeSUPERFAMILYSSF52799(Phosphotyrosine protein) phosphatases IIcoord: 114..257
NoneNo IPR availablePANTHERPTHR45961FAMILY NOT NAMEDcoord: 104..276
NoneNo IPR availableCDDcd14514DUSP14-likecoord: 116..249
e-value: 7.13008E-56
score: 175.435
IPR016130Protein-tyrosine phosphatase, active sitePROSITEPS00383TYR_PHOSPHATASE_1coord: 198..208
IPR000387Tyrosine specific protein phosphatases domainPROSITEPS50056TYR_PHOSPHATASE_2coord: 177..235
score: 14.716